WorldWideScience

Sample records for berkelium 253

  1. Chemistry of berkelium: a review

    International Nuclear Information System (INIS)

    Hobart, D.E.; Peterson, J.R.

    1985-01-01

    Element 97 was first produced in December 1949, by the bombardment of americium-241 with accelerated alpha particles. This new element was named berkelium (Bk) after Berkeley, California, the city of its discovery [Thompson, Ghiorso, and Seaborg, Phys. Rev. 77, 838 (1950); 80, 781 (1950)]. In the 36 years since the discovery of Bk, a substantial amount of knowledge concerning the physicochemical properties of this relatively scarce transplutonium element has been acquired. All of the Bk isotopes of mass numbers 240 and 242 through 251 are presently known, but only berkelium-249 (β - decay, 0.125 MeV, t/sub 1/2/ = 325 days) is available in sufficient quantities for bulk chemical studies. About 0.7 gram of this isotope has been isolated at the HFIR/TRU Complex in Oak Ridge, Tennessee in the last 18 years. Over the same time period, the scale of experimental work using berkelium-249 has increased from the tracer level to bulk studies at the microgram level to solution and solid state investigations with milligram quantities. Extended knowledge of the physicochemical behavior of berkelium is important in its own right, because Bk is the first member of the second half of the actinide series. In addition, such information should enable more accurate extrapolations to the predicted behavior of heavier elements for which experimental studies are severely limited by lack of material and/or by intense radioactivity

  2. Citric complexes of trivalent cerium and berkelium

    International Nuclear Information System (INIS)

    Boulhassa, S.

    1977-01-01

    The extraction by thenoyltrifluoroacetone (TTA) in benzene of trivalent cerium, berkelium and californium, at the indicator scale, hydrolysis and complexation by citric acid of these cations are studied. The radionuclides used were 144 Ce, 249 Bk and 249 Cf respectively γ, β and α emitters. The solvent extraction technique of the elements by TTA in benzene from a perchloric medium at the ionic stength 0.1 was employed. The distribution coefficients D were measured by the γ, β or α radiometry. Cerium and berkelium, which have a comparable redox behavior, show in solution a relatively stable valency IV. Therefore the study by solvent extraction of their trivalent form required the standing up of complete reducing conditions of these elements and their stabilization in solution at the valency III. The thermodynamic data obtained for berkelium and californium contribute to understand the chemistry of these elements and permit to complete the third 'tetrad branch' of 5f elements from Cm 3+ to Es 3+ . This tetrad effect is a manifestation of thermodynamic consequence of the 'nephelauxetic effect'. As for Ce(III), the data confirm the pronounced acid property and may be show no neglected ligand effect for f 1 configuration [fr

  3. Berkelium (4) and cerium (4) extraction with tertiary amines

    International Nuclear Information System (INIS)

    Milyukova, M.S.; Malikov, D.A.; Myasoedov, B.V.

    1978-01-01

    Oxidation of indicator quantities of berkelium and cerium by a mixture of silver nitrate and ammonium persulfate in the solutions of nitric and sulfuric acid has been examined. The stability of the elements in a tetravalent state and their extraction by the solutions of ternary amines have been investigated. It has been established that berkelium and cerium oxidation under these conditions occurs under the effect of ions of divalent silver which is formed owing to oxidation of monovalent silver by peroxide sulfate ions. The following supposition has been put forward: a difference in the behaviour of tetravalent berkelium and cerium during their extraction by ternary amines is explained by their different stability in this state, but not by the formation of complex compounds with nitrate ions

  4. Chelation and stabilization of berkelium in oxidation state +IV

    Science.gov (United States)

    Deblonde, Gauthier J.-P.; Sturzbecher-Hoehne, Manuel; Rupert, Peter B.; An, Dahlia D.; Illy, Marie-Claire; Ralston, Corie Y.; Brabec, Jiri; de Jong, Wibe A.; Strong, Roland K.; Abergel, Rebecca J.

    2017-09-01

    Berkelium (Bk) has been predicted to be the only transplutonium element able to exhibit both +III and +IV oxidation states in solution, but evidence of a stable oxidized Bk chelate has so far remained elusive. Here we describe the stabilization of the heaviest 4+ ion of the periodic table, under mild aqueous conditions, using a siderophore derivative. The resulting Bk(IV) complex exhibits luminescence via sensitization through an intramolecular antenna effect. This neutral Bk(IV) coordination compound is not sequestered by the protein siderocalin—a mammalian metal transporter—in contrast to the negatively charged species obtained with neighbouring trivalent actinides americium, curium and californium (Cf). The corresponding Cf(III)-ligand-protein ternary adduct was characterized by X-ray diffraction analysis. Combined with theoretical predictions, these data add significant insight to the field of transplutonium chemistry, and may lead to innovative Bk separation and purification processes.

  5. Identification of 253Md

    International Nuclear Information System (INIS)

    Kadkhodayan, B.; Czerwinski, K.R.; Kreek, S.A.; Hannink, N.J.; Gregorich, K.E.; Lee, D.M.; Nurmia, M.J.; Hoffman, D.C.; Hall, H.L.

    1992-01-01

    We have measured the half-life and production cross section of the new isotope 253 Md, produced via the 243 Am( 13 C,3n) reaction. Isolation of Md from other activities was accomplished using elution with ammonium α-hydroxyisobutyrate from a cation exchange resin column. Experiments were performed with different irradiation time intervals, but the chemical separation always began and ended at exactly the same length of time after the end of irradiation. All separations with the same irradation lengths were combined and analyzed for growth and decay of the 3.0-d 253 Fm daughter and 20.47-d 253 Es, granddaugther of 253 Md. The amount of 253 Es in each fraction depends on the length of each irradiation and the 253 Md half-life. An increase in the length of irradiation will cause a corresponding increase in the amount of the new isotope 253 Md and hence, in the amount of 253 Es produced, provided the length of irradiations are not very long compared to the half-life of 253 Md. In this way, the Md half-life was estimated to be about 6 minutes with a production cross section of the order of 50 nb. (orig.)

  6. Possible stabilization of the tetravalent oxidation state of berkelium and californium in acetonitrile with triphenylarsine oxide

    International Nuclear Information System (INIS)

    Payne, G.F.; Peterson, J.R.

    1987-01-01

    It appears that we may have prepared Bk(IV) nitrate.nTPAs0 and Bk(IV) perchlorate.nTPAs0 complexes which formed the corresponding Cf(IV) complexes through the beta decay of Bk-249. Definitive proof should come from similar experiments with quantities of Bk-249 large enough to allow spectrophotometric detection of the characteristic f→f transitions in these berkelium and californium species. It is clear, however, that TPAs0 and acetonitrile can play a pivotal role in the stabilization of lanact(IV) species

  7. Peaceful berkelium

    Science.gov (United States)

    Trabesinger, Andreas

    2017-09-01

    The first new element produced after the Second World War has led a rather peaceful life since entering the period table -- until it became the target of those producing superheavy elements, as Andreas Trabesinger describes.

  8. Isomeric states in 253No and 253Fm

    International Nuclear Information System (INIS)

    Antalic, S.; Kalaninova, Z.; Saro, S.; Venhart, M.; Hessberger, F.P.; Ackermann, D.; Heinz, S.; Kindler, B.; Khuyagbaatar, J.; Kojouharov, I.; Kuusiniemi, P.; Lommel, B.; Mann, R.; Sulignano, B.; Hofmann, S.; Leino, M.; Nishio, K.; Streicher, B.

    2011-01-01

    Nuclear structure and decay of isomeric states in 253 No were investigated. The isotope was produced by the reaction 48 Ca + 207 Pb. The excitation energy of the known single-particle isomeric state (5/2 + [622]) was measured by delayed coincidences between γ-rays and implanted evaporation residues and was placed into the level scheme. In addition, decay of a high-lying multi-quasiparticle isomer in 253 No was studied using e - -γ coincidence measurements. A rotational band populated by its de-excitation was identified in 253 No. A new isomeric state in 253 Fm was observed and a partial-level scheme for this isotope is suggested. In addition γ transitions from excited levels are reported for 253 Md. (orig.)

  9. 7 CFR 253.4 - Administration.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Administration. 253.4 Section 253.4 Agriculture... GENERAL REGULATIONS AND POLICIES-FOOD DISTRIBUTION ADMINISTRATION OF THE FOOD DISTRIBUTION PROGRAM FOR HOUSEHOLDS ON INDIAN RESERVATIONS § 253.4 Administration. (a) Federal administration. Within the Department...

  10. 6 CFR 25.3 - Delegation.

    Science.gov (United States)

    2010-01-01

    ... 6 Domestic Security 1 2010-01-01 2010-01-01 false Delegation. 25.3 Section 25.3 Domestic Security DEPARTMENT OF HOMELAND SECURITY, OFFICE OF THE SECRETARY REGULATIONS TO SUPPORT ANTI-TERRORISM BY FOSTERING EFFECTIVE TECHNOLOGIES § 25.3 Delegation. All of the Secretary's responsibilities, powers, and functions...

  11. 48 CFR 253.209 - Contractor qualifications.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Contractor qualifications. 253.209 Section 253.209 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE CLAUSES AND FORMS FORMS Prescription of Forms 253.209 Contractor qualifications. ...

  12. 28 CFR 25.3 - System information.

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 1 2010-07-01 2010-07-01 false System information. 25.3 Section 25.3 Judicial Administration DEPARTMENT OF JUSTICE DEPARTMENT OF JUSTICE INFORMATION SYSTEMS The National Instant Criminal Background Check System § 25.3 System information. (a) There is established at the FBI a...

  13. 36 CFR 25.3 - Supervision; suspensions.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 1 2010-07-01 2010-07-01 false Supervision; suspensions. 25.3 Section 25.3 Parks, Forests, and Public Property NATIONAL PARK SERVICE, DEPARTMENT OF THE INTERIOR NATIONAL MILITARY PARKS; LICENSED GUIDE SERVICE REGULATIONS § 25.3 Supervision; suspensions. (a) The guide service will operate under the direction...

  14. 50 CFR 253.22 - State projects.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false State projects. 253.22 Section 253.22... State projects. (a) General—(1) Designation of state agency. The Governor of each state shall notify the... participation under the Act, to sign project documents, and to receive payments. (2) States that choose to...

  15. 50 CFR 253.16 - Fees.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Fees. 253.16 Section 253.16 Wildlife and... Fees. (a) Application fee. The Division will not accept an application without the application fee. Fifty percent of the application fee is fully earned at application acceptance, and is not refundable...

  16. Gamma spectroscopy of the isotope 253No

    International Nuclear Information System (INIS)

    Kalaninova, Z.

    2009-01-01

    The first part deals with the evaluation of the relative and absolute efficiency of detectors for the registration of gamma radiation to separator SHIP at GSI Darmstadt (Germany). In the second part we discussed the decay alpha-gamma coincidence spectroscopy of isotope 253 No. In conclusion, the basic characteristics of deexcitation of K-isomeric state in isotope 253 No are evaluated. Only sort abstract is published.

  17. 50 CFR 216.253 - Prohibitions.

    Science.gov (United States)

    2010-10-01

    ..., DEPARTMENT OF COMMERCE MARINE MAMMALS REGULATIONS GOVERNING THE TAKING AND IMPORTING OF MARINE MAMMALS Taking Marine Mammals Incidental to Conducting Precision Strike Weapon Missions in the Gulf of Mexico § 216.253... shall: (a) Take any marine mammal not specified in § 216.250(b); (b) Take any marine mammal specified in...

  18. 48 CFR 253.215 - Contracting by negotiation.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Contracting by negotiation. 253.215 Section 253.215 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE CLAUSES AND FORMS FORMS Prescription of Forms 253.215 Contracting by negotiation...

  19. 4 CFR 25.3 - Admission to the GAO building.

    Science.gov (United States)

    2010-01-01

    ... 4 Accounts 1 2010-01-01 2010-01-01 false Admission to the GAO building. 25.3 Section 25.3 Accounts GOVERNMENT ACCOUNTABILITY OFFICE GENERAL PROCEDURES CONDUCT IN THE GOVERNMENT ACCOUNTABILITY OFFICE BUILDING AND ON ITS GROUNDS § 25.3 Admission to the GAO building. A person may be admitted to the GAO Building...

  20. 7 CFR 253.1 - General purpose and scope.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false General purpose and scope. 253.1 Section 253.1... AGRICULTURE GENERAL REGULATIONS AND POLICIES-FOOD DISTRIBUTION ADMINISTRATION OF THE FOOD DISTRIBUTION PROGRAM FOR HOUSEHOLDS ON INDIAN RESERVATIONS § 253.1 General purpose and scope. This part describes the terms...

  1. 50 CFR 253.18 - Program operating guidelines.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Program operating guidelines. 253.18 Section 253.18 Wildlife and Fisheries NATIONAL MARINE FISHERIES SERVICE, NATIONAL OCEANIC AND ATMOSPHERIC... Guarantee Program § 253.18 Program operating guidelines. The Division may issue Program operating guidelines...

  2. Alpha-gamma decay studies of 253No and its daughter products 253Md, 249Fm

    International Nuclear Information System (INIS)

    Hessberger, F.P.; Antalic, S.; Kalaninova, Z.; Saro, S.; Venhart, M.; Ackermann, D.; Heinz, S.; Kindler, B.; Kojouharov, I.; Kuusiniemi, P.; Lommel, B.; Mann, R.; Sulignano, B.; Hofmann, S.; Streicher, B.; Leino, M.; Nishio, K.

    2012-01-01

    Nuclear structure and decay of the isotope 253 No and its decay products 249 Fm and 253 Md were investigated by means of α - γ spectroscopy. Besides the established strong γ transitions from the 9/2 - [734] Nilsson level in 249 Fm, populated predominantly by the α decay of 253 No, into the ground-state (gs) rotational band, a couple of weaker γ lines (58.3, 129.2, 209.3 and 669.5keV) were observed and placed into the 249 Fm level scheme. The transition from the 7/2 - level in 249 Es, populated by the α decay of 253 Md, into the 9/2 + member of the gs rotational band, so far established for other odd-mass Es isotopes, was observed clearly. GEANT4 simulations were performed to investigate the influence of energy summing between α particles and conversion electrons (CE) on the shape of the α spectra at different implantation energies, leading to evidence for a weak α decay branch of 253 No into the gs of 249 Fm or the ground-state rotational band, respectively. (orig.)

  3. Oxidation-reduction properties of americium, curium, berkelium, californium, einsteinium and fermium, and thermodynamic consequences for the 5f series

    International Nuclear Information System (INIS)

    Samhoun, K.

    1976-01-01

    The amalgamation of 5f elements from Am to Fm has been studied by using 241 Am, 244 Cm, 249 Bk, 249 Cf, 252 Cf, 253 Es, 254 Es, 252 Fm and 255 Fm with two electrochemical methods, radiocoulometry and radiopolarography, perfectly adapted to investigate extremely diluted solutions when the concentration of electroactive species is as low as 10 -16 M. The theory of radiocoulometry has been developed in the general cases of reversible and irreversible electrode process. It has been used to interpret the experimental data on the kinetic curves of amalgamation, and to estimate the standard rate constant of the electrode process in complexing medium (citric). On the other hand the radiopolarographic method has been applied to study the mechanism of reduction at the dropping mercury electrode of cations M 3+ in aqueous medium to the metal M with formation of amalgam. The results are exploited into two directions: 1- Acquisition of some data concerning the oxidation-reduction properties of elements from Am to Fm. Therefore the standard electrode E 0 [M(III-0)] potentials for Bk, Cf and Es, and the standard electrode E 0 [M(II-0)] potential for Fm are estimated and the relative stability of each oxidation state (from II to VII) of 5f elements is discussed; 2- Acquisition of unknown thermodynamic data on transcalifornium elements. Correlations between 4f and 5f elements are precised and some divergences appear for the second half of 4f and 5f series (i.e. for 65 [fr

  4. Dicty_cDB: VHP253 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHP253 (Link to dictyBase) - - - Contig-U16349-1 - (Link to Or...iginal site) - - VHP253Z 355 - - - - Show VHP253 Library VH (Link to library) Clone ID VHP253 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16349-1 Original site URL http://dictycdb.b...CTTGGGTACCAAGAACTGACCGTCAATTTGCTGGTTCATGGTTTGC sequence update 2002. 9.10 Translated Amino Acid sequence ---MQLFAGIKSICT...VPIMRMYFHTGILDYILFKSWVPRTDRQFAGSWF Translated Amino Acid sequence (All Frames) Frame A: ---MQLFAGIKSICTEMAMD

  5. 50 CFR 253.14 - Economic and financial requirements.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Economic and financial requirements. 253... Obligation Guarantee Program § 253.14 Economic and financial requirements. (a) Income and expense projections... protect the U.S. against the industry's cyclical economics and other risks of loss. (b) Working capital...

  6. 14 CFR 23.253 - High speed characteristics.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false High speed characteristics. 23.253 Section... Requirements § 23.253 High speed characteristics. If a maximum operating speed VMO/MMO is established under § 23.1505(c), the following speed increase and recovery characteristics must be met: (a) Operating...

  7. 46 CFR 169.253 - Miscellaneous systems and equipment.

    Science.gov (United States)

    2010-10-01

    ... VESSELS Inspection and Certification Inspections § 169.253 Miscellaneous systems and equipment. (a) At each inspection for certification and periodic inspection all items in the ship's outfit, such as...

  8. In-beam spectroscopy of 253,254No

    International Nuclear Information System (INIS)

    Herzberg, R.D.; Amzal, N.; Bastin, J.E.; Brew, P.M.T.; Butler, P.A.; Chewter, A.J.C.; Hammond, N.J.; Humphreys, R.D.; Jones, G.D.; Becker, F.; Hauschild, K.; Houry, M.; Huerstel, A.; Cocks, J.F.C.; Dorvaux, O.; Greenlees, P.T.; Eskola, K.; Gerl, J.; Hessberger, F.; Helariutta, K.; Jones, P.M.; Julin, R.; Juutinen, S.; Kankaanpaeae, H.; Kettunen, H.; Khoo, T.L.; Korten, W.; Kuusiniemi, P.; Le Coz, Y.; Leino, M.; Leppaenen, C.J.; Lister, A.P.; Lucas, R.; Muikku, M.; Nieminen, P.; Page, R.D.; Page, T.; Rahkila, P.; Reiter, P.; Schlegel, Ch.; Scholey, C.; Sletten, G.; Stezowski, O.; Theisen, Ch.; Trzaska, W.H.; Uusitalo, J.; Wollersheim, H.J.

    2002-01-01

    In-beam conversion electron spectroscopy experiments have been performed on the transfermium nuclei 253, 254 No using the conversion electron spectrometer SACRED in nearly collinear geometry in conjunction with the gas-filled separator RITU at the University of Jyvaeskylae. The experimental setup is discussed and the spectra are compared to Monte Carlo simulations. The implications for the ground-state configuration of 253 No are discussed. (orig.)

  9. 14 CFR 253.8 - Qualifications to notice requirements.

    Science.gov (United States)

    2010-01-01

    ... to notice requirements. (a) If notice is not provided in accordance with § 253.5 at a ticket sales location outside of the United States that is not a U.S. air carrier ticket office, the price paid for the portion of such ticket that is for interstate and overseas air transportation shall be refundable without...

  10. 37 CFR 253.10 - Cost of living adjustment.

    Science.gov (United States)

    2010-07-01

    ... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Cost of living adjustment... NONCOMMERCIAL EDUCATIONAL BROADCASTING § 253.10 Cost of living adjustment. (a) (a) On December 1, 2003, the Librarian of Congress shall publish in the Federal Register a notice of the change in the cost of living as...

  11. 14 CFR 25.253 - High-speed characteristics.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false High-speed characteristics. 25.253 Section...-speed characteristics. (a) Speed increase and recovery characteristics. The following speed increase and recovery characteristics must be met: (1) Operating conditions and characteristics likely to cause...

  12. 24 CFR 236.253 - Premiums-operating loss loans.

    Science.gov (United States)

    2010-04-01

    ... Obligations for Mortgage Insurance § 236.253 Premiums—operating loss loans. All of the provisions of § 207.252a of this chapter relating to mortgage insurance premiums on operating loss loans shall apply to... Act the mortgage insurance premiums due in accordance with § 207.252a shall be calculated on the basis...

  13. 30 CFR 253.1 - What is the purpose of this part?

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false What is the purpose of this part? 253.1 Section 253.1 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR OFFSHORE OIL SPILL FINANCIAL RESPONSIBILITY FOR OFFSHORE FACILITIES General § 253.1 What is the purpose of this part? This part...

  14. PCA/HEXTE Observations of M82 and NGC253

    Science.gov (United States)

    Rephaeli, Yoel

    1999-01-01

    The nearby starburst galaxies M82 & NGC 253 were observed by the RXTE satellite during the period February - November 1997. Data reduction and analysis began in summer 1998, and continued through March 1999. The spectral analysis indicates that the main emission in these galaxies is from hot gas. We find a considerable degree of variability in the emission from M82, possibly due to M81 (a known AGN) in the FOV. The main spectral parameters were determined for both sources. The results of the analysis were reported in the March 1999 meeting of the AAS. Summary of the data analysis, theoretical modeling, and interpretation will be presented in a paper which is currently being prepared for publication in the Astrophysical Journal.

  15. 29 CFR 1910.253 - Oxygen-fuel gas welding and cutting.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 5 2010-07-01 2010-07-01 false Oxygen-fuel gas welding and cutting. 1910.253 Section 1910..., DEPARTMENT OF LABOR OCCUPATIONAL SAFETY AND HEALTH STANDARDS Welding, Cutting and Brazing § 1910.253 Oxygen-fuel gas welding and cutting. (a) General requirements—(1) Flammable mixture. Mixtures of fuel gases...

  16. Long-term effects of intratracheally instilled 253EsCl3 in rats

    International Nuclear Information System (INIS)

    Ballou, J.E.; Dagle, G.E.; Morrow, W.

    1975-01-01

    ts administered 253 EsCl 3 by intratracheal instillation developed more bone tumors and fewer lung tumors than similar rats administered 239 Pu(NO 3 ) 4 . In explanation, it is suggested that 253 Es may irradiatete bone surface cells more effectively while 239 Pu may irradiate a greater total number of cells in the lung. (U.S.)

  17. 48 CFR 253.215-70 - DD Form 1547, Record of Weighted Guidelines Application.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false DD Form 1547, Record of... Forms 253.215-70 DD Form 1547, Record of Weighted Guidelines Application. Follow the procedures at PGI 253.215-70 for completing DD Form 1547. [71 FR 69495, Dec. 1, 2006] ...

  18. 48 CFR 253.213-70 - Completion of DD Form 1155, Order for Supplies or Services.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Completion of DD Form 1155... Forms 253.213-70 Completion of DD Form 1155, Order for Supplies or Services. Follow the procedures at PGI 253.213-70 for completion of DD Form 1155. [71 FR 3413, Jan. 23, 2006] ...

  19. 49 CFR 234.253 - Flashing light units and lamp voltage.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Flashing light units and lamp voltage. 234.253... Maintenance, Inspection, and Testing Inspections and Tests § 234.253 Flashing light units and lamp voltage. (a... voltage shall be tested when installed and at least once every 12 months thereafter. (c) Each flashing...

  20. 48 CFR 253.208-2 - DD Form 448-2, Acceptance of MIPR.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false DD Form 448-2, Acceptance... REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE CLAUSES AND FORMS FORMS Prescription of Forms 253.208-2 DD Form 448-2, Acceptance of MIPR. Follow the procedures at PGI 253.208-2 for use of DD Form 448-2. [71 FR 39005...

  1. 30 CFR 253.40 - What OSFR evidence must I submit to MMS?

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false What OSFR evidence must I submit to MMS? 253.40... § 253.40 What OSFR evidence must I submit to MMS? (a) You must submit to MMS: (1) A single demonstration... unaltered Form MMS-1016; (3) MMS forms that identify your COFs (Form MMS-1021, Form MMS-1022), and the...

  2. Late effects of inhaled 253Es(NO3)3 in rats

    International Nuclear Information System (INIS)

    Ballou, J.E.; Dagle, G.E.; Gies, R.A.; Smith, L.G.

    1979-01-01

    Einsteinium-253 nitrate was administered as an aerosol to male Wistar rats and the long-term biological effects were followed for the animals' life span. Lung was the major target organ for absorbed radiation dose and tumor induction, in agreement with results for other inhaled transuranic nitrates. The earlier finding of a high incidence of bone tumors following intratracheal instillation of 253 EsCl 3 was not confirmed in the present study with inhaled 253 Es(NO 3 ) 3 . The reason for the difference in bone tumor production is believed to be related to the different acute toxicities of intratracheally instilled and inhaled 253 Es. Intratracheally instilled 253 EsCl 3 was less acutely toxic (only a single lobe or one-half the lung was irradiated); thus, a larger more tumorigenic dose could be translocated to bone without shortening the life span to the extent that bone tumors could not be expressed. The radiation dose from inhaled 253 Es(NO 3 ) 3 was uniformly spread throughout both lungs and early death due to a generalized radiation pneumonitis precluded the development of long-term effects in bone. (author)

  3. APTO-253 Stabilizes G-quadruplex DNA, Inhibits MYC Expression, and Induces DNA Damage in Acute Myeloid Leukemia Cells.

    Science.gov (United States)

    Local, Andrea; Zhang, Hongying; Benbatoul, Khalid D; Folger, Peter; Sheng, Xia; Tsai, Cheng-Yu; Howell, Stephen B; Rice, William G

    2018-06-01

    APTO-253 is a phase I clinical stage small molecule that selectively induces CDKN1A (p21), promotes G 0 -G 1 cell-cycle arrest, and triggers apoptosis in acute myeloid leukemia (AML) cells without producing myelosuppression in various animal species and humans. Differential gene expression analysis identified a pharmacodynamic effect on MYC expression, as well as induction of DNA repair and stress response pathways. APTO-253 was found to elicit a concentration- and time-dependent reduction in MYC mRNA expression and protein levels. Gene ontogeny and structural informatic analyses suggested a mechanism involving G-quadruplex (G4) stabilization. Intracellular pharmacokinetic studies in AML cells revealed that APTO-253 is converted intracellularly from a monomer to a ferrous complex [Fe(253) 3 ]. FRET assays demonstrated that both monomeric APTO-253 and Fe(253) 3 stabilize G4 structures from telomeres, MYC, and KIT promoters but do not bind to non-G4 double-stranded DNA. Although APTO-253 exerts a host of mechanistic sequelae, the effect of APTO-253 on MYC expression and its downstream target genes, on cell-cycle arrest, DNA damage, and stress responses can be explained by the action of Fe(253) 3 and APTO-253 on G-quadruplex DNA motifs. Mol Cancer Ther; 17(6); 1177-86. ©2018 AACR . ©2018 American Association for Cancer Research.

  4. Late effects of inhaled 253Es(NO3)3 in the rat

    International Nuclear Information System (INIS)

    Ballou, J.E.; Smith, L.G.; Dagle, G.E.; Gies, R.A.

    1979-01-01

    The lungs of rats exposed to 253 Es(NO 3 ) 3 aerosols sustained the greatest cumulative radiation dose, approximately 6-fold higher than the skeletal dose. Malignant lung tumors (incidence 8.5, 27.6%) were observed after a mean cumulative lung dose of 26 and 400 rad, respectively. Higher lung doses were associated with severe life shortening that precluded the expression of delayed effects. Osteosarcomas of the skeleton (incidence 6.9%) were found after a mean cumulative skeletal dose of 68 rad. Earlier studies, which showed a high incidence of bone tumors and relatively fewer lung tumors after intratracheal instillation of 253 EsCl 3 , were not confirmed in this study with inhaled 253 Es(NO 3 ) 3

  5. Spectral Energy Distribution and Radio Halo of NGC 253 at Low Radio Frequencies

    Energy Technology Data Exchange (ETDEWEB)

    Kapińska, A. D.; Staveley-Smith, L.; Meurer, G. R.; For, B.-Q. [International Centre for Radio Astronomy Research (ICRAR), University of Western Australia, 35 Stirling Hwy, WA 6009 (Australia); Crocker, R. [Research School of Astronomy and Astrophysics, Australian National University, Canberra, ACT 2611 (Australia); Bhandari, S.; Callingham, J. R.; Gaensler, B. M.; Hancock, P. J.; Lenc, E. [ARC Centre of Excellence for All-Sky Astrophysics (CAASTRO), Sydney NSW (Australia); Hurley-Walker, N.; Seymour, N. [International Centre for Radio Astronomy Research (ICRAR), Curtin University, Bentley, WA 6102 (Australia); Offringa, A. R. [Netherlands Institute for Radio Astronomy (ASTRON), P.O. Box 2, 7990 AA Dwingeloo (Netherlands); Hanish, D. J. [Spitzer Science Center, California Institute of Technology, MC 220-6, 1200 East California Boulevard, Pasadena, CA 91125 (United States); Ekers, R. D.; Bell, M. E. [CSIRO Astronomy and Space Science (CASS), P.O. Box 76, Epping, NSW 1710 (Australia); Dwarakanath, K. S. [Raman Research Institute, Bangalore 560080 (India); Hindson, L. [Centre of Astrophysics Research, University of Hertfordshire, College Lane, Hatfield AL10 9AB (United Kingdom); Johnston-Hollitt, M. [School of Chemical and Physical Sciences, Victoria University of Wellington, P.O. Box 600, Wellington 6140 (New Zealand); McKinley, B., E-mail: anna.kapinska@uwa.edu.au [School of Physics, The University of Melbourne, Parkville, VIC 3010 (Australia); and others

    2017-03-20

    We present new radio continuum observations of NGC 253 from the Murchison Widefield Array at frequencies between 76 and 227 MHz. We model the broadband radio spectral energy distribution for the total flux density of NGC 253 between 76 MHz and 11 GHz. The spectrum is best described as a sum of a central starburst and extended emission. The central component, corresponding to the inner 500 pc of the starburst region of the galaxy, is best modeled as an internally free–free absorbed synchrotron plasma, with a turnover frequency around 230 MHz. The extended emission component of the spectrum of NGC 253 is best described as a synchrotron emission flattening at low radio frequencies. We find that 34% of the extended emission (outside the central starburst region) at 1 GHz becomes partially absorbed at low radio frequencies. Most of this flattening occurs in the western region of the southeast halo, and may be indicative of synchrotron self-absorption of shock-reaccelerated electrons or an intrinsic low-energy cutoff of the electron distribution. Furthermore, we detect the large-scale synchrotron radio halo of NGC 253 in our radio images. At 154–231 MHz the halo displays the well known X-shaped/horn-like structure, and extends out to ∼8 kpc in the z -direction (from the major axis).

  6. H I observations of the nearest starburst galaxy NGC 253 with the SKA precursor KAT-7

    NARCIS (Netherlands)

    Lucero, D. M.; Carignan, C.; Elson, E. C.; Randriamampandry, T. H.; Jarrett, T. H.; Oosterloo, T. A.; Heald, G. H.

    We present H I observations of the Sculptor group starburst spiral galaxy NGC 253, obtained with the Karoo Array Telescope (KAT-7). KAT-7 is a pathfinder for the Square Kilometre Array precursor MeerKAT, under construction. The short baselines and low system temperature of the telescope make it very

  7. 40 CFR 96.253 - Recordation of CAIR SO2 allowances.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 20 2010-07-01 2010-07-01 false Recordation of CAIR SO2 allowances. 96... (CONTINUED) NOX BUDGET TRADING PROGRAM AND CAIR NOX AND SO2 TRADING PROGRAMS FOR STATE IMPLEMENTATION PLANS CAIR SO2 Allowance Tracking System § 96.253 Recordation of CAIR SO2 allowances. (a)(1) After a...

  8. 40 CFR 97.253 - Recordation of CAIR SO2 allowances.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 20 2010-07-01 2010-07-01 false Recordation of CAIR SO2 allowances. 97... (CONTINUED) FEDERAL NOX BUDGET TRADING PROGRAM AND CAIR NOX AND SO2 TRADING PROGRAMS CAIR SO2 Allowance Tracking System § 97.253 Recordation of CAIR SO2 allowances. (a)(1) After a compliance account is...

  9. 48 CFR 253.208-1 - DD Form 448, Military Interdepartmental Purchase Request.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false DD Form 448, Military... DD Form 448, Military Interdepartmental Purchase Request. Follow the procedures at PGI 253.208-1 for use of DD Form 448. [71 FR 39005, July 11, 2006] ...

  10. 7 CFR 2.53 - Administrator, Food Safety and Inspection Service.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 1 2010-01-01 2010-01-01 false Administrator, Food Safety and Inspection Service. 2... Secretary for Food Safety § 2.53 Administrator, Food Safety and Inspection Service. (a) Delegations... to the Administrator, Food Safety and Inspection Service: (1) Exercise the functions of the Secretary...

  11. Refinement of the critical 2p25.3 deletion region

    DEFF Research Database (Denmark)

    De Rocker, Nina; Vergult, Sarah; Koolen, David

    2015-01-01

    PURPOSE: Submicroscopic deletions of chromosome band 2p25.3 are associated with intellectual disability and/or central obesity. Although MYT1L is believed to be a critical gene responsible for intellectual disability, so far no unequivocal data have confirmed this hypothesis. METHODS: In this study...

  12. 30 CFR 253.50 - How can MMS refuse or invalidate my OSFR evidence?

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false How can MMS refuse or invalidate my OSFR... can MMS refuse or invalidate my OSFR evidence? (a) If MMS determines that any OSFR evidence you submit... acceptable evidence without being subject to civil penalty under § 253.51. (b) MMS may immediately and...

  13. 30 CFR 206.253 - Coal subject to royalties-general provisions.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Coal subject to royalties-general provisions... MINERALS REVENUE MANAGEMENT PRODUCT VALUATION Federal Coal § 206.253 Coal subject to royalties—general provisions. (a) All coal (except coal unavoidably lost as determined by BLM under 43 CFR part 3400) from a...

  14. 7 CFR 1726.253 - Prior approved contract modification related to alternative bid provision for payment to...

    Science.gov (United States)

    2010-01-01

    ... alternative bid provision for payment to contractor for bulk purchase of materials. 1726.253 Section 1726.253... contractor for bulk purchase of materials. When construction is to be performed over an extended period of... AGRICULTURE ELECTRIC SYSTEM CONSTRUCTION POLICIES AND PROCEDURES Modifications to RUS Standard Contract Forms...

  15. Hemorroidectomia convencional versus hemorroidopexia mecânica (PPH: estudo retrospectivo de 253 casos Conventional hemorrhoidectomy versus stapled hemorrhoidopexy (PPH: a retrospective study of 253 patients

    Directory of Open Access Journals (Sweden)

    Raphael Marianelli

    2009-03-01

    Full Text Available O objetivo deste estudo foi rever a experiência do serviço de coloproctologia do HSPM-SP no tratamento cirúrgico da doença hemorroidária. Estudou-se retrospectivamente 253 pacientes portadores de hemorroidas submetidos à cirurgia no período de 10/05/2004 a 31/12/2007. Foram estabelecidos dois grupos: Grupo 1 Pacientes operados pela técnica convencional (212; Grupo 2 Pacientes operados pelo PPH (41. Estudou-se, pela revisão de prontuários, as características epidemiológicas, indicações, resultados e complicações de cada grupo. Entre os 253 pacientes analisados, 170 eram mulheres, com média de idade de 50 anos. O tempo operatório médio foi de 52 minutos para o grupo 1, e 31 minutos para o grupo 2 (p=0,0001. O tempo médio de alta ambulatorial foi de 10 e 6 semanas para o grupo 1 e 2, respectivamente (p=0,021. As complicações totalizaram 28 casos no grupo 1, e 3 casos no grupo 2 (p>0,05. Cerca de 13 casos no grupo 1, e 1 caso no grupo 2 necessitaram de reintervenção cirúrgica. Neste serviço a técnica mais utilizada foi a hemorroidectomia convencional. O método do PPH apresentou tempo operatório mais curto, e recuperação pós-operatória mais breve. Houve uma maior tendência a complicações tardias e recidivas com o grupo de hemorroidectomia convencional, porém sem significância estatística.The aim of this study was to review the experience of the Coloproctology Department of HSPM-SP in the treatment of hemorrhoids. We have retrospectively studied 253 patients submitted to the surgical treatment of hemorrhoids between 05/10/ 2004 and 12/31/2007. Patients were distributed in groups: Group 1 Conventional Hemorrhoidectomy (212; Group 2 Stapled Hemorrhoidopexy (41. Epidemiology, indications, results and complications were studied based on registers. From 253 patients studied, 170 were women, with a mean age of 50 years. Mean operating time was 52 minutes (25 -120 in group 1 and 31 minutes (20 - 65 in group 2 (p=0

  16. SHAKEN, NOT STIRRED: THE DISRUPTED DISK OF THE STARBURST GALAXY NGC 253

    International Nuclear Information System (INIS)

    Davidge, T. J.

    2010-01-01

    Near-infrared images obtained with WIRCam on the Canada-France-Hawaii Telescope are used to investigate the recent history of the nearby Sculptor Group spiral NGC 253, which is one of the nearest starburst galaxies. Bright asymptotic giant branch (AGB) stars are traced out to projected distances of ∼22-26 kpc (∼13-15 disk scale lengths) along the major axis. The distribution of stars in the disk is lopsided, in the sense that the projected density of AGB stars in the northeast portion of the disk between 10 and 20 kpc from the galaxy center is ∼0.5 dex higher than on the opposite side of the galaxy. A large population of red supergiants is also found in the northeast portion of the disk and, with the exception of the central 2 kpc, this area appears to have been the site of the highest levels of star-forming activity in the galaxy during the past ∼0.1 Gyr. It is argued that such high levels of localized star formation may have produced a fountain that ejected material from the disk, and the extraplanar H I detected by Boomsma et al. may be one manifestation of such activity. Diffuse stellar structures are found in the periphery of the disk, and the most prominent of these is to the south and east of the galaxy. Bright AGB stars, including cool C stars that are identified based on their J - K colors, are detected out to 15 kpc above the disk plane, and these are part of a diffusely distributed, flattened extraplanar component. Comparisons between observed and model luminosity functions suggest that the extraplanar regions contain stars that formed throughout much of the age of the universe. Additional evidence of a diffuse, extraplanar stellar component that contains moderately young stars comes from archival Galaxy Evolution Explorer images. It is suggested that the disk of NGC 253 was disrupted by a tidal encounter with a now defunct companion. This encounter introduced asymmetries that remain to this day, and the projected distribution of stars in and

  17. [Influence of cold spot temperature on 253.7 nm resonance spectra line of electrodeless discharge lamps].

    Science.gov (United States)

    Dong, Jin-yang; Zhang, Gui-xin; Wang, Chang-quan

    2012-01-01

    As a kind of new electric light source, electrodeless discharge lamps are of long life, low mercury and non-stroboscopic light. The lighting effect of electrodeless discharge lamps depends on the radiation efficiency of 253.7 nm resonance spectra line to a large extent. The influence of cold temperature on 253.7 nm resonance spectra line has been studied experimentally by atomic emission spectral analysis. It was found that the radiation efficiency of 253.7 nm resonance spectra line is distributed in a nearly normal fashion with the variation of cold spot temperature, in other words, there is an optimum cold spot temperature for an electrodeless discharge lamp. At last, the results of experiments were analyzed through gas discharge theory, which offers guidance to the improvement of lighting effect for electrodeless discharge lamps.

  18. In-beam study of {sup 253}No using the SAGE spectrometer

    Energy Technology Data Exchange (ETDEWEB)

    Mistry, A.K.; Herzberg, R.D.; Butler, P.A.; Cox, D.M.; Joss, D.T.; Page, R.D.; Seddon, D.; Thornhill, J.; Wells, D. [University of Liverpool, Oliver Lodge Laboratory, Liverpool (United Kingdom); Greenlees, P.T.; Papadakis, P.; Auranen, K.; Grahn, T.; Jakobsson, U.; Julin, R.; Konki, J.; Leino, M.; Pakarinen, J.; Peura, P.; Rahkila, P.; Sandzelius, M.; Scholey, C.; Sorri, J.; Stolze, S.; Uusitalo, J. [University of Jyvaskyla, Department of Physics, Jyvaskyla (Finland); Garnsworthy, A.B.; Ketelhut, S. [University of British Columbia, TRIUMF, Vancouver, British Columbia (Canada); Hauschild, K.; Lopez-Martens, A. [Universite Paris-Sud, CSNSM, CNRS, IN2P3, Orsay (France); Simpson, J. [STFC, Daresbury Laboratory, Daresbury, Warrington (United Kingdom)

    2017-02-15

    The heavy actinide nucleus {sup 253}No (Z = 102) was studied using the (S)ilicon (A)nd (Ge)rmanium (SAGE) spectrometer allowing simultaneous in-beam γ-ray and conversion electron spectroscopy at the accelerator laboratory of the University of Jyvaeskylae. Using the recoil-tagging technique, γ-electron coincidences have allowed for the extension of the level scheme in the lower-spin region of the yrast band. In addition, internal conversion coefficient (ICC) measurements to establish the multipolarity of transitions have been performed. Measurement of the interband-intraband branching ratios supports the assignment of the Nilsson band-head configuration 9/2{sup -}[734] assigned in previous studies. The study shows the viability of combined in-beam electron and γ-ray spectroscopy down to μb cross sections. (orig.)

  19. THE COMPACT STAR-FORMING COMPLEX AT THE HEART OF NGC 253

    Energy Technology Data Exchange (ETDEWEB)

    Davidge, T. J., E-mail: tim.davidge@nrc.ca [Dominion Astrophysical Observatory, National Research Council of Canada, 5071 West Saanich Road, Victoria, BC V9E 2E7 (Canada)

    2016-02-20

    We discuss integral field spectra of the compact star-forming complex that is the brightest near-infrared (NIR) source in the central regions of the starburst galaxy NGC 253. The spectra cover the H and K passbands and were recorded with the Gemini NIR Spectrograph during subarcsecond seeing conditions. Absorption features in the spectrum of the star-forming complex are weaker than in the surroundings. An absorption feature is found near 1.78 μm that coincides with the location of a C{sub 2} bandhead. If this feature is due to C{sub 2} then the star-forming complex has been in place for at least a few hundred Myr. Emission lines of Brγ, [Fe ii], and He i 2.06 μm do not track the NIR continuum light. Pockets of star-forming activity that do not have associated concentrations of red supergiants, and so likely have ages <8 Myr, are found along the western edge of the complex, and there is evidence that one such pocket contains a rich population of Wolf–Rayet stars. Unless the star-forming complex is significantly more metal-poor than the surroundings, then a significant fraction of its total mass is in stars with ages <8 Myr. If the present-day star formation rate is maintained then the timescale to double its stellar mass ranges from a few Myr to a few tens of Myr, depending on the contribution made by stars older than ∼8 Myr. If—as suggested by some studies—the star-forming complex is centered on the galaxy’s nucleus, which presumably contains a large population of old and intermediate-age stars, then the nucleus of NGC 253 is currently experiencing a phase of rapid growth in its stellar mass.

  20. H I observations of the nearest starburst galaxy NGC 253 with the SKA precursor KAT-7

    Science.gov (United States)

    Lucero, D. M.; Carignan, C.; Elson, E. C.; Randriamampandry, T. H.; Jarrett, T. H.; Oosterloo, T. A.; Heald, G. H.

    2015-07-01

    We present H I observations of the Sculptor group starburst spiral galaxy NGC 253, obtained with the Karoo Array Telescope (KAT-7). KAT-7 is a pathfinder for the Square Kilometre Array precursor MeerKAT, under construction. The short baselines and low system temperature of the telescope make it very sensitive to large-scale, low-surface-brightness emission. The KAT-7 observations detected 33 per cent more flux than previous Very Large Array observations, mainly in the outer parts and in the halo for a total H I mass of 2.1 ± 0.1 × 109 M⊙. H I can be found at large distances perpendicular to the plane out to projected distances of ˜9-10 kpc away from the nucleus and ˜13-14 kpc at the edge of the disc. A novel technique, based on interactive profile fitting, was used to separate the main disc gas from the anomalous (halo) gas. The rotation curve (RC) derived for the H I disc confirms that it is declining in the outer parts, as seen in previous optical Fabry-Perot measurements. As for the anomalous component, its RC has a very shallow gradient in the inner parts and turns over at the same radius as the disc, kinematically lagging by 100 km s-1. The kinematics of the observed extra-planar gas is compatible with an outflow due to the central starburst and galactic fountains in the outer parts. However, the gas kinematics shows no evidence for inflow. Analysis of the near-IR WISE data, shows clearly that the star formation rate is compatible with the starburst nature of NGC 253.

  1. Activation of p38 MAPK pathway in the skull abnormalities of Apert syndrome Fgfr2+P253R mice

    Directory of Open Access Journals (Sweden)

    Hill Cheryl A

    2010-02-01

    Full Text Available Abstract Background Apert syndrome is characterized by craniosynostosis and limb abnormalities and is primarily caused by FGFR2 +/P253R and +/S252W mutations. The former mutation is present in approximately one third whereas the latter mutation is present in two-thirds of the patients with this condition. We previously reported an inbred transgenic mouse model with the Fgfr2 +/S252W mutation on the C57BL/6J background for Apert syndrome. Here we present a mouse model for the Fgfr2+/P253R mutation. Results We generated inbred Fgfr2+/P253R mice on the same C56BL/6J genetic background and analyzed their skeletal abnormalities. 3D micro-CT scans of the skulls of the Fgfr2+/P253R mice revealed that the skull length was shortened with the length of the anterior cranial base significantly shorter than that of the Fgfr2+/S252W mice at P0. The Fgfr2+/P253R mice presented with synostosis of the coronal suture and proximate fronts with disorganized cellularity in sagittal and lambdoid sutures. Abnormal osteogenesis and proliferation were observed at the developing coronal suture and long bones of the Fgfr2+/P253R mice as in the Fgfr2+/S252W mice. Activation of mitogen-activated protein kinases (MAPK was observed in the Fgfr2+/P253R neurocranium with an increase in phosphorylated p38 as well as ERK1/2, whereas phosphorylated AKT and PKCα were not obviously changed as compared to those of wild-type controls. There were localized phenotypic and molecular variations among individual embryos with different mutations and among those with the same mutation. Conclusions Our in vivo studies demonstrated that the Fgfr2 +/P253R mutation resulted in mice with cranial features that resemble those of the Fgfr2+/S252W mice and human Apert syndrome. Activated p38 in addition to the ERK1/2 signaling pathways may mediate the mutant neurocranial phenotype. Though Apert syndrome is traditionally thought to be a consistent phenotype, our results suggest localized and regional

  2. En undersøgelse af de 253 første nyrestensbehandlinger med 3. generations Siemens Lithoskop™

    DEFF Research Database (Denmark)

    Kruckow, Line; Eldrup, Jesper

    Introduktion: Kandidatspecialets formål er at undersøge et års behandlinger af nyresten ved ny stenknuser, Siemens Lithoskop. Undersøgelsen fokuserer på hvorvidt stenstørrelse, BMI og stenplacering har indflydelse på stenfrihedsraten. Metode: Mellem 6/12-11 og 11/12-12 blev 253 behandlinger og...

  3. 30 CFR 253.27 - When I submit audited annual financial statements to verify my unencumbered assets, what...

    Science.gov (United States)

    2010-07-01

    ... financial statements to verify my unencumbered assets, what standards must they meet? Any audited annual financial statements that you submit must: (a) Meet the standards in § 253.24; and (b) Include a certification by the independent accountant who audited the financial statements that states: (1) The value of...

  4. Nustar and Chandra insight into the nature of the 3-40 kev nuclear emission in NGC 253

    DEFF Research Database (Denmark)

    Lehmer, B. D.; Wik, D. R.; Hornschemeier, A. E.

    2013-01-01

    We present results from three nearly simultaneous Nuclear Spectroscopic Telescope Array ( NuSTAR ) and Chandra monitoring observations between 2012 September 2 and 2012 November 16 of the local star-forming galaxy NGC 253. The 3-40 keV intensity of the inner ~ 20 arcsec ( ~ 400 pc) nuclear region...

  5. A VST and VISTA study of globular clusters in NGC 253

    Science.gov (United States)

    Cantiello, Michele; Grado, Aniello; Rejkuba, Marina; Arnaboldi, Magda; Capaccioli, Massimo; Greggio, Laura; Iodice, Enrica; Limatola, Luca

    2018-03-01

    Context. Globular clusters (GCs) are key to our understanding of the Universe, as laboratories of stellar evolution, fossil tracers of the past formation epoch of the host galaxy, and effective distance indicators from local to cosmological scales. Aim. We analyze the properties of the sources in the NGC 253 with the aim of defining an up to date catalog of GC candidates in the galaxy. Given the distance of the galaxy, GCs in NGC 253 are ideal targets for resolved color-magnitude diagram studies of extragalactic GCs with next-generation diffraction limited ground-based telescopes. Methods: Our analysis is based on the science verification data of two ESO survey telescopes, VST and VISTA. Using ugri photometry from VST and JKs from VISTA, GC candidates were selected using as reference the morpho-photometric and color properties of spectroscopically confirmed GCs available in the literature. The strength of the results was verified against available archival HST/ACS data from the GHOSTS survey: all but two of the selected GC candidates appear as star clusters in HST footprints. Results: The adopted GC selection leads to the definition of a sample of ˜350 GC candidates. At visual inspection, we find that 82 objects match all the requirements for selecting GC candidates and 155 are flagged as uncertain GC candidate; however, 110 are unlikely GCs, which are most likely background galaxies. Furthermore, our analysis shows that four of the previously spectroscopically confirmed GCs, i.e., ˜20% of the total spectroscopic sample, are more likely either background galaxies or high-velocity Milky Way stars. The radial density profile of the selected best candidates shows the typically observed r1/4-law radial profile. The analysis of the color distributions reveals only marginal evidence of the presence of color bimodality, which is normally observed in galaxies of similar luminosity. The GC luminosity function does not show the typical symmetry, mainly because of the lack

  6. G0.253 + 0.016: A MOLECULAR CLOUD PROGENITOR OF AN ARCHES-LIKE CLUSTER

    International Nuclear Information System (INIS)

    Longmore, Steven N.; Ascenso, Joana; Testi, Leonardo; Bressert, Eli; Rathborne, Jill; Bastian, Nate; Alves, Joao; Meingast, Stefan; Bally, John; Battersby, Cara; Longmore, Andy; Purcell, Cormac; Walsh, Andrew; Jackson, James; Foster, Jonathan; Molinari, Sergio; Amorim, A.; Lima, J.; Marques, R.; Moitinho, A.

    2012-01-01

    Young massive clusters (YMCs) with stellar masses of 10 4 -10 5 M ☉ and core stellar densities of 10 4 -10 5 stars per cubic pc are thought to be the 'missing link' between open clusters and extreme extragalactic super star clusters and globular clusters. As such, studying the initial conditions of YMCs offers an opportunity to test cluster formation models across the full cluster mass range. G0.253 + 0.016 is an excellent candidate YMC progenitor. We make use of existing multi-wavelength data including recently available far-IR continuum (Herschel/Herschel Infrared Galactic Plane Survey) and mm spectral line (H 2 O Southern Galactic Plane Survey and Millimetre Astronomy Legacy Team 90 GHz Survey) data and present new, deep, multiple-filter, near-IR (Very Large Telescope/NACO) observations to study G0.253 + 0.016. These data show that G0.253 + 0.016 is a high-mass (1.3 × 10 5 M ☉ ), low-temperature (T dust ∼ 20 K), high-volume, and column density (n ∼ 8 × 10 4 cm –3 ; N H 2 ∼4×10 23 cm –2 ) molecular clump which is close to virial equilibrium (M dust ∼ M virial ) so is likely to be gravitationally bound. It is almost devoid of star formation and, thus, has exactly the properties expected for the initial conditions of a clump that may form an Arches-like massive cluster. We compare the properties of G0.253 + 0.016 to typical Galactic cluster-forming molecular clumps and find it is extreme, and possibly unique in the Galaxy. This uniqueness makes detailed studies of G0.253 + 0.016 extremely important for testing massive cluster formation models.

  7. VizieR Online Data Catalog: NGC253 near-infrared H2 emission (Rosenberg+,

    Science.gov (United States)

    Rosenberg, M. J. F.; van der Werf, P. P.; Israel, F. P.

    2012-11-01

    All observations were made with SINFONI at the ESO VLT. We observed in the H, and K bands using a spatial pixel scale of 0.25" corresponding to a field of view of 8" by 8" per frame and a spectral resolution of 2000, 3000 and 4000 respectively, which corresponds to a velocity resolution of 149.8, 99.9 and 74.9km/s. All science observations were taken in the ABA'nodding mode (300s of object, 300s of sky, 300s of object), where A' is slightly offset from A. The object exposures are aligned and averaged during the reconstruction of the data cube. The observations of NGC 253 were made in visitor mode on August 28th, 2005. In order to capture the full extent of the H2 emission, consecutive frames were taken in the K band moving further away from the center, along the disk until H2 was no longer detected. This resulted in 6 separate pointings. Since there are also H2 transitions in the H band, a similar strategy was used, resulting in 4 separate pointings. We used the standard reduction techniques of the SINFONI pipeline on all observations, including corrections for flat field, dark current, nonlinearity of pixels, distortion, and wavelength calibration. We obtained the flux calibration and atmospheric corrections from observations of a standard star, namely HR 2058 in the H band and HD 20001 in the K band (2 data files).

  8. Henry's Law vaporization studies and thermodynamics of einsteinium-253 metal dissolved in ytterbium

    International Nuclear Information System (INIS)

    Kleinschmidt, P.D.; Ward, J.W.; Matlack, G.M.; Haire, R.G.

    1984-01-01

    The cohesive energy of metallic einsteinium determines whether einsteinium is a trivalent or divalent metal. The enthalpy of sublimation, a measure of the cohesive energy, is calculated from the partial pressures of einsteinium over an alloy. The partial pressure of 253 Es has been measured over the range 470--870 K, using combined target and mass spectrometric Knudsen effusion techniques. An alloy was prepared with einsteinium dissolved in a ytterbium solvent to produce a very dilute solution. Partial pressure measurements on the alloy were amenable to the experimental technique and a data analysis using a Henry's law treatment of the data. Vapor pressure data are combined with an estimated crystal entropy S 0 298 and ΔC 0 /sub p/ for ytterbium, to produce enthalpy, entropy, and free energy functions from 298 to 1300 K. The vapor pressure of einsteinium in a dilute einsteinium--ytterbium alloy is described by the equation log P(atm) = -(6815 +- 216)/T+2.576 +- 0.337, from which we calculate for the enthalpy of sublimation of pure einsteinium ΔH 0 298 (second law) = 31.76 kcal/mol. The value of the enthalpy of sublimation is consistent with the conclusion that Es is a divalent metal

  9. Joint Institute for Nuclear Research Data Analysis Guide - Berkelium Edition

    International Nuclear Information System (INIS)

    Henderson, R.A.

    2009-01-01

    This is a data analysis guide to the JINR system developed by Roger Henderson. It is intended as a complete guide to the data format and the calibration parameters utilized for the analysis of the data. This guide will provide the basic structure of the data files, the description of the individual data items, and the basic equations developed for the calculation of the results. Currently (7/17/2009), calculation of the calibration parameters is not a covered topic. It is intended that this will be covered in a future update

  10. Chelation and stabilization of berkelium in oxidation state +IV

    Czech Academy of Sciences Publication Activity Database

    Deblonde, G. J.-P.; Sturzbecher-Hoehne, M.; Rupert, P. B.; An, D. D.; Illy, M.-C.; Ralston, C. Y.; Brabec, Jiří; de Jong, W. A.; Strong, R. K.; Abergel, R. J.

    2017-01-01

    Roč. 9, č. 9 (2017), s. 843-849 ISSN 1755-4330 Institutional support: RVO:61388955 Keywords : bioorganic chemistry * chemical bonding * mass spectrometry Subject RIV: CF - Physical ; Theoretical Chemistry OBOR OECD: Physical chemistry Impact factor: 25.870, year: 2016

  11. The new high-resolution IRMS MAT253 ULTRA at Utrecht University

    Science.gov (United States)

    Röckmann, Thomas; Hofmann, Magdalena; Paul, Dipayan; Popa, Elena; Adnew, Getachew

    2017-04-01

    In 2016, the new high-resolution, multi-collector isotope ratio mass spectrometer MAT253 ULTRA [1] was installed at Utrecht University. This instrument is designed to reach a mass resolving power of 20,000 to 40,000 (M/ΔM). The ion currents are detected with a variable multi-collector unit that allows to register up to 9 ion currents simultaneously with Faraday cups and ion counters. The width of the entrance slit can be varied between 5 and 250μm so that the instrument can be operated under low, medium and high mass resolution, and an optimum balance between resolution and sensitivity can be selected for the respective applications. The central field of application of the new IRMS at Utrecht University is the measurement of multiply substituted isotopologues (clumped isotopes) in atmospheric trace compounds (e.g. 13CDH3, 13C18O16O, 18O18O, 15N14N18O) [1-7]. It is known from thermodynamics that the zero point energy of a chemical bond usually decreases when multiple heavy isotopes clump together in a molecule, and this effect depends on temperature [7]. Therefore, the abundance of clumped isotopes can be used as temperature indicator under thermodynamical equilibrium conditions. However, in the atmosphere, many reactions are controlled kinetically. It has been shown recently for a few examples that negative clumping signatures (anti-clumping) can be produced under non-equilibrium conditions [3,4]. In addition, based on purely statistical reasons, anti-clumping signatures will be produced in any molecule that contains indistinguishable atoms, which originate from isotopically distinct reservoir [5,6]. Thus, the investigation of multiply substituted isotopologues is expected to generate novel isotope signatures that can complement conventional stable isotope analysis in atmospheric science. We will present data on the performance of the MAT 253 ULTRA instrument and first scientific applications to atmospheric research. 1. Eiler, J.M., et al., A high-resolution gas

  12. On the paleoenvironmental potential of 253 newly discovered pine stumps from Zurich, Switzerland

    Science.gov (United States)

    Reinig, Frederick; Nievergelt, Daniel; Esper, Jan; Friedrich, Michael; Helle, Gerhard; Hellmann, Lena; Kromer, Bernd; Morganti, Sandro; Pauly, Maren; Sookdeo, Adam; Tegel, Willy; Treydte, Kerstin; Wacker, Lukas; Büntgen, Ulf

    2017-04-01

    The transition from the last Ice Age to the early Holocene 15'000-10'000 BP represents a close natural analog to the ongoing and predicted rates of anthropogenic climate change. A reduced quality and quantity of high-resolution proxy archives during this period, however, limits our understanding of the magnitude and pace of Late Glacial (LG) environmental variability. Here, we present the world's best preserved, most replicated and oldest forest remains: A total of 253 subfossil pine stumps were recently discovered in Zurich. The combined approach of tree-ring and radiocarbon (14C) measurements results in an absolutely dated Preboreal Swiss tree-ring width chronology and eight floating chronologies. With tree ages ranging between 41 and 506 years, often including pith and bark, and a mean segment length of 163 years, this exceptional find is distributed over nearly 2'000 years between the Allerød and the Preboreal. Together with 200 previously collected LG pines from the greater Zurich region, this study sets a benchmark in terms of sample replication and dating precision for stable more dynamic climatic periods such as the Laacher See eruption, the Older and Younger Dryas. The paleoenvironmental significance would even increase when annually resolved 14C-measurements help fixing a major, Northern Hemispheric gap in the absolutely dated dendro time series during the Younger Dryas. While overcoming this interlude, our results further emphasize the importance of interdisciplinary research on these striking LG climatic shifts to better understand and assess their ecological and environmental impact.

  13. ALMA MULTI-LINE IMAGING OF THE NEARBY STARBURST NGC 253

    Energy Technology Data Exchange (ETDEWEB)

    Meier, David S. [New Mexico Institute of Mining and Technology, 801 Leroy Place, Socorro, NM 87801 (United States); Walter, Fabian; Zschaechner, Laura K. [Max-Planck Institut für Astronomie, Königstuhl 17, D-69117 Heidelberg (Germany); Bolatto, Alberto D.; Veilleux, Sylvain; Warren, Steven R. [Department of Astronomy and Joint Space-Science Institute, University of Maryland, College Park, MD 20742 (United States); Leroy, Adam K. [National Radio Astronomy Observatory, 520 Edgemont Road, Charlottesville, VA 22903 (United States); Ott, Jürgen [National Radio Astronomy Observatory, Pete V. Domenici Array Science Center, P.O. Box O, Socorro, NM 87801 (United States); Rosolowsky, Erik [Department of Physics, University of Alberta, Edmonton, AB T6G 2E1 (Canada); Weiß, Axel [Max Planck Institut für Radioastronomie, Auf dem Hügel 69, D-53121 Bonn (Germany); Zwaan, Martin A., E-mail: dmeier@nmt.edu [European Southern Observatory, Karl-Schwarzschild-Str. 2, D-85748 Garching bei München (Germany)

    2015-03-01

    We present spatially resolved (∼50 pc) imaging of molecular gas species in the central kiloparsec of the nearby starburst galaxy NGC 253, based on observations taken with the Atacama Large Millimeter/submillimeter Array. A total of 50 molecular lines are detected over a 13 GHz bandwidth imaged in the 3 mm band. Unambiguous identifications are assigned for 27 lines. Based on the measured high CO/C{sup 17}O isotopic line ratio (≳350), we show that {sup 12}CO(1-0) has moderate optical depths. A comparison of the HCN and HCO{sup +} with their {sup 13}C-substituted isotopologues shows that the HCN(1-0) and HCO{sup +}(1-0) lines have optical depths at least comparable to CO(1-0). H{sup 13}CN/H{sup 13}CO{sup +} (and H{sup 13}CN/HN{sup 13}C) line ratios provide tighter constraints on dense gas properties in this starburst. SiO has elevated abundances across the nucleus. HNCO has the most distinctive morphology of all the bright lines, with its global luminosity dominated by the outer parts of the central region. The dramatic variation seen in the HNCO/SiO line ratio suggests that some of the chemical signatures of shocked gas are being erased in the presence of dominating central radiation fields (traced by C{sub 2}H and CN). High density molecular gas tracers (including HCN, HCO{sup +}, and CN) are detected at the base of the molecular outflow. We also detect hydrogen β recombination lines that, like their α counterparts, show compact, centrally peaked morphologies, distinct from the molecular gas tracers. A number of sulfur based species are mapped (CS, SO, NS, C{sub 2}S, H{sub 2}CS, and CH{sub 3}SH) and have morphologies similar to SiO.

  14. Clinical significance of circulating miR-25-3p as a novel diagnostic and prognostic biomarker in osteosarcoma.

    Science.gov (United States)

    Fujiwara, Tomohiro; Uotani, Koji; Yoshida, Aki; Morita, Takuya; Nezu, Yutaka; Kobayashi, Eisuke; Yoshida, Akihiko; Uehara, Takenori; Omori, Toshinori; Sugiu, Kazuhisa; Komatsubara, Tadashi; Takeda, Ken; Kunisada, Toshiyuki; Kawamura, Machiko; Kawai, Akira; Ochiya, Takahiro; Ozaki, Toshifumi

    2017-05-16

    Emerging evidence has suggested that circulating microRNAs (miRNAs) in body fluids have novel diagnostic and prognostic significance for patients with malignant diseases. The lack of useful biomarkers is a crucial problem of bone and soft tissue sarcomas; therefore, we investigated the circulating miRNA signature and its clinical relevance in osteosarcoma. Global miRNA profiling was performed using patient serum collected from a discovery cohort of osteosarcoma patients and controls and cell culture media. The secretion of the detected miRNAs from osteosarcoma cells and clinical relevance of serum miRNA levels were evaluated using in vitro and in vivo models and a validation patient cohort. Discovery screening identified 236 serum miRNAs that were highly expressed in osteosarcoma patients compared with controls, and eight among these were also identified in the cell culture media. Upregulated expression levels of miR-17-5p and miR-25-3p were identified in osteosarcoma cells, and these were abundantly secreted into the culture media in tumor-derived exosomes. Serum miR-25-3p levels were significantly higher in osteosarcoma patients than in control individuals in the validation cohort, with favorable sensitivity and specificity compared with serum alkaline phosphatase. Furthermore, serum miR-25-3p levels at diagnosis were correlated with patient prognosis and reflected tumor burden in both in vivo models and patients; these associations were more sensitive than those of serum alkaline phosphatase. Serum-based circulating miR-25-3p may serve as a non-invasive blood-based biomarker for tumor monitoring and prognostic prediction in osteosarcoma patients.

  15. THE GALACTIC CENTER CLOUD G0.253+0.016: A MASSIVE DENSE CLOUD WITH LOW STAR FORMATION POTENTIAL

    Energy Technology Data Exchange (ETDEWEB)

    Kauffmann, Jens; Pillai, Thushara [Astronomy Department, California Institute of Technology, 1200 East California Boulevard, Pasadena, CA 91125 (United States); Zhang Qizhou, E-mail: jens.kauffmann@astro.caltech.edu [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street MS78, Cambridge, MA 02138 (United States)

    2013-03-10

    We present the first interferometric molecular line and dust emission maps for the Galactic Center (GC) cloud G0.253+0.016, observed using CARMA and the SMA. This cloud is very dense, and concentrates a mass exceeding the Orion Molecular Cloud Complex (2 Multiplication-Sign 10{sup 5} M{sub Sun }) into a radius of only 3 pc, but it is essentially starless. G0.253+0.016 therefore violates ''star formation laws'' presently used to explain trends in galactic and extragalactic star formation by a factor {approx}45. Our observations show a lack of dense cores of significant mass and density, thus explaining the low star formation activity. Instead, cores with low densities and line widths {approx}< 1 km s{sup -1}-probably the narrowest lines reported for the GC region to date-are found. Evolution over several 10{sup 5} yr is needed before more massive cores, and possibly an Arches-like stellar cluster, could form. Given the disruptive dynamics of the GC region, and the potentially unbound nature of G0.253+0.016, it is not clear that this evolution will happen.

  16. SPECTRAL ANALYSIS AND INTERPRETATION OF THE {gamma}-RAY EMISSION FROM THE STARBURST GALAXY NGC 253

    Energy Technology Data Exchange (ETDEWEB)

    Abramowski, A. [Institut fuer Experimentalphysik, Universitaet Hamburg, Luruper Chaussee 149, D-22761 Hamburg (Germany); Acero, F. [Laboratoire Univers et Particules de Montpellier, Universite Montpellier 2, CNRS/IN2P3, CC 72, Place Eugene Bataillon, F-34095 Montpellier Cedex 5 (France); Aharonian, F.; Bernloehr, K.; Bochow, A. [Max-Planck-Institut fuer Kernphysik, P.O. Box 103980, D-69029 Heidelberg (Germany); Akhperjanian, A. G. [National Academy of Sciences of the Republic of Armenia, Yerevan (Armenia); Anton, G.; Balzer, A.; Brucker, J. [Physikalisches Institut, Universitaet Erlangen-Nuernberg, Erwin-Rommel-Str. 1, D-91058 Erlangen (Germany); Barnacka, A. [Nicolaus Copernicus Astronomical Center, ul. Bartycka 18, 00-716 Warsaw (Poland); Becherini, Y. [APC, AstroParticule et Cosmologie, Universite Paris Diderot, CNRS/IN2P3, CEA/lrfu, Observatoire de Paris, Sorbonne Paris Cite, 10, rue Alice Domon et Leonie Duquet, F-75205 Paris Cedex 13 (France); Becker, J. [Institut fuer Theoretische Physik, Lehrstuhl IV: Weltraum und Astrophysik, Ruhr-Universitaet Bochum, D-44780 Bochum (Germany); Birsin, E. [Institut fuer Physik, Humboldt-Universitaet zu Berlin, Newtonstr. 15, D-12489 Berlin (Germany); Biteau, J.; Brun, F. [Laboratoire Leprince-Ringuet, Ecole Polytechnique, CNRS/IN2P3, F-91128 Palaiseau (France); Boisson, C. [LUTH, Observatoire de Paris, CNRS, Universite Paris Diderot, 5 Place Jules Janssen, F-92190 Meudon (France); Bolmont, J. [LPNHE, Universite Pierre et Marie Curie Paris 6, Universite Denis Diderot Paris 7, CNRS/IN2P3, 4 Place Jussieu, F-75252, Paris Cedex 5 (France); Bordas, P. [Institut fuer Astronomie und Astrophysik, Universitaet Tuebingen, Sand 1, D-72076 Tuebingen (Germany); Brun, P. [CEA Saclay, DSM/IRFU, F-91191 Gif-Sur-Yvette Cedex (France); Bulik, T., E-mail: stefan.ohm@le.ac.uk [Astronomical Observatory, The University of Warsaw, Al. Ujazdowskie 4, 00-478 Warsaw (Poland); Collaboration: H.E.S.S. Collaboration; and others

    2012-10-01

    Very high energy (VHE; E {>=} 100 GeV) and high-energy (HE; 100 MeV {<=} E {<=} 100 GeV) data from {gamma}-ray observations performed with the H.E.S.S. telescope array and the Fermi-LAT instrument, respectively, are analyzed in order to investigate the non-thermal processes in the starburst galaxy NGC 253. The VHE {gamma}-ray data can be described by a power law in energy with differential photon index {Gamma} = 2.14 {+-} 0.18{sub stat} {+-} 0.30{sub sys} and differential flux normalization at 1 TeV of F{sub 0} = (9.6 {+-} 1.5{sub stat}(+ 5.7, -2.9){sub sys}) Multiplication-Sign 10{sup -14} TeV{sup -1} cm{sup -2} s{sup -1}. A power-law fit to the differential HE {gamma}-ray spectrum reveals a photon index of {Gamma} 2.24 {+-} 0.14{sub stat} {+-} 0.03{sub sys} and an integral flux between 200 MeV and 200 GeV of F(0.2-200 GeV) = (4.9 {+-} 1.0{sub stat} {+-} 0.3{sub sys}) Multiplication-Sign 10{sup -9} cm{sup -2} s{sup -1}. No evidence for a spectral break or turnover is found over the dynamic range of both the LAT instrument and the H.E.S.S. experiment: a combined fit of a power law to the HE and VHE {gamma}-ray data results in a differential photon index {Gamma} = 2.34 {+-} 0.03 with a p-value of 30%. The {gamma}-ray observations indicate that at least about 20% of the energy of the cosmic rays (CRs) capable of producing hadronic interactions is channeled into pion production. The smooth alignment between the spectra in the HE and VHE {gamma}-ray domain suggests that the same transport processes dominate in the entire energy range. Advection is most likely responsible for charged particle removal from the starburst nucleus from GeV to multiple TeV energies. In a hadronic scenario for the {gamma}-ray production, the single overall power-law spectrum observed would therefore correspond to the mean energy spectrum produced by the ensemble of CR sources in the starburst region.

  17. Physicochemical properties of binary solutions of propylene carbonate-acetonitrile in the range of 253.15-313.15 K

    Science.gov (United States)

    Tyunina, E. Yu.; Chekunova, M. D.

    2017-05-01

    The density, dynamic viscosity, and dielectric constant of propylene carbonate solutions with acetonitrile are measured over the composition of a mixed solvent at temperatures of 253.15, 273.15, 293.15, and 313.15 K. The molar volume, molar viscosity, and molar capacity of a mixture of propylene carbonate-acetonitrile and an excess amount of it are calculated. The effect the temperature and composition of the mixture have on the excess molar properties is discussed. A linear correlation is observed between the values of the molar fluidity, capacity, polarization, and molar volume of the studied system.

  18. Direct Evidence for Maser Emission from the 36.2 GHz Class I Transition of Methanol in NGC253

    Science.gov (United States)

    Chen, Xi; Ellingsen, Simon P.; Shen, Zhi-Qiang; McCarthy, Tiege P.; Zhong, Wei-Ye; Deng, Hui

    2018-04-01

    Observations made with the Jansky Very large Array (JVLA) at an angular resolution of ∼0.″1 have detected class I methanol maser emission from the 36.2 GHz transition toward the starburst galaxy NGC 253. The methanol emission is detected toward four sites which lie within the regions of extended methanol emission detected in previous lower angular resolution (a few arcseconds) observations. The peak flux densities of the detected compact components are in the range 3–9 mJy beam‑1. Combining the JVLA data with single-dish observations from the Shanghai Tianma Radio Telescope (TMRT) and previous interferometric observations with the Australia Telescope Compact Array (ATCA), we show that the 36.2 GHz class I methanol emission consists of both extended and compact structures, with typical scales of ∼6″ (0.1 kpc) and ∼0.″05 (1 pc), respectively. The strongest components have a brightness temperature of >103 K, much higher than the maximum kinetic temperature (∼100 K) of the thermal methanol emission from NGC 253. Therefore, these observations conclusively demonstrate for the first time the presence of maser emission from a class I methanol transition in an external galaxy.

  19. Effect of variable doses of ultraviolet radiation (253.7 nm) on thermoluminescence NaCl:Ca(T) material

    International Nuclear Information System (INIS)

    Nehate, A.K.; Joshi, T.R.; Kathuria, S.P.; Joshi, R.V.

    1986-01-01

    This paper studies the thermoluminescence (TL) glow curves of NaCl:Ca(T) phosphors to various doses of 253.7-nm ultraviolet (UV) radiation at room temperature. TLD grade NaCl:Ca(T) material was obtained by crystallization from solution and was subsequently annealed at 750 degrees C for 2 h, followed by sudden quenching. We undertook measurement of the effect of variable UV radiation doses (10(2) to 10(6) J m-2) on the TL behaviour of NaCl:Ca(T) phosphors. It was observed that the phosphor exhibits a dominant peak around 167 degrees C along with a weak peak at lower temperature. The high-temperature peak (Peak II) is found to grow linearly with the increase in UV dose in the range of 10(2) to 10(6) J m-2. Since the nature of the glow curves under the influence of different doses remains more or less identical, it is believed that the phosphor does not undergo radiation damage and displays high intrinsic TL around Peak II. Examination of the system for fundamental dosimetry requirements shows that it can be used in dosimetry work at 253.7 nm

  20. XMM-Newton Observations of NGC 253: Resolving the Emission Components in the Disk and Nuclear Area

    Science.gov (United States)

    Pietsch, W.; Borozdin, K. N.; Branduardi-Raymont, G.; Cappi, M.; Ehle, M.; Ferrando, P.; Freyberg, M. J.; Kahn, S. M.; Ponman, T. J.; Ptak, A.

    2000-01-01

    We describe the first XMM-Newton observations of the starburst galaxy NGC 253. As known from previous X-ray observations, NGC 253 shows a mixture of extended (disk and halo) and point-source emission. The high XMM-Newton throughput allows for the first time a detailed investigation of the spatial, spectral and variability properties of these components simultaneously. We detect a bright X-ray transient approx. 70 sec SSW of the nucleus and show the spectrum and light curve of the brightest point source (approx. 30 sec S of the nucleus, most likely a black-hole X-ray binary, BHXRB). The unprecedented combination of RGS and EPIC also sheds new light on the emission of the complex nuclear region, the X-ray plume and the disk diffuse emission. In particular, EPIC images reveal that the limb-brightening of the plume is mostly seen in higher ionization emission lines, while in the lower ionization lines, and below 0.5 keV, the plume is more homo- geneously structured, pointing to new interpretations as to the make up of the starburst-driven outflow. Assuming that type IIa supernova remnants (SNRs) are mostly responsible for the E greater than 4 keV emission, the detection with EPIC of the 6.7 keV line allows us to estimate a supernova rate within the nuclear starburst of 0.2 /yr.

  1. Apert Syndrome: Molecularly Confirmed C.758C>G (P.Pro253Arg) in FGFR2

    Energy Technology Data Exchange (ETDEWEB)

    Cha Gon, Lee, E-mail: leechagon@eulji.ac.kr [Department of Pediatrics, Eulji General Hospital, College of Medicine, Eulji University, 68 Hangeulbiseok-ro, Nowon-gu, Seoul 139-711 (Korea, Republic of)

    2016-03-21

    A 5-day-old girl was referred to our clinic for evaluation of congenital malformations. She was identified with a pathogenic mutation c.758C>G (p.Pro253Arg) in FGFR2 gene using targeted exome sequencing. The de novo mutation was confirmed with Sanger sequencing in the patient and her parents. She showed occipital plagiocephaly with frontal bossing (Figure A and B). Skull frontal and lateral radiography revealed fusion of most of the sutures except coronal suture, with convolutional markings (Figure D and E). She had complete cleft palate (Figure C). Her fused bilateral hands showed type II syndactyly with complete syndactyly between the ring and the little fingers (Figure F1-F3). Both toes were simple syndactyly with side-to-side fusion of skin (Figure G1-)

  2. Apert Syndrome: Molecularly Confirmed C.758C>G (P.Pro253Arg) in FGFR2

    International Nuclear Information System (INIS)

    Cha Gon, Lee

    2016-01-01

    A 5-day-old girl was referred to our clinic for evaluation of congenital malformations. She was identified with a pathogenic mutation c.758C>G (p.Pro253Arg) in FGFR2 gene using targeted exome sequencing. The de novo mutation was confirmed with Sanger sequencing in the patient and her parents. She showed occipital plagiocephaly with frontal bossing (Figure A and B). Skull frontal and lateral radiography revealed fusion of most of the sutures except coronal suture, with convolutional markings (Figure D and E). She had complete cleft palate (Figure C). Her fused bilateral hands showed type II syndactyly with complete syndactyly between the ring and the little fingers (Figure F1-F3). Both toes were simple syndactyly with side-to-side fusion of skin (Figure G1-)

  3. Gene expression response of A253 human salivary cell line to radiation, Cis-Pt, and EGF

    International Nuclear Information System (INIS)

    Woloschak, G.; Paunesku, T.; Mittal, B.; Dyck, P.; Pauloski, B.; Rademaker, A.; Logemann, J.; Quigg, R.

    2003-01-01

    We are interested in long and short term effects of head and neck cancers treatment, and prior to the studies of patient samples, experiments were designed to observe treatment effects in cultured cells, and examine gene expression profiles from A253 human salivary cells (derived from a head and neck tumor) following exposure to gamma-rays, cisplatin (cis-Pt), and a combination of either with epidermal growth factor (EGF) treatment. A253 cells were treated by: 2 Gy or 10 Gy of γ-rays (Cs137 source, 77 cGy/min), Cis-Pt at 50 μ/mL, and EGF at 40 ng/mL. RNAs were processed and hybridized with Affymetrix Hu95A arrays according to the manufacturer's instructions. Data were scanned and analyzed and we found significant differences in the expression patterns of numerous genes were observed. Some of the more interesting genes are: Requeim [a protein required for apoptosis]; Cyclin D1 (prad1/bcl1) [a cyclin that can function as an oncogene]; FK506 Binding Protein [which may be competing with TGF-beta type I receptor for binding with FK506 thus acting against this powerful immunosuppressant]; Thioredoxin (TXN) [an oxidoreductase with multiple in vitro substrates, including ribonuclease, choriogonadotropins, coagulation factors, glucocorticoid receptor, and insulin]; Glutathione Peroxidase (GPX) [whose role in protection against oxidative stress was long ago well documented]; Aquaporin 3 (AQP3) [protein with a water-channel function that was confirmed by functional expression in Xenopus oocytes]; Eukaryotic Initiation Factor 1A (EIF1A) [a translation factor, proposed as a candidate gene for Turner syndrome]; and finally Insulin-like Growth Factor-Binding Protein 6 (IGFBP6) [an autocrine growth inhibitor shown to inhibit growth of HaCat cells and other keratinocyte cell lines

  4. A Thorough View of the Nuclear Region of NGC 253: Combined Herschel, SOFIA, and APEX Data Set

    Science.gov (United States)

    Pérez-Beaupuits, J. P.; Güsten, R.; Harris, A.; Requena-Torres, M. A.; Menten, K. M.; Weiß, A.; Polehampton, E.; van der Wiel, M. H. D.

    2018-06-01

    We present a large set of spectral lines detected in the 40″ central region of the starburst galaxy NGC 253. Observations were obtained with the three instruments SPIRE, PACS, and HIFI on board the Herschel Space Observatory, upGREAT on board the SOFIA airborne observatory, and the ground-based Atacama Pathfinder EXperiment telescope. Combining the spectral and photometry products of SPIRE and PACS, we model the dust continuum spectral energy distribution (SED) and the most complete 12CO line SED reported so far toward the nuclear region of NGC 253. The properties and excitation of the molecular gas were derived from a three-component non-LTE radiative transfer model, using the SPIRE 13CO lines and ground-based observations of the lower-J 13CO and HCN lines, to constrain the model parameters. Three dust temperatures were identified from the continuum emission, and three components are needed to fit the full CO line SED. Only the third CO component (fitting mostly the HCN and PACS 12CO lines) is consistent with a shock-/mechanical-heating scenario. A hot core chemistry is also argued as a plausible scenario to explain the high-J 12CO lines detected with PACS. The effect of enhanced cosmic-ray ionization rates, however, cannot be ruled out and is expected to play a significant role in the diffuse and dense gas chemistry. This is supported by the detection of ionic species like OH+ and H2O+, as well as the enhanced fluxes of the OH lines with respect to those of H2O lines detected in both PACS and SPIRE spectra.

  5. Refinement of the critical 2p25.3 deletion region: the role of MYT1L in intellectual disability and obesity

    NARCIS (Netherlands)

    Rocker, N. de; Vergult, S.; Koolen, D.A.; Jacobs, E.; Hoischen, A.; Zeesman, S.; Bang, B.; Bena, F.; Bockaert, N.; Bongers, E.M.H.F.; Ravel, T. de; Devriendt, K.; Giglio, S.; Faivre, L.; Joss, S.; Maas, S.; Marle, N.; Novara, F.; Nowaczyk, M.J.; Peeters, H.; Polstra, A.; Roelens, F.; Rosenberg, C.; Thevenon, J.; Tumer, Z.; Vanhauwaert, S.; Varvagiannis, K.; Willaert, A.; Willemsen, M.H.; Willems, M.; Zuffardi, O.; Coucke, P.; Speleman, F.; Eichler, E.E.; Kleefstra, T.; Menten, B.

    2015-01-01

    PURPOSE: Submicroscopic deletions of chromosome band 2p25.3 are associated with intellectual disability and/or central obesity. Although MYT1L is believed to be a critical gene responsible for intellectual disability, so far no unequivocal data have confirmed this hypothesis. METHODS: In this study

  6. Refinement of the critical 2p25.3 deletion region: the role of MYT1L in intellectual disability and obesity

    NARCIS (Netherlands)

    de Rocker, Nina; Vergult, Sarah; Koolen, David; Jacobs, Eva; Hoischen, Alexander; Zeesman, Susan; Bang, Birgitte; Béna, Frédérique; Bockaert, Nele; Bongers, Ernie M.; de Ravel, Thomy; Devriendt, Koenraad; Giglio, Sabrina; Faivre, Laurence; Joss, Shelagh; Maas, Saskia; Marle, Nathalie; Novara, Francesca; Nowaczyk, Malgorzata J. M.; Peeters, Hilde; Polstra, Abeltje; Roelens, Filip; Rosenberg, Carla; Thevenon, Julien; Tümer, Zeynep; Vanhauwaert, Suzanne; Varvagiannis, Konstantinos; Willaert, Andy; Willemsen, Marjolein; Willems, Marjolaine; Zuffardi, Orsetta; Coucke, Paul; Speleman, Frank; Eichler, Evan E.; Kleefstra, Tjitske; Menten, Björn

    2015-01-01

    Submicroscopic deletions of chromosome band 2p25.3 are associated with intellectual disability and/or central obesity. Although MYT1L is believed to be a critical gene responsible for intellectual disability, so far no unequivocal data have confirmed this hypothesis. In this study we evaluated a

  7. Study of cyclic oxidation for stainless steels AISI 309 T 253 M A, with low additions of cerium; Estudio de la oxidacion ciclica de los aceros inoxidables AISI 309 T 253 MA, con pequenas adiciones de Cerio

    Energy Technology Data Exchange (ETDEWEB)

    Velazquez F, G.L.; Martinez, M.; Ruiz, A. [Universidad Nacional Experimental Politecnica (UNEXPO) - Vicerrectorado de Puerto Ordaz, Centro de Estudios de Corrosion. Puerto Ordaz. venezuela (Venezuela)

    1998-12-31

    It has been detected that the addition of small amounts (<1%) of the so called `reactive elements` such as Cerium to Fe-Cr alloys that was utilized in oxidating environment at high temperatures improving its resistance to oxidation under isothermal and cyclic conditions. In this work, it was evaluated the behavior under cyclic oxidation conditions for an austenitic stainless steel at chromium-nickel (253MA) with cerium addition, and comparing it with the AISI 310S austenitic stainless steel. The cyclic oxidation essays consist of five cycles by 24 hours each one, following of a cooling in air until ambient temperature from the temperatures of 850, 900 and 950 Centigrade, registering the gain mass of the specimen at end of each cycle. In order to this were prepared samples with dimensions of 20 mm. x 10 mm. x 1 mm. Later to the oxidation essays was evaluated the morphology of the corrosion products layer by scanning electron microscopy. The present phases were identified by X-ray diffraction and by chemical microanalysis by Dispersive energy (EDAX). The results obtained show that the steel with cerium addition, presents a higher adherence and resistance to the spalling noting that the cerium promotes the casting anchor of the oxides layer to matrix and by reducing the grain size of the layer improving its plasticity. Additionally the cerium promotes the preferential oxidation of the forming elements of protective layers like the chromium. (Author)

  8. miR-25-3p, Positively Regulated by Transcription Factor AP-2α, Regulates the Metabolism of C2C12 Cells by Targeting Akt1

    Directory of Open Access Journals (Sweden)

    Feng Zhang

    2018-03-01

    Full Text Available miR-25, a member of the miR-106b-25 cluster, has been reported as playing an important role in many biological processes by numerous studies, while the role of miR-25 in metabolism and its transcriptional regulation mechanism remain unclear. In this study, gain-of-function and loss-of-function assays demonstrated that miR-25-3p positively regulated the metabolism of C2C12 cells by attenuating phosphoinositide 3-kinase (PI3K gene expression and triglyceride (TG content, and enhancing the content of adenosine triphosphate (ATP and reactive oxygen species (ROS. Furthermore, the results from bioinformatics analysis, dual luciferase assay, site-directed mutagenesis, qRT-PCR, and Western blotting demonstrated that miR-25-3p directly targeted the AKT serine/threonine kinase 1 (Akt1 3′ untranslated region (3′UTR. The core promoter of miR-25-3p was identified, and the transcription factor activator protein-2α (AP-2α significantly increased the expression of mature miR-25-3p by binding to its core promoter in vivo, as indicated by the chromatin immunoprecipitation (ChIP assay, and AP-2α binding also downregulated the expression of Akt1. Taken together, our findings suggest that miR-25-3p, positively regulated by the transcription factor AP-2α, enhances C2C12 cell metabolism by targeting the Akt1 gene.

  9. Study of cyclic oxidation for stainless steels AISI 309 T 253 M A, with low additions of cerium

    International Nuclear Information System (INIS)

    Velazquez F, G.L.; Martinez, M.; Ruiz, A.

    1998-01-01

    It has been detected that the addition of small amounts (<1%) of the so called 'reactive elements' such as Cerium to Fe-Cr alloys that was utilized in oxidating environment at high temperatures improving its resistance to oxidation under isothermal and cyclic conditions. In this work, it was evaluated the behavior under cyclic oxidation conditions for an austenitic stainless steel at chromium-nickel (253MA) with cerium addition, and comparing it with the AISI 310S austenitic stainless steel. The cyclic oxidation essays consist of five cycles by 24 hours each one, following of a cooling in air until ambient temperature from the temperatures of 850, 900 and 950 Centigrade, registering the gain mass of the specimen at end of each cycle. In order to this were prepared samples with dimensions of 20 mm. x 10 mm. x 1 mm. Later to the oxidation essays was evaluated the morphology of the corrosion products layer by scanning electron microscopy. The present phases were identified by X-ray diffraction and by chemical microanalysis by Dispersive energy (EDAX). The results obtained show that the steel with cerium addition, presents a higher adherence and resistance to the spalling noting that the cerium promotes the casting anchor of the oxides layer to matrix and by reducing the grain size of the layer improving its plasticity. Additionally the cerium promotes the preferential oxidation of the forming elements of protective layers like the chromium. (Author)

  10. Effect of UV irradiation (253.7 nm) on free Legionella and Legionella associated with its amoebae hosts.

    Science.gov (United States)

    Cervero-Aragó, Sílvia; Sommer, Regina; Araujo, Rosa M

    2014-12-15

    Water systems are the primary reservoir for Legionella spp., where the bacteria live in association with other microorganisms, such as free-living amoebae. A wide range of disinfection treatments have been studied to control and prevent Legionella colonization but few of them were performed considering its relation with protozoa. In this study, the effectiveness of UV irradiation (253.7 nm) using low-pressure lamps was investigated as a disinfection method for Legionella and amoebae under controlled laboratory conditions. UV treatments were applied to 5 strains of Legionella spp., 4 strains of free-living amoeba of the genera Acanthamoeba and Vermamoeba, treating separately trophozoites and cysts, and to two different co-cultures of Legionella pneumophila with the Acanthamoeba strains. No significant differences in the UV inactivation behavior were observed among Legionella strains tested which were 3 logs reduced for fluences around 45 J/m(2). UV irradiation was less effective against free-living amoebae; which in some cases required up to 990 J/m(2) to obtain the same population reduction. UV treatment was more effective against trophozoites compared to cysts; moreover, inactivation patterns were clearly different between the genus Acanthamoeba and Vermamoeba. For the first time data about Vermamoeba vermiformis UV inactivation has been reported in a study. Finally, the results showed that the association of L. pneumophila with free-living amoebae decreases the effectiveness of UV irradiation against the bacteria in a range of 1.5-2 fold. That fact demonstrates that the relations established between different microorganisms in the water systems can modify the effectiveness of the UV treatments applied. Copyright © 2014 Elsevier Ltd. All rights reserved.

  11. Acute kidney injury in a tropical country: a cohort study of 253 patients in an infectious diseases intensive care unit

    Directory of Open Access Journals (Sweden)

    Elizabeth De Fransceco Daher

    2014-01-01

    Full Text Available Introduction: Acute kidney injury (AKI is a frequent and potentially fatal complication in infectious diseases. The aim of this study was to investigate the clinical aspects of AKI associated with infectious diseases and the factors associated with mortality. Methods: This retrospective study was conducted in patients with AKI who were admitted to the intensive care unit (ICU of a tertiary infectious diseases hospital from January 2003 to January 2012. The major underlying diseases and clinical and laboratory findings were evaluated. Results: A total of 253 cases were included. The mean age was 46±16 years, and 72% of the patients were male. The main diseases were human immunodeficiency virus (HIV infection, HIV/acquired immunodeficiency syndrome (AIDS (30%, tuberculosis (12%, leptospirosis (11% and dengue (4%. Dialysis was performed in 70 cases (27.6%. The patients were classified as risk (4.4%, injury (63.6% or failure (32%. The time between AKI diagnosis and dialysis was 3.6±4.7 days. Oliguria was observed in 112 cases (45.7%. The Acute Physiology and Chronic Health Evaluation (APACHE II scores were higher in patients with HIV/AIDS (57±20, p-value=0.01 and dengue (68±11, p-value=0.01. Death occurred in 159 cases (62.8%. Mortality was higher in patients with HIV/AIDS (76.6%, p-value=0.02. A multivariate analysis identified the following independent risk factors for death: oliguria, metabolic acidosis, sepsis, hypovolemia, the need for vasoactive drugs, the need for mechanical ventilation and the APACHE II score. Conclusions: AKI is a common complication in infectious diseases, with high mortality. Mortality was higher in patients with HIV/AIDS, most likely due to the severity of immunosuppression and opportunistic diseases.

  12. Evidence for large-scale winds from starburst galaxies. I. The nature of the ionized gas in M82 and NGC 253

    International Nuclear Information System (INIS)

    Mccarthy, P.J.; Van breugel, W.; Heckman, T.; Maryland Univ., College Park)

    1987-01-01

    The results of long-slit spectroscopy and narrow-band imaging of M82 and NGC 253, the two nearest examples of FIR luminous galaxies believed to be undergoing intense bursts of star formation, are presented. The profile of the gas pressure in the emission-line filaments in M82 is derived and found to be in good agreement with the model of Chevalier and Clegg (1985) of a supernovae-driven wind from a starburst nucleus. Lower quality data from NGC 253 support the same interpretation. Analysis of the emission-line ratios suggests that the line-emitting gas may be heated by low-velocity shocks, although photoionization from dilute UV radiation from unusually hot stars in the central starburst may also be important. 56 references

  13. Nustar and Chandra Insight into the Nature of the 3-40 Kev Nuclear Emission in Ngc 253

    Science.gov (United States)

    Lehmer, Bret D.; Wik, Daniel R.; Hornschemeier, Ann E.; Ptak, Andrew; Antoniu, V.; Argo, M.K.; Bechtol, K.; Boggs, S.; Christensen, F.E.; Craig, W.W.; hide

    2013-01-01

    We present results from three nearly simultaneous Nuclear Spectroscopic Telescope Array (NuSTAR) and Chandra monitoring observations between 2012 September 2 and 2012 November 16 of the local star-forming galaxy NGC 253. The 3-40 kiloelectron volt intensity of the inner approximately 20 arcsec (approximately 400 parsec) nuclear region, as measured by NuSTAR, varied by a factor of approximately 2 across the three monitoring observations. The Chandra data reveal that the nuclear region contains three bright X-ray sources, including a luminous (L (sub 2-10 kiloelectron volt) approximately few × 10 (exp 39) erg per s) point source located approximately 1 arcsec from the dynamical center of the galaxy (within the sigma 3 positional uncertainty of the dynamical center); this source drives the overall variability of the nuclear region at energies greater than or approximately equal to 3 kiloelectron volts. We make use of the variability to measure the spectra of this single hard X-ray source when it was in bright states. The spectra are well described by an absorbed (power-law model spectral fit value, N(sub H), approximately equal to 1.6 x 10 (exp 23) per square centimeter) broken power-law model with spectral slopes and break energies that are typical of ultraluminous X-ray sources (ULXs), but not active galactic nuclei (AGNs). A previous Chandra observation in 2003 showed a hard X-ray point source of similar luminosity to the 2012 source that was also near the dynamical center (Phi is approximately equal to 0.4 arcsec); however, this source was offset from the 2012 source position by approximately 1 arcsec. We show that the probability of the 2003 and 2012 hard X-ray sources being unrelated is much greater than 99.99% based on the Chandra spatial localizations. Interestingly, the Chandra spectrum of the 2003 source (3-8 kiloelectron volts) is shallower in slope than that of the 2012 hard X-ray source. Its proximity to the dynamical center and harder Chandra spectrum

  14. The 253-kb inversion and deep intronic mutations in UNC13D are present in North American patients with familial hemophagocytic lymphohistiocytosis 3.

    Science.gov (United States)

    Qian, Yaping; Johnson, Judith A; Connor, Jessica A; Valencia, C Alexander; Barasa, Nathaniel; Schubert, Jeffery; Husami, Ammar; Kissell, Diane; Zhang, Ge; Weirauch, Matthew T; Filipovich, Alexandra H; Zhang, Kejian

    2014-06-01

    The mutations in UNC13D are responsible for familial hemophagocytic lymphohistiocytosis (FHL) type 3. A 253-kb inversion and two deep intronic mutations, c.118-308C > T and c.118-307G > A, in UNC13D were recently reported in European and Asian FHL3 patients. We sought to determine the prevalence of these three non-coding mutations in North American FHL patients and evaluate the significance of examining these new mutations in genetic testing. We performed DNA sequencing of UNC13D and targeted analysis of these three mutations in 1,709 North American patients with a suspected clinical diagnosis of hemophagocytic lymphohistiocytosis (HLH). The 253-kb inversion, intronic mutations c.118-308C > T and c.118-307G > A were found in 11, 15, and 4 patients, respectively, in which the genetic basis (bi-allelic mutations) explained 25 additional patients. Taken together with previously diagnosed FHL3 patients in our HLH patient registry, these three non-coding mutations were found in 31.6% (25/79) of the FHL3 patients. The 253-kb inversion, c.118-308C > T and c.118-307G > A accounted for 7.0%, 8.9%, and 1.3% of mutant alleles, respectively. Significantly, eight novel mutations in UNC13D are being reported in this study. To further evaluate the expression level of the newly reported intronic mutation c.118-307G > A, reverse transcription PCR and Western blot analysis revealed a significant reduction of both RNA and protein levels suggesting that the c.118-307G > A mutation affects transcription. These specified non-coding mutations were found in a significant number of North American patients and inclusion of them in mutation analysis will improve the molecular diagnosis of FHL3. © 2014 Wiley Periodicals, Inc.

  15. El Límite a la Protección de las Tierras Indígenas de la Ley 19.253

    Directory of Open Access Journals (Sweden)

    Mario Salamanca Huenchullán

    Full Text Available Este trabajo aborda el tema del límite a la protección de las tierras indígenas, que como una exigencia del interés nacional introduce en la legislación chilena la Ley Indígena 19.253, en su relación con la expropiación para la construcción de obras públicas, que en virtud de la utilidad pública se construyen sobre estas mismas tierras.

  16. Refinement of the critical 2p25.3 deletion region: the role of MYT1L in intellectual disability and obesity.

    Science.gov (United States)

    De Rocker, Nina; Vergult, Sarah; Koolen, David; Jacobs, Eva; Hoischen, Alexander; Zeesman, Susan; Bang, Birgitte; Béna, Frédérique; Bockaert, Nele; Bongers, Ernie M; de Ravel, Thomy; Devriendt, Koenraad; Giglio, Sabrina; Faivre, Laurence; Joss, Shelagh; Maas, Saskia; Marle, Nathalie; Novara, Francesca; Nowaczyk, Malgorzata J M; Peeters, Hilde; Polstra, Abeltje; Roelens, Filip; Rosenberg, Carla; Thevenon, Julien; Tümer, Zeynep; Vanhauwaert, Suzanne; Varvagiannis, Konstantinos; Willaert, Andy; Willemsen, Marjolein; Willems, Marjolaine; Zuffardi, Orsetta; Coucke, Paul; Speleman, Frank; Eichler, Evan E; Kleefstra, Tjitske; Menten, Björn

    2015-06-01

    Submicroscopic deletions of chromosome band 2p25.3 are associated with intellectual disability and/or central obesity. Although MYT1L is believed to be a critical gene responsible for intellectual disability, so far no unequivocal data have confirmed this hypothesis. In this study we evaluated a cohort of 22 patients (15 sporadic patients and two families) with a 2p25.3 aberration to further refine the clinical phenotype and to delineate the role of MYT1L in intellectual disability and obesity. In addition, myt1l spatiotemporal expression in zebrafish embryos was analyzed by quantitative polymerase chain reaction and whole-mount in situ hybridization. Complete MYT1L deletion, intragenic deletion, or duplication was observed in all sporadic patients, in addition to two patients with a de novo point mutation in MYT1L. The familial cases comprise a 6-Mb deletion in a father and his three children and a 5' MYT1L overlapping duplication in a father and his two children. Expression analysis in zebrafish embryos shows specific myt1l expression in the developing brain. Our data strongly strengthen the hypothesis that MYT1L is the causal gene for the observed syndromal intellectual disability. Moreover, because 17 patients present with obesity/overweight, haploinsufficiency of MYT1L might predispose to weight problems with childhood onset.Genet Med 17 6, 460-466.

  17. Measurements of the viscosity of carbon dioxide at temperatures from (253.15 to 473.15) K with pressures up to 1.2 MPa

    International Nuclear Information System (INIS)

    Schäfer, Michael; Richter, Markus; Span, Roland

    2015-01-01

    Highlights: • A new rotating-body viscometer for the low-pressure region was presented. • A viscosity dependent offset was compensated by calibrating the viscometer. • The viscosity of carbon dioxide was measured at low pressures. • Measurements were carried out from T = (253.15 to 473.15) K with p ≤ 1.2 MPa. • The relative expanded combined uncertainty (k = 2) was U r,c (η) = (0.20 to 0.41)%. - Abstract: The viscosity of carbon dioxide was measured over the temperature range T = (253.15 to 473.15) K with pressures up to 1.2 MPa utilizing a new rotating-body viscometer. The relative expanded combined uncertainty (k = 2) in viscosity (including uncertainties of temperature and pressure) was (0.20 to 0.41)%. The instrument was specifically designed for measurements at low gas densities and enables measurements of the dynamic viscosity at temperatures between T = 253.15 K and T = 473.15 K with pressures up to 2 MPa. For carbon dioxide, the fluid specific measuring range with regard to pressure was limited to 1.2 MPa due to the formation of disturbing vortices inside the measuring cell at higher pressures. The model function for the viscosity measurement was extended in such a way that the dynamic viscosity was measured relative to helium. Therefore, the influence of the geometry of the concentric cylindrical system inside the measuring cell became almost negligible. Moreover, a systematic offset resulting from a small but inevitable eccentricity of the cylindrical system was compensated for. The residual damping, usually measured in vacuum, was calibrated in the entire temperature range using viscosity values of helium, neon and argon calculated ab initio; at T = 298.15 K recommended reference values were used. A viscosity dependent offset of the measured viscosities, which was observed in previously published data, did not occur when using the calibrated residual damping. The new carbon dioxide results were compared to other experimental literature data

  18. Spatially resolving a starburst galaxy at hard X-ray energies: NuSTAR, CHANDRA, AND VLBA observations of NGC 253

    DEFF Research Database (Denmark)

    Wik, D. R.; Lehmer, B. D.; Hornschemeier, A. E.

    2014-01-01

    for the first time. As a follow up to our initial study of its nuclear region, we present the first results concerning the full galaxy from simultaneous NuSTAR, Chandra, and Very Long Baseline Array monitoring of the local starburst galaxy NGC 253. Above ~10 keV, nearly all the emission is concentrated within...... is detected at E > 40 keV. We report upper limits on diffuse inverse Compton emission for a range of spatial models. For the most extended morphologies considered, these hard X-ray constraints disfavor a dominant inverse Compton component to explain the γ-ray emission detected with Fermi and H.E.S.S. If NGC...

  19. DETECTION OF GAMMA-RAY EMISSION FROM THE STARBURST GALAXIES M82 AND NGC 253 WITH THE LARGE AREA TELESCOPE ON FERMI

    International Nuclear Information System (INIS)

    Abdo, A. A.; Ackermann, M.; Ajello, M.; Bechtol, K.; Berenji, B.; Bloom, E. D.; Borgland, A. W.; Atwood, W. B.; Axelsson, M.; Baldini, L.; Bellazzini, R.; Bregeon, J.; Brez, A.; Ballet, J.; Barbiellini, G.; Bastieri, D.; Bonamente, E.; Brigida, M.; Bruel, P.; Burnett, T. H.

    2010-01-01

    We report the detection of high-energy γ-ray emission from two starburst galaxies using data obtained with the Large Area Telescope on board the Fermi Gamma-ray Space Telescope. Steady point-like emission above 200 MeV has been detected at significance levels of 6.8σ and 4.8σ, respectively, from sources positionally coincident with locations of the starburst galaxies M82 and NGC 253. The total fluxes of the sources are consistent with γ-ray emission originating from the interaction of cosmic rays with local interstellar gas and radiation fields and constitute evidence for a link between massive star formation and γ-ray emission in star-forming galaxies.

  20. Co-regulation analysis of closely linked genes identifies a highly recurrent gain on chromosome 17q25.3 in prostate cancer

    International Nuclear Information System (INIS)

    Bermudo, Raquel; Martínez-A, Carlos; Ortiz, Ángel R; Fernández, Pedro L; Thomson, Timothy M; Abia, David; Ferrer, Berta; Nayach, Iracema; Benguria, Alberto; Zaballos, Ángel; Rey, Javier del; Miró, Rosa; Campo, Elías

    2008-01-01

    Transcriptional profiling of prostate cancer (PC) has unveiled new markers of neoplasia and allowed insights into mechanisms underlying this disease. Genomewide analyses have also identified new chromosomal abnormalities associated with PC. The combination of both classes of data for the same sample cohort might provide better criteria for identifying relevant factors involved in neoplasia. Here we describe transcriptional signatures identifying distinct normal and tumoral prostate tissue compartments, and the inference and demonstration of a new, highly recurrent copy number gain on chromosome 17q25.3. We have applied transcriptional profiling to tumoral and non-tumoral prostate samples with relatively homogeneous epithelial representations as well as pure stromal tissue from peripheral prostate and cultured cell lines, followed by quantitative RT-PCR validations and immunohistochemical analysis. In addition, we have performed in silico colocalization analysis of co-regulated genes and validation by fluorescent in situ hybridization (FISH). The transcriptomic analysis has allowed us to identify signatures corresponding to non-tumoral luminal and tumoral epithelium, basal epithelial cells, and prostate stromal tissue. In addition, in silico analysis of co-regulated expression of physically linked genes has allowed us to predict the occurrence of a copy number gain at chromosomal region 17q25.3. This computational inference was validated by fluorescent in situ hybridization, which showed gains in this region in over 65% of primary and metastatic tumoral samples. Our approach permits to directly link gene copy number variations with transcript co-regulation in association with neoplastic states. Therefore, transcriptomic studies of carefully selected samples can unveil new diagnostic markers and transcriptional signatures highly specific of PC, and lead to the discovery of novel genomic abnormalities that may provide additional insights into the causes and mechanisms

  1. Novel metal-organic and supramolecular 3D frameworks constructed from flexible biphenyl-2,5,3‧-tricarboxylate blocks: Synthesis, structural features and properties

    Science.gov (United States)

    You, Ao; Li, Yu; Zhang, Ze-Min; Zou, Xun-Zhong; Gu, Jin-Zhong; Kirillov, Alexander M.; Chen, Jin-Wei; Chen, Yun-Bo

    2017-10-01

    Biphenyl-2,5,3‧-tricarboxylic acid (H3L) was selected as an unexplored tricarboxylate building block and applied for the hydrothermal synthesis of three novel coordination compounds, namely a 0D tetramer [Co4(HL)2(μ3-HL)2(phen)6(H2O)2]·3H2O (1) and two 3D metal-organic frameworks (MOFs) [Cd3(μ5-L)(μ6-L)(py)(μ-H2O)2(H2O)]n·H2O (2) and [Zn3(μ4-L)2(2,2‧-bpy)(μ-4,4‧-bpy)]n·2H2O (3). These products were easily generated in aqueous medium from the corresponding metal(II) chlorides, H3L, and various N-donor ancillary ligands, selected from 1,10-phenanthroline (phen), pyridine (py), 2,2‧-bipyridine (2,2‧-bpy), and 4,4‧-bipyridine (4,4‧-bpy). Compounds 1-3 were isolated as stable crystalline solids and were fully characterized by IR and UV-vis spectroscopy, elemental, thermogravimetric (TGA), powder (PXRD) and single-crystal X-ray diffraction analyses. Compound 1 possesses a discrete tetracobalt(II) structure, which is extended into a 3D H-bonded network with the pcu topology. In contrast, MOF 2 discloses a very complex trinodal 4,5,12-connected net with an undocumented topology, while MOF 3 features the nce/I topological framework. The magnetic (for 1) and luminescence (for 2 and 3) properties were also studied and discussed. The present study thus widens a still very limited family of metal-organic and supramolecular frameworks driven by flexible biphenyl-2,5,3‧-tricarboxylate building blocks.

  2. Remarkably High Stability of Late Actinide Dioxide Cations: Extending Chemistry to Pentavalent Berkelium and Californium.

    Science.gov (United States)

    Dau, Phuong D; Vasiliu, Monica; Peterson, Kirk A; Dixon, David A; Gibson, John K

    2017-12-06

    Actinyl chemistry is extended beyond Cm to BkO 2 + and CfO 2 + through transfer of an O atom from NO 2 to BkO + or CfO + , establishing a surprisingly high lower limit of 73 kcal mol -1 for the dissociation energies, D[O-(BkO + )] and D[O-(CfO + )]. CCSD(T) computations are in accord with the observed reactions, and characterize the newly observed dioxide ions as linear pentavalent actinyls; these being the first Bk and Cf species with oxidation states above IV. Computations of actinide dioxide cations AnO 2 + for An=Pa to Lr reveal an unexpected minimum for D[O-(CmO + )]. For CmO 2 + , and AnO 2 + beyond EsO 2 + , the most stable structure has side-on bonded η 2 -(O 2 ), as An III peroxides for An=Cm and Lr, and as An II superoxides for An=Fm, Md, and No. It is predicted that the most stable structure of EsO 2 + is linear [O=Es V =O] + , einsteinyl, and that FmO 2 + and MdO 2 + , like CmO 2 + , also have actinyl(V) structures as local energy minima. The results expand actinide oxidation state chemistry, the realm of the distinctive actinyl moiety, and the non-periodic character towards the end of the periodic table. © 2017 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

  3. Total neutron cross sections of berkelium-249 and californium-249 below 100 eV

    International Nuclear Information System (INIS)

    Benjamin, R.W.; Harvey, J.A.; Hill, N.W.; Pandey, M.S.; Carlton, R.F.

    1979-01-01

    The neutron total cross sections of 249 Bk and 249 Cf have been measured from 0.03 to 100 eV using the Oak Ridge Electron Linear Accelerator (ORELA) as a source of pulsed neutrons. The 1.6 mm dia. cylindrical transmission samples contained initially up to 5.3 mg of 98% 249 Bk and 2% 249 Cf: 4.5 years later, when the final measurements were made, the composition of the samples had become 2.5% 249 Bk, 96.9% 249 Cf, and 0.6% 245 Cm. Samples were cooled with liquid nitrogen to reduce Doppler broadening. Thirty-nine resonances were identified in 249 Bk and analyzed using a single-level Breit-Wigner formalism. Fifty-five resonances were identified in 249 Cf and analyzed using an R-matrix multilevel formalism. Fifty-five resonances were identified in 249 Cf and analyzed using an R-matrix multilevel formalism. The resonance parameters obtained have been used to determine the average level spacings and the s-wave neutron and fission strength functions. Where possible, bound-level parameters were derived to fit the thermal neutron total cross section data

  4. Comment on "Applications of homogenous balanced principle on investigating exact solutions to a series of time fractional nonlinear PDEs", [Commun Nonlinear Sci Numer Simulat 47 (2017) 253-266

    Science.gov (United States)

    Li, Xiangzheng

    2018-06-01

    A counterexample is given to show that the product rule of the Caputo fractional derivatives does not hold except on a special point. The function-expansion method of separation variable proposed by Rui[Commun Nonlinear Sci Numer Simulat 47 (2017) 253-266] based on the product rule must be modified.

  5. Luminescent properties of Sr{sub 2.5-3x/2}Ba{sub 0.5}Sm{sub x}AlO{sub 4}F oxyfluorides

    Energy Technology Data Exchange (ETDEWEB)

    Park, Sangmoon, E-mail: spark@silla.ac.kr [Department of Engineering in Energy and Applied Chemistry, Silla University, Busan 617-736 (Korea, Republic of)

    2012-04-15

    Effective orange Sm{sup 3+}-doped Sr{sub 2.5}Ba{sub 0.5}AlO{sub 4}F phosphors excited at 254 and 408 nm excitation were prepared by the solid-state method. The excitation and emission spectra of Sr{sub 2.5-3x/2}Ba{sub 0.5}Sm{sub x}AlO{sub 4}F and Sr{sub 2.5-3x/2}Ba{sub 0.5}Sm{sub x}AlO{sub 4-{alpha}}F{sub 1-{delta}} (x=0.001{approx}0.1) based on photoluminescence spectroscopy are investigated. The defects in anion-deficient Sr{sub 2.5-3x/2}Ba{sub 0.5}Sm{sub x}AlO{sub 4-{alpha}}F{sub 1-{delta}} (x=0.001, 0.01) are monitored by broad-band photoluminescence emission centered near 480 nm along with the orange emission transitions of Sm{sup 3+}. CIE values and relative luminescent intensities of Sr{sub 2.5-3x/2}Ba{sub 0.5}Sm{sub x}AlO{sub 4}F and Sr{sub 2.5-3x/2}Ba{sub 0.5}Sm{sub x}AlO{sub 4-{alpha}}F{sub 1-{delta}} by changing the Sm{sup 3+} content (x=0.001{approx}0.1) are discussed. - Highlights: Black-Right-Pointing-Pointer Under the excitation of 408 nm competent orange emitting Sr{sub 2.5-3x/2}Ba{sub 0.5}Sm{sub x}AlO{sub 4}F phosphor is initiated. Black-Right-Pointing-Pointer Sm{sup 3+}-activated oxyfluoride phosphor is quite effective to prepare white-emitting light for near-UV LED applications. Black-Right-Pointing-Pointer Defects could be visibly created in the Sr{sub 2.5-3x/2}Ba{sub 0.5}Sm{sub x}Al O{sub 4}F host lattices when Sm{sup 3+} ions are doped less than 5 mol %. Black-Right-Pointing-Pointer The gradual substitution of Sm{sup 3+} contents in oxyfluoride hosts is amenable to change CIE values and desired emitting intensity.

  6. Biomass-burning during Holika at Varanasi (25.3 N, 83.0 E): Optical observations and Aerosol Radiative Forcing

    Science.gov (United States)

    Singh, A. K.; Singh, R. K.; Srivastava, M. K.; Mehrotra, B. J.; Murari, V.; Sharma, S. K., , Dr; Mandal, T. K., , Dr; Singh, R. S.; Banerjee, T.; Tiwari, S.

    2017-12-01

    All the anthropogenic activity, including various festivals, affect the environment. Impact of fireworks done during various festival are well documented in literature. In India, the festival of colors, Holi, is celebrated during spring season. During this festival, wood-log and other natural biomass are burned on the eve of the festival (Holika). Although the festival falls during a season with clear sky, that possibly can allow the pollutants to mix in the free troposphere, but observations made during Holika-2016 showed 2-3-times soot (or Black Carbon, BC) enhancement in nighttimes due to Holika, than the background levels. This observations motivated us to better understand the optical impact of Holika-2017. For this purpose, we planned first-time intensive-observation during Holika-2017 (March 13, 2017). Estimated 450 thousands kgs of wood and biomass is burnt during Holika-2017 in 2250 (± 5%) units of Holika at around 10 pm local time of March 12th, in the vicinity of Varanasi city (25.3N, 83.0E). Intensive observations are being done from 5th to 18th March, 2017. Extensive optical analyses have been done to understand the aerosol radiative impact of Holika burning on environment. The observed AOD was 0.336, 0.392 and 0.47 and daily average BC mass was 7137, 9942 and 8950 ng/m3 for Pre-Holika, Holika and Post-Holika. Top of the atmosphere, at the surface and in atmosphere are 2.53, -40.48 and 43.00 W/m2 for Pre-Holika, 6.45, -53.75 and 60.21 W/m2 for Holika and 8.91, -65.75 and 74.66 W/m2 for Post-Holika burning. Highest BC mass was observed around 0200 hrs on 13th March, just after few hours of Holika-2017. Preliminary results are shown in figure, depicting surface/ top-of-atmosphere/ atmospheric radiative forcing along with changes in heating rates from pre-holika to holika and post-holika days. Heating rates have enhanced 2-times for post-Holika than the background levels.

  7. Intellectual disability, muscle weakness and characteristic face in three siblings: A newly described recessive syndrome mapping to 3p24.3-p25.3.

    Science.gov (United States)

    Kariminejad, Ariana; Nafissi, Shahriar; Nilipoor, Yalda; Tavasoli, Alireza; Van Veldhoven, Paul P; Bonnard, Carine; Ng, Yeng Ting; Majoie, Charles B; Reversade, Bruno; Hennekam, Raoul C

    2015-11-01

    We report on a sister and two brothers born to healthy Iranian parents with mild intellectual disability, progressive muscle weakness, and characteristic facies. including highly arched eyebrows, down-slanting palpebral fissures, prominent nasal bridge, prominent nose, columella extending below alae nasi, narrow mouth, narrow palate, and dental caries, and in one of them an inability to abduct the left eye. Electrophysiological studies showed signs of myopathy, and muscle biopsies demonstrated only nonspecific signs. Brain MRIs in two of the sibs showed leukencephalopathy with delayed myelination, frontal and parietal hyperintensities, and hippocampal atrophy in one. We have been unable to find a description of this association of features in literature. Based on the occurrence in siblings, no significant difference in phenotype between the brothers and sister, absence of manifestations in parents, and a likely consanguinity between parents we performed a homozygosity mapping. A single identical-by-descent bloc encompassing 57 genes located at 3p24.3-p25.3 was found to segregate within the family with this phenotype. © 2015 Wiley Periodicals, Inc. © 2015 Wiley Periodicals, Inc.

  8. p.Ser252Trp and p.Pro253Arg mutations in FGFR2 gene causing Apert syndrome: the first clinical and molecular report of Indonesian patients.

    Science.gov (United States)

    Mundhofir, Farmaditya E P; Sistermans, Erik A; Faradz, Sultana M H; Hamel, Ben C J

    2013-03-01

    Apert syndrome (AS) is a rare autosomal dominant disorder characterised by craniosynostosis and limb malformations, and is associated with congenital heart disease and other systemic malformations, including intellectual disability. We report two Indonesian patients with AS, in whom molecular analysis detected p.Ser252Trp (c.755C>G) and p.Pro253Arg (c.758C>G) mutations in the fibroblast growth factor receptor 2 (FGFR2) gene, respectively. Although the syndrome has been frequently described, this is the first clinical report of AS confirmed by molecular analysis in Indonesia. The difference in severity of clinical features in the two patients may be consistent with a genotype-phenotype correlation of the FGFR2mutation. The management of individuals with AS is best achieved within a multidisciplinary setting. However, in most developing countries, early intervention may be delayed due to late diagnosis, a lack of facilities and financial constraints. This report underpins the benefits of early diagnosis for AS management.

  9. Erratum to "Solar Sources and Geospace Consequences of Interplanetary Magnetic Clouds Observed During Solar Cycle 23-Paper 1" [J. Atmos. Sol.-Terr. Phys. 70(2-4) (2008) 245-253

    Science.gov (United States)

    Gopalswamy, N.; Akiyama, S.; Yashiro, S.; Michalek, G.; Lepping, R. P.

    2009-01-01

    One of the figures (Fig. 4) in "Solar sources and geospace consequences of interplanetary magnetic Clouds observed during solar cycle 23 -- Paper 1" by Gopalswamy et al. (2008, JASTP, Vol. 70, Issues 2-4, February 2008, pp. 245-253) is incorrect because of a software error in t he routine that was used to make the plot. The source positions of various magnetic cloud (MC) types are therefore not plotted correctly.

  10. Kinetics of the gas-phase reactions of chlorine atoms with CH2F2, CH3CCl3 and CF3CFH2 over the temperature range 253 – 551 K

    DEFF Research Database (Denmark)

    Nilsson, Elna Johanna Kristina; Johnson, Matthew Stanley; Nielsen, Ole John

    2009-01-01

    Relative rate techniques were used to study the title reactions in 930–1200 mbar of N2 diluent. The reaction rate coefficients measured in the present work are summarized by the expressions k(Cl+CH2F2) = 1.19×10-17 T 2 exp(-1023/T ) cm3 molecule-1 s-1 (253– 553 K), k(Cl+CH3CCl3) = 2.41×10-12 exp(...

  11. Deformed Skull Morphology Is Caused by the Combined Effects of the Maldevelopment of Calvarias, Cranial Base and Brain in FGFR2-P253R Mice Mimicking Human Apert Syndrome.

    Science.gov (United States)

    Luo, Fengtao; Xie, Yangli; Xu, Wei; Huang, Junlan; Zhou, Siru; Wang, Zuqiang; Luo, Xiaoqing; Liu, Mi; Chen, Lin; Du, Xiaolan

    2017-01-01

    Apert syndrome (AS) is a common genetic syndrome in humans characterized with craniosynostosis. Apert patients and mouse models showed abnormalities in sutures, cranial base and brain, that may all be involved in the pathogenesis of skull malformation of Apert syndrome. To distinguish the differential roles of these components of head in the pathogenesis of the abnormal skull morphology of AS, we generated mouse strains specifically expressing mutant FGFR2 in chondrocytes, osteoblasts, and progenitor cells of central nervous system (CNS) by crossing Fgfr2 +/P253R-Neo mice with Col2a1-Cre, Osteocalcin-Cre (OC-Cre), and Nestin-Cre mice, respectively. We then quantitatively analyzed the skull and brain morphology of these mutant mice by micro-CT and micro-MRI using Euclidean distance matrix analysis (EDMA). Skulls of Col2a1-Fgfr2 +/P253R mice showed Apert syndrome-like dysmorphology, such as shortened skull dimensions along the rostrocaudal axis, shortened nasal bone, and evidently advanced ossification of cranial base synchondroses. The OC-Fgfr2 +/P253R mice showed malformation in face at 8-week stage. Nestin-Fgfr2 +/P253R mice exhibited increased dorsoventral height and rostrocaudal length on the caudal skull and brain at 8 weeks. Our study indicates that the abnormal skull morphology of AS is caused by the combined effects of the maldevelopment in calvarias, cranial base, and brain tissue. These findings further deepen our knowledge about the pathogenesis of the abnormal skull morphology of AS, and provide new clues for the further analyses of skull phenotypes and clinical management of AS.

  12. Evaluation of thermal neutron cross-sections and resonance integrals of protactinium, americium, curium, and berkelium isotopes

    International Nuclear Information System (INIS)

    Belanova, T.S.

    1994-12-01

    Data on the thermal neutron fission and capture cross-sections as well as their corresponding resonance integrals are reviewed and analysed. The data are classified according to the form of neutron spectra under investigation. The weighted mean values of the cross-sections and resonance integrals for every type of neutron spectra were adopted as evaluated data. (author). 87 refs, 2 tabs

  13. Correction to: Valuch, Tibor. “Following the Life Stories of Participants in the 1956 Hungarian Revolution.” Hungarian Cultural Studies. e-Journal of the American Hungarian Educators Association, Volume 9 (2016 DOI: 10.5195/ahea.2016.253

    Directory of Open Access Journals (Sweden)

    Tibor Valuch

    2017-09-01

    Full Text Available The dates next to the names of two interviewees, Imre Lázár and Zoltán Mervó, were shown incorrectly. The original article can be found via the DOI: http://dox.doi.org/10.5195/ahea.2016.253

  14. Comparison of fluoroscopy-guided pull-type percutaneous radiological gastrostomy (pull-type-PRG) with conventional percutaneous radiological gastrostomy (push-type-PRG): clinical results in 253 patients

    Energy Technology Data Exchange (ETDEWEB)

    Yang, Yang; Schneider, J.; Dueber, C.; Pitton, M.B. [University Medical Center of the Johannes Gutenberg University Mainz, Department of Diagnostic and Interventional Radiology, Mainz (Germany)

    2011-11-15

    To analyze the clinical results and complications of fluoroscopy guided internal-external pull-type percutaneous radiological gastrostomy (pull-type-PRG) and conventional external-internal percutaneous radiological gastrostomy (push-type-PRG). A total of 253 patients underwent radiological gastrostomy between January 2002 and January 2010. Data were collected retrospectively from radiology reports, Chart review of clinical notes, procedure reports, discharge summaries and subsequent hospital visits. Statistical analysis was performed to compare the two methods for gastrostomy with respect to peri-interventional aspects and clinical results. 128 patients received the Pull-type-PRG whereas the other 125 patients were served with the Push-type-PRG. Indications for gastrostomy were similar in these two groups. The most frequent indications for the both methods were stenotic oesophageal tumors or head/neck tumors (54.7% in pull-type-PRG, 68% in push-type-PRG). Gastrostomy procedures were successful in 98.3% in pull-type-PRG compared to 92% in push-type-PRG. There was no procedure-related mortality. Compared to Push-type-PRG, the peri-interventional complication rate was significantly reduced in pull-type-PRG (14.8% versus 34.4%, P = 0.002). Compared to the external-internal push-type-PRG, the internal-external Pull-type-PRG showed a high primary success rate and a decreased incidence of peri-interventional complications. (orig.)

  15. Comparison of fluoroscopy-guided pull-type percutaneous radiological gastrostomy (pull-type-PRG) with conventional percutaneous radiological gastrostomy (push-type-PRG): clinical results in 253 patients

    International Nuclear Information System (INIS)

    Yang, Yang; Schneider, J.; Dueber, C.; Pitton, M.B.

    2011-01-01

    To analyze the clinical results and complications of fluoroscopy guided internal-external pull-type percutaneous radiological gastrostomy (pull-type-PRG) and conventional external-internal percutaneous radiological gastrostomy (push-type-PRG). A total of 253 patients underwent radiological gastrostomy between January 2002 and January 2010. Data were collected retrospectively from radiology reports, Chart review of clinical notes, procedure reports, discharge summaries and subsequent hospital visits. Statistical analysis was performed to compare the two methods for gastrostomy with respect to peri-interventional aspects and clinical results. 128 patients received the Pull-type-PRG whereas the other 125 patients were served with the Push-type-PRG. Indications for gastrostomy were similar in these two groups. The most frequent indications for the both methods were stenotic oesophageal tumors or head/neck tumors (54.7% in pull-type-PRG, 68% in push-type-PRG). Gastrostomy procedures were successful in 98.3% in pull-type-PRG compared to 92% in push-type-PRG. There was no procedure-related mortality. Compared to Push-type-PRG, the peri-interventional complication rate was significantly reduced in pull-type-PRG (14.8% versus 34.4%, P = 0.002). Compared to the external-internal push-type-PRG, the internal-external Pull-type-PRG showed a high primary success rate and a decreased incidence of peri-interventional complications. (orig.)

  16. 50 CFR 253.15 - Miscellaneous.

    Science.gov (United States)

    2010-10-01

    ... due diligence investigation of every application it accepts and determine if, in the Division's sole... guarantee life. These must be conducted by competent and impartial inspectors acceptable to the Division...

  17. 7 CFR 1924.253 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... structural defect. (d) Structural defect. A defect in the dwelling or unit, installation or set-up of a unit... of the dwelling or unit or site such as faulty wiring, or failure of sewage disposal or water supply systems located on the property securing the loan caused by faulty materials or improper installation. (3...

  18. 50 CFR 253.11 - Guarantee policy.

    Science.gov (United States)

    2010-10-01

    ... inconsistent with wise use, but financing it may be. (2) Vessel refurbishing that materially increases an... financed (or otherwise paid). Refinancing this project cost is not inconsistent with wise use, but financing it may be. (3) Purchasing a used vessel or used fishery facility. The Program will neither finance...

  19. 33 CFR 117.253 - Anacostia River.

    Science.gov (United States)

    2010-07-01

    ... for public vessels of the United States, state and local government vessels, commercial vessels and... sensors, laser scanners, video cameras or marine-radio communications, In these situations, a bridge... condition two board gauges painted white with black figures not less than six inches high to indicate the...

  20. Publications | Page 253 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    ... been towards focalization, subsidies on demand, decentralization and privatization. ... Each year, Moroccans use nearly 70% of their annual recoverable water supply ... Adapting fishing policies to address climate change in West Africa.

  1. 40 CFR 265.253 - Containment.

    Science.gov (United States)

    2010-07-01

    ... maintain a run-off management system to collect and control at least the water volume resulting from a 24...: If collected leachate or run-off is discharged through a point source to waters of the United States, it is subject to the requirements of section 402 of the Clean Water Act, as amended.] [45 FR 33232...

  2. 7 CFR 25.3 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... participation and commitment of local governments, tribal governments, state governments, private sector... same as or different from the lead managing entity. Baseline condition means a measurable condition or... Appropriations Act, 1999 (Public Law 105-277). Round III identifies designations of empowerment zones pursuant to...

  3. 50 CFR 253.20 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... work or investigative study, designed to acquire knowledge of fisheries resources and their habitat... the apportionment formula, which is equal to the price paid at the first point of landing. Volume...

  4. 17 CFR 230.253 - Offering circular.

    Science.gov (United States)

    2010-04-01

    .... Repetition of information should be avoided; cross-referencing of information within the document is... COMPLETENESS OF ANY OFFERING CIRCULAR OR OTHER SELLING LITERATURE. THESE SECURITIES ARE OFFERED PURSUANT TO AN...

  5. 50 CFR 253.10 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... less overutilized species than before; applying new technology; improving safety or fuel efficiency..., growth, productivity, or any other business attribute. Demand means a noteholder's request that the.... Wise use means the wise use of fisheries resources and their development, advancement, management...

  6. 14 CFR 93.253 - Nonstop operations.

    Science.gov (United States)

    2010-01-01

    ... AND GENERAL OPERATING RULES SPECIAL AIR TRAFFIC RULES Ronald Reagan Washington National Airport... between Ronald Reagan Washington National Airport and another airport that is more than 1,250 miles away from Ronald Reagan Washington National Airport. ...

  7. 256 253 Profitability Analysis of Groundnut

    African Journals Online (AJOL)

    2008-12-02

    Dec 2, 2008 ... Metropolitan Council of Borno State, Nigeria. * A. Iliyasu, I. ... processing and determine the return on investment in groundnut processing in the study area. Structured ... It was recommended that large scale groundnut production should be encouraged .... increasing rate, increases at decreasing rate and.

  8. 7 CFR 1901.253 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... Regulations of the Department of Agriculture (Continued) RURAL HOUSING SERVICE, RURAL BUSINESS-COOPERATIVE..., sites, buildings, structures, and objects, significant in American history, architecture, archeology... significance in American History, Architecture, Archeology, and the culture is present in districts, sites...

  9. 42 CFR 447.253 - Other requirements.

    Science.gov (United States)

    2010-10-01

    ... intermediate care services) under conditions similar to those described in section 1861(v)(1)(G) of the Act... agency determines appropriate, of payment rates. (f) Uniform cost reporting. The Medicaid agency must... Medicaid agency must provide for periodic audits of the financial and statistical records of participating...

  10. A conservative assessment of the major genetic causes of idiopathic chronic pancreatitis: data from a comprehensive analysis of PRSS1, SPINK1, CTRC and CFTR genes in 253 young French patients.

    Directory of Open Access Journals (Sweden)

    Emmanuelle Masson

    Full Text Available Idiopathic chronic pancreatitis (ICP has traditionally been defined as chronic pancreatitis in the absence of any obvious precipitating factors (e.g. alcohol abuse and family history of the disease. Studies over the past 15 years have revealed that ICP has a highly complex genetic architecture involving multiple gene loci. Here, we have attempted to provide a conservative assessment of the major genetic causes of ICP in a sample of 253 young French ICP patients. For the first time, conventional types of mutation (comprising coding sequence variants and variants at intron/exon boundaries and gross genomic rearrangements were screened for in all four major pancreatitis genes, PRSS1, SPINK1, CTRC and CFTR. For the purposes of the study, synonymous, intronic and 5'- or 3'-untranslated region variants were excluded from the analysis except where there was persuasive evidence of functional consequences. The remaining sequence variants/genotypes were classified into causative, contributory or neutral categories by consideration of (i their allele frequencies in patient and normal control populations, (ii their presumed or experimentally confirmed functional effects, (iii the relative importance of their associated genes in the pathogenesis of chronic pancreatitis and (iv gene-gene interactions wherever applicable. Adoption of this strategy allowed us to assess the pathogenic relevance of specific variants/genotypes to their respective carriers to an unprecedented degree. The genetic cause of ICP could be assigned in 23.7% of individuals in the study group. A strong genetic susceptibility factor was also present in an additional 24.5% of cases. Taken together, up to 48.2% of the studied ICP patients were found to display evidence of a genetic basis for their pancreatitis. Whereas these particular proportions may not be extrapolable to all ICP patients, the approach employed should serve as a useful framework for acquiring a better understanding of the

  11. A molecular line survey toward the nearby galaxies NGC 1068, NGC 253, and IC 342 at 3 mm with the Nobeyama 45 m radio telescope: Impact of an AGN on 1 kpc scale molecular abundances

    Science.gov (United States)

    Nakajima, Taku; Takano, Shuro; Kohno, Kotaro; Harada, Nanase; Herbst, Eric

    2018-01-01

    It is important to investigate the relationships between the power sources and the chemical compositions of galaxies in order to understand the scenario of galaxy evolution. We carried out an unbiased molecular line survey towards active galactic nucleus (AGN) host galaxy NGC1068, and prototypical starburst galaxies, NGC 253 and IC 342, with the Nobeyama 45 m telescope in the 3 mm band. The advantage of this line survey is that the obtained spectra have the highest angular resolution ever obtained with single-dish telescopes. In particular, the beam size of this telescope is ˜15″-19″, which is able to separate spatially the nuclear molecular emission from that of the starburst ring (d ˜ 30″) in NGC 1068. We successfully detected approximately 23 molecular species in each galaxy, and calculated rotation temperatures and column densities. We estimate the molecular fractional abundances with respect to 13CO and CS molecules and compare them among three galaxies in order to investigate the chemical signatures of an AGN environment. As a result, we found clear trends in the abundances of molecules surrounding the AGN on a 1-kpc scale. HCN, H13CN, CN, 13CN, and HC3N are more abundant, and CH3CCH is deficient in NGC 1068 compared with the starburst galaxies. High abundances of HCN, H13CN, and HC3N suggest that the circumnuclear disk in NGC 1068 is in a high-temperature environment. The reason for the non-detection of CH3CCH is likely to be dissociation by high-energy radiation or less sublimation of a precursor of CH3CCH from grains.

  12. Reactor production of 252Cf and transcurium isotopes

    International Nuclear Information System (INIS)

    Alexander, C.W.; Halperin, J.; Walker, R.L.; Bigelow, J.E.

    1990-01-01

    Berkelium, californium, einsteinium, and fermium are currently produced in the High Flux Isotope Reactor (HFIR) and recovered in the Radiochemical Engineering Development Center (REDC) at the Oak Ridge National Laboratory (ORNL). All the isotopes are used for research. In addition, 252 Cf, 253 Es, and 255 Fm have been considered or are used for industrial or medical applications. ORNL is the sole producer of these transcurium isotopes in the western world. A wide range of actinide samples were irradiated in special test assemblies at the Fast Flux Test Facility (FFTF) at Hanford, Washington. The purpose of the experiments was to evaluate the usefulness of the two-group flux model for transmutations in the special assemblies with an eventual goal of determining the feasibility of producing macro amounts of transcurium isotopes in the FFTF. Preliminary results from the production of 254g Es from 252 Cf will be discussed. 14 refs., 5 tabs

  13. Speed of sound in saturated aliphatic alcohols (propan-2-ol, butan-2-ol, and 2-methylpropan-1-ol) and alkanediols (ethane-1,2-diol, propane-1,2- and -1,3-diol) at temperature between 253.15 K and 353.15 K and pressures up to 30 MPa

    International Nuclear Information System (INIS)

    Dávila, María J.; Gedanitz, Holger; Span, Roland

    2016-01-01

    Highlights: • Speed of sound measurements were made in aliphatic alcohols and alkanediols. • Speeds of sound were measured in a wide temperature and pressure range. • A pulse-echo method with a double path type sensor operating at 8 MHz was employed. • A double polynomial equation was used to fit the experimental speed of sound data. • The accurate results were compared with available literature sources. - Abstract: Speeds of sound have been measured in three saturated aliphatic alcohols (propan-2-ol, butan-2-ol, and 2-methylpropan-1-ol) and three alkanediols (ethane-1,2-diol, propane-1,2- and -1,3-diol) in the temperature range from (253.15 to 353.15) K and pressures up to 30 MPa by use of a pulse-echo method with a double path type sensor operating at 8 MHz. The expanded overall uncertainties (k = 2) in the speed of sound measurements are estimated to be 0.013% for propan-2-ol, 0.019% for butan-2-ol, 0.01% for 2-methylpropan-1-ol, 0.009% for ethane-1,2-diol, 0.02% for propane-1,2-diol, and 0.07% for propane-1,3-diol. Experimental speeds of sound data were correlated with the temperature and pressure with an empirical double polynomial equation. Our results were also compared with the available literature data and a satisfactory agreement was found.

  14. 24 CFR 960.253 - Choice of rent.

    Science.gov (United States)

    2010-04-01

    ... section. Except for financial hardship cases as provided in paragraph (d) of this section, the family may... on the market rent charged for comparable units in the private unassisted rental market. It is equal... determine the flat rent, the PHA must consider: (i) The location, quality, size, unit type and age of the...

  15. 253 Education and the Paradox of Graduate Unemployment: The ...

    African Journals Online (AJOL)

    FIRST LADY

    2011-01-18

    Jan 18, 2011 ... basically four major types of unemployment; the cyclical, seasonal, frictional and structural. Cyclical unemployment is the type of joblessness that occurs as a result of lower rates of production, during recessions in business cycles resulting in massive layoffs of workers. Seasonal unemployment results from.

  16. 7 CFR 765.253 - Ceasing to operate security.

    Science.gov (United States)

    2010-01-01

    ... AGRICULTURE SPECIAL PROGRAMS DIRECT LOAN SERVICING-REGULAR Required Use and Operation of Agency Security § 765... reside in the immediate farming community for reasonable management and operation involvement; (2) The... reside in the immediate farming community for reasonable management and operation involvement; or (3) The...

  17. 7 CFR 253.7 - Certification of households.

    Science.gov (United States)

    2010-01-01

    ... savings accounts, savings certificates, stocks, or bonds, or other readily negotiable instruments exceeds... duration of the disqualification (that is, 12 months; 24 months; or permanent). The State agency must also... agency conference. (Approved by the Office of Management and Budget under control number 0584-0071) (44 U...

  18. H:\\PMKER 25(3)\\TRAORE K..xps

    African Journals Online (AJOL)

    AISA

    Laboratoire de Phytopathologie de la Faculté d'Agronomie de l'Université de Parakou (Bénin) pour confirmer ou non la présence des trois virus responsables de maladies chez les Solanaceae à savoir le CMV, le PVMV et le PVYN. Des tampons ont été préparés conformément aux directives de Clarck et al. (1977), il s'agit.

  19. 253 Education and the Paradox of Graduate Unemployment: The ...

    African Journals Online (AJOL)

    FIRST LADY

    2011-01-18

    Jan 18, 2011 ... The paper is an assessment of education, graduate unemployment and the ... acknowledged as a legitimized vehicle for self and societal advancement. The ... curriculum and pedagogical reforms, upgrading existing facilities to match ... It is against this background that the paper examines the issue of.

  20. 37 CFR 253.7 - Recording rights, rates and terms.

    Science.gov (United States)

    2010-07-01

    ...-distributed program, the royalty fees shall be calculated by multiplying the following per-composition rates... royalty fee shall be calculated by multiplying the following per-composition rates by the number of... royalty fees shall be calculated by multiplying the following per-composition rates by the number of...

  1. Dicty_cDB: CFG253 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Value N AF305060 |AF305060.1 Dictyostelium discoideum Wiscott-Aldrich syndrome protein (wasA) gene, complete...ences producing significant alignments: (bits) Value AF305060_1( AF305060 |pid:none) Dictyostelium discoideum Wiscott

  2. 40 CFR 98.253 - Calculating GHG emissions.

    Science.gov (United States)

    2010-07-01

    ... (metric tons/year). NCD = Number of atmospheric crude oil distillation columns at the facility. NPU1... = Methane emission rate from blowdown systems (mt CH4/year). QRef = Quantity of crude oil plus the quantity...) For storage tanks other than those processing unstabilized crude oil, you must either calculate CH4...

  3. 19 CFR 10.253 - Articles eligible for preferential treatment.

    Science.gov (United States)

    2010-04-01

    ... limited to, mechanical, quartz digital or quartz analog, if those watches or watch parts contain any... than fair market value, its cost or value will be determined by computing the sum of: (1) All expenses...

  4. All projects related to | Page 253 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Markets in developing countries are often marked by anti-competitive behaviour, concentrated market power, and low access for newcomers. ... Adding a social science perspective to the field of health policy and systems research can help developing countries address health problems in a more comprehensive way.

  5. 7 CFR 253.5 - State agency requirements.

    Science.gov (United States)

    2010-01-01

    ... Federal, State, or local laws, including, but not limited to, laws relating to taxation, welfare, and... advance of the meeting. FNS shall schedule and conduct the meeting and make a decision within 60 days of...

  6. H:\\PMKER 25(3)\\EGAH J..xps

    African Journals Online (AJOL)

    AISA

    de réponses ne favorisent que certaines variétés, laissant presqu'entière la question de la conservation de la biodiversité .... biodiversité de l'igname surtout que son système semencier en ...... framework for valuing on-farm genetic resources.

  7. 42 CFR 403.253 - Calculation of benefits.

    Science.gov (United States)

    2010-10-01

    ... the gross premiums are computed to provide coverage. (iv) Reserve for future contingent benefits means... the loss ratio calculation period. (iii) Net premium means the level portion of the gross premium used... period, to— (B) The total policy reserve at the last day of the loss ratio calculation period: and (ii...

  8. 40 CFR 25.3 - Policy and objectives.

    Science.gov (United States)

    2010-07-01

    ... governmental and educational associations. (b) Public participation is that part of the decision-making process... the decision-making process, seeking input from and conducting dialogue with the public, assimilating... considered by the decision-making official. Disagreement on significant issues is to be expected among...

  9. 40 CFR 180.253 - Methomyl; tolerances for residues.

    Science.gov (United States)

    2010-07-01

    ..., grain 1 Oat, hay 10 Oat, straw 10 Onion, green 3 Orange, sweet 2 Parsley, leaves 6 Pea 5 Pea, field...), kale, lettuce, mustard greens, parsley, spinach, Swiss chard, turnip, greens (tops), and watercress] 0...

  10. 32 CFR 253.1 - Reissuance and purpose.

    Science.gov (United States)

    2010-07-01

    ...) MISCELLANEOUS ASSIGNMENT OF AMERICAN NATIONAL RED CROSS AND UNITED SERVICE ORGANIZATIONS, INC., EMPLOYEES TO...”) employees and United Service Organizations, Inc. (USO), staff for the purpose of determining the security acceptability of such personnel for assignment to duty with the Military Services. ...

  11. H:\\PMKER 25(3)\\ZEZE A..xps

    African Journals Online (AJOL)

    AISA

    préalablement stérilisé à l'autoclave (110 °C,. 2 kg/cm2, 3h) et 150 g de sol de chaque échantillon servant d'inoculum (2 plants par pot). Après 75 jours de culture, 50 g de sols de chaque échantillon séché à l'air libre est utilisé pour extraire les spores selon la méthode de tamisage humide (Gerdemann et Nicolson,. 1963).

  12. H:\\PMKER 25(3)\\BEUGRE F..xps

    African Journals Online (AJOL)

    AISA

    nodules and permitted the application of the herbicide, better development of soybean plants. Herbicide ... négative sur les micro-organismes du sol, en particulier, sur les .... différences significatives entre les traitements sont apparus à partir de 45e jour après le semis. (JAS), et ce, jusqu'au 90e JAS. En effet, pendant ...

  13. H:\\PMKER 25(3)\\NOUATIN G..xps

    African Journals Online (AJOL)

    AISA

    Les institutions de micro finance, de part leur importance dans la réduction de la pauvreté dans les pays en développement, sont de plus en plus au centre des préoccupations aussi bien des politiques que des scientifiques. Au Bénin on compte ... En effet, il existe relativement peu d'analyses d'impact de programmes de ...

  14. Dicty_cDB: CHJ253 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available dkeklakkaaeglknakntassyasgin askdqlnsnfknikenissnlnnakhtieenvhnaqrtgyppkvpapgsnkf...igflalgv fglfawkfyegkkykeneqklikqkh*kk--- ---slyy*fvfkkfikikiinfk*ikr*kkmtdnwdkeklakkaaeglknakntassyax ginaskdqlnsnfknike

  15. Dicty_cDB: SLA253 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available TTTATS*i*sknifyqvslq**f****yqkmilkipf fsl*fln*i*nk*kkkknl Translated Amino Acid s...GMPLQLGYGANGKNGDNGISVWLIYGYTIVDINCNIRPIITAA TIATTTAATTTATTTATTATTTATTTATS*i*sknifyqvslq**f****yqkmilkipf fsl

  16. 7 CFR 253.6 - Eligibility of households.

    Science.gov (United States)

    2010-01-01

    ... resources of a household, only cash on hand, money in checking or savings accounts, savings certificates..., such as a Keogh plan or an Individual Retirement Account (IRA), as long as the funds remain in the... course would be excluded. However, transportation, supplies, and textbook expenses are not uniformly...

  17. H:\\PMKER 25(3)\\BRAHIM I..xps

    African Journals Online (AJOL)

    AISA

    ordinateur. Au cours de ces dictées d'enregistrement de compor- tement et pour chaque femelle, sept paramètres ont été relevés et enregistrés à l'ordinateur : - durée de marche sans balayage (en sec) : pendant laquelle la femelle se déplace sur les.

  18. 20 CFR 632.253 - Special operating provisions.

    Science.gov (United States)

    2010-04-01

    ...; (c) Provide labor market orientation to participants. This orientation may include, as appropriate: vocational exposure, counseling, testing, resume preparation, job interview preparation, providing labor... labor market orientation, skill training and remedial education, each grantee shall make maximum efforts...

  19. H:\\PMKER 25(3)\\HALA.xps

    African Journals Online (AJOL)

    AISA

    plus fréquemment utilisées contre les cochenilles appartiennent au groupe des organophosphorés. Le chlorpyrifos-éthyl a montré une bonne efficacité comparativement aux pyréthrinoïdes tels que la bifenthrine et la lamdacyhalothrine (Dembélé, 2001). Toutes les formulations à base de chlorpyriphos- éthyl (Dursban 4 E, ...

  20. 30 CFR Appendix to Part 253 - List of U.S. Geological Survey Topographic Maps

    Science.gov (United States)

    2010-07-01

    ... Comal; La Leona; La Parra Ranch NE; Laguna Vista; Lake Austin; Lake Como; Lake Stephenson; Lamar; Long... Canyon; Encinitas; Gaviota; Goleta; Guadalupe; Imperial Beach; Laguna Beach; La Jolla; Las Pulgas Canyon... SE; Steinhatchee SW; Sugar Hill; Sumner; Suwannee; Tampa; Tarpon Springs; Valparaiso; Venice; Vista...

  1. Fungal diversity notes 253-366: taxonomic and phylogenetic contributions to fungal taxa

    Czech Academy of Sciences Publication Activity Database

    Li, G.J.; Hyde, K.D.; Zhao, R. L.; Hongsanan, S.; Abdel-Aziz, F.A.; Abdel-Wahab, M. A.; Alvarado, P.; Alves-Silva, G.; Ammirati, J.F.; Ariyawansa, H.A.; Baghela, A.; Bahkali, A. H.; Beug, M.; Bhat, D.J.; Bojantchev, D.; Boonpratuang, T.; Bulgakov, T.S.; Camporesi, E.; Boro, M.C.; Ceska, O.; Chakraborty, D.; Chen, J.J.; Chethana, K.W.T.; Chomnunti, P.; Consiglio, G.; Cui, B.K.; Dai, D. Q.; Dai, Y.C.; Daranagama, D. A.; Das, K.; Vlasák, Josef

    2016-01-01

    Roč. 78, č. 1 (2016), s. 1-237 ISSN 1560-2745 Institutional support: RVO:60077344 Keywords : lichenized ascomycota ostropales * ribosomal dna-sequences * strictly anaerobic fungus * sp-nov russulaceae * molecular phylogeny * Basidiomycota Subject RIV: EF - Botanics Impact factor: 13.465, year: 2016

  2. 253 some biochemical effects of a mainly fruit diet in man

    African Journals Online (AJOL)

    -carbohydrate diet. Conn" made similar observations. Insulin Secretion. The fruit diet produced a statistically significant reduc- tion in the plasma insulin response after glucose intake in some Bantu while in some Whites there was an inex-.

  3. Radiative and mechanical feedback into the molecular gas of NGC 253

    NARCIS (Netherlands)

    Rosenberg, M. J. F.; Kazandjian, M. V.; van der Werf, P. P.; Israel, F. P.; Meijerink, R.; Weiß, A.; Requena-Torres, M. A.; Güsten, R.

    Starburst galaxies are galaxies or regions of galaxies undergoing intense periods of star formation. Understanding the heating and cooling mechanisms in these galaxies can give us insight to the driving mechanisms that fuel the starburst. Molecular emission lines play a crucial role in the cooling

  4. 7 CFR 1710.253 - Engineering and cost studies-addition of generation capacity.

    Science.gov (United States)

    2010-01-01

    ... must include comprehensive economic present-value analyses of the costs and revenues of the available... assessments of service reliability and financing requirements and risks. Requirements for analyzing purchased... costs; (2) Financing requirements and risks; (3) System reliability; (4) Alternative unit sizes; (5...

  5. 29 CFR 779.253 - What is included in computing the total annual inflow volume.

    Science.gov (United States)

    2010-07-01

    ... FAIR LABOR STANDARDS ACT AS APPLIED TO RETAILERS OF GOODS OR SERVICES Employment to Which the Act May... taxes and other charges which the enterprise must pay for such goods. Generally, all charges will be... computing the total annual inflow volume. The goods which the establishment purchases or receives for resale...

  6. Sud du Sahara | Page 253 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Savoir. Innovation. Solutions. Carrières · Communiquez avec nous · Plan du site · Droits d'auteur · Éthique de la recherche · Politique de libre accès · Politique de confidentialité · Transparence · Utilisation du site Web. Suivez-nous; Facebook · Twitter · Youtube · Linked In · RSS Feed. © 2015 CRDI. Tous droits réservés.

  7. People and things. CERN Courier, Apr 1985, v.25(3)

    Energy Technology Data Exchange (ETDEWEB)

    Anon.

    1985-04-15

    The article reports on achievements of various people, staff changes and position opportunities within the CERN organization and contains news updates on upcoming or past events. To commemorate the 25th anniversary of Austria's joining CERN and the forming of the first high energy physics group in the country, a celebration took place last November in the Auditorium of the old University of Vienna. From 25-28 February next year, another (the fourth) Vienna Wire Chamber Conference will take place. The fifth US Summer School on High Energy Particle Accelerators is to be held at the Stanford Linear Accelerator Center from 15-26 July.

  8. SU-E-J-253: The Radiomics Toolbox in the Computational Environment for Radiological Research (CERR)

    Energy Technology Data Exchange (ETDEWEB)

    Apte, A; Veeraraghavan, H; Oh, J; Kijewski, P; Deasy, J [Memorial Sloan Kettering Cancer Center, New York, NY (United States)

    2015-06-15

    Purpose: To present an open source and free platform to facilitate radiomics research — The “Radiomics toolbox” in CERR. Method: There is scarcity of open source tools that support end-to-end modeling of image features to predict patient outcomes. The “Radiomics toolbox” strives to fill the need for such a software platform. The platform supports (1) import of various kinds of image modalities like CT, PET, MR, SPECT, US. (2) Contouring tools to delineate structures of interest. (3) Extraction and storage of image based features like 1st order statistics, gray-scale co-occurrence and zonesize matrix based texture features and shape features and (4) Statistical Analysis. Statistical analysis of the extracted features is supported with basic functionality that includes univariate correlations, Kaplan-Meir curves and advanced functionality that includes feature reduction and multivariate modeling. The graphical user interface and the data management are performed with Matlab for the ease of development and readability of code and features for wide audience. Open-source software developed with other programming languages is integrated to enhance various components of this toolbox. For example: Java-based DCM4CHE for import of DICOM, R for statistical analysis. Results: The Radiomics toolbox will be distributed as an open source, GNU copyrighted software. The toolbox was prototyped for modeling Oropharyngeal PET dataset at MSKCC. The analysis will be presented in a separate paper. Conclusion: The Radiomics Toolbox provides an extensible platform for extracting and modeling image features. To emphasize new uses of CERR for radiomics and image-based research, we have changed the name from the “Computational Environment for Radiotherapy Research” to the “Computational Environment for Radiological Research”.

  9. : tous les projets | Page 253 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Au Sahel, la sécheresse et la piètre fertilité des sols limitent grandement le rendement des cultures. Date de début : 1 mars 2011. End Date: 1 septembre 2014. Sujet: FOOD CROPS, SOIL FERTILITY, FERTILIZERS, FERTILIZING, RAIN FED FARMING, WATER MANAGEMENT, CROP YIELD, Food security. Région: Burkina ...

  10. H:\\PMKER 25(3)\\NGORAN K. E..xps

    African Journals Online (AJOL)

    AISA

    'étable. Comparison of cowshed milk contamination respect with the months. GAM = Germes aérobies mésophiles, CT = Coliformes totaux, CF = Coliformes fécaux,. GAM = Aerobic mesophlile germ, CT = Total coliform, CF = fecal coliform.

  11. People and things. CERN Courier, Apr 1985, v.25(3)

    International Nuclear Information System (INIS)

    Anon.

    1985-01-01

    The article reports on achievements of various people, staff changes and position opportunities within the CERN organization and contains news updates on upcoming or past events. To commemorate the 25th anniversary of Austria's joining CERN and the forming of the first high energy physics group in the country, a celebration took place last November in the Auditorium of the old University of Vienna. From 25-28 February next year, another (the fourth) Vienna Wire Chamber Conference will take place. The fifth US Summer School on High Energy Particle Accelerators is to be held at the Stanford Linear Accelerator Center from 15-26 July

  12. Status of Radiotherapy around the World: Sub-Saharan Africa. Chapter 25.3

    International Nuclear Information System (INIS)

    Kigula Mugambe, J.B.; Kavuma, A.

    2017-01-01

    Sub-Saharan Africa is faced with numerous socioeconomic and political challenges. These significantly influence the delivery of health services, including radiotherapy. The availability of radiotherapy service in a country does not necessarily mean that its population can access that service. Financial constraints, lack of awareness and poor road infrastructure influence accessibility. For example, the Democratic Republic of the Congo is a vast country with only one centre in Kinshasa, and it is very difficult for people in the eastern part of the country to access it. Late presentation of patients for cancer management is another formidable challenge, aggravated by the issues mentioned above. The countries in this region have to address the problem of increasing cancer burden and the increasingly important role of radiotherapy in cancer management. There is an urgent need for the establishment of radiotherapy centres that are distributed widely across the region, accompanied by the training of more personnel. On the positive side, several countries in this region, e.g. Eritrea, Malawi and Niger, are in the process of establishing radiotherapy facilities in cooperation with the IAEA. Others, such as Ghana, Nigeria and the United Republic of Tanzania, are in the process of expanding the existing services. The countries in this region should address the late presentation problem by increasing awareness and establishing effective prevention and early detection programmes as part of their national cancer control strategies. They should also develop appropriate cancer policies with the continued support of international organizations such as the IAEA and the World Health Organization (WHO).

  13. Diagnosis and Management of 253 Cases with Cushing's syndrome in Imam Khomeini Hospital

    Directory of Open Access Journals (Sweden)

    Esteghamati A.R

    2007-09-01

    Full Text Available Background: Definite diagnosis and treatment of Cushing's syndrome is still a dilemma. The aim of this study was to evaluate the accuracy of diagnostic tests and follow-up of patients with Cushing's syndrome."nMethods: Two hundred and fifty three consecutive cases with Cushing's syndrome during 1370-78 were studied. The screening tests were performed in all patients. High dose dexamethasone suppression test (HDDST and ACTH measurement were carried out. MRI/CT Scan were performed and compared with laboratory data and pathologic specimens as a gold standard test."nResults: The age range was 32±11 yrs. The most frequent symptoms were weakness; hypertension, typical striae, and depression .The frequency of hypertension in ACTH-dependent case were 77% vs. 36% in adrenal tumors (P< 0.001. HDDST was positive in 99% of micro and 71% of macroadenomas. Adrenal tumors showed 3.6% suppression but none in ectopic cases. HDDST had a sensitivity of 98%, specificity of 97% and accuracy equals to 98%. The frequency of different etiologies was as following: Cushing's disease in 64.8%, adrenal tumors in 32.8% and ectopic ACTH in 2.4% of patients. Trans-sphenoidal surgery (TSS was performed in 120 patients .The patients were followed for 53±25 months whose remission periods were 46.7±23.8 months (range 4-114 months. Survival analysis showed 93% remission rate in 12mo, 82% in 2yr and only 33% after 5yr.This recurrence didn't have any platue level."nConclusion: In our study, hypertension was more prevalent in ACTH-dependent Cushing's syndrome. HDDST had acceptable sensitivity, specificity and accuracy. Lifelong follow up of pituitary adenomas is inevitable in the case of progressive and gradual nature of recurrence in these tumors.

  14. 30 CFR 253.3 - How are the terms used in this regulation defined?

    Science.gov (United States)

    2010-07-01

    ... in this regulation defined? Terms used in this part have the following meaning: Advertise means... well drilled from a mobile offshore drilling unit (MODU) and the associated riser and well control...

  15. The importance of education in the promotion of organ donation - doi: 10.5020/18061230.2012.p253

    Directory of Open Access Journals (Sweden)

    Taise Ribeiro Morais

    2012-11-01

    Full Text Available Transplantation and human organ donation are controversial issues that have generated much interest and discussion. The lack of clarification and the sensationalist news about organ trafficking contribute to raise questions and render the myths and prejudices permanent.The donation of organs and tissues is seen by society in general, as an act of solidarity and love from the family. However, it requires decision-making at a time of extreme pain and distress, caused by the impact of breaking news of death, the feeling of loss and the unexpected interruption of a life course(1.As the criteria of death are modified, the concept of brain death arises, along with the possibility of using donor organs and tissues. When there is not a good understanding of the organ donation process, the relatives of potential donors feel apprehensive, doubtful and undecided at the time of occurrence, because it is a subject about which there hasn’t been much clarification(1.Brazil has the largest public transplants program in the world, since the government finances 92% of procedures done in the country. However, when we consider the rate of post mortem transplant into the population, Brazil’s results are little expressive(2.Family refusal is a major obstacle to the realization of transplants, and is also identified as major cause for the shortage of organs and tissues for transplantation. Families who understand well the diagnosis of brain death are more favorable to organ donation, compared to families who believe that death only occurs after the heart stops. Therefore, the poor level of information, either by the quality of information concerning brain death, either by not having exceeded the barrier of stigmatized fear of organ trading, propagated by the media, drastically reduces the number of patients who are benefited from receiving an organ(3.Although all people are responsible for disseminating information, we must also educate health professionals, since they interfere directly in the likely donor’s family decision. Perhaps, they lack the study of Thanatology. These professionals deal directly with death but do not investigate death, mourning. The family situation at the time of mourning, hardened by the difficult decision of donating the organs of their beloved one, should form a strong synergistic relationship, as it comes into question the shock of death and the decision to save other people’s lives. It has also been disclosed that religion is considered one of the reasons to refuse the donation of organs and tissues for transplantation. It is, thus, necessary to give greater attention to people’s religious beliefs and values by the time of the loss of their relatives. The literature is rich in references demonstrating that the mass media, despite their high national and global spreading power, are not best suited to provide sufficient explanation on such contentious issues as it is, among others, the organ donation. Instead, the means, the symbology and the repertoire often used by mass media cause more confusion than clarification(4.A study in Spain found that a lot of information spread in the media could be an alternative to the clarification of doubts, however, it sometimes reproduce misinformation, superficial and prejudice-based ideas, being unable to modify negative behavior related to organ donation.A research conducted with people attending health centers in Spain showed that only 7% of the respondents received information about transplantation from primary care professionals. Although the negative information has been quite absorbed, the study indicates that, even in small proportion, the positive information has generated a new way of interpreting organ donation(6We here emphasize the importance of discussing the issue “organ donation” with friends and family, because people, being well educated, are capable of promoting discussions, which that can be understood as promotion of donation.The profile of the opponent to organ donation is: man or woman over the age of 45 years, with low schooling, who does not know the concept of brain death and has a partner also against organ donation, is not conducive to blood donation and fears the manipulation of the body after death. The main reasons for not accepting the donation is the lack of knowledge of how to become a donor and the fear of misdiagnosis of death(7.Facing this reality, health professionals should act as educators, to modify public opinion regarding the misconceptions. However, unfavorable beliefs can be modified only if educators are well prepared for that, so that the population is prompted to participate in debates on organ transplants and legislation.Modifying the existing reality means developing programs planned and evaluated in an ongoing educational process, supported by theoretical background and scientifically recognized models, for all segments of the community, along with incorporating the knowledge of thanatology in the formation of health professionals, with better appreciation of religious principles, to avoid making an aggressive approach to the families of potential donors. The preparation of families should be taken into consideration, to prevent the false idea that death is being expected in order to save others’ lives, because every family wants their patient to have the opportunity to live. Therefore, the government is to be exhorted to realize that the lack of support to the practice of organ donation is a real problem, and to include educational activities regarding transplants in priority governmental programs and in public policies of health care.Since organ donation in Brazil depends exclusively on the family permission, campaigns that seek to increase the understanding of the concept of brain death among the population, and, most of all, to encourage people to express their desire to be a donor and to discuss their decision with family are important strategies to tackle this problem.With a performance based on ethics and responsibility, the relationships and public policies contribute to the interests of society and organizations being achieved and established through dialogue. On the issue of transplantation, this contribution stands out because, through information and the establishment of relations with the public segments, the activity aims to reduce the suffering of many people awaiting in queues, as well as to alleviate the suffering of donor’s relatives and friends.It is also extremely valuable to include contents related to the theme of transplants / organ donation in undergraduate courses in the health area, so that professionals can act accordingly to the needs of their clientele, safely and efficiently, improving quality of life population.

  16. 30 CFR 253.24 - When I submit audited annual financial statements to verify my net worth, what standards must...

    Science.gov (United States)

    2010-07-01

    ... statements to verify my net worth, what standards must they meet? (a) Your audited annual financial statements must be bound. (b) Your audited annual financial statements must include the unqualified opinion of an independent accountant that states: (1) The financial statements are free from material...

  17. 37 CFR 253.8 - Terms and rates of royalty payments for the use of published pictorial, graphic, and sculptural...

    Science.gov (United States)

    2010-07-01

    ... royalty fees to each copyright owner not later than July 31 of each calendar year for uses during the... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Terms and rates of royalty..., Trademarks, and Copyrights COPYRIGHT OFFICE, LIBRARY OF CONGRESS COPYRIGHT ARBITRATION ROYALTY PANEL RULES...

  18. 34 CFR 75.253 - Continuation of a multi-year project after the first budget period.

    Science.gov (United States)

    2010-07-01

    ... sufficient funds under the program; (2) The recipient has either— (i) Made substantial progress toward meeting the objectives in its approved application; or (ii) Obtained the Secretary's approval of changes... those objectives in succeeding budget periods; (3) The recipient has submitted all reports as required...

  19. 37 CFR 253.4 - Performance of musical compositions by PBS, NPR and other public broadcasting entities engaged in...

    Science.gov (United States)

    2010-07-01

    ... background or theme music in a PBS program: 2003-2007 $56.81 (3) For performance of such a work in a feature... music in a program of a station of PBS: 2003-2007 $4.04 (5) For the performance of such a work in a... theme music in an NPR program: 2003-2007 $5.51 (7) For the performance of such a work in a feature...

  20. 40 CFR 421.253 - Effluent limitations guidelines representing the degree of effluent reduction attainable by the...

    Science.gov (United States)

    2010-07-01

    ... pollutant property Maximum for any 1 day Maximum for monthly average mg/troy ounce of gold and silver... Pollutant or pollutant property Maximum for any 1 day Maximum for monthly average mg/troy ounce of silver... Subcategory Pollutant or pollutant property Maximum for any 1 day Maximum for monthly average mg/troy ounce of...

  1. SU-E-T-253: Open-Source Automatic Software for Quantifying Biological Assays of Radiation Effects

    International Nuclear Information System (INIS)

    Detappe, A; Korideck, H; Makrigiorgos, G; Berbeco, R

    2014-01-01

    Purpose: Clonogenic cell survival is a common assay for quantifying the effect of drugs and radiation. Manual counting of surviving colonies can take 30–90seconds per plate, a major limitation for large studies. Currently available automatic counting tools are not easily modified for radiation oncology research. Our goal is to provide an open-source toolkit for precise, accurate and fast analysis of biological assays in radiation oncology. Methods: As an example analysis, we used HeLa cells incubated with gadolinium nanoparticles prior to irradiation. After treatment, the cells are grown for 14days to allow for colony formation. To analyze the colony growth, we capture images of each dish for archiving and automatic computer-based analysis. A FujifilmX20 camera is placed at the top of a box setup, 20cm above the sample, which is backlit by a LED lamp placed at the bottom of the box. We use a Gaussian filter (width=1.3mm) and color threshold (19–255). The minimum size for a colony to be counted is 1mm. For this example, 20 dishes with a large range of colonies were analyzed. Each dish was counted 3 times manually by 3 different users and then compared to our counter. Results: Automatic counting of cell colonies takes an average of 7seconds, enabling the analysis process to be accelerated 4–12 times. The average precision of the automatic counter was 1.7%. The Student t-test demonstrated the non-significant differences between the two counting methods (p=0.64). The ICC demonstrated the reliability of each method with ICC>0.999 (automatic) and ICC=0.95 (manual). Conclusion: We developed an open-source automatic toolkit for the analysis of biological assays in radiation oncology and demonstrated the accuracy, precision and effort savings for clonogenic cell survival quantification. This toolkit is currently being used in two laboratories for routine experimental analysis and will be made freely available on our departmental website

  2. 75 FR 21298 - Determination of Regulatory Review Period for Purposes of Patent Extension; VIMPAT -NDA 22-253

    Science.gov (United States)

    2010-04-23

    ... additive, or color additive) was subject to regulatory review by FDA before the item was marketed. Under... (lacosamide). VIMPAT tablets are indicated as adjunctive therapy in the treatment of partial-onset seizures in...

  3. Pion and nucleon structure as probed in the reaction π/sup +-/N → μ+μ-X at 253 GeV

    International Nuclear Information System (INIS)

    McDonald, K.T.

    1988-01-01

    New results are presented from Fermilab experiment E615, in which hadroproduction of muon pairs allows a determination of the quark structure of the initial-state hadrons in the context of a Drell-Yan model. Comparison of muon-pair production by π + and π - beams shows the cross-section ratio follows Drell-Yan model expectations, except for a dip in σ(π + )/σ(π - ) near x/sub π/ near 1. The same data are also used to extract the ratio of the sea to valence quark distributions in the nucleon, with improved accuracy for x/sub N/ 2 for the π - data sample. This provides stronger evidence of a rise in the nucleon structure function for x/sub N/ < 0.06 compared to that extracted in deep-inelastic lepton scattering. The issue is raised of the nonuniqueness of the definition of x/sub π/ and x/sub N/ used in the Drell-Yan analysis. A definition proposed by Soper has superior invariance properties to that commonly used. An analysis based on this definition yields generally similar results for the pion and nucleon structure function, compared to use of the common definition. However, the pion structure function shows a larger intercept at x/sub π/ = 1 when the definition of Soper is used. 21 refs., 6 figs

  4. Concomitant NSAID use during antipsychotic treatment and risk of 2-year relapse - a population-based study of 16,253 incident patients with schizophrenia

    DEFF Research Database (Denmark)

    Köhler, Karl Ole; Petersen, Liselotte; Benros, Michael Eriksen

    2016-01-01

    OBJECTIVE: Clinical trials have indicated antipsychotic effects of non-steroidal anti-inflammatory drugs (NSAIDs) among incident patients with schizophrenia. We aimed to study, in a population-based setting, whether concomitant use of NSAIDs or paracetamol, changed 2-year relapse risk...... for schizophrenia. METHODS: We identified all incident patients with schizophrenia in Denmark diagnosed 1996-2012 initiating antipsychotic treatment within the year after diagnosis. We calculated concomitant treatment intervals for antipsychotic and NSAID or paracetamol use. Hazard rate ratios (HRR) were estimated...... using Cox regression adjusted for important covariates. MAIN OUTCOME MEASURES: 2-year relapse, i.e. (re)-hospitalizations with schizophrenia. RESULTS: Among 16,235 incident patients with schizophrenia using antipsychotics, 1480 (9.1%) used NSAIDs and 767 (4.7%) paracetamol. Concomitant use of NSAIDs...

  5. 47 CFR 25.253 - Special requirements for ancillary terrestrial components operating in the 1626.5-1660.5 MHz/1525...

    Science.gov (United States)

    2010-10-01

    ... commercial mobile radio service (CMRS) base stations that make use of Global Positioning System (GPS) time... toward the physical horizon (not to include man-made structures) of 26.9-10*log (number of carriers) dBW... 1541.5-1547.5 MHz frequency band; (4) Exceed an EIRP toward the physical horizon (not to include man...

  6. Care for diabetes patients using the Staged Diabetes Management protocol: an experience report - doi:10.5020/18061230.2006.p253

    Directory of Open Access Journals (Sweden)

    Maria Lúcia Zanetti

    2012-01-01

    Full Text Available The work in multi professional health team has been acknowledged as important for the diabetic patient education. This study aimed at describing the implementation of a care assistance program using the Staged Diabetes Management (SDM protocol; also, characterizing the activities performed by the multi professional health team of the Nurse Education Center for Adults and Elderly, from Ribeirão Preto, in the treatment of diabetic patients. The study was developed from April, 2004 to April, 2005 through weakly meetings, combining individual and group activities coordinated by nurses, physicians, nutritionists, psychologists and physical educators. The results showed that the use of the SDM protocol contributed to improve diabetic patient’s metabolic control and consequently, drug cover up for diabetes mellitus, arterial hypertension and dislipidemia; also, increased the adherence to the nutrition program, to physical activity and the knowledge about the disease; and yet, reduced the signs and symptoms referred by the patients. This experience, showed the viability of implanting the referred protocol. The authors believe that the disclosure of this type of study might contribute to the guides commended by World Health Organization for the care of diabetic patients, specially the disease’s self-managed care.

  7. Pure partial monosomy 3p (3p25.3 → pter: Prenatal diagnosis and array comparative genomic hybridization characterization

    Directory of Open Access Journals (Sweden)

    Chih-Ping Chen

    2012-09-01

    Conclusion: In this case, aCGH has characterized a 3p deleted region with haploinsufficiency of the neurodevelopmental genes associated with cognitive deficit and mental retardation but without involvement of the congenital heart disease susceptibility locus, and QF-PCR has determined a paternal origin of the deletion. aCGH and QF-PCR help to delineate the genomic imbalance in prenatally detected de novo chromosome aberration, and the information acquired is useful for genetic counseling.

  8. T253. THE CORRELATION ANALYSIS BETWEEN RENAMING SCHIZOPHRENIA AND VISITING FREQUENCY OF MENTAL HEALTH SERVICES BY BIG DATA ANALYSIS (INTERNET SEARCHES AND NEWSPAPER ARTICLES) IN SOUTH KOREA

    Science.gov (United States)

    Lee, Sang Yup; Hong, Kyung Sue; Joo, Yeon Ho; Koike, Shinsuke; Lee, Yu Sang; Kwon, Jun Soo

    2018-01-01

    Abstract Background Korean Neuropsychiatric Association changed the Korean term for schizophrenia from ‘split-mind disorder’ to ‘attunement disorder’ in 2012, to dispel the stigma associated with name, and to promote early detection and treatment. Information on the internet affects the public awareness and attitude toward schizophrenia. The main purpose of this study was to investigate the correlation between renaming schizophrenia and the pattern of mental health services utilization by big data analysis of internet (newspaper articles and internet searches) in Korea. Methods From January 2016 to September 2017, newspaper articles on “attunement disorder” and “split-mind disorder” available on the internet were classified as related with negative images like crime and helpful or positive in dispelling the stigma. The relationship between the number of anti-stigma newspaper articles and newspaper articles of schizophrenia containing both positive and negative images was examined. In addition, using Naver, a major internet search engine in Korea, we investigated the total number of internet searches of both old and new name of schizophrenia by gender differences. Finally, the frequency of the visits of mental health services of patients with schizophrenia was measured using the Korean Healthcare Bigdata Hub (http://opendata.hira.or.kr/home.do#none) for 14 months and the correlation between the frequency of the visits and the above big data was examined. The data were analyzed using the SPSS/WIN 24.0. Pearson correlation coefficients were used to analyze correlations. Results The amounts of newspaper articles containing anti-stigma of schizophrenia were correlated with the amounts of newspaper articles containing negative images like crime of the new name (attunement disorder) of schizophrenia (r=0.528, p0.05) in next month was larger than the correlation of “split-mind disorder” searches with mental health services utilization (r = 0.082, p>0.05). Discussion “Attunement disorder” rather than “split-mind disorder” was appeared more frequently in newspaper articles of the anti-stigma characteristics. “Attunement disorder” seems to be more useful for anti-stigma campaign. Renaming schizophrenia didn’t seem to affect the visiting frequency of mental health services. There was statistical limitation which was originated from the lack of numbers of patient’s information. It was because Korean Bigdata Hub provided patients information just for 14 months as monthly data. Also, it should be considered that the time period, the kinds of mental disorders and the search engine we investigated were limited. Future research needs to overcome these limitations.

  9. El-AbedOroub, Unprotected: Palestinians in Egypt since 1948, Washington, DC, Institute for Palestine Studies / Ottawa: International Development Research Centre, 2009, 253 p.

    Directory of Open Access Journals (Sweden)

    Françoise de Bel-Air

    2010-06-01

    Full Text Available L’ouvrage proposé par Oroub El-Abed sur les Palestiniens d’Égypte comble un manque : cette communauté n’avait, en effet, encore jamais fait l’objet d’une étude scientifique de grande ampleur telle que celle entreprise par l’auteur sous les auspices du programme Forced Migration and Refugee Studies de l’Université américaine au Caire. L’ambition initiale de Oroub El-Abed et de son équipe était de réaliser une enquête de terrain portant sur un échantillon de 300 ménages répartis dans 15 gouvern...

  10. Intellectual disability, muscle weakness and characteristic face in three siblings: A newly described recessive syndrome mapping to 3p24.3-p25.3

    NARCIS (Netherlands)

    Kariminejad, Ariana; Nafissi, Shahriar; Nilipoor, Yalda; Tavasoli, Alireza; van Veldhoven, Paul P.; Bonnard, Carine; Ng, Yeng Ting; Majoie, Charles B.; Reversade, Bruno; Hennekam, Raoul C.

    2015-01-01

    We report on a sister and two brothers born to healthy Iranian parents with mild intellectual disability, progressive muscle weakness, and characteristic facies. including highly arched eyebrows, down-slanting palpebral fissures, prominent nasal bridge, prominent nose, columella extending below alae

  11. p.Ser252Trp and p.Pro253Arg mutations in FGFR2 gene causing Apert syndrome: the first clinical and molecular report of Indonesian patients

    NARCIS (Netherlands)

    Mundhofir, F.E.P.; Sistermans, E.A.; Faradz, S.M.H.; Hamel, B.C.J.

    2013-01-01

    Apert syndrome (AS) is a rare autosomal dominant disorder characterised by craniosynostosis and limb malformations, and is associated with congenital heart disease and other systemic malformations, including intellectual disability. We report two Indonesian patients with AS, in whom molecular

  12. On the origin of mixed-layered clay minerals from the San Andreas Fault at 2.5-3 km vertical depth (SAFOD drillhole at Parkfield, California)

    Science.gov (United States)

    Schleicher, A. M.; Warr, L. N.; van der Pluijm, B. A.

    2009-02-01

    A detailed mineralogical study is presented of the matrix of mudrocks sampled from spot coring at three key locations along the San Andreas Fault Observatory at depth (SAFOD) drill hole. The characteristics of authigenic illite-smectite (I-S) and chlorite-smectite (C-S) mixed-layer mineral clays indicate a deep diagenetic origin. A randomly ordered I-S mineral with ca. 20-25% smectite layers is one of the dominant authigenic clay species across the San Andreas Fault zone (sampled at 3,066 and 3,436 m measured depths/MD), whereas an authigenic illite with ca. 2-5% smectite layers is the dominant phase beneath the fault (sampled at 3,992 m MD). The most smectite-rich mixed-layered assemblage with the highest water content occurs in the actively deforming creep zone at ca. 3,300-3,353 m (true vertical depth of ca. 2.7 km), with I-S (70:30) and C-S (50:50). The matrix of all mudrock samples show extensive quartz and feldspar (both plagioclase and K-feldspar) dissolution associated with the crystallization of pore-filling clay minerals. However, the effect of rock deformation in the matrix appears only minor, with weak flattening fabrics defined largely by kinked and fractured mica grains. Adopting available kinetic models for the crystallization of I-S in burial sedimentary environments and the current borehole depths and thermal structure, the conditions and timing of I-S growth can be evaluated. Assuming a typical K+ concentration of 100-200 ppm for sedimentary brines, a present-day geothermal gradient of 35°C/km and a borehole temperature of ca. 112°C for the sampled depths, most of the I-S minerals can be predicted to have formed over the last 4-11 Ma and are probably still in equilibrium with circulating fluids. The exception to this simple burial pattern is the occurrence of the mixed layered phases with higher smectite content than predicted by the burial model. These minerals, which characterize the actively creeping section of the fault and local thin film clay coating on polished brittle slip surfaces, can be explained by the influence of either cooler fluids circulating along this segment of the fault or the flow of K+-depleted brines.

  13. The Phase Evolution and Property of FeCoCrNiAlTix High-Entropy Alloying Coatings on Q253 via Laser Cladding

    Directory of Open Access Journals (Sweden)

    Bin He

    2017-09-01

    Full Text Available High-entropy alloys (HEAs are emerging as a hot research frontier in the metallic materials field. The study on the effect of alloying elements on the structure and properties of HEAs may contribute to the progress of the research and accelerate the application in actual production. FeCoCrNiAlTix (x = 0, 0.25, 0.5, 0.75, and 1 in at.%, respectively HEA coatings with different Ti concentrations were produced on Q235 steel via laser cladding. The constituent phases, microstructure, hardness, and wear resistance of the coatings were investigated by XRD, SEM, microhardness tester and friction-wear tester, respectively. The results show that the structure of the coating is a eutectic microstructure of FCC and BCC1 at x = 0. The structure of coatings consists of both proeutectic FCC phase and the eutectic structure of BCC1 and BCC2. With the continuous addition of Ti, the amount of eutectic structure decreases. The average hardness of the FeCoCrNiAlTix HEA coatings at x = 0, 0.25, 0.5, 0.75, and 1 are 432.73 HV, 548.81 HV, 651.03 HV, 769.20 HV, and 966.29 HV, respectively. The hardness of coatings increases with the addition of Ti, where the maximum hardness is achieved for the HEA at x = 1. The wear resistance of the HEA coatings is enhanced with the addition of Ti, and the main worn mechanism is abrasive wear.

  14. A high-resolution whole genome radiation hybrid map of human chromosome 17q22-q25.3 across the genes for GH and TK

    Energy Technology Data Exchange (ETDEWEB)

    Foster, J.W.; Schafer, A.J.; Critcher, R. [Univ. of Cambridge (United Kingdom)] [and others

    1996-04-15

    We have constructed a whole genome radiation hybrid (WG-RH) map across a region of human chromosome 17q, from growth hormone (GH) to thymidine kinase (TK). A panel of 128 WG-RH hybrid cell lines generated by X-irradiation and fusion has been tested for the retention of 39 sequence-tagged site (STS) markers by the polymerase chain reaction. This genome mapping technique has allowed the integration of existing VNTR and microsatellite markers with additional new markers and existing STS markers previously mapped to this region by other means. The WG-RH map includes eight expressed sequence tag (EST) and three anonymous markers developed for this study, together with 23 anonymous microsatellites and five existing ESTs. Analysis of these data resulted in a high-density comprehensive map across this region of the genome. A subset of these markers has been used to produce a framework map consisting of 20 loci ordered with odds greater than 1000:1. The markers are of sufficient density to build a YAC contig across this region based on marker content. We have developed sequence tags for both ends of a 2.1-Mb YAC and mapped these using the WG-RH panel, allowing a direct comparison of cRay{sub 6000} to physical distance. 31 refs., 3 figs., 2 tabs.

  15. Konference o srovnávacím výzkumu bydlení, Delft, Nizozemsko, 24.3. – 25.3. 2010

    Czech Academy of Sciences Publication Activity Database

    Sládek, Jan

    2010-01-01

    Roč. 8, č. 5 (2010), s. 9 ISSN 1214-1720 R&D Projects: GA ČR GA403/09/1915 Institutional research plan: CEZ:AV0Z70280505 Keywords : methodology * city * theory Subject RIV: AO - Sociology, Demography http://www.socioweb.cz/upl/editorial/download/179_soc.web._05-2010%20final!.pdf

  16. The Influence of Deformation on the Surface Structure of Silicon Under Irradiation by $^{86}$Kr Ions with Energy 253 MeV

    CERN Document Server

    Vlasukova, L A; Hofmann, A; Komarov, F F; Semina, V K; Yuvchenko, V N

    2006-01-01

    The influence of the previously produced deformation in silicon structure by means of macro-scratch surface covering on the sputtering processes under following irradiation by swift $^{86}$Kr ions is studied. The significant leveling of surface relief of irradiated silicon was observed using atomic force microscopy method (AFM), in particular it takes place for smoothing of micro-scratches produced by mechanical polishing of silicon initial plates. The experimental studies of irradiated surface allowed one to conclude that it is impossible to explain the surface changes only by elastic cascade mechanism as it was calculated using the computer code TRIM-98, because the calculated sputtered layers of silicon at ion fluence $\\Phi_{\\rm Kr} = 1{.}3\\cdot10^{14}$ ion/cm$^{2}$ should be $\\Delta H_{\\rm Sputtering}^{\\rm Kr} = 5{.}5\\cdot10^{-3 }${\\AA}. Correspondingly, the surface changes should be explained by one of mechanisms of inelastic sputtering. The macro-cracks on the surface were observed near the scratches. I...

  17. Analysis of t(9;17)(q33.2;q25.3) chromosomal breakpoint regions and genetic association reveals novel candidate genes for bipolar disorder

    DEFF Research Database (Denmark)

    Rajkumar, Anto P; Christensen, Jane H; Mattheisen, Manuel

    2015-01-01

    ,856) data. Genetic associations between these disorders and single nucleotide polymorphisms within these breakpoint regions were analysed by BioQ, FORGE, and RegulomeDB programmes. RESULTS: Four protein-coding genes [coding for (endonuclease V (ENDOV), neuronal pentraxin I (NPTX1), ring finger protein 213...

  18. Safety analysis report for packaging: neutron shipping cask, model 0.5T

    International Nuclear Information System (INIS)

    Peterson, R.T.

    1976-01-01

    The Safety Analysis Report for Packaging demonstrates that the neutron shipping cask can safely transport, in solid or powder form, all isotopes of uranium, plutonium, americium, curium, berkelium, californium, einsteinium, and fermium. The shipping cask and its contents are described. It also evaluates transport conditions, structural parameters (e.g., load resistance, pressure and impact effects, lifting and tiedown devices), and shielding. Finally, it discusses compliance with Chapter 0529 of the Energy Research and Development Administration Manual

  19. Directed evolution of the periodic table: probing the electronic structure of late actinides.

    Science.gov (United States)

    Marsh, M L; Albrecht-Schmitt, T E

    2017-07-25

    Recent investigations of the coordination chemistry and physical properties of berkelium (Z = 97) and californium (Z = 98) have revealed fundamental differences between post-curium elements and lighter members of the actinide series. This review highlights these developments and chronicles key findings and concepts from the last half-century that have helped usher in a new understanding of the evolution of electronic structure in the periodic table.

  20. Report on the behalf of the Parliamentary Office for the Assessment of Scientific and Technological Choices on hydrogen: a vector for energy transition? - National Assembly Nr 1672, Senate Nr 253

    International Nuclear Information System (INIS)

    Kalinowski, Laurent; Pastor, Jean-Marc

    2013-01-01

    In its first part, this report describes the role and use hydrogen may have as a possible sustainable energy vector: description of its remarkable properties, description of various production modalities and processes, issues related to storage, transport and distribution. The second part proposes an overview of applications: fuel cells, hydrogen in transports, power-to-gas, co-generation, energy autonomy, mobile devices. The third part describes and discusses the role hydrogen may have in energy transition, notably for the integration of renewable energies, and in the substitution to fossil energies. The last chapter discusses the governance for a hydrogen energy sector in France: a sector with a high potential, a needed intervention by the State, the unavoidable role of territories, the issue of regulation. A description of the situation in foreign countries is provided in appendix

  1. A Response to Ages Past. Commentary on Harris, R. M., Michell, B.G. & Cooley. C. (1985) The Gender Gap in Library Education. (Journal of Education for Library and Information Science, 25(3), 167-176)

    Science.gov (United States)

    Wellstead, Peta

    2015-01-01

    Much has changed in the information environment since the years of Harris' review. It is important to mention the significance of the impact of technology that has rendered the work of librarians and information workers almost unknowable to those teaching in the period 1965-1983. As a result of these reviews and technological changes, many…

  2. An advanced method of contributing emissions to short-lived chemical species (OH and HO2: the TAGGING 1.1 submodel based on the Modular Earth Submodel System (MESSy 2.53

    Directory of Open Access Journals (Sweden)

    V. S. Rieger

    2018-06-01

    Full Text Available To mitigate the human impact on climate change, it is essential to determine the contribution of emissions to the concentration of trace gases. In particular, the source attribution of short-lived species such as OH and HO2 is important as they play a crucial role for atmospheric chemistry. This study presents an advanced version of a tagging method for OH and HO2 (HOx which attributes HOx concentrations to emissions. While the former version (V1.0 only considered 12 reactions in the troposphere, the new version (V1.1, presented here, takes 19 reactions in the troposphere into account. For the first time, the main chemical reactions for the HOx chemistry in the stratosphere are also regarded (in total 27 reactions. To fully take into account the main HO2 source by the reaction of H and O2, the tagging of the H radical is introduced. In order to ensure the steady-state assumption, we introduce rest terms which balance the deviation of HOx production and loss. This closes the budget between the sum of all contributions and the total concentration. The contributions to OH and HO2 obtained by the advanced tagging method V1.1 deviate from V1.0 in certain source categories. For OH, major changes are found in the categories biomass burning, biogenic emissions and methane decomposition. For HO2, the contributions differ strongly in the categories biogenic emissions and methane decomposition. As HOx reacts with ozone (O3, carbon monoxide (CO, reactive nitrogen compounds (NOy, non-methane hydrocarbons (NMHCs and peroxyacyl nitrates (PAN, the contributions to these species are also modified by the advanced HOx tagging method V1.1. The contributions to NOy, NMHC and PAN show only little change, whereas O3 from biogenic emissions and methane decomposition increases in the tropical troposphere. Variations for CO from biogenic emissions and biomass burning are only found in the Southern Hemisphere.

  3. Detection of recurrent 4p16.3 microdeletion with 2p25.3 microduplication by multiplex ligation-dependent probe amplification and array comparative genomic hybridization in a fetus from a family with Wolf–Hirschhorn syndrome

    Directory of Open Access Journals (Sweden)

    Wen-Xu Yang

    2016-02-01

    Conclusion: The combined use of MLPA and aCGH is an effective way to diagnose recurrent WHS. Although WHS is typically caused by a de novo deletion, prenatal diagnosis and genetic counseling are necessary in the next pregnancy in families that have suffered such cases.

  4. Bruno Dorin, Frédéric Landy, Agriculture et alimentation de l’Inde : les vertes années (1947-2001, INRA Editions, Paris, 2002, 253 pages

    Directory of Open Access Journals (Sweden)

    Sylvain Ropital

    2004-12-01

    Full Text Available Considérée dès à présent comme l’un des premiers producteurs mondiaux de denrées alimentaires de la planète, l’Inde, outre son image moderne de géant mondial de la sous-traitance informatique, incarnera le futur « Ventre » agricole du monde en tant que premier exportateur de céréales, de lait et d’oléagineux du grand marché mondial. Parallèlement à ce visage de géant mondial de la production agricole, l’Inde apparaît aussi telle l’une des terres les plus touchées par la violence de la malnutr...

  5. About the nitriding of powder uranium by nitrogen - Extract from the proceedings of the sessions of the Academy of Sciences, t. 253, p. 1100-1102, session of the 28 August 1961

    International Nuclear Information System (INIS)

    Moreau, Claude; Philippot, Joseph

    1961-01-01

    The authors report the study of powder uranium nitriding by nitrogen performed by thermogravimetry between 300 and 700 C. Results highlight the complexity of a pulverulent gas-solid reaction, and notably the influence of granulometry. Uranium powder is prepared by calciothermy, and presents nearly spherical grains with a diameter between 2 and 20 microns. Preliminary tests, performed on grains with heterogeneous size, showed that the reaction started between 300 and 350 C. Isotherm curves are discussed [fr

  6. Kerrou Mohammed (dir., « D’Islam et D’ailleurs », Hommage à Clifford Geertz, Éditions Cérès, Tunis, 2008, 253 p.

    Directory of Open Access Journals (Sweden)

    Kamel Chachoua

    2011-04-01

    Full Text Available D’islam et d’Ailleurs est un livre collectif dirigé par Mohammed Kerrou autour de l’œuvre et de la pensée de Clifford Geertz (1926-2006. Le livre est publié aux éditions Cérès dans une belle collection « texto », en 2008, à Tunis. Il est, en partie, l’aboutissement imprimé d’une journée d’étude organisée par les enseignants du Master d’Anthropologie sociale et culturelle, qui s’est tenu, le 30 avril 2007, à l’Institut supérieur des sciences humaines (Université de Tunis El-Manar, dans les l...

  7. Osteoclasts from patients with autosomal dominant osteopetrosis type I caused by a T253I mutation in low-density lipoprotein receptor-related protein 5 are normal in vitro, but have decreased resorption capacity in vivo

    DEFF Research Database (Denmark)

    Henriksen, Kim; Gram, Jeppe; Høegh-Andersen, Pernille

    2005-01-01

    of osteoclast markers, morphology, and localization of proteins involved in bone resorption, such as ClC-7 and cathepsin K. The ability to resorb bone was also normal. In vivo, we compared the bone resorption and bone formation response to T3 in ADOI patients and age- and sex-matched controls. We found...

  8. Fauna parasitária de peixes oriundos de “pesque-pague” do município de Guariba, São Paulo, Brasil - DOI: 10.4025/actascibiolsci.v28i3.253 Parasitic fauna of cultivated fishes in fee fishing farm of Guariba, São Paulo State, Brazil - DOI: 10.4025/actascibiolsci.v28i3.253

    Directory of Open Access Journals (Sweden)

    Julieta Rodini Engracia de Moraes

    2007-11-01

    Full Text Available Este trabalho descreve a ocorrência e a sazonalidade de parasitos em peixes de “pesque-pague” do município de Guariba, Estado de São Paulo, Brasil (21º15`22``S, 48º18`58``W e 595 m de altitude, durante o período de agosto de 2001 a julho de 2002. A presença de parasitos foi pesquisada em pacu Piaractus mesopotamicus (Characidae, carpa comum Cyprinus carpio (Cyprinidae, tilápia-do-Nilo Oreochromis niloticus (Cichlidae, híbrido tambacu (macho de P. mesopotamicus x fêmea de tambaqui-Colossoma macropomum e piraputanga Brycon hillari (Characidae. Os resultados demonstram que dos 100 peixes examinados, 15% estavam parasitados por pelo menos um dos seguintes parasitos: Trichodina sp.; helmintos monogenóides; copepoditos de Lernaea cyprinacea; L. cyprinacea adulta ou Dolops carvalhoi. Por ordem decrescente, o grau de suscetibilidade dos hospedeiros foi C. carpio, P. mesopotamicus, B. hillari, híbrido tambacu e O. niloticus. Por ordem decrescente, os parasitos encontrados foram helmintos monogenóides, Dolops carvalhoi, Trichodina sp., Lernaea cyprinacea adultas e suas formas jovens.This study describes the occurrence and the seasonality of parasites of cultivated fish from a fee fishing farm located in Guariba, São Paulo State, Brazil (21º15`22`` S, 48º18`58`` W and 595 m of altitude, from August, 2001 to July, 2002. The presence of parasites was researched in pacu Piaractus mesopotamicus (Characidae, common carp Cyprinus carpio (Cyprinidae, nile-tilapia Oreochromis niloticus (Cichlidae, tambacu hybrid (male of P. mesopotamicus x female of tambaqui-Colossoma macropomum and piraputanga Brycon hillari (Characidae. Results demonstrate that out of 100 fish examined, 15% were sponged for at least one of the following parasites: Trichodina sp.; monogenean helminths; copepodits of Lernaea cyprinacea; adults of L. cyprinacea; or Dolops carvalhoi. In decreasing order, the susceptibility degree of the hosts was C. carpio, P. mesopotamicus, B. hillari, tambacu hybrid and O. niloticus. In decreasing order the reported parasites were monogenean helminths, Dolops carvalhoi, Trichodina sp., adults of Lernaea cyprinacea and their young shapes.

  9. PROCEEDINGS OF THE SYMPOSIUM COMMEMORATING THE 25th ANNIVERSARY OF ELEMENTS 97 and 98 HELD ON JAN. 20, 1975

    Energy Technology Data Exchange (ETDEWEB)

    Seaborg, Glenn T.; Street Jr., Kenneth; Thompson, Stanley G.; Ghiorso, Albert

    1976-07-01

    This volume includes the talks given on January 20, 1975, at a symposium in Berkeley on the occasion of the celebration of the 25th anniversary of the discovery of berkelium and californium. Talks were given at this symposium by the four people involved in the discovery of these elements and by a number of people who have made significant contributions in the intervening years to the investigation of their nuclear and chemical properties. The papers are being published here, without editing, in the form in which they were submitted by the authors in the months following the anniversary symposium, and they reflect rather faithfully the remarks made on that occasion.

  10. Radiological safety considerations in the design and operation of the ORNL Transuranium Research Laboratory (TRL)

    International Nuclear Information System (INIS)

    Haynes, C.E.

    1976-01-01

    The Transuranium Research Laboratory (TRL) is the central facility at Oak Ridge National Laboratory (ORNL) for chemical and physical research involving transuranium elements. Transuranium Research Laboratory investigations are about equally divided between studies of inorganic and structural chemistry of the heavy elements and nuclear structure and properties of their isotopes. Elements studied include neptunium, plutonium, americium, curium, berkelium, californium, and einsteinium, each in microgram-to-gram quantities depending upon availability and experimental requirements. This paper describes an eight-step safety procedure followed in planning and approving individual research projects. This procedure should provide an optimum margin of safety and should permit the accomplishment of successful research

  11. Composition containing transuranic elements for use in the homeopathic treatment of aids

    International Nuclear Information System (INIS)

    Lustig, D.

    1996-01-01

    A homeopathic remedy consisting of a composition containing one or more transuranic elements, particularly plutonium, for preventing and treating acquired immunodeficiency syndrome (AIDS) in humans, as well as seropositivity for human immunodeficiency virus (HIV). Said composition is characterized in that it uses any chemical or isotopic form of one or more transuranic elements (neptunium, plutonium, americium, curium, berkelium, californium or einsteinium), particularly plutonium, said form being diluted and dynamized according to conventional homeopathic methods, particularly the so-called Hahnemann and Korsakov methods, and provided preferably but not exclusively in the form of lactose and/or saccharose globules or granules impregnated with the active principle of said composition. (author)

  12. Actinides

    International Nuclear Information System (INIS)

    Martinot, L.; Fuger, J.

    1985-01-01

    The oxidation behavior of the actinides is explained on the basis of their electronic structure. The actinide elements, actinium, thorium, protactinium, uranium, neptunium, plutonium, americium, curium, berkelium, californium, einsteinium, fermium, mendelevium, nobelium, and laurencium are included. For all except the last three elements, the points of discussion are oxidation states, Gibbs energies and potentials, and potential diagram for the element in acid solution; and thermodynamic properties of these same elements are tabulated. References are cited following discussion of each element with a total of 97 references being cited. 13 tables

  13. Safety analysis report for packaging: neutron shipping cask, model 4T

    International Nuclear Information System (INIS)

    Peterson, R.T.

    1977-01-01

    This Safety Analysis Report for Packaging demonstrates that the neutron shipping cask can safely transport, in solid or powder form, all isotopes of uranium, plutonium, americium, curium, berkelium, californium, einsteinium, and fermium. The cask and its contents are described. It also evaluates transport conditions, structural parameters (e.g., load resistance, pressure and impact effects, lifting and tiedown devices), and shielding. Finally, it discusses compliance with Chapter 0529 of the Energy Research and Development Administration Manual, Safety Standards for the Packaging of Fissile and Other Radioactive Materials

  14. TOWARD AN IMPROVED UNDERSTANDING OF STRUCTURE AND MAGNETISM IN NEPTUNIUM AND PLUTONIUM PHOSPHONATES AND SULFONATES

    Energy Technology Data Exchange (ETDEWEB)

    Albrecht-Schmitt, Thomas

    2012-03-01

    This grant supported the exploratory synthesis of new actinide materials with all of the actinides from thorium to californium with the exceptions of protactinium and berkelium. We developed detailed structure-property relationships that allowed for the identification of novel materials with selective ion-exchange, selective oxidation, and long-range magnetic ordering. We found novel bonding motifs and identified periodic trends across the actinide series. We identified structural building units that would lead to desired structural features and novel topologies. We also characterized many different spectroscopic trends across the actinide series. The grant support the preparation of approximately 1200 new compounds all of which were structurally characterized.

  15. ORF Alignment: Ca19AnnotatedDec2004aaSeq [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available P 192 ... Query: 276 EKIINVDYSYKSPIPLPPDVIQLIDSILISEPSARATIPHIMSSRWFSDIPWDD 329 ... ... ... EKIINVDYSYKSPIPLPPDVIQLIDSILISEPSARATIPHIMSSRWFSDIPWDD Sbjct: 253 EKIINVDYSYKSPIPLPPDVIQLIDSILISEPSARATIPHIMSSRWFSDIPWDD 306

  16. ORF Alignment: NC_000917 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available us ... Length = 119 ... Query: 253 KPKKVLFLSRSNDCRTKIAEAIFNHISPNNMLAVSAGIEPAQDLDLRAVATMRELGLKIN 312 ... ... ... KPKKVLFLSRSNDCRTKIAEAIFNHISPNNMLAVSAGIEPAQDLDLRAVATMRELGLKIN Sbjct: 1 ... KPKKVLFLSRSNDCRTKIAEAIFNHISPNNMLAVSAGIEPAQDLDLRAVATMRELGLKIN 60 ...

  17. Bright Light Therapy for Treatment of Sleep Problems Following Mild TBI https://www.dacspr.documentservices.dla.mil/dtic/livelink func=formwf.formedit and workid=4132484 and subworkid=4132484 and taskid=8 and formID=1 and viewname=jhg and editable=1176347093 and nexturl=%2Fdtic%2Flivelink%3Ffunc%3Dwork%2Etaskdone%26workid%3D4132484%26subworkid%3D4132484%26taskid%3D8%26xAction%3Dsave%26paneindex%3D1%26nexturl%3D%252Fdtic%252Flivelink%253Ffunc%253Dllworkspace and noredisplay=1#

    Science.gov (United States)

    2016-10-01

    00) and at night (between 00:00 and 04:00), and found that participants reported lower levels of sleepiness and fatigue, pii: sp-00684-15 ht tp...Chief Psychologist, GovSource, Inc., U.S. Department of Defense (DoD) Contractor 8/08 Consulting Psychologist, The Brain Institute, University of

  18. Decision of the Constitutional Review Division of the National Court of The Republic of Estonia : 30 September 1994 : review of the constitutionality of § 25(3) of the Property Law Enforcement Act to the extent that it sought to repeal § 30(2) of t

    Index Scriptorium Estoniae

    1995-01-01

    Riigikohtu lahendi III-4/A-5/94 (Asjaõigusseaduse rakendamise seaduse § 25 lg. 3 Põhiseadusele vastavuse läbivaatamine Eesti NSV taluseaduse § 30 lg. 2 kehtetuks tunnistamise osas) tekst inglise keeles

  19. Comment on Spracklandus Hoser, 2009 (Reptilia, Serpentes, ELAPIDAE): request for confirmation of availability of the generic name and for the nomenclatural validation of the journal in which it was published (Case 3601; BZN 70:234–237; 71:30–38; 133-135,181-182 ,252-253)

    Science.gov (United States)

    Rhodin, Anders G.J.; Kaiser, Hinrich; van Dijk, Peter Paul; Wüster, Wolfgang; O’Shea, Mark; Archer, Michael; Auliya, Mark; Boitani, Luigi; Bour, Roger; Clausnitzer, Viola; Contreras-MacBeath, Topiltzin; Crother, Brian I.; Daza, Juan M.; Driscoll, Carlos A.; Flores-Villela, Oscar; Frazier, Jack; Fritz, Uwe; Gardner, Alfred L.; Gascon, Claude; Georges, Arthur; Glaw, Frank; Grazziotin, Felipe G.; Groves, Colin P.; Haszprunar, Gerhard; Havaš, Peter; Hero, Jean-Marc; Hoffmann, Michael; Hoogmoed, Marinus S.; Horne, Brian D.; Iverson, John B.; Jäch, Manfred; Jenkins, Christopher L.; Jenkins, Richard K.B.; Kiester, A. Ross; Keogh, J. Scott; Lacher, Thomas E.; Lovich, Jeffrey E.; Luiselli, Luca; Mahler, D. Luke; Mallon, David P.; Mast, Roderic; McDiarmid, Roy W.; Measey, John; Mittermeier, Russell A.; Molur, Sanjay; Mosbrugger, Volker; Murphy, Robert W.; Naish, Darren; Niekisch, Manfred; Ota, Hidetoshi; Parham, James F.; Parr, Michael J.; Pilcher, Nicolas J.; Pine, Ronald H.; Rylands, Anthony B.; Sanderson, James G.; Savage, Jay M.; Schleip, Wulf; Scrocchi, Gustavo J.; Shaffer, H. Bradley; Smith, Eric N.; Sprackland, Robert; Stuart, Simon N.; Vetter, Holger; Vitt, Laurie J.; Waller, Tomás; Webb, Grahame; Wilson, Edward O.; Zaher, Hussam; Thomson, Scott

    2015-01-01

    In Case 3601 Raymond Hoser has asked the Commission to validate for the purposes of nomenclature the name Spracklandus Hoser, 2009, and ‘the journal in which it was published,’ issue 7 of the Australasian Journal of Herpetology (AJH). We note that the entire run of AJH has been written, edited, and published solely by Hoser. Although his requests to the Commission were presented as narrow and, in his words, ‘routine matters,’ we are convinced that they represent an important tipping-point with broad implications of major concern for zoological taxonomy and nomenclature as a whole and, by extension, the greater scientific community. Since Hoser’s actions and works have failed to follow scientific best practices (e.g. Turtle Taxonomy Working Group, 2007, 2014; Kaiser et al., 2013; Kaiser, 2014) and both the Commission’s general Recommendations and Code of Ethics in Appendix A, the global herpetological community has widely rejected his taxonomic decisions and resultant nomenclature. This has unfortunately caused a confusing dual nomenclature to develop in the herpetological community, with most boycotting or ignoring Hoser’s 700+ new names coined in the AJH, while he and a few personal followers actively promote their usage. We believe that suppression of the name Spracklandus, and all issues of AJH, is the only effective way to bring this contentious and confusing issue to resolution. The plenary power available under Article 81.1 of the Code exist specifically to allow the Commission to make rulings in individual cases that disturb stability and cause confusion, whether the works are Code-compliant or not. We maintain that it is in the interest of nomenclatural stability, not only for herpetology, but for all of zoological taxonomy, that the plenary power be invoked to declare the works in AJH unavailable, regardless of any narrow interpretation of their technical Code-compliance. We present our arguments for rejection of the validity of AJH in the following commentary. In view of the wide-reaching implications of this case for all of zoology, and reflecting the deep and broad-based community concern over these issues, our contributing authors include 70 global scientific leaders and accomplished amateurs from a wide variety of zoological disciplines.

  20. Directive of the Secretary of State for Social Affairs and Public Health of 18 December 1969, no. 133.024, Stcrt. 253, concerning the Nomination of Civil Servants in Implementation of Section 58, paragraphs 1 and 3 of the Nuclear Energy Act

    International Nuclear Information System (INIS)

    1969-01-01

    Further to the Directive of 29 November 1969 (Stcrt.239) on officials responsible for supervising observance of the provisions of the Nuclear Energy Act, this Directive concerns the appointment of medical and veterinary inspectors under the authority of the Government Public Health Inspectorate. (NEA) [fr

  1. Choosing the Right Book: Factors that Affect Children’s Reading. A Review of: Maynard, S., Mackay, S., & Smyth, F. (2008. A survey of young people’s reading in England: Borrowing and choosing books. Journal of Librarianship and Information Science, 40(4, 239-253.

    Directory of Open Access Journals (Sweden)

    Gayle Bogel

    2011-03-01

    Full Text Available Objective – To analyze factors affecting book choice: reading recommendations, reasons for choosing series books, book reviews, and school libraries.Design – This secondary analysis of data is based on a selection of findings from a larger 2005 survey that monitored trends in youth reading habits. The large scale 2005 study was designed as a follow up to a 1996 survey. The 2005 survey used online questionnaires and formal statistical analysis to compare gender and age groups. The data on factors affecting book choice were derived from the original questions, responses, and analyses.Setting – Questionnaires were administered in22 primary and 24 secondary schools in the UK with access to computers and internet.Subjects – Almost 4,200 students from 4 to 16 years of age.Methods – Study authors invited approximately 150 schools to participate in the survey. Forty-six schools (31% responded. A total of 22 primary and 24 secondary schools participated in the original study between April and June 2005.This study used comparative analysis to examine factors affecting book choice between gender and age groups. Statistical significance was defined as one percent. Other demographic information was collected, such as ethnicity, language spoken at home, and religion, but was deemed insufficient for any meaningful analysis.There were 4,182 responses to the survey, separated into three age groups: ages 4 to 7 (KS1, ages 7 to 11 (KS2, and ages 11 to 16 (KS3&4.Students were asked to describe themselves as readers by responding to multiple choice questions, and then to provide specific information on the places or people most frequently used as book borrowing sources. Participants were considered “enthusiastic” readers if they “read a lot with pleasure” and “average” readers if they “read an ordinary amount”. Participants responded to additional multiple choice questions on specific factors related to borrowing books and book choices, the process of choosing series, fiction, and nonfiction books.Main Results – Readers: The number of children who described themselves as “enthusiastic” readers decreased with age, and approximately half of the children between 7 and 16 years of age described themselves as “average” readers, average rating increasing slightly through this age group. Investigators found a marked difference in gender within the 4 to 7 year olds: 49.7% percent of girls in this age group considered themselves “enthusiastic,” compared to 37.3% of boys. Only 18.5% of girls considered themselves “reluctant” readers, compared to 28.1% of boys.The longitudinal comparison to the earlier 1996 study found that although the percentage of boys from ages 7 to 16 who described themselves as reluctant readers stayed about the same, the percentage of girls who described themselves as reluctant increased. There was also a dramatic drop in the number of girls who described themselves as enthusiastic; from 51% in 1996 to 17% in 2005.Borrowing Books: Libraries of all types (school, classroom and public were the prime sources for borrowing books. Girls borrowed more books from schools than boys, and girls also borrowed more books from non-library sources (family members and friends than boys. Both boys and girls increasingly reported borrowing more books from friends than from libraries as they grew older.Over half of each age group rated the school library or classroom book corner as having “enough” books. The perception of “too many books” decreased with age. The perception of quality of the classroom or school library also decreased with age. The number of students in the younger age groups who rated the quality of books in the classroom or school library as “very good” was significantly higher than students in the older age groups. The number of student who rated the quality as “okay” doubled from the lower to the higher age group.Choosing Books: Children were asked six questions related to whether the physical book itself provided motivation to read, and six questions related to other factors for book recommendation. Younger readers were more likely to choose a book for its visual appeal, although this factor (interesting cover or illustrations inside was more consistent for boys of all age groups than girls. The author’s name and book blurb were stronger factors for girls in the 7 to 16 age group than for boys.The study authors sought to explore the idea of “shared reading” and asked children in the 7 to 11 and 11 to 16 age groups how often they chose a book based on a recommendation from a friend or family member, a public or school librarian, or other adults. Friends were the strongest recommendation source (43.2% for 7 to 11 year olds and 38.4% for 11to 16 year olds. Recommendations from school or public librarians rated only three to six percent for both age groups.All age groups were asked about choosing series books, and the questions were simplified for the younger age group. All students reported that appealing factors were the consistency of characters, familiar storylines, and familiar writing styles. Some students also noted that the availability of series books positively affected their choices.Print or online book reviews were used “hardly ever or never” by over 40% of the 7 to16 year old age groups, while television or magazine reviews or recommendations were highly rated by over 50% of respondents in the same age groups. Participants chose informational or non-fiction books because of personal interests, hobbies, or recommendations from friends, while they selected fiction or poetry for the blurb, title, or appearance and design of the cover. Celebrity recommendations and books about celebrities were popular reasons for choosing books.When asked who helped them choose books, 53.2% in the 7 to11 age group and 66.1% in the 11to 16 age group stated that no one ever helps them. Of the students who had help choosing books, “family members” was the most common response. Local librarians were not used as a source for recommendations.

  2. Chemical consequences of radioactive decay. 1. Study of 249Cf ingrowth into crystalline 249BkBr3: a new crystalline phase of CfBr3

    International Nuclear Information System (INIS)

    Young, J.P.; Haire, R.G.; Peterson, J.R.; Ensor, D.D.; Fellows, R.L.

    1980-01-01

    Spectrophotometric and x-ray powder diffraction methods have been applied to a study of the ingrowth of californium-249 by β - decay of berkelium-249 in crystalline 249 BkBr 3 . It was found that the Cf daughter grows in with the same oxidation state and crystal structure as the parent. Thus, six-coordinate BkBr 3 (AlCl 3 -type monoclinic structure) generates six-coordinate CfBr 3 , and eight-coordinate BkBr 3 (PuBr 3 -type orthorhombic structure) generates eight-coordinate CfBr 3 , a previously unknown form of CfBr 3 . It was also found that the daughter Cf(III) in the BkBr 3 parent compound can be reduced to Cf(II) by treatment with H 2 , as it can in pure CfBr 3 . 5 figures

  3. Nuclear fission and the transuranium elements

    International Nuclear Information System (INIS)

    Seaborg, G.T.

    1989-02-01

    Many of the transuranium elements are produced and isolated in large quantities through the use of neutrons furnished by nuclear fission reactions: plutonium (atomic number 94) in ton quantities; neptunium (93), americium (95), and curium (96) in kilogram quantities; berkelium (97) in 100 milligram quantities; californium (98) in gram quantities; and einsteinium (99) in milligram quantities. Transuranium isotopes have found many practical applications---as nuclear fuel for the large-scale generation of electricity, as compact, long-lived power sources for use in space exploration, as means for diagnosis and treatment in the medical area, and as tools in numerous industrial processes. Of particular interest is the unusual chemistry and impact of these heaviest elements on the periodic table. This account will feature these aspects. 9 refs., 5 figs

  4. Nuclear fission and the transuranium elements

    Energy Technology Data Exchange (ETDEWEB)

    Seaborg, G.T.

    1989-02-01

    Many of the transuranium elements are produced and isolated in large quantities through the use of neutrons furnished by nuclear fission reactions: plutonium (atomic number 94) in ton quantities; neptunium (93), americium (95), and curium (96) in kilogram quantities; berkelium (97) in 100 milligram quantities; californium (98) in gram quantities; and einsteinium (99) in milligram quantities. Transuranium isotopes have found many practical applications---as nuclear fuel for the large-scale generation of electricity, as compact, long-lived power sources for use in space exploration, as means for diagnosis and treatment in the medical area, and as tools in numerous industrial processes. Of particular interest is the unusual chemistry and impact of these heaviest elements on the periodic table. This account will feature these aspects. 9 refs., 5 figs.

  5. ORF Alignment: NC_005362 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available TALTKLRSYSRELEKSLKERHFLANCVVLKVRDANFKTI 312 ... ERNRKSIGIERTFNQNLFDENTALTKLR...SYSRELEKSLKERHFLANCVVLKVRDANFKTI Sbjct: 241 ERNRKSIGIERTFNQNLFDENTALTKLRSYSRELEKSLKERHFLANCVVLKVRDANFKTI 300 ... ...ct: 121 PVRIAALLQERIYQRIGLTSSFGVSYNKFLAKMGSEYAKPFGRTVIKPEGARDFLAKQPI 180 ... Query: 253 ERNRKSIGIERTFNQNLFDEN

  6. ORF Alignment: NC_004193 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available PVHFIQGDATEDDTIKKA Sbjct: 1 ... HFIFVGWNERTRQLMKLVLEYYPGRRIVVIDKTVNKLTYKEYPVHFIQGDATEDDTIKKA 60 ... Query: 236 TIIRSN...DFMSNLFFHELD 253 ... TIIRSNDFMSNLFFHELD Sbjct: 121 TIIRSNDFMSNLFFHELD 138

  7. Dicty_cDB: Contig-U09533-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 33308 |pid:none) Anabas testudineus cyclin-dependen... 253 1e-65 BC061617_1( BC06..... 253 1e-65 EU006765_1( EU006765 |pid:none) Gossypium hirsutum cultivar des119... 253 1e-65 AY533308_1( AY5

  8. Format Guide for Scientific and Technical Reports.

    Science.gov (United States)

    1984-01-01

    supported by the discussion. Graphkic Services The Graphic Services Section (Code 2632) provides a variety of layout and design services. Camera-ready artwork...complex typography , elaborate graphic elements, extensive computer printouts, and other unusual materials that explain the project. With few exceptions...2630 Publications Branch Office 222/253 72379 S Publications Control Center 222/253 73508 Editorial 222/253 72782 Graphic Services 222/234 72756 73989

  9. Archeological Excavations at Two Prehistoric Campsites Near Keystone Dam, El Paso, Texas.

    Science.gov (United States)

    1985-07-19

    Flotacion Microdebitate Analysis 246 Groundstone Artifacts 253 Slab Metates 253 Manos 253 PesLIes 253 Groundstone Fragments 263 Anvils 263 Polishing...important new information to our understanding of local prehistory. The bulk ot O’LaugnliLn’s (1980) work in the area was directed toward the excavation...contains or summarizes the bulk of L111 ptiiaisiitd( iaci on iitnic artiract frequenCies irom El Paso ’Ir’Ia Sites. fhese data, along with those from the

  10. ORF Alignment: NC_002678 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available esorhizobium ... loti MAFF303099] ... Length = 291 ... Query: 194 YTFATLVDPHEELPPSEISSLRYWAKIAEKM...GVEIEPITRKDLAKLANYDALFIRETTSI 253 ... YTFATLVDPHEELPPSEISSLRYWAKIAEKMGVEIE...PITRKDLAKLANYDALFIRETTSI Sbjct: 1 ... YTFATLVDPHEELPPSEISSLRYWAKIAEKMGVEIEPITRKDLAKLANYDALFIRETTSI 60 ... Query:

  11. Characterization of a Viking Blade Fabricated by Traditional Forging Techniques

    Science.gov (United States)

    Vo, H.; Frazer, D.; Bailey, N.; Traylor, R.; Austin, J.; Pringle, J.; Bickel, J.; Connick, R.; Connick, W.; Hosemann, P.

    2016-12-01

    A team of students from the University of California, Berkeley, participated in a blade-smithing competition hosted by the Minerals, Metals, and Materials Society at the TMS 2015 144th annual meeting and exhibition. Motivated by ancient forging methods, the UC Berkeley team chose to fabricate our blade from historical smithing techniques utilizing naturally-occurring deposits of iron ore. This approach resulted in receiving the "Best Example of a Traditional Blade Process/Ore Smelting Technique" award for our blade named "Berkelium." First, iron-enriched sand was collected from local beaches. Magnetite (Fe3O4) was then extracted from the sand and smelted into individual high- and low-carbon steel ingots. Layers of high- and low-carbon steels were forge-welded together, predominantly by hand, to form a composite material. Optical microscopy, energy dispersive spectroscopy, and Vickers hardness mechanical testing were conducted at different stages throughout the blade-making process to evaluate the microstructure and hardness evolution during formation. It was found that the pre-heat-treated blade microstructure was composed of ferrite and pearlite, and contained many nonmetallic inclusions. A final heat treatment was performed, which caused the average hardness of the blade edge to increase by more than a factor of two, indicating a martensitic transformation.

  12. Nuclear Chemistry Institute, Mainz University. Annual Report 1995

    International Nuclear Information System (INIS)

    Denschlag, H.O.

    1996-03-01

    The annual report of the Institut fuer Kernchemie addresses inter alia three main research activities. The first belongs to the area of basic research, covering studies in the fields of nuclear fission, chemistry of the super-heavy elements and of heavy-ion reactions extending from the Coulomb barrier to relativistic energies, and nuclear astrophysics in connection with the ''r process''. By means of laser technology, high-precision data could be measured of the ionization energies of berkelium and californium. Studies of atomic clusters in the vacuum of an ionization trap revealed interesting aspects. The second major activity was devoted to the analysis of environmental media, applying inter alia neutron activation analysis and resonance ionization mass spectroscopy (RIMS). The third activity resulted in the development of novel processes, or the enhancement of existing processes or methods, for applications in basic research work and in environmental analytics. Another item of interest is the summarizing report on the operation of the TRIGA research reactor. (orig./SR) [de

  13. The Transplutonium. The superheavy nuclei found in the micas of Madagascar and their interests

    International Nuclear Information System (INIS)

    Raoelina Andriambololona

    1976-01-01

    Since June 1976, evidence for the existence of superheavy elements is discussed about. After having recalled artificial elements with atomic numbers Z of wich go from Z=95 (Americium) to Z=107 (built in 1976), superheavy elements having Z greater than 110 are considered. They have been discovered by american searchers in giant halos seen in Madagascar micas. The samples have been recoked in the Fort-Dauphin region (Haut Mandrare). The corresponding numbers Z are 114, 115, 116, 124, 125, 125, 126, 127. It seems that the existence of Z=126 element should be accepted with a greater degree of confidence. But different experiences done by other groups seem to show the evidence of superheavy elements in micas looks weaker. Nevertheless, it is interesting to investigate the evidence or the non-evidence of those elements. We estimate the mass numbers A of those superheavy elements in the liquid drop model if we assume that they are stable versus β. The results thus obtained agree with the shell-model ones within 4 % approximation. We propose if the evidence of superheavies is confirmed to give the name of madagascarium to one of them (Z=126) by similitude with francium, lutetium, polonium, berkelium, americium, europium, ...Their evidence was first conjectured in Madagascar micas in 1976. Superheavy nuclei are to be distinguished from hypernuclei. [fr

  14. Identification of the new isotope sup 2 sup 4 sup 1 Bk

    CERN Document Server

    Asai, M; Ichikawa, S; Nagame, Y; Nishinaka, I; Akiyama, K; Toyoshima, A; Kaneko, T; Sakama, M; Haba, H; Oura, Y; Kojima, Y; Shibata, M

    2003-01-01

    A new neutron-deficient berkelium isotope sup 2 sup 4 sup 1 Bk produced in the sup 2 sup 3 sup 9 Pu( sup 6 Li, 4n) reaction has been identified using a gas-jet coupled on-line isotope separator. Cm K and L X-rays associated with the EC decay of sup 2 sup 4 sup 1 Bk were observed in the mass-241 fraction, and three gamma transitions were attributed to the EC decay of sup 2 sup 4 sup 1 Bk through X-gamma coincidences. The half-life of sup 2 sup 4 sup 1 Bk was determined to be 4.6+-0.4 min which is 1/2-1/4 of that of theoretical predictions. The half-life value and the observed gamma transitions can be consistently explained as a consequence of the allowed EC transition of pi 7/2 sup + [633] -> nu 7/2 sup + [624]. (orig.)

  15. The creation of new nuclei

    International Nuclear Information System (INIS)

    Armbruster, P.; Hessberger, F.P.

    1998-01-01

    In the last 60 years physicists have created 20 artificial elements beyond uranium. In 1934 Enrico Fermi predicted the creation of new elements by bombarding atoms with neutrons. This method led to the discovery of neptunium (Z=93), plutonium, americium, curium, berkelium, californium, einsteinium and fermium (Z=100). In fact the capture of a neutron is followed by a beta-decay which increases the atomic number (Z) by one unit. Beyond Z=100 beta-decay no more occurs so a new approach was necessary. Between the American Lawrence Berkeley Laboratory and the Russian Dubna Institute a fierce competition broke out to produce new elements by bombarding transuranium nuclei with light elements such as helium, carbon, nitrogen. This new method required heavy equipment: ion accelerator and detectors but led to the creation of all the elements from Z=101 to Z=106. A new idea was to provoke the fusion of heavy nuclei such as lead and bismuth with colliding argon, nickel or zinc ion beams. This method called 'cold fusion' opened the way to reach the nuclei beyond Z=107. In 1996 the element Z=112 was the last discovered. The next step could be the element Z=114 for which a particular stability is expected. (A.C.)

  16. Actinide metals

    Energy Technology Data Exchange (ETDEWEB)

    Brown, Paul L. [Geochem Australia, Kiama, NSW (Australia); Ekberg, Christian [Chalmers Univ. of Technology, Goeteborg (Sweden). Nuclear Chemistry/Industrial Materials Recycling

    2016-07-01

    All isotopes of actinium are radioactive and exist in aqueous solution only in the trivalent state. There have been very few studies on the hydrolytic reactions of actinium(III). The hydrolysis reactions for uranium would only be important in alkaline pH conditions. Thermodynamic parameters for the hydrolysis species of uranium(VI) and its oxide and hydroxide phases can be determined from the stability and solubility constants. The hydrolytic behaviour of neptunium(VI) is quite similar to that of uranium(VI). The solubility constant of NpO{sub 2}OH(am) has been reported a number of times for both zero ionic strength and in fixed ionic strength media. Americium can form four oxidation states in aqueous solution, namely trivalent, tetravalent, pentavalent and hexavalent. Desire, Hussonnois and Guillaumont determined stability constants for the species AmOH{sup 2+} for the actinides, plutonium(III), americium(III), curium(III), berkelium(III) and californium(III) using a solvent extraction technique.

  17. Management of nuclear materials in an R ampersand D environment at the Los Alamos National Laboratory

    International Nuclear Information System (INIS)

    Behrens, R.G.; Roth, S.B.; Jones, S.R.

    1991-01-01

    Los Alamos National Laboratory is a multidisciplinary R ampersand D organization and, as such, its nuclear materials inventory is diverse. Accordingly, major inventories of isotopes such as Pu-238, Pu-239, Pu-242, U-235, Th, tritium, and deuterium, and lesser amounts of isotopes of Am, Cm, Np and exotic isotopes such as berkelium must be managed in accordance with Department of Energy Orders and Laboratory policies. Los Alamos also acts as a national resource for many one-of-a-kind materials which are supplied to universities, industry, and other government agencies within the US and throughout the world. Management of these materials requires effective interaction and communication with many nuclear materials custodians residing in over forty technical groups as well as effective interaction with numerous outside organizations. This paper discusses the role, philosophy, and organizational structure of Nuclear Materials Management at Los Alamos and also briefly presents results of two special nuclear materials management projects: 1- Revision of Item Description Codes for use in the Los Alamos nuclear material data base and 2- The recommendation of new economic discard limits for Pu-239. 2 refs., 1 fig

  18. Extraction of transplutonium elements from carbonate solutions by alkylpyrocatechol

    International Nuclear Information System (INIS)

    Karalova, Z.K.; Myasoedov, B.F.; Rodionova, L.M.; Kuznetsova, V.S.

    1983-01-01

    Extraction of americium, berkelium as well as Ce, Eu, Th, U, Zr, Cs, Fe with solution of 4(α, α-dioctylethyl)pyrocatechol (DOP) in toluene from carbonate solutions to determine conditions of their separation has been studied. It is established that americium extraction is quite sensitive to the changes of potassium carbonate concentration. The maximum extraction of americium (R >90%) is observed in the case of 0.1-0.5 mol/l of K 2 CO 3 solutions and the minimum one (R=2.5%) - in the case of 8 mol/l K 2 CO 3 . Americium extraction increases sharply when sodium hydroxide is introduced in carbonate solutions. It is shown that varying sodium hydroxide concentration it is possible to achieve qualitative extraction of americium even from saturated solution of potassium carbonate. Reextraction of TPE is easily realized with 3 mol/l HCl solution. The system K 2 CO 3 (KOH)-DOP proved to be perspective for Am separation from Bk, Ce, Cs, actinoid elements as well as from Fe

  19. Actinide metals

    International Nuclear Information System (INIS)

    Brown, Paul L.; Ekberg, Christian

    2016-01-01

    All isotopes of actinium are radioactive and exist in aqueous solution only in the trivalent state. There have been very few studies on the hydrolytic reactions of actinium(III). The hydrolysis reactions for uranium would only be important in alkaline pH conditions. Thermodynamic parameters for the hydrolysis species of uranium(VI) and its oxide and hydroxide phases can be determined from the stability and solubility constants. The hydrolytic behaviour of neptunium(VI) is quite similar to that of uranium(VI). The solubility constant of NpO 2 OH(am) has been reported a number of times for both zero ionic strength and in fixed ionic strength media. Americium can form four oxidation states in aqueous solution, namely trivalent, tetravalent, pentavalent and hexavalent. Desire, Hussonnois and Guillaumont determined stability constants for the species AmOH 2+ for the actinides, plutonium(III), americium(III), curium(III), berkelium(III) and californium(III) using a solvent extraction technique.

  20. Paul Scherrer Institute Scientific Report 1999. Volume I: Particles and Matter

    International Nuclear Information System (INIS)

    Gobrecht, J.; Gaeggeler, H.; Herlach, D.; Junker, K.; Kettle, P.-R.; Kubik, P.; Zehnder, A.

    2000-01-01

    Although originally planned for fundamental research in nuclear physics, the particle beams of pions, muons, protons and neutrons are now used in a large variety of disciplines in both natural science and medicine. The beams at PSI have the world's highest intensities and therefore allow certain experiments to be performed, which would not be possible elsewhere. The highlight of research this year was the first-ever determination of the chemical properties of the superheavy element 107 Bohrium. This was undertaken, by an international team led by H. Gaeggeler of PSI's Laboratory for Radiochemistry. Bohrium was produced by bombarding a Berkelium target with Neon ions from the Injector I cyclotron and six atoms were detected after having passed through an online gas chromatography device. At the Laboratory for Particle Physics the focus has shifted from nuclear physics to elementary particle physics with about a fifty-fifty split between investigations of rare processes or particle decays using the high intensity muon, pion and recently also polarized neutron beams of PSI, and research at the highest energy frontier at CERN (Geneva) and DESY (Hamburg). Important space instrumentation has been contributed by the Laboratory for Astrophysics to the European Space Agency and NASA satellite programmes. The Laboratory for Micro and Nanotechnology continued to focus on research into molecular nanotechnology and SiGeC nanostructures, the latter with the aim of producing silicon based optoelectronics. Progress in 1999 in these topical areas is described in this report. A list of scientific publications in 1999 is also provided

  1. Paul Scherrer Institute Scientific Report 1999. Volume I: Particles and Matter

    Energy Technology Data Exchange (ETDEWEB)

    Gobrecht, J; Gaeggeler, H; Herlach, D; Junker, K; Kettle, P -R; Kubik, P; Zehnder, A [eds.

    2000-07-01

    lthough originally planned for fundamental research in nuclear physics, the particle beams of pions, muons, protons and neutrons are now used in a large variety of disciplines in both natural science and medicine. The beams at PSI have the world's highest intensities and therefore allow certain experiments to be performed, which would not be possible elsewhere. The highlight of research this year was the first-ever determination of the chemical properties of the superheavy element {sup 107} Bohrium. This was undertaken, by an international team led by H. Gaeggeler of PSI's Laboratory for Radiochemistry. Bohrium was produced by bombarding a Berkelium target with Neon ions from the Injector I cyclotron and six atoms were detected after having passed through an online gas chromatography device. At the Laboratory for Particle Physics the focus has shifted from nuclear physics to elementary particle physics with about a fifty-fifty split between investigations of rare processes or particle decays using the high intensity muon, pion and recently also polarized neutron beams of PSI, and research at the highest energy frontier at CERN (Geneva) and DESY (Hamburg). Important space instrumentation has been contributed by the Laboratory for Astrophysics to the European Space Agency and NASA satellite programmes. The Laboratory for Micro and Nanotechnology continued to focus on research into molecular nanotechnology and SiGeC nanostructures, the latter with the aim of producing silicon based optoelectronics. Progress in 1999 in these topical areas is described in this report. A list of scientific publications in 1999 is also provided.

  2. Investigations for the influence of geochemical parameters on the sorption and desorption of lanthanides and uranium onto opalinus clay as potential host rock for a repository

    International Nuclear Information System (INIS)

    Moeser, Christina

    2010-01-01

    The development of a disposal in deep geological formations for radioactive waste is a very important task for the future. The safety assessment for more than a hundred thousand years needs a full understanding of all processes of interaction between the radioactive waste and the surrounded formations. This work contributes to this understanding. The interaction between lanthanides (homologues of the actinides americium, curium and berkelium) / uranium and the host rock opalinus clay under influence of organic substances (NOM) have been analyzed and discussed. The complex system was split into 3 binary basic systems with the following interactions - Interactions between lanthanides / uranium and NOM - Interactions between lanthanides / uranium and the opalinus clay - Interactions between NOM and opalinus clay All binary systems can be influenced by geological parameters like pH, ion strength and competing cations. The sorption / desorption of the lanthanides onto the opalinus clay is analyzed via inductively coupled plasma mass spectrometry. For the investigation of the complexation behavior of metals with NOM we used capillary electrophoresis coupled with inductively coupled plasma mass spectrometry. Under these conditions the chosen model organic humic acid affected the sorption of the lanthanides onto opalinus clay favorably. The smaller organic compounds, which dominate in the composition of the clay organics, remobilized the metals after sorption onto clay and the sorption can be inhibited by NOM. Due to the reduced metal sorption onto Opalinus clay by NOM, a migration through the clay may be possible.

  3. Fluorescence and excitation spectra of Bk3+, Cf3+, and Es3+ ions in single crystals of LaCl3

    International Nuclear Information System (INIS)

    Hessler, J.P.; Caird, J.A.; Carnall, W.T.; Crosswhite, H.M.; Sjoblom, R.K.; Wagner, F. Jr.

    1978-01-01

    Dye laser techniques have been used to study the energy level structure of the heavier actinides in single crystals of lanthanum chloride. In the case of einsteinium, fluorescence was detected and measured from the following manifolds: J = 5 at 0.984 μm -1 , J = 4 at 1.572 μm -1 , J = 6 at 2.930 μm -1 . This fluorescence was observed to the five lowest manifolds: J = 8, 5, 7, 2, 6. For californium, fluorescence has been detected from the manifolds: J = 11/2 at 1.190 μm -1 , J = 7/2 at 1.389 μm -1 , J = 5/2 at 1.977 μm -1 . This fluorescence was observed to the three lowest manifolds: J = 15/2, 9/2, 11/2. The fluorescence manifolds of berkelium are J = 6 at 1.540 μm -1 , and J = 4 at 1.953 μm -1 . The three lowest manifolds, J = 6, 5, and 4, have been observed in fluorescence. Absorption spectra data have yielded crystal-field splitting measurements in the higher manifolds of Es + . The location of the manifolds in general confirmed earlier approximate free-ion level structure calculations based on assumed regularities in the energy level parameters derived from spectra of the actinide ions through Cf + . 2 figures

  4. 4-Chloro-N-(3,4,5-trimethoxybenzylidene)aniline

    Czech Academy of Sciences Publication Activity Database

    Khalaji, A.D.; Asghari, J.; Fejfarová, Karla; Dušek, Michal

    2009-01-01

    Roč. 65, - (2009), o253-o253 ISSN 1600-5368 R&D Projects: GA ČR GC202/07/J008 Institutional research plan: CEZ:AV0Z10100521 Keywords : X-ray diffraction * Jana 2006 Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.411, year: 2009

  5. Vaginal Yeast Infections

    Science.gov (United States)

    ... Tract . Clinical Microbiology Reviews; 23(2): 253–273. Ferris, D.G., Nyirjesy, P., Sobel, J.D., Soper, ... Tract . Clinical Microbiology Reviews; 23(2): 253–273. Ferris, D.G., Nyirjesy, P., Sobel, J.D., Soper, ...

  6. Body dimensions and coloration of the winter pelage of a Moravian population of sika deer, Cervus nippon

    Czech Academy of Sciences Publication Activity Database

    Heroldová, Marta; Zejda, J.

    2002-01-01

    Roč. 51, č. 3 (2002), s. 253-256 ISSN 0139-7893 R&D Projects: GA AV ČR IBS6093003 Institutional research plan: CEZ:AV0Z6093917 Keywords : sika deer * body dimensions * coloration Subject RIV: EG - Zoology Impact factor: 0.234, year: 2002 http://www.ivb.cz/folia/51/3/253-256.pdf

  7. Musik som analogi og metafor

    DEFF Research Database (Denmark)

    Bonde, Lars Ole

    2014-01-01

    Indeholder underkapitlerne: 2.5.1 Musik som analogi 2.5.2 Musik som metafor 2.5.3 Musikkens psykologiske funktioner - en taxonomi og metaforisk lytning til fire baroksatser......Indeholder underkapitlerne: 2.5.1 Musik som analogi 2.5.2 Musik som metafor 2.5.3 Musikkens psykologiske funktioner - en taxonomi og metaforisk lytning til fire baroksatser...

  8. 78 FR 1220 - Agency Information Collection Activities: Guarantee of Payment

    Science.gov (United States)

    2013-01-08

    .... Abstract: Section 253 of the Immigration and Nationality Act (INA) requires that an alien crewman found to... provided for by 8 CFR 253.1 and is accessible at: http://forms.cbp.gov/pdf/CBP_Form_i510.pdf . Action: CBP...

  9. Inflation expectations in the Czech interbank market

    Czech Academy of Sciences Publication Activity Database

    Fukač, Martin

    -, č. 253 (2005), s. 1-30 ISSN 1211-3298 Institutional research plan: CEZ:AV0Z70850503 Keywords : inflation expectations * nominal interest rate * Fisher rule Subject RIV: AH - Economics http://www.cerge-ei.cz/pdf/wp/Wp253.pdf

  10. 24 CFR 213.259a - Premiums-mortgages insured pursuant to section 238(c) of the Act.

    Science.gov (United States)

    2010-04-01

    .... All of the provisions of §§ 213.253 through 213.259 governing mortgage insurance premiums shall apply... mortgage insurance premiums due on such mortgages in accordance with §§ 213.253 through 213.259 shall be... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Premiums-mortgages insured pursuant...

  11. Structures of BmrR-Drug Complexes Reveal a Rigid Multidrug Binding Pocket And Transcription Activation Through Tyrosine Expulsion

    Energy Technology Data Exchange (ETDEWEB)

    Newberry, K.J.; Huffman, J.L.; Miller, M.C.; Vazquez-Laslop, N.; Neyfakh, A.A.; Brennan, R.G.

    2009-05-22

    BmrR is a member of the MerR family and a multidrug binding transcription factor that up-regulates the expression of the bmr multidrug efflux transporter gene in response to myriad lipophilic cationic compounds. The structural mechanism by which BmrR binds these chemically and structurally different drugs and subsequently activates transcription is poorly understood. Here, we describe the crystal structures of BmrR bound to rhodamine 6G (R6G) or berberine (Ber) and cognate DNA. These structures reveal each drug stacks against multiple aromatic residues with their positive charges most proximal to the carboxylate group of Glu-253 and that, unlike other multidrug binding pockets, that of BmrR is rigid. Substitution of Glu-253 with either alanine (E253A) or glutamine (E253Q) results in unpredictable binding affinities for R6G, Ber, and tetraphenylphosphonium. Moreover, these drug binding studies reveal that the negative charge of Glu-253 is not important for high affinity binding to Ber and tetraphenylphosphonium but plays a more significant, but unpredictable, role in R6G binding. In vitro transcription data show that E253A and E253Q are constitutively active, and structures of the drug-free E253A-DNA and E253Q-DNA complexes support a transcription activation mechanism requiring the expulsion of Tyr-152 from the multidrug binding pocket. In sum, these data delineate the mechanism by which BmrR binds lipophilic, monovalent cationic compounds and suggest the importance of the redundant negative electrostatic nature of this rigid drug binding pocket that can be used to discriminate against molecules that are not substrates of the Bmr multidrug efflux pump.

  12. MYT1L mutations cause intellectual disability and variable obesity by dysregulating gene expression and development of the neuroendocrine hypothalamus

    OpenAIRE

    Blanchet, P.; Bebin, M.; Bruet, S,; Cooper, G.M.; Thompson, M.L.; Duban-Bedu, B.; Gerard, B.; Piton, A.; Suckno, S.; Deshpande, C.; Clowes, V.; Vogt, J.; Turnpenny, P.; Williamson, M.P.; Alembik, Y.

    2017-01-01

    Deletions at chromosome 2p25.3 are associated with a syndrome consisting of intellectual disability and obesity. The smallest region of overlap for deletions at 2p25.3 contains PXDN and MYT1L. MYT1L is expressed only within the brain in humans. We hypothesized that single nucleotide variants (SNVs) in MYT1L would cause a phenotype resembling deletion at 2p25.3. To examine this we sought MYT1L SNVs in exome sequencing data from 4, 296 parent-child trios. Further variants were identified throug...

  13. Actinide production in the reaction of heavy ions with curium-248

    International Nuclear Information System (INIS)

    Moody, K.J.

    1983-07-01

    Chemical experiments were performed to examine the usefulness of heavy ion transfer reactions in producing new, neutron-rich actinide nuclides. A general quasi-elastic to deep-inelastic mechanism is proposed, and the utility of this method as opposed to other methods (e.g. complete fusion) is discussed. The relative merits of various techniques of actinide target synthesis are discussed. A description is given of a target system designed to remove the large amounts of heat generated by the passage of a heavy ion beam through matter, thereby maximizing the beam intensity which can be safely used in an experiment. Also described is a general separation scheme for the actinide elements from protactinium (Z=91) to mendelevium (Z=101), and fast specific procedures for plutonium, americium and berkelium. The cross sections for the production of several nuclides from the bombardment of 248 Cm with 18 O, 86 Kr and 136 Xe projectiles at several energies near and below the Coulomb barrier were determined. The results are compared with yields from 48 Ca and 238 U bombardments of 248 Cm. Simple extrapolation of the product yields into unknown regions of charge and mass indicates that the use of heavy ion transfer reactions to produce new, neutron-rich above-target species is limited. The substantial production of neutron-rich below-target species, however, indicates that with very heavy ions like 136 Xe and 238 U the new species 248 Am, 249 Am and 247 Pu should be produced with large cross sections from a 248 Cm target. A preliminary, unsuccessful attempt to isolate 247 Pu is outlined. The failure is probably due to the half life of the decay, which is calculated to be less than 3 minutes. The absolute gamma ray intensities from 251 Bk decay, necessary for calculating the 251 Bk cross section, are also determined

  14. Radiochemical studies of neutron deficient actinide isotopes

    International Nuclear Information System (INIS)

    Williams, K.E.

    1978-04-01

    The production of neutron deficient actinide isotopes in heavy ion reactions was studied using alpha, gamma, x-ray, and spontaneous fission detection systems. A new isotope of berkelium, 242 Bk, was produced with a cross-section of approximately 10 μb in reactions of boron on uranium and nitrogen on thorium. It decays by electron capture with a half-life of 7.0 +- 1.3 minutes. The alpha-branching ratio for this isotope is less than 1% and the spontaneous fission ratio is less than 0.03%. Studies of (Heavy Ion, pxn) and (Heavy Ion, αxn) transfer reactions in comparison with (Heavy ion, xn) compound nucleus reactions revealed transfer reaction cross-sections equal to or greater than the compound nucleus yields. The data show that in some cases the yield of an isotope produced via a (H.I.,pxn) or (H.I.,αxn) reaction may be higher than its production via an xn compound nucleus reaction. These results have dire consequences for proponents of the ''Z 1 + Z 2 = Z/sub 1+2/'' philosophy. It is no longer acceptable to assume that (H.I.,pxn) and (H.I.,αxn) product yields are of no consequence when studying compound nucleus reactions. No evidence for spontaneous fission decay of 228 Pu, 230 Pu, 232 Cm, or 238 Cf was observed indicating that strictly empirical extrapolations of spontaneous fission half-life data is inadequate for predictions of half-lives for unknown neutron deficient actinide isotopes

  15. Radiochemical studies of neutron deficient actinide isotopes

    Energy Technology Data Exchange (ETDEWEB)

    Williams, K.E.

    1978-04-01

    The production of neutron deficient actinide isotopes in heavy ion reactions was studied using alpha, gamma, x-ray, and spontaneous fission detection systems. A new isotope of berkelium, /sup 242/Bk, was produced with a cross-section of approximately 10 ..mu..b in reactions of boron on uranium and nitrogen on thorium. It decays by electron capture with a half-life of 7.0 +- 1.3 minutes. The alpha-branching ratio for this isotope is less than 1% and the spontaneous fission ratio is less than 0.03%. Studies of (Heavy Ion, pxn) and (Heavy Ion, ..cap alpha..xn) transfer reactions in comparison with (Heavy ion, xn) compound nucleus reactions revealed transfer reaction cross-sections equal to or greater than the compound nucleus yields. The data show that in some cases the yield of an isotope produced via a (H.I.,pxn) or (H.I.,..cap alpha..xn) reaction may be higher than its production via an xn compound nucleus reaction. These results have dire consequences for proponents of the ''Z/sub 1/ + Z/sub 2/ = Z/sub 1+2/'' philosophy. It is no longer acceptable to assume that (H.I.,pxn) and (H.I.,..cap alpha..xn) product yields are of no consequence when studying compound nucleus reactions. No evidence for spontaneous fission decay of /sup 228/Pu, /sup 230/Pu, /sup 232/Cm, or /sup 238/Cf was observed indicating that strictly empirical extrapolations of spontaneous fission half-life data is inadequate for predictions of half-lives for unknown neutron deficient actinide isotopes.

  16. Paul Scherrer Institute Scientific Report 1999. Volume I: Particles and Matter

    Energy Technology Data Exchange (ETDEWEB)

    Gobrecht, J.; Gaeggeler, H.; Herlach, D.; Junker, K.; Kettle, P.-R.; Kubik, P.; Zehnder, A. [eds.

    2000-07-01

    lthough originally planned for fundamental research in nuclear physics, the particle beams of pions, muons, protons and neutrons are now used in a large variety of disciplines in both natural science and medicine. The beams at PSI have the world's highest intensities and therefore allow certain experiments to be performed, which would not be possible elsewhere. The highlight of research this year was the first-ever determination of the chemical properties of the superheavy element {sup 107} Bohrium. This was undertaken, by an international team led by H. Gaeggeler of PSI's Laboratory for Radiochemistry. Bohrium was produced by bombarding a Berkelium target with Neon ions from the Injector I cyclotron and six atoms were detected after having passed through an online gas chromatography device. At the Laboratory for Particle Physics the focus has shifted from nuclear physics to elementary particle physics with about a fifty-fifty split between investigations of rare processes or particle decays using the high intensity muon, pion and recently also polarized neutron beams of PSI, and research at the highest energy frontier at CERN (Geneva) and DESY (Hamburg). Important space instrumentation has been contributed by the Laboratory for Astrophysics to the European Space Agency and NASA satellite programmes. The Laboratory for Micro and Nanotechnology continued to focus on research into molecular nanotechnology and SiGeC nanostructures, the latter with the aim of producing silicon based optoelectronics. Progress in 1999 in these topical areas is described in this report. A list of scientific publications in 1999 is also provided.

  17. Minor Actinides Recycling in PWRs

    International Nuclear Information System (INIS)

    Delpech, M.; Golfier, H.; Vasile, A.; Varaine, F.; Boucher, L.; Greneche, D.

    2006-01-01

    Recycling of minor actinides in current and near future PWR is considered as one of the options of the general waste management strategy. This paper presents the analysis of this option both from the core physics and fuel cycle point of view. A first indicator of the efficiency of different neutron spectra for transmutation purposes is the capture to fission cross sections ratio which is less favourable by a factor between 5 to 10 in PWRs compared to fast reactors. Another indicator presented is the production of high ranking isotopes like Curium, Berkelium or Californium in the thermal or epithermal spectrum conditions of PWR cores by successive neutron captures. The impact of the accumulation of this elements on the fabrication process of such PWR fuels strongly penalizes this option. The main constraint on minor actinides loadings in PWR (or fast reactors) fuels are related to their direct impact (or the impact of their transmutation products) on the reactivity coefficients, the reactivity control means and the core kinetics parameters. The main fuel cycle physical parameters like the neutron source, the alpha decay power, the gamma and neutrons dose rate and the criticality aspects are also affected. Recent neutronic calculations based on a reference core of the Evolutionary Pressurized Reactor (EPR), indicates typical maximum values of 1 % loadings. Different fuel design options for minor actinides transmutation purposes in PWRs are presented: UOX and MOX, homogeneous and heterogeneous assemblies. In this later case, Americium loading is concentrated in specific pins of a standard UOX assembly. Recycling of Neptunium in UOX and MOX fuels was also studied to improve the proliferation resistance of the fuel. The impact on the core physics and penalties on Uranium enrichment were underlined in this case. (authors)

  18. Transuranium Processing Plant semiannual report of production, status, and plans for period ending December 31, 1975

    International Nuclear Information System (INIS)

    King, L.J.; Bigelow, J.E.; Collins, E.D.

    1976-10-01

    Between July 1, 1975, and December 31, 1975, maintenance was conducted at TRU for a period of three months, 295 g of curium oxide (enough for approximately 26 HFIR targets) were prepared, 100 mg of high-purity 248 Cm, were separated from 252 Cf that had been purified during earlier periods, 11 HFIR targets were fabricated, and 28 product shipments were made. No changes were made in the chemical processing flowsheets normally used at TRU during this report period. However, three equipment racks were replaced (with two new racks) during this time. In Cubicle 6, the equipment replaced was that used to decontaminate the transplutonium elements from rare earth fission products and to separate curium from the heavier elements by means of the LiCl-based anion-exchange process. In Cubicle 5, the equipment used to separate the transcurium elements by high-pressure ion exchange and to purify berkelium by batch solvent extraction was replaced. Two neutron sources were fabricated, bringing the total fabricated to 79. One source that had been used in a completed project was returned to the TRU inventory and is available for reissue. Three sources, for which no further use was foreseen, were processed to isolate and recover the ingrown 248 Cm and the residual 252 Cf. Eight pellets, each containing 100 μg of high-purity 248 Cm were prepared for irradiation in HFIR to study the production of 250 Cm. The values currently being used for transuranium element decay data and for cross-section data in planning irradiation-processing cycles, calculating production forecasts, and assaying products are tabulated

  19. Predictors of risky sexual behaviour among young people in the era ...

    African Journals Online (AJOL)

    AJRH Managing Editor

    people's practicing risky sexual behaviour in the era of HIV/AIDS. Data used in ... pregnancies, unsafe induced abortion and HIV .... additional selection criteria. ...... India. International. Family. Planning. Perspectives 1999; 25(3): 139-146. 18.

  20. Structure and ecology of freshwater benthic diatom communities from Byers Peninsula, Livingston Island, South Shetland Islands

    Czech Academy of Sciences Publication Activity Database

    Kopalová, Kateřina; Van de Vijver, B.

    2013-01-01

    Roč. 25, č. 2 (2013), s. 239-253 ISSN 0954-1020 Institutional support: RVO:67985939 Keywords : Bacillariophyta * lakes * Maritime Antarctic Region Subject RIV: EF - Botanics Impact factor: 1.417, year: 2013

  1. Quenching of photoluminescence of Rhodamine 6G molecules on functionalized graphene

    Czech Academy of Sciences Publication Activity Database

    Valeš, Václav; Kovaříček, Petr; Ji, X.; Ling, X.; Kong, J.; Dresselhaus, M. S.; Kalbáč, Martin

    2016-01-01

    Roč. 253, č. 12 (2016), s. 2347-2350 ISSN 0370-1972 Institutional support: RVO:61388955 Keywords : atomic force microscopy * functionalized graphene * photoluminiscence quenching Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.674, year: 2016

  2. Effects of the Size of Cosmological N-body Simulations on Physical ...

    Indian Academy of Sciences (India)

    Apart from N-body simulations, an analytical prescription given by Press & ...... Little, B., Weinberg, D. H., Park, C. 1991, MNRAS, 253, 295. Ma, C.-P. ... Padmanabhan, T. 1993, Structure Formation in the Universe, Cambridge University Press.

  3. 75 FR 26301 - Self-Regulatory Organizations; BATS Exchange, Inc.; Notice of Filing and Immediate Effectiveness...

    Science.gov (United States)

    2010-05-11

    ... SYMC Symantec Corp. 162 TIVO TiVo Inc 253 AMED Amedisys Inc. 163 MNKD MannKind Corp 255 TM Toyota Motor... Marvell Technology Group 273 EP El Paso Corp. Ltd. 215 XLP Consumer Staples Select 274 SEED Origin...

  4. 75 FR 25895 - Self-Regulatory Organizations; Notice of Filing and Immediate Effectiveness of a Proposed Rule...

    Science.gov (United States)

    2010-05-10

    ... Symantec Corp. 162 TIVO TiVo Inc 253 AMED Amedisys Inc. 163 MNKD MannKind Corp 255 TM Toyota Motor Corp... Marvell Technology Group 273 EP El Paso Corp. Ltd. 215 XLP Consumer Staples Select 274 SEED Origin...

  5. Ecotoxicity and genotoxicity assessment of cytotoxic antineoplastic drugs and their metabolites

    Czech Academy of Sciences Publication Activity Database

    Zounková, R.; Kovalová, L.; Bláha, Luděk; Dott, W.

    2010-01-01

    Roč. 81, č. 2 (2010), s. 253-260 ISSN 0045-6535 Institutional research plan: CEZ:AV0Z60050516 Keywords : cytotoxic drugs * ecotoxicity * metabolite Subject RIV: EF - Botanics Impact factor: 3.155, year: 2010

  6. Gender differences in Parkinson's disease

    NARCIS (Netherlands)

    Haaxma, Charlotte A.; Bloem, Bastiaan R.; Borm, George F.; Oyen, Wim J. G.; Leenders, Klaus L.; Eshuis, Silvia; Booij, Jan; Dluzen, Dean E.; Horstink, Martin W. I. M.

    Objective: To investigate gender differences in basic disease characteristics, motor deterioration and nigrostriatal degeneration in Parkinson's disease (PD). Methods: We studied 253 consecutive PD patients who were not receiving levodopa or dopamine agonists ( disease duration Results: Age at onset

  7. Gender differences in Parkinson's disease.

    NARCIS (Netherlands)

    Haaxma, C.A.; Bloem, B.R.; Borm, G.F.; Oyen, W.J.G.; Leenders, K.L.; Eshuis, S.; Booij, J.; Dluzen, D.E.; Horstink, M.W.I.M.

    2007-01-01

    OBJECTIVE: To investigate gender differences in basic disease characteristics, motor deterioration and nigrostriatal degeneration in Parkinson's disease (PD). METHODS: We studied 253 consecutive PD patients who were not receiving levodopa or dopamine agonists (disease duration < or = 10 years). We

  8. Gender differences in Parkinson's disease

    NARCIS (Netherlands)

    Haaxma, Charlotte A.; Bloem, Bastiaan R.; Borm, George F.; Oyen, Wim J. G.; Leenders, Klaus L.; Eshuis, Silvia; Booij, Jan; Dluzen, Dean E.; Horstink, Martin W. I. M.

    2007-01-01

    OBJECTIVE: To investigate gender differences in basic disease characteristics, motor deterioration and nigrostriatal degeneration in Parkinson's disease (PD). METHODS: We studied 253 consecutive PD patients who were not receiving levodopa or dopamine agonists (disease duration < or = 10 years). We

  9. Psychosocial risk and protective factors associated with perpetration ...

    African Journals Online (AJOL)

    and gender violence need to address male depression, anxiety and ... health problems cause difficulties with emotion regulation, and some men may use GBV ..... Student. 253 (56.5). *Two participants reported volunteering full time and.

  10. TAA1-Mediated Auxin Biosynthesis Is Essential for Hormone Crosstalk and Plant Development

    Czech Academy of Sciences Publication Activity Database

    Stepanova, A.N.; Robertson-Hoyt, J.; Yun, J.; Benavente, L.M.; Xie, D.Y.; Doležal, Karel; Schlereth, A.; Jürgens, G.; Alonso, J.M.

    2008-01-01

    Roč. 133, č. 1 (2008), s. 177-191 ISSN 0092-8674 Institutional research plan: CEZ:AV0Z50380511 Keywords : CELLBIO * SIGNALING * DEVBIO Subject RIV: CE - Biochemistry Impact factor: 31.253, year: 2008

  11. ORF Alignment: NT_033778 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available de-binding protein [Periplaneta americana] ... pir||JQ0708 lipopolysaccharide-binding protein precurs... NT_033778 gi|24762680 >1qddA 8 141 113 253 1e-15 ... dbj|BAA00616.1| lipopolysacchari

  12. Biotechnology Process Engineering Center at MIT - Overview

    Science.gov (United States)

    | Facsimile (617) 253-2400 | e-mail: bpec-www@mit.edu THERAPEUTIC GENE BIOTECHNOLOGY INDUSTRIAL CONSORTIUM Board (ICAB) in Therapeutic Gene Biotechnology. ICAB Member Representatives review our research progress

  13. 76 FR 46300 - Food and Drug Administration Modernization Act of 1997: Modifications to the List of Recognized...

    Science.gov (United States)

    2011-08-02

    ... 62366:2007. engineering to medical devices. D. General Hospital/General Plastic Surgery: 6-253 Hoists... CLSI H59-A. Thromboembolic Disease; Approved Guideline. F. Nanotechnology: 18-2 Standard Guide for...

  14. 9 CFR 3.107 - Sanitation.

    Science.gov (United States)

    2010-01-01

    ... in food preparation must be cleaned and sanitized after each use. Kitchens and other food handling... marine mammals except when deemed essential by an attending veterinarian. [66 FR 253, Jan. 3, 2001] ...

  15. Aviation security : TSA is increasing procurement and deployment of the advanced imaging technology, but challenges to this effort and other areas of aviation security remain : testimony before the Subcommittee on Transportation Security and Infrastructur

    Science.gov (United States)

    2010-03-17

    The attempted bombing of Northwest flight 253 highlighted the importance of detecting improvised explosive devices on passengers. This testimony focuses on (1) the Transportation Security Administrations (TSA) efforts to procure and deploy advance...

  16. Archeologický výzkum zaniklého těžebního areálu u kostela sv. Václava v Pněvicích (okr. Kutná Hora)

    Czech Academy of Sciences Publication Activity Database

    Končelová, Markéta; Velímský, Filip

    2012-01-01

    Roč. 12, prosinec (2012), s. 253-256 ISSN 1801-5972 Institutional research plan: CEZ:AV0Z80020508 Keywords : Kutná Hora * archaeology * Middle Ages * silver mining Subject RIV: AC - Archeology, Anthropology, Ethnology

  17. Dealing with food allergies in babies and children

    National Research Council Canada - National Science Library

    Joneja, Janice M. Vickerstaff

    2007-01-01

    ... . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 231 CHAPTER 14 CornAllergy ...243 CHAPTER 15 SeafoodAllergy ...253 CHAPTER 16 The Top Ten Allergens: Avoidance of Milk, Egg, Wheat, Corn, Peanuts, Soy, Tree Nuts...

  18. Combat Neurosis in the Battered Teacher.

    Science.gov (United States)

    Science News, 1978

    1978-01-01

    Investigates the effect of school violence on classroom teachers. The study of 253 Los Angeles inner city classroom teachers reveals that many of them have developed conditions similar to the combat neurosis found in soldiers at war. (HM)

  19. Knocking down expression of the auxin-amidohydrolase IAR3 alters defense responses in Solanaceae family plants

    Czech Academy of Sciences Publication Activity Database

    D'Ippolito, S.; Vaňková, Radomíra; Joosten, M.H.A.J.; Casalongue, C.A.; Fiol, D.F.

    2016-01-01

    Roč. 253, DEC (2016), s. 31-39 ISSN 0168-9452 Institutional support: RVO:61389030 Keywords : Auxin * Biotic stress * Cladosporium fulvum Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.437, year: 2016

  20. The Prevalence and Outcome of Asymptomatic Chlamydial Infection ...

    African Journals Online (AJOL)

    Annals of Medical and Health Sciences Research | Mar-Apr 2014 | Vol 4 | Issue 2 |. 253. Address for .... effect may further compromise the reproductive chance of such women .... easy evaluation and this exercise has been encouraged. Some.

  1. Apoptosis and necrosis during the circadian cycle in the centipede midgut

    Czech Academy of Sciences Publication Activity Database

    Rost-Roszkowska, M.M.; Chajec, Ł.; Vilímová, J.; Tajovský, Karel

    2016-01-01

    Roč. 253, č. 4 (2016), s. 1051-1061 ISSN 0033-183X Institutional support: RVO:60077344 Keywords : cell death * centipede * digestive cells * midgut epithelium * ultrastructure Subject RIV: EG - Zoology Impact factor: 2.870, year: 2016

  2. 75 FR 57396 - List of Nonconforming Vehicles Decided To Be Eligible for Importation

    Science.gov (United States)

    2010-09-21

    ... 150 ...... ...... Chevrolet Astro Van 1997 298 ...... ...... Chevrolet Blazer 1986 405... (MC) FX, FL, XL Series..... 1998 253 ...... ...... Harley Davidson (MC) FX, FL, XL Series..... 1999 281 ...... ...... Harley Davidson (MC) FX, FL, XL Series..... 2000 321 ...... ...... Harley Davidson...

  3. Geochemical background in polluted river sediments: How to separate the effects of sediment provenance and grain size with statistical rigour?

    Czech Academy of Sciences Publication Activity Database

    Bábek, O.; Matys Grygar, Tomáš; Faměra, M.; Hron, K.; Nováková, Tereza; Sedláček, J.

    2015-01-01

    Roč. 135, DEC (2015), s. 240-253 ISSN 0341-8162 Institutional support: RVO:61388980 Keywords : Anthropogenic contamination * Geochemical background * Fluvial sediments Subject RIV: DD - Geochemistry Impact factor: 2.612, year: 2015

  4. Personal neutron dosemeter of the Czech Republic: Review of basic properties, results of recent tests

    Czech Academy of Sciences Publication Activity Database

    Trousil, J.; Spurný, František; Plichta, J.

    2006-01-01

    Roč. 14, 7/8 (2006), s. 246-253 ISSN 1210-7085 Institutional research plan: CEZ:AV0Z10480505 Keywords : detectors * dosemeters * personal dosimetry Subject RIV: DN - Health Impact of the Environment Quality

  5. Éva Katalin Vámos (1950-2015)

    Czech Academy of Sciences Publication Activity Database

    Štrbáňová, Soňa

    2015-01-01

    Roč. 22, č. 2 (2015), s. 251-253 ISSN 1230-1159 Institutional support: RVO:68378114 Keywords : history of science and technology * hungarian history of science and technology * women in science Subject RIV: AB - History

  6. Anthropological perspectives on democratic citizenship education and globalization

    Czech Academy of Sciences Publication Activity Database

    Červinková, Hana

    2013-01-01

    Roč. 2013, č. 27 (2013), s. 253-262 ISSN 1233-6688 Institutional support: RVO:68378076 Keywords : citizenship education * anthropology of education * action research * youth * participation * globalization Subject RIV: AC - Archeology, Anthropology, Ethnology

  7. Konsolidation und Stoffaustrag von Aufbereitungsrueckstaendendes Uranerzbergbaus

    Czech Academy of Sciences Publication Activity Database

    Beyer, K. D.; Herrmann, R.; Ohlendorf, F.; Sembdner, T.; von Wolffersdorff, P. A.; Herle, Ivo; Kolymbas, D.

    2001-01-01

    Roč. 24, č. 4 (2001), s. 253-262 ISSN 0172-6145 Institutional research plan: CEZ:AV0Z2071913 Keywords : consolidation, solute transport, uranium mill tailings. Subject RIV: JM - Building Engineering

  8. Krajina jako prostředí k rekreaci - na příkladu Šuamvy

    Czech Academy of Sciences Publication Activity Database

    Kušová, Drahomíra; Těšitel, Jan; Bartoš, Michael

    2001-01-01

    Roč. 35, č. 5 (2001), s. 253-256 ISSN 0044-4863 Institutional research plan: CEZ:AV0Z6087904 Keywords : tourism * leisure time activities * sociological survey Subject RIV: AO - Sociology, Demography

  9. Microsporidia and ‘The Art of Living Together’

    Czech Academy of Sciences Publication Activity Database

    Vávra, Jiří; Lukeš, Julius

    2013-01-01

    Roč. 82, č. 2013 (2013), s. 253-319 ISSN 0065-308X Institutional support: RVO:60077344 Keywords : Microsporidia * polar tube protein * ribosomal RNA Subject RIV: EE - Microbiology, Virology Impact factor: 4.360, year: 2013

  10. Gentegreerde woordeboekgebruik van vakwoordeboeke vir ...

    African Journals Online (AJOL)

    Riette Ruthven

    word bespreek asook daardie vakwoordeboeke wat op aanleerders van sowel 'n taal as die vak gerig is. ... Abstract: Integrated Dictionary Use of Specialised Dictionaries for Learn- ers. ...... Applied Language Studies 25(3): 319-331. Gouws ...

  11. 5 original article pcr detection of entamoeba histolytica

    African Journals Online (AJOL)

    boaz

    STOOL SAMPLES OF HOSPITAL PATIENTS IN SOROTI, EASTERN UGANDA. Ekou1, 3*, J. ... Department of Wildlife and Animal resources management, Makerere University. P.O Box ... In Mexico, E.histolytica prevalence of. 25.3% in the ...

  12. Sources of hydrocarbons in sediments of the Mandovi estuary and the Marmugoa harbour, west coast of India

    Digital Repository Service at National Institute of Oceanography (India)

    Harji, R.R.; Yvenat, A.; Bhosle, N.B.

    anthropogenic hydrocarbon inputs. Mar Environ Res 1992;33:223-253. Stout SA, Uhler AD, McCarthy KJ, Emsbo-Mattingly S. Chemical fingerprinting of hydrocarbons. In: Murphy BL, Morrison R (Eds.), Introduction to Environmental Forensics. Academic Press, Boston...

  13. 77 FR 65899 - Agency Information Collection Activities: Guarantee of Payment

    Science.gov (United States)

    2012-10-31

    ... Payment. OMB Number: 1651-00127. Form Number: Form I-510. Abstract: Section 253 of the Immigration and....gov/pdf/CBP_Form_i510.pdf Action: CBP proposes to extend the expiration date of this information...

  14. Active sites engineering of metal-organic frameworks for heterogeneous catalysis

    Energy Technology Data Exchange (ETDEWEB)

    Li, Xinle [Iowa State Univ., Ames, IA (United States)

    2016-12-17

    In conclusion, we have for the first time developed a novel solid base catalyst, Ndoped MOF-253 derived porous carbons (Cz-MOF-253). Cz-MOF-253 is highly porous and exhibit high efficiency in Knoevenagel condensation reaction. Furthermore, Cz-MOF-253 is robust and can be reused up to five times. In comparison, the analogous nitrogen-free catalyst-Cz-DUT-5, and other nitrogen- MOFs derived carbon showed an inferior performance. Moreover, the high basicity and porous nature enable the design of bifunctional catalyst and facilitate tandem condensation-hydrogenation reactions. This work delineates the first attempt that demonstrates MOF-derived carbons as solid base catalyst and its potential application in tandem catalysis. Future work on exploring new catalytic reactions based on such porous Lewis basic MOF-derived carbons is currently underway.

  15. 75 FR 5925 - Proposed Flood Elevation Determinations

    Science.gov (United States)

    2010-02-05

    ... Spring County. Martin Luther King Boulevard. Approximately 1,300 None +263 feet downstream of Martin Luther King Boulevard. Town Creek Approximately 2,300 None +253 Unincorporated Areas of feet downstream...

  16. Taking notes as an interactive process

    OpenAIRE

    Hornig, Wolfgang

    1984-01-01

    Taking notes as an interactive process : how to improve students´ notes / Hornig W. ; Nowak, J. - In: Nowak, Johann: Textverstehen und Textrekonstruktion in Vorlesungen. - Augsburg : HDZ, 1984. - S. 227-253. - (Augsburger Studien zur Hochschuldidaktik ; 12)

  17. Study of the effect of moisture content and bending rate on the fracture toughness of rocks

    Czech Academy of Sciences Publication Activity Database

    Vavro, Leona; Souček, Kamil

    2013-01-01

    Roč. 10, č. 2 (2013), s. 247-253 ISSN 1214-9705 R&D Projects: GA MŠk ED2.1.00/03.0082 Institutional support: RVO:68145535 Keywords : fracture toughness * bending rate * tensile strength Subject RIV: DB - Geology ; Mineralogy Impact factor: 0.667, year: 2013 http://www.irsm.cas.cz/materialy/acta_content/2013_02/acta_170_14_Vavro_Soucek_247-253.pdf

  18. Palladium complexes of pyrrole-2-aldehyde thiosemicarbazone ...

    Indian Academy of Sciences (India)

    Chem. Rev. 253 1384; (j) Lobana T S, Sharma. R, Bawa G and Khanna S 2009 Coord. Chem. Rev. 253. 977; (k) Quiroga A G and Ranninger C N 2004 Coord. Chem. Rev. 248 119; (l) Dilworth J R, Arnold P, Morales. D, Wong Y L and Zheng Y 2002 Modern Coord. Chem. 217; (m) West D X, Liberta A E, Padhye S B, Chikate.

  19. DDN (Defence Data Network) Protocol Implementations and Vendors Guide

    Science.gov (United States)

    1988-08-01

    Artificial Intelligence Laboratory Room NE43-723 545 Technology Square Cambridge, MA 02139 (617) 253-8843 S John Wroclawski, (JTW@AI.AJ.MIT.EDU...Massachusetts Institute of Technology Artificial Intelligence Laboratory Room NE43-743 545 Technology Square 0 Cambridge, MA 02139 (617) 253-7885 ORDERING...TCP/IP Network Software for PC-DOS Systems CPU: IBM-PC/XT/AT/compatible in conjunction with EXOS 205 Inteligent Ethernet Controller for PCbus 0/s

  20. Protein interactions with quaternized chitosan/heparin multilayers

    Czech Academy of Sciences Publication Activity Database

    Kumorek, Marta M.; Kubies, Dana; Riedel, Tomáš

    2016-01-01

    Roč. 65, Suppl. 2 (2016), S253-S261 ISSN 0862-8408 R&D Projects: GA MŠk(CZ) LQ1604 Institutional support: RVO:61389013 Keywords : heparin * chitosan * protein Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.461, year: 2016 http://www.biomed.cas.cz/physiolres/pdf/65%20Suppl%202/65_S253.pdf

  1. 数字解读(英文)

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    253 Million Internet Users vs 46.4 Percent of Women Netizens China Internet Network Information Center(CNNIC) recently issued its 22nd Statistical Survey Report on Internet Development in China. The report indicated China had 253 million Internet users by the end of June 2008, up 56.2 percent over the previous year.For the first time in China's history,the Internet

  2. 40 CFR 52.2370 - Identification of plan.

    Science.gov (United States)

    2010-07-01

    ... Radiation Docket and Information Center, Air Docket (Mail Code 6102T), Room B-108, 1301 Constitution Avenue... nuisance and odor 01/25/78 12/21/78, 43 FR 59496 Section 5-251 Control of nitrogen oxides emissions 01/04... FR 19825 Section 5-253.3 Bulk gasoline plants 10/29/92 04/22/98, 63 FR 19825 Section 5-253.4 Gasoline...

  3. Microstructures and Mechanical Properties of Inconel 718 Alloy at Ultralow Temperatures

    Science.gov (United States)

    Yao, C. G.; Lv, H. J.; Yi, D. Q.; Meng, S.; Xiao, L. R.; Wang, B.

    2018-05-01

    The microstructures and mechanical properties of powder metallurgy Inconel 718 alloy were investigated in the temperatures range between 25 and - 253 °C. Tensile strength increased with the decrease in temperature, while the ductility first increased and then decreased. There was no significant change in impact toughness. When the temperature was - 253 °C, a zigzag stress-strain curve was observed for the alloy, owing to the interaction of dislocation glide and twinning, which effectively maintained the relatively good ductility.

  4. Acute Cannabis Intoxication and the Brain's Response to Visual Erotica: An Fmri Study

    Czech Academy of Sciences Publication Activity Database

    Androvičová, R.; Horáček, J.; Tintěra, J.; Rydlo, J.; Ježová, D.; Balíková, M.; Hložek, T.; Mikšátková, P.; Kuchař, M.; Hlinka, Jaroslav; Roman, M.; Tomíček, P.; Viktorínová, M.; Tylš, F.; Páleníček, T.

    2017-01-01

    Roč. 14, č. 5 (2017), e253-e253 ISSN 1743-6095. [Congress of the World Association for Sexual Health /23./. 28.05.2017-31.05.2017, Prague] Grant - others:GA MV(CZ) VG20122015080; GA MZd NT13145; GA MŠk(CZ) LO1611 Institutional support: RVO:67985807 Keywords : fMRI * cannabis * sexuality Subject RIV: FH - Neurology http://www.jsm.jsexmed.org/article/S1743-6095(17)30689-6/pdf

  5. 1α,25(OH)2D3 differentially regulates miRNA expression in human bladder cancer cells.

    Science.gov (United States)

    Ma, Yingyu; Hu, Qiang; Luo, Wei; Pratt, Rachel N; Glenn, Sean T; Liu, Song; Trump, Donald L; Johnson, Candace S

    2015-04-01

    Bladder cancer is the fourth most commonly diagnosed cancer in men and eighth leading cause of cancer-related death in the US. Epidemiological and experimental studies strongly suggest a role for 1α,25(OH)2D3 in cancer prevention and treatment. The antitumor activities of 1α,25(OH)2D3 are mediated by the induction of cell cycle arrest, apoptosis, differentiation and the inhibition of angiogenesis and metastasis. miRNAs play important regulatory roles in cancer development and progression. However, the role of 1α,25(OH)2D3 in the regulation of miRNA expression and the potential impact in bladder cancer has not been investigated. Therefore, we studied 1α,25(OH)2D3-regulated miRNA expression profiles in human bladder cancer cell line 253J and the highly tumorigenic and metastatic derivative line 253J-BV by miRNA qPCR panels. 253J and 253J-BV cells express endogenous vitamin D receptor (VDR), which can be further induced by 1α,25(OH)2D3. VDR target gene 24-hydroxylase was induced by 1α,25(OH)2D3 in both cell lines, indicating functional 1α,25(OH)2D3 signaling. The miRNA qPCR panel assay results showed that 253J and 253J-BV cells have distinct miRNA expression profiles. Further, 1α,25(OH)2D3 differentially regulated miRNA expression profiles in 253J and 253J-BV cells in a dynamic manner. Pathway analysis of the miRNA target genes revealed distinct patterns of contribution to the molecular functions and biological processes in the two cell lines. In conclusion, 1α,25(OH)2D3 differentially regulates the expression of miRNAs, which may contribute to distinct biological functions, in human bladder 253J and 253J-BV cells. This article is part of a Special Issue entitled '17th Vitamin D Workshop'. Copyright © 2014 Elsevier Ltd. All rights reserved.

  6. Regulation of the Incorporation of Tissue Factor into Microparticles by Serine Phosphorylation of the Cytoplasmic Domain of Tissue Factor*

    Science.gov (United States)

    Collier, Mary E. W.; Ettelaie, Camille

    2011-01-01

    The mechanisms that regulate the incorporation and release of tissue factors (TFs) into cell-derived microparticles are as yet unidentified. In this study, we have explored the regulation of TF release into microparticles by the phosphorylation of serine residues within the cytoplasmic domain of TF. Wild-type and mutant forms of TF, containing alanine and aspartate substitutions at Ser253 and Ser258, were overexpressed in coronary artery and dermal microvascular endothelial cells and microparticle release stimulated with PAR2 agonist peptide (PAR2-AP). The release of TF antigen and activity was then monitored. In addition, the phosphorylation state of the two serine residues within the released microparticles and the cells was monitored for 150 min. The release of wild-type TF as procoagulant microparticles peaked at 90 min and declined thereafter in both cell types. The TF within these microparticles was phosphorylated at Ser253 but not at Ser258. Aspartate substitution of Ser253 resulted in rapid release of TF antigen but not activity, whereas TF release was reduced and delayed by alanine substitution of Ser253 or aspartate substitution of Ser258. Alanine substitution of Ser258 prolonged the release of TF following PAR2-AP activation. The release of TF was concurrent with phosphorylation of Ser253 and was followed by dephosphorylation at 120 min and phosphorylation of Ser258. We propose a sequential mechanism in which the phosphorylation of Ser253 through PAR2 activation results in the incorporation of TF into microparticles, simultaneously inducing Ser258 phosphorylation. Phosphorylation of Ser258 in turn promotes the dephosphorylation of Ser253 and suppresses the release of TF. PMID:21310953

  7. An Exponential Stability Result of a Timoshenko System with Thermoelasticity with Second Sound and in the Presence of Delay

    Energy Technology Data Exchange (ETDEWEB)

    Apalara, Tijani A., E-mail: tijani@kfupm.edu.sa [King Fahd University of Petroleum and Minerals, Affiliated Colleges at Hafr Al-Batin, General Science and Studies Unit-Mathematics (Saudi Arabia); Messaoudi, Salim A., E-mail: messaoud@kfupm.edu.sa [King Fahd University of Petroleum and Minerals, Department of Mathematics and Statistics (Saudi Arabia)

    2015-06-15

    In this paper, we consider a one-dimensional linear thermoelastic system of Timoshenko type with a delay, where the heat flux is given by Cattaneo’s law. We prove an exponential decay result under a smallness condition on the delay and a stability number introduced first in Santos et al. (J Diff Eqs 253:2715–2733, 2012), using a method different from that of Santos et al. (J Diff Eqs 253:2715–2733, 2012). We also reproduce the polynomial decay of Santos et al. (J Diff Eqs 253:2715–2733, 2012) using the multiplier method in the case of absence of delay. The polynomial decay issue in the presence of a small delay is an open question.

  8. SDS-PAGE analysis of high molecular weight glutenin subunits in SP3 from spaceflight carried wheat

    International Nuclear Information System (INIS)

    Zhang Su'na; Lv Jinyin

    2009-01-01

    The compositions of high molecular weight glutenin subunits (HMW-GS) of the third generation (SP 3 ) of two wheat varieties spaceflight carried were analyzed by SDS-PAGE. The quality score of Glu-1 of each site was calculated according to the quality rating system. The results showed that the space flight carried could result in a higher frequency of HMW-GS gene mutation. The variance frequency of HMW-GS in SP 3 of Shaan253 and Xinong1043 were 27.08% and 27.45%, and the quality score in SP 3 of Shaan253 and Xinong1043 were 7 and 6, respectively. Shaan253 SP 3 generation mutants were considered as high-quality wheat. (authors)

  9. p38α phosphorylates serine 258 within the cytoplasmic domain of tissue factor and prevents its incorporation into cell-derived microparticles.

    Science.gov (United States)

    Ettelaie, Camille; Elkeeb, Azza M; Maraveyas, Anthony; Collier, Mary Elizabeth W

    2013-03-01

    We previously showed that the phosphorylation of Ser253 within the cytoplasmic domain of human tissue factor (TF) initiates the incorporation and release of this protein into cell-derived microparticles. Furthermore, subsequent phosphorylation of Ser258 terminates this process. However, the identity of the kinase responsible for the phosphorylation of Ser258 and mode of action of this enzyme remain unknown. In this study, p38α was identified as the proline-directed kinase capable of phosphorylating Ser258 specifically, and without any detectable activity towards Ser253. Furthermore, using synthetic peptides, it was shown that the Km for the reaction decreased by approximately 10 fold on substitution of Ser253 with phospho-Ser253. Either inhibition of p38 using SB202190 or knockdown of p38α expression in coronary artery endothelial cells overexpressing wild-type TF, resulted in decreased phosphorylation of Ser258, following activation of cells with PAR2-agonist peptide (PAR2-AP). In agreement with our previous data, inhibition of phosphorylation of this residue maintained the release of TF. Activation of PAR2 in cells transfected to overexpress TF, resulted in two separate peaks of p38 activity at approximately 40 and 120 min post-activation. Furthermore, overexpression of Ala253-substituted TF enhanced the second p38 activation peak. However, the second peak was absent in cells devoid of TF or in cells overexpressing the Asp253-substituted TF. Our data clearly identifies p38α as a kinase capable of phosphorylating Ser258 within the cytoplasmic domain of TF. Moreover, it appears that the presence of TF within the cells regulates the late activation of p38 and consequently the termination of TF release into microparticles. Copyright © 2012 Elsevier B.V. All rights reserved.

  10. Gene Therapy for Fracture Repair

    Science.gov (United States)

    2007-05-01

    modulator-1; c-myc binding protein [ Homo sapiens ]. regulation of transcription, DNA dependent NM_012488 1.55 2.53 Rattus norvegicus α-2-macroglobulin...myc binding protein [ Homo sapiens ] Regulation of transcription, DNA dependent NM_012488 1.55 2.53 Rattus norvegicus α-2-macroglobulin (A2m) Protease...1-HIV LTR-MLV Promoter EG FP -C el l N um be r (M ea n) 10 ul Vector 50 ul Vector 7 Periosteal/Endosteal Cell Transduction 0 200 400 600 800

  11. Results of the Elections to the Governing Board of the Pensions Fund

    CERN Multimedia

    2006-01-01

    Voting papers issued Ballot papers returned Ballot papers declared null 3'193 1'338 0 Total number of votes Blank votes Null votes Valid votes 1'338 24 61 1'253 Valid ballot papers cast as follows : 1'253 Michel GOOSSENS Henrik VESTERGARD 820 433 Votes cast (percentage) 41.90 % Thus Mr Michel GOOSSENS is elected member of the Governing Board, as from 1 January 2007 for three years.Mr Henrik VESTERGARD is elected alternate member of the Board as from 1 January 2007 for three years. F. Ranjard J. Lahaye

  12. Ring Chromosome 17 Not Involving the Miller-Dieker Region: A Case with Drug-Resistant Epilepsy.

    Science.gov (United States)

    Coppola, Antonietta; Morrogh, Deborah; Farrell, Fiona; Balestrini, Simona; Hernandez-Hernandez, Laura; Krithika, S; Sander, Josemir W; Waters, Jonathan J; Sisodiya, Sanjay M

    2017-12-01

    Chromosomal abnormalities are often identified in people with neurodevelopmental disorders including intellectual disability, autism, and epilepsy. Ring chromosomes, which usually involve gene copy number loss, are formed by fusion of subtelomeric or telomeric chromosomal regions. Some ring chromosomes, including ring 14, 17, and 20, are strongly associated with seizure disorders. We report an individual with a ring chromosome 17, r(17)(p13.3q25.3), with a terminal 17q25.3 deletion and no short arm copy number loss, and with a phenotype characterized by intellectual disability and drug-resistant epilepsy, including a propensity for nonconvulsive status epilepticus.

  13. Complexes of membrane-associated gamma-tubulin with Fyn kinase and phosphoinositide 3-kinase in differentiating cells

    Czech Academy of Sciences Publication Activity Database

    Sulimenko, Vadym; Macůrek, Libor; Dráberová, Eduarda; Richterová, Věra; Sulimenko, Tetyana; Dráberová, Lubica; Marková, Vladimíra; Dráber, Pavel

    2009-01-01

    Roč. 276, č. 1 (2009), s. 253-253 ISSN 1742-464X. [FEBS Congress /34/. 04.07.2009-09.07.2009, Praha] R&D Projects: GA MŠk 1M0506; GA MŠk LC545; GA ČR GA204/05/2375; GA ČR GA304/04/1273 Institutional research plan: CEZ:AV0Z50520514 Keywords : detergent -resistant membrane * Fyn * PI3K gamma-tubulin Subject RIV: EB - Genetics ; Molecular Biology

  14. Strouhal number of bridge cables with ice accretion at low flow turbulence

    Czech Academy of Sciences Publication Activity Database

    Górski, P.; Pospíšil, Stanislav; Kuznetsov, Sergeii; Tatara, M.; Marušić, Ante

    2016-01-01

    Roč. 22, č. 2 (2016), s. 253-272 ISSN 1226-6116 R&D Projects: GA MŠk(CZ) LO1219; GA ČR(CZ) GC13-34405J; GA ČR(CZ) GA14-12892S Keywords : bridge cable * ice accretion * Strouhal number * angle of attack * vortex shedding frequency Subject RIV: JM - Building Engineering Impact factor: 0.868, year: 2016 http://koreascience.or.kr/article/ArticleFullRecord.jsp?cn=KJKHCF_2016_v22n2_253

  15. Genetic Testing for Wolfram Syndrome Mutations in a Sample of 71 Patients with Hereditary Optic Neuropathy and Negative Genetic Test Results for OPA1/OPA3/LHON.

    Science.gov (United States)

    Galvez-Ruiz, Alberto; Galindo-Ferreiro, Alicia; Schatz, Patrik

    2018-04-01

    In this study, the authors present a sample of 71 patients with hereditary optic neuropathy and negative genetic test results for OPA1/OPA3/LHON. All of these patients later underwent genetic testing to rule out WFS. As a result, 53 patients (74.7%) were negative and 18 patients (25.3%) were positive for some type of mutation or variation in the WFS gene. The authors believe that this study is interesting because it shows that a sizeable percentage (25.3%) of patients with hereditary optic 25 neuropathy and negative genetic test results for OPA1/OPA3/LHON had WFS mutations or variants.

  16. Minor Actinide Burning in Thermal Reactors. A Report by the Working Party on Scientific Issues of Reactor Systems

    International Nuclear Information System (INIS)

    Hesketh, K.; Porsch, D.; Rimpault, G.; Taiwo, T.; Worrall, A.

    2013-01-01

    The actinides (or actinoids) are those elements in the periodic table from actinium upwards. Uranium (U) and plutonium (Pu) are two of the principal elements in nuclear fuel that could be classed as major actinides. The minor actinides are normally taken to be the triad of neptunium (Np), americium (Am) and curium (Cm). The combined masses of the remaining actinides (i.e. actinium, thorium, protactinium, berkelium, californium, einsteinium and fermium) are small enough to be regarded as very minor trace contaminants in nuclear fuel. Those elements above uranium in the periodic table are known collectively as the transuranics (TRUs). The operation of a nuclear reactor produces large quantities of irradiated fuel (sometimes referred to as spent fuel), which is either stored prior to eventual deep geological disposal or reprocessed to enable actinide recycling. A modern light water reactor (LWR) of 1 GWe capacity will typically discharge about 20-25 tonnes of irradiated fuel per year of operation. About 93-94% of the mass of uranium oxide irradiated fuel is comprised of uranium (mostly 238 U), with about 4-5% fission products and ∼1% plutonium. About 0.1-0.2% of the mass is comprised of neptunium, americium and curium. These latter elements accumulate in nuclear fuel because of neutron captures, and they contribute significantly to decay heat loading and neutron output, as well as to the overall radio-toxic hazard of spent fuel. Although the total minor actinide mass is relatively small - approximately 20-25 kg per year from a 1 GWe LWR - it has a disproportionate impact on spent fuel disposal, and thus the longstanding interest in transmuting these actinides either by fission (to fission products) or neutron capture in order to reduce their impact on the back end of the fuel cycle. The combined masses of the trace actinides actinium, thorium, protactinium, berkelium and californium in irradiated LWR fuel are only about 2 parts per billion, which is far too low for

  17. Genome-wide meta-analysis in alopecia areata resolves HLA associations and reveals two new susceptibility loci

    NARCIS (Netherlands)

    Betz, Regina C; Petukhova, Lynn; Ripke, Stephan; Huang, Hailiang; Menelaou, Androniki; Redler, Silke; Becker, Tim; Heilmann, Stefanie; Yamany, Tarek; Duvic, Madeliene; Hordinsky, Maria; Norris, David; Price, Vera H; Mackay-Wiggan, Julian; de Jong, Annemieke; DeStefano, Gina M; Moebus, Susanne; Böhm, Markus; Blume-Peytavi, Ulrike; Wolff, Hans; Lutz, Gerhard; Kruse, Roland; Bian, Li; Amos, Christopher I; Lee, Annette; Gregersen, Peter K; Blaumeiser, Bettina; Altshuler, David; Clynes, Raphael; de Bakker, Paul I W; Nöthen, Markus M; Daly, Mark J; Christiano, Angela M

    2015-01-01

    Alopecia areata (AA) is a prevalent autoimmune disease with 10 known susceptibility loci. Here we perform the first meta-analysis of research on AA by combining data from two genome-wide association studies (GWAS), and replication with supplemented ImmunoChip data for a total of 3,253 cases and

  18. Theoretical modeling of influence of the structural disorder on the charge carrier mobility in triphenylene stacks

    Czech Academy of Sciences Publication Activity Database

    Mikolajczyk, M.; Toman, Petr; Bartkowiak, W.

    2010-01-01

    Roč. 485, 1-3 (2010), s. 253-257 ISSN 0009-2614 R&D Projects: GA MŠk MEB050815; GA AV ČR IAA401770601 Institutional research plan: CEZ:AV0Z40500505 Keywords : triphenylene * charge carrier mobility * tight-binding approximation Subject RIV: CD - Macromolecular Chemistry Impact factor: 2.282, year: 2010

  19. Defining the role of common variation in the genomic and biological architecture of adult human height

    NARCIS (Netherlands)

    A.R. Wood (Andrew); T. Esko (Tõnu); J. Yang (Jian); S. Vedantam (Sailaja); T.H. Pers (Tune); S. Gustafsson (Stefan); A.Y. Chu (Audrey Y); K. Estrada Gil (Karol); J. Luan; Z. Kutalik; N. Amin (Najaf); M.L. Buchkovich (Martin); D.C. Croteau-Chonka (Damien); F.R. Day (Felix); Y. Duan (Yanan); M. Fall (Magnus); R.S.N. Fehrmann (Rudolf); T. Ferreira (Teresa); A.U. Jackson (Anne); J. Karjalainen (Juha); K.S. Lo (Ken Sin); A. Locke (Adam); R. Mägi (Reedik); E. Mihailov (Evelin); E. Porcu (Eleonora); J.C. Randall (Joshua); A. Scherag (Andre); A.A.E. Vinkhuyzen (Anna A.); H.J. Westra (Harm-Jan); T.W. Winkler (Thomas W.); T. Workalemahu (Tsegaselassie); J.H. Zhao (Jing Hua); D. Absher (Devin); E. Albrecht (Eva); J. Baron (Jeffrey); M. Beekman (Marian); A. Demirkan (Ayşe); G.B. Ehret (Georg); B. Feenstra; M.F. Feitosa (Mary Furlan); K. Fischer (Krista); R.M. Fraser (Ross); A. Goel (Anuj); J. Gong (Jian); A.E. Justice (Anne); S. Kanoni (Stavroula); M.E. Kleber (Marcus); K. Kristiansson (Kati); U. Lim (Unhee); V. Lotay (Vaneet); J.C. Lui (Julian C); M. Mangino (Massimo); I.M. Leach (Irene Mateo); M.C. Medina-Gomez (Carolina); M.A. Nalls (Michael); A.S. Dimas (Antigone); C. Palmer (Cameron); D. Pasko (Dorota); S. Pechlivanis (Sonali); I. Prokopenko (Inga); J.S. Ried (Janina); S. Ripke (Stephan); D. Shungin (Dmitry); A. Stancáková (Alena); R.J. Strawbridge (Rona); Y.J. Sung (Yun Ju); T. Tanaka (Toshiko); A. Teumer (Alexander); S. Trompet (Stella); S.W. Van Der Laan (Sander W.); J. van Setten (Jessica); J.V. van Vliet-Ostaptchouk (Jana); Z. Wang (Zhaoming); L. Yengo (Loic); W. Zhang (Weihua); U. Afzal (Uzma); J. Ärnlöv (Johan); G.M. Arscott (Gillian M.); S. Bandinelli (Stefania); A. Barrett (Angela); C. Bellis (Claire); A.J. Bennett (Amanda); C. Berne (Christian); M. Blüher (Matthias); J.L. Bolton (Jennifer); Y. Böttcher (Yvonne); H.A. Boyd; M. Bruinenberg (M.); B.M. Buckley (Brendan M.); S. Buyske (Steven); I.H. Caspersen (Ida H.); P.S. Chines (Peter); R. Clarke (Robert); S. Claudi-Boehm (Simone); M.N. Cooper (Matthew); E.W. Daw (E Warwick); P.A. De Jong (Pim A); J. Deelen (Joris); G. Delgado; J.C. Denny (Josh C); R.A.M. Dhonukshe-Rutten (Rosalie); M. Dimitriou (Maria); A.S.F. Doney (Alex); M. Dörr (Marcus); N. Eklund (Niina); E. Eury (Elodie); L. Folkersen (Lasse); M. Garcia (Melissa); F. Geller (Frank); V. Giedraitis (Vilmantas); A. Go (Attie); H. Grallert (Harald); T.B. Grammer (Tanja B); J. Gräßler (Jürgen); H. Grönberg (Henrik); L.C.P.G.M. de Groot (Lisette); C.J. Groves (Christopher J.); J. Haessler (Jeff); P. Hall (Per); T. Haller (Toomas); G. Hallmans (Göran); M. Hannemann (Mario); C.A. Hartman (Catharina); M. Hassinen (Maija); C. Hayward (Caroline); N.L. Heard-Costa (Nancy); Q. Helmer (Quinta); G. Hemani; A.K. Henders (Anjali); H.L. Hillege (Hans); M.A. Hlatky (Mark); W. Hoffmann (Wolfgang); P. Hoffmann (Per); O.L. Holmen (Oddgeir); J.J. Houwing-Duistermaat (Jeanine); T. Illig (Thomas); A. Isaacs (Aaron); A.L. James (Alan); J. Jeff (Janina); B. Johansen (Berit); A. Johansson (Åsa); G.J. Jolley (Jason); T. Juliusdottir (Thorhildur); M.J. Junttila (Juhani); M.M.L. Kho (Marcia); L. Kinnunen (Leena); N. Klopp (Norman); T. Kocher; W. Kratzer (Wolfgang); P. Lichtner (Peter); L. Lind (Lars); J. Lindström (Jaana); S. Lobbens (Stéphane); M. Lorentzon (Mattias); Y. Lu (Yingchang); V. Lyssenko (Valeriya); P.K. Magnusson (Patrik); A. Mahajan (Anubha); M. Maillard (Marc); W.L. McArdle (Wendy); C.A. McKenzie (Colin A.); S. McLachlan (Stela); P.J. McLaren (Paul J); C. Menni (Cristina); S. Merger (Sigrun); L. Milani (Lili); A. Moayyeri (Alireza); K.L. Monda (Keri); M.A. Morken (Mario); G. Müller (Gabriele); M. Müller-Nurasyid (Martina); A.W. Musk (Arthur); N. Narisu (Narisu); M. Nauck (Matthias); I.M. Nolte (Ilja M.); M.M. Nöthen (Markus); L. Oozageer (Laticia); S. Pilz (Stefan); N.W. Rayner (Nigel William); F. Renström (Frida); N.R. Robertson (Neil R.); L.M. Rose (Lynda M.); R. Roussel (Ronan); S. Sanna (Serena); H. Scharnagl (Hubert); S. Scholtens (Salome); F.R. Schumacher (Fredrick R); H. Schunkert (Heribert); R.A. Scott (Robert); J.S. Sehmi (Joban); T. Seufferlein (Thomas); J. Shi (Jianxin); K. Silventoinen (Karri); J.H. Smit (Johannes); G.D. Smith; J. Smolonska (Joanna); A. Stanton (Alice); K. Stirrups (Kathy); D.J. Stott (David J); H.M. Stringham (Heather); J. Sundstrom (Johan); M. Swertz (Morris); A.C. Syvanen; B. Tayo (Bamidele); G. Thorleifsson (Gudmar); J.P. Tyrer (Jonathan); S. Van Dijk (Suzanne); N.M. van Schoor (Natasja); N. van der Velde (Nathalie); D. van Heemst (Diana); F.V.A. Van Oort (Floor V A); S.H.H.M. Vermeulen (Sita); N. Verweij (Niek); J.M. Vonk (Judith M); L. Waite (Lindsay); M. Waldenberger (Melanie); R. Wennauer (Roman); L.R. Wilkens (Lynne R.); C. Willenborg (Christina); T. Wilsgaard (Tom); M.K. Wojczynski (Mary ); A. Wong (Andrew); A. Wright (Alan); Q. Zhang (Qunyuan); D. Arveiler (Dominique); S.J.L. Bakker (Stephan); J. Beilby (John); R.N. Bergman (Richard); S.M. Bergmann (Sven); R. Biffar; J. Blangero (John); D.I. Boomsma (Dorret); S.R. Bornstein (Stefan R.); P. Bovet (Pascal); P. Brambilla (Paolo); M.J. Brown (Morris); H. Campbell (Harry); M. Caulfield (Mark); A. Chakravarti (Aravinda); F.S. Collins (Francis); D.C. Crawford (Dana); L.A. Cupples (Adrienne); J. Danesh (John); U. de Faire (Ulf); H.M. den Ruijter (Hester ); R. Erbel (Raimund); J. Erdmann (Jeanette); J. Eriksson; M. Farrall (Martin); E. Ferrannini (Ele); J. Ferrieres (Jean); I. Ford; N.G. Forouhi (Nita); T. Forrester (Terrence); R.T. Gansevoort (Ron); P.V. Gejman (Pablo); C. Gieger (Christian); A. Golay (Alain); R.F. Gottesman (Rebecca); V. Gudnason (Vilmundur); U. Gyllensten (Ulf); D.W. Haas (David W); A.S. Hall (Alistair); T.B. Harris (Tamara); A.T. Hattersley (Andrew); A.C. Heath (Andrew C); C. Hengstenberg (Christian); A.A. Hicks (Andrew); L.A. Hindorff (Lucia A); A. Hingorani (Aroon); A. Hofman (Albert); G.K. Hovingh (Kees); S.E. Humphries (Steve E.); S.C. Hunt (Steven); E. Hypponen (Elina); K.B. Jacobs (Kevin); M.-R. Jarvelin (Marjo-Riitta); P. Jousilahti (Pekka); A. Jula (Antti); J. Kaprio (Jaakko); J.J.P. Kastelein (John); M.H. Kayser (Manfred); F. Kee (Frank); S. Keinanen-Kiukaanniemi (Sirkka); L.A.L.M. Kiemeney (Bart); J.S. Kooner (Jaspal S.); C. Kooperberg (Charles); S. Koskinen (Seppo); P. Kovacs (Peter); A. Kraja (Aldi); M. Kumari (Meena); J. Kuusisto (Johanna); T.A. Lakka (Timo); C. Langenberg (Claudia); L. Le Marchand (Loic); T. Lehtimäki (Terho); S. Lupoli (Sara); P.A. Madden; S. Männistö (Satu); P. Manunta (Paolo); A. Marette (Andre'); T.C. Matise (Tara C.); B. McKnight (Barbara); T. Meitinger (Thomas); F.L. Moll (Frans); G.W. Montgomery (Grant W.); A.D. Morris (Andrew); A.P. Morris (Andrew); J.C. Murray (Jeffrey); M. Nelis (Mari); C. Ohlsson (Claes); A.J. Oldehinkel (Albertine); K.K. Ong (Ken K.); W.H. Ouwehand (Willem); G. Pasterkamp (Gerard); A. Peters (Annette); P.P. Pramstaller (Peter Paul); J.F. Price (Jackie F.); L. Qi (Lu); O. Raitakari (Olli); T. Rankinen (Tuomo); D.C. Rao (Dabeeru C.); T.K. Rice (Treva K.); M.D. Ritchie (Marylyn D.); I. Rudan (Igor); V. Salomaa (Veikko); N.J. Samani (Nilesh); J. Saramies (Jouko); M.A. Sarzynski (Mark A.); P.E.H. Schwarz (Peter E. H.); S. Sebert (Sylvain); P. Sever (Peter); A.R. Shuldiner (Alan); J. Sinisalo (Juha); V. Steinthorsdottir (Valgerdur); R.P. Stolk; J.-C. Tardif (Jean-Claude); A. Tönjes (Anke); A. Tremblay (Angelo); E. Tremoli (Elena); J. Virtamo (Jarmo); M.-C. Vohl (Marie-Claude); P. Amouyel (Philippe); F.W. Asselbergs (Folkert W.); T.L. Assimes (Themistocles); M. Bochud (Murielle); B.O. Boehm (Bernhard); E.A. Boerwinkle (Eric); E.P. Bottinger (Erwin P.); C. Bouchard (Claude); S. Cauchi (Stéphane); J.C. Chambers (John C.); S.J. Chanock (Stephen); R.S. Cooper (Richard S.); P.I.W. de Bakker (Paul); G.V. Dedoussis (George); L. Ferrucci (Luigi); P.W. Franks; P. Froguel (Philippe); L. Groop (Leif); C.A. Haiman (Christopher); A. Hamsten (Anders); M.G. Hayes (M. Geoffrey); J. Hui (Jennie); D. Hunter (David); K. Hveem (Kristian); J.W. Jukema (Jan Wouter); R.C. Kaplan (Robert); M. Kivimaki (Mika); D. Kuh (Diana); M. Laakso (Markku); Y. Liu (YongMei); N.G. Martin (Nicholas); W. März (Winfried); M. Melbye (Mads); S. Moebus (Susanne); P. Munroe (Patricia); I. Njølstad (Inger); B.A. Oostra (Ben); C.N.A. Palmer (Colin); N.L. Pedersen (Nancy L.); M. Perola (Markus); L. Perusse (Louis); U. Peters (Ulrike); J.E. Powell (Joseph); C. Power (Christine); T. Quertermous (Thomas); R. Rauramaa (Rainer); E. Reinmaa (Eva); P.M. Ridker (Paul); F. Rivadeneira Ramirez (Fernando); J.I. Rotter (Jerome I.); T. Saaristo (Timo); D. Saleheen; D. Schlessinger (David); P.E. Slagboom (P Eline); H. Snieder (Harold); T.D. Spector (Timothy); K. Strauch (Konstantin); M. Stumvoll (Michael); J. Tuomilehto (Jaakko); M. Uusitupa (Matti); P. van der Harst (Pim); H. Völzke (Henry); M. Walker (Mark); N.J. Wareham (Nick); H. Watkins (Hugh); H.E. Wichmann (Heinz Erich); J.F. Wilson (James F); P. Zanen (Pieter); P. Deloukas (Panagiotis); I.M. Heid (Iris); C.M. Lindgren (Cecilia); K.L. Mohlke (Karen); E.K. Speliotes (Elizabeth); U. Thorsteinsdottir (Unnur); I.E. Barroso (Inês); C.S. Fox (Caroline S.); K.E. North (Kari); D.P. Strachan (David P.); J.S. Beckmann (Jacques); S.I. Berndt (Sonja); M. Boehnke (Michael); I.B. Borecki (Ingrid); M.I. McCarthy (Mark); A. Metspalu (Andres); J-A. Zwart (John-Anker); A.G. Uitterlinden (André); C.M. van Duijn (Cornelia); L. Franke (Lude); C.J. Willer (Cristen); A. Price (Alkes); G. Lettre (Guillaume); R.J.F. Loos (Ruth); M.N. Weedon (Michael); E. Ingelsson (Erik); J.R. O´Connell; G.R. Abecasis (Gonçalo); D.I. Chasman (Daniel); D. Anderson (Denise); M.E. Goddard (Michael); P.M. Visscher (Peter); J.N. Hirschhorn (Joel); T.M. Frayling (Timothy)

    2014-01-01

    textabstractUsing genome-wide data from 253,288 individuals, we identified 697 variants at genome-wide significance that together explained one-fifth of the heritability for adult height. By testing different numbers of variants in independent studies, we show that the most strongly associated

  20. Browse Title Index

    African Journals Online (AJOL)

    Items 101 - 150 of 253 ... OE Umezinwa. Vol 13, No 1 (2012), Music as Edae: The Implications for Music Therapy in Nigeria, Abstract PDF. CO Aluede ... Vol 15, No 2 (2014), Perspective Actionelle Visa-a-Vis L'enseignement du Français Langue Entrangele au Nigeria : Problem et Vision, Abstract PDF. S Ezeodili. Vol 13, No 2 ...

  1. Book Reviews: Social justice and neoliberalism | Vally | New ...

    African Journals Online (AJOL)

    Social justice and neoliberalism - Global perspectives. Adriaan Smith, Alison Stenning, Kate Willis (Eds). Zed Books: London and New York. 2008, 253 pp. Full Text: EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT · AJOL African Journals Online. HOW TO USE AJOL.

  2. Large-Scale Systems Control Design via LMI Optimization

    Czech Academy of Sciences Publication Activity Database

    Rehák, Branislav

    2015-01-01

    Roč. 44, č. 3 (2015), s. 247-253 ISSN 1392-124X Institutional support: RVO:67985556 Keywords : Combinatorial linear matrix inequalities * large-scale system * decentralized control Subject RIV: BC - Control Systems Theory Impact factor: 0.633, year: 2015

  3. 7 CFR 254.3 - Administration by an ITO.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Administration by an ITO. 254.3 Section 254.3... FOR INDIAN HOUSEHOLDS IN OKLAHOMA § 254.3 Administration by an ITO. (a) Applicability of part 253. All... any claim and to settle and adjust any claim against an ITO. (d) ITO administration. The ITO, acting...

  4. Microbial-induced remediation of Zn2+ pollution based on the capture and utilization of carbon dioxide

    Directory of Open Access Journals (Sweden)

    Qiwei Zhan

    2016-01-01

    Conclusions: The TG-DSC results showed that weight loss of the precipitates occurred around 253°C. The FTIR and TG-DSC results were in accord with the XRD and EDS results and proved again that the precipitates were basic zinc carbonate. This work thus demonstrates a new method for processing Zn2+ pollution based on the utilization of carbon dioxide.

  5. West African Journal of Medicine - Vol 23, No 3 (2004)

    African Journals Online (AJOL)

    Circulating immune complexes, immunoglobulin classes (IgG, IgA and IgM) and complement components (C3c, C4 and Factor B) in diabetic Nigerians. EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. KS Akinlade, OG Arinola, LS Salimonu, GO Oyeyinka, 253-255.

  6. 77 FR 48097 - Operation of Radar Systems in the 76-77 GHz Band

    Science.gov (United States)

    2012-08-13

    ... modify the emission limits for vehicular radar systems operating within the 76-77 GHz band. Specifically.... 15.253 of the rules for vehicular radar systems operating in the 76-77 GHz band. Vehicular radars can... sensors operating in the 76-77 GHz band, the spectrum shall be investigated up to 231 GHz. (f) Fundamental...

  7. Tracking dinosaurs in Spain

    Directory of Open Access Journals (Sweden)

    Neil D.L. Clark

    2015-12-01

    Full Text Available Book review: Félix Pérez-Lorente 2015. Dinosaur Footprints and Trackways of La Rioja. 376 pp. Indiana University Press. Hardcover. ISBN: 978-0-253-01515-0. Price $85.00/£61.00; e-book $84.99.

  8. Family Relationships and Perfectionism in Middle-School Students

    Science.gov (United States)

    DiPrima, Amy J.; Ashby, Jeffrey S.; Gnilka, Philip B.; Noble, Christina L.

    2011-01-01

    Several authors have suggested that perfectionism develops in the context of a person's family of origin. However, there are few empirical studies that address the relationship between family variables and perfectionism. This study examined the relationship between family variables and multidimensional perfectionism among a sample of 253

  9. Micro and nanohardness testing of laser welds

    Czech Academy of Sciences Publication Activity Database

    Šebestová, H.; Čtvrtlík, Radim; Chmelíčková, H.; Tomáštík, J.

    2014-01-01

    Roč. 15, č. 3 (2014), s. 247-253 ISSN 1454-9069 R&D Projects: GA TA ČR TA01010517 Institutional support: RVO:68378271 Keywords : Vickers microhardness * depth sensing indentation * laser welding Subject RIV: JP - Industrial Processing Impact factor: 1.658, year: 2014

  10. Failure to Detect Deaf-Blindness in a Population of People with Intellectual Disability

    Science.gov (United States)

    Fellinger, J.; Holzinger, D.; Dirmhirn, A.; van Dijk, J.; Goldberg, D.

    2009-01-01

    Background: Early identification of deaf-blindness is essential to ensure appropriate management. Previous studies indicate that deaf-blindness is often missed. We aim to discover the extent to which deaf-blindness in people with intellectual disability (ID) is undiagnosed. Method: A survey was made of the 253 residents of an institute offering…

  11. Biosorption of mercury on magnetically modified yeast cells

    Czech Academy of Sciences Publication Activity Database

    Yavuz, H.; Denizli, A.; Gungunes, H.; Šafaříková, Miroslava; Šafařík, Ivo

    2006-01-01

    Roč. 52, - (2006), s. 253-260 ISSN 1383-5866 R&D Projects: GA MŠk(CZ) OC 108 Institutional research plan: CEZ:AV0Z60870520 Keywords : mercury removal * magnetic biosorbents * yeast Subject RIV: EI - Biotechnology ; Bionics Impact factor: 2.497, year: 2006

  12. Factors Affecting the Job Satisfaction of Latino/a Immigrants in the Midwest

    Science.gov (United States)

    Valdivia, Corinne; Flores, Lisa Y.

    2012-01-01

    This study examined the job satisfaction of 253 Latino/a newcomers in three rural communities in the Midwest. Specifically, the authors explored the effects of ethnic identity, Anglo acculturation, Latino/a acculturation, perceptions of the community (social relations, discrimination/racism, and language pressures), job tenure, work hours, and…

  13. Why testes are resistant to hydatidosis: Is blood-testis-barrier ...

    African Journals Online (AJOL)

    Testes are extremely rare sites for echinococcosis. To our knowledge only three cases of testicular hydatid disease have been reported so far. In this laboratory animal model, we studied hydatidosis in rabbit testis. Fourteen male albino rabbits (body weight 2.5-3 kg) were randomized into two groups: Group A (study group), ...

  14. Household measures for river flood risk reduction in the Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Duží, B.; Vikhrov, Dmytro; Kelman, I.; Stojanov, R.; Juřička, D.

    2017-01-01

    Roč. 10, č. 2 (2017), s. 253-266 ISSN 1753-318X Institutional support: Progres-Q24 Keywords : Becva river basin * Czech Republic * flood damage Subject RIV: AH - Economics OBOR OECD: Applied Economics, Econometrics Impact factor: 3.121, year: 2016

  15. Exposure of Postnatal Rats to a Static Magnetic Field of 0.14 T Influences Functional Laterality of the Hippocampal High-Affinity Choline Uptake System in Adulthood; In Vitro Test With Magnetic Nanoparticles

    Czech Academy of Sciences Publication Activity Database

    Krištofíková, Z.; Čermák, M.; Benešová, O.; Klaschka, Jan; Zach, P.

    2005-01-01

    Roč. 30, č. 2 (2005), s. 253-262 ISSN 0364-3190 R&D Projects: GA MZd NF7576 Keywords : magnetic nanoparticles * choline transport * cholinergic * functional impairment * hippocampus * laterality * magnetoreception * static magnetic field Subject RIV: BB - Applied Statistics, Operational Research Impact factor: 2.187, year: 2005

  16. Settlement problems in the Czech borderland

    Czech Academy of Sciences Publication Activity Database

    Vaishar, Antonín; Dvořák, Petr; Nováková, Eva; Zapletalová, Jana

    2008-01-01

    Roč. 60, č. 3 (2008), s. 241-253 ISSN 0016-7193 R&D Projects: GA MŠk 2D06001 Institutional research plan: CEZ:AV0Z30860518 Keywords : borderland * social infrastructure * education * micro-regions Subject RIV: DE - Earth Magnetism, Geodesy, Geography

  17. Phenotypic plasticity and local adaptation in two extreme ...

    African Journals Online (AJOL)

    Principal coordinate analysis (PCoA) of allozymes revealed little genetic overlap among populations. Keywords: allozyme, genotype×environment interaction, genetic variation, local adaptation, reaction norms, starch gel electrophoresis, trade-off. African Journal of Range & Forage Science 2008, 25(3): 121–130 ...

  18. Aiding and Abetting: The Responsibility of Business Leaders under the Rome Statute of the International Criminal Court

    Directory of Open Access Journals (Sweden)

    Caspar Plomp

    2014-08-01

    Full Text Available While no business leaders have yet been charged before the International Criminal Court (ICC, such future proceedings will typically be conducted with reference to the accessorial mode of liability of aiding and abetting, under Article 25(3(c of the Rome Statute of the ICC. There exist diverse and competing interpretations of Article 25(3(c. This paper aims to advocate the creation of a dominant interpretation of Article 25(3(c and, consequently, to the clarification of the potential responsibility of business leaders who aid or abet crimes under the jurisdiction of the Rome Statute, in two ways. First, it asks whether Article 25(3(c can be interpreted in harmony with the dominant practice on aiding and abetting in international criminal law generally. Second, it presents a case study on the provision of arms by the Russian corporation Rosoboronexport to the Syrian government, which is likely to have committed crimes against humanity since March 2011 and war crimes since mid-2012. The theoretical conclusions are applied to a discussion on the potential criminal responsibility of the Director General of Rosoboronexport for aiding and abetting the commission of international crimes by high-level Syrian officials.

  19. Zvířecí skelet z laténského objektu v Nových Dvorech, okr. Kutná Hora

    Czech Academy of Sciences Publication Activity Database

    Kyselý, René

    2011-01-01

    Roč. 63, č. 2 (2011), s. 253-255 ISSN 0323-1267 Institutional research plan: CEZ:AV0Z80020508 Keywords : ritual * La Tène period * osteology * Bos taurus * cattle Subject RIV: AC - Archeology, Anthropology, Ethnology

  20. Epigenetic regulation – contribution to herbicide resistance in weeds?

    Czech Academy of Sciences Publication Activity Database

    Markus, C.; Pečinka, Aleš; Karan, R.; Barney, J. N.; Merotto, A.

    2018-01-01

    Roč. 74, č. 2 (2018), s. 275-281 ISSN 1526-498X Institutional support: RVO:61389030 Keywords : DNA methylation * epigenetic s * gene expression * gene regulation * herbicide detoxification * plant stress response Subject RIV: EF - Botanics OBOR OECD: Plant sciences, botany Impact factor: 3.253, year: 2016

  1. Separation of yttrium from strontium in the aqueous phase of the water/nitrobenzene system

    Czech Academy of Sciences Publication Activity Database

    Vaňura, P.; Makrlík, E.; Vobecký, Miloslav

    2002-01-01

    Roč. 253, č. 1 (2002), s. 171-172 ISSN 0236-5731 Institutional research plan: CEZ:AV0Z4031919 Keywords : stroncium * yttrium * separation Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 0.502, year: 2002

  2. Separation of microamounts of yttrium from strontium in the two-phase water/nitrobenzene system

    Czech Academy of Sciences Publication Activity Database

    Makrlík, E.; Vaňura, P.; Vobecký, Miloslav

    2002-01-01

    Roč. 253, č. 1 (2002), s. 153-155 ISSN 0236-5731 Institutional research plan: CEZ:AV0Z4031919 Keywords : separation * stroncium * yttrium Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 0.502, year: 2002

  3. Experiences with Provision of Post-Abortion Care in a University ...

    African Journals Online (AJOL)

    HP

    years and less were 37(7.1%) and single women were 132, constituting 25.3% of all cases. About 31% of the PAC .... Missed Abortion is defined as the retention of dead products of ... service providers transcending all cadres of staff in ... Married women were .... post abortion care, which is the unmarried teenage girls who ...

  4. 76 FR 62165 - Endangered and Threatened Wildlife and Plants; 12-Month Finding on a Petition To List Texas...

    Science.gov (United States)

    2011-10-06

    ... shell). They may also feed on organic particles in sediment using the large, muscular foot (an organ... detritus (Yeager et al. 1994, pp. 253-259). Mussels tend to grow relatively rapidly for the first few years.... Juvenile freshwater mussels burrow into interstitial substrates and grow to a larger size that is less...

  5. Approaching the Affective Factors of Information Seeking: The Viewpoint of the Information Search Process Model

    Science.gov (United States)

    Savolainen, Reijo

    2015-01-01

    Introduction: The article contributes to the conceptual studies of affective factors in information seeking by examining Kuhlthau's information search process model. Method: This random-digit dial telephone survey of 253 people (75% female) living in a rural, medically under-serviced area of Ontario, Canada, follows-up a previous interview study…

  6. PLASMA SPRAYING OF REFRACTORY CERMETS BY THE WATER-STABILIZED SPRAY (WSP®) SYSTEM

    Czech Academy of Sciences Publication Activity Database

    Ctibor, Pavel; Brožek, V.; Cheong, D.-I.; Chráska, Pavel

    2009-01-01

    Roč. 54, č. 3 (2009), s. 241-253 ISSN 0001-7043 Institutional research plan: CEZ:AV0Z20430508 Keywords : Plasma spraying * cermet coatings * microhardness * zirconium carbide * tungsten Subject RIV: JH - Ceramics, Fire-Resistant Materials and Glass

  7. 76 FR 19781 - Protection Island and San Juan Islands National Wildlife Refuges, Jefferson, San Juan, Skagit...

    Science.gov (United States)

    2011-04-08

    ... would continue as they have in the past and be facilitated through a State Parks partnership..., provided the draft CCP and EA on the Regional Web site, and provided a press release to local media. We... 98286. University of Puget Sound Library 1500 N. Warner St. 253-879-3669 Campus, Mail Box 1021 Tacoma...

  8. Prognostic Importance of Cardiovascular Risk Factors in Myocardial Infarction Patients

    Czech Academy of Sciences Publication Activity Database

    Monhart, Z.; Grünfeldová, H.; Zvárová, Jana; Janský, P.

    2010-01-01

    Roč. 122, č. 2 (2010), e253 ISSN 0009-7322. [World Congress of Cardiology . 16.06.2010-19.06.2010, Beijing] Institutional research plan: CEZ:AV0Z10300504 Keywords : cardiology * risk factors * myocardioal infarction Subject RIV: FA - Cardiovascular Diseases incl. Cardiotharic Surgery

  9. Nuclear magnetic resonance in diagnostics of internal diseases

    International Nuclear Information System (INIS)

    Malaya, L.T.; Uvarov, N.I.; Shashura, Yu.V.; Miklyaev, I.Yu.; Zhmuro, A.V.

    1990-01-01

    Use of NMR-tomography in general and differential diagnosis of brain diseases, diseases of internal organs (liver, galbludder, pancreas, kidneys, adrenal glands, organs small pelvis, thoracic cavity, soft tissues and bone-jopint system) is shown. Physical-technical bases of getting NMR image are presented. Problems of reproducibility, accuracy and interpretation of investigation results are discussed. 253 refs.; 1 tab

  10. Dissolved petroleum hydrocarbons along the oil tanker route in the southern Bay of Bengal

    Digital Repository Service at National Institute of Oceanography (India)

    Topgi, R; Noronha, R; Fondekar, S.P.; SenGupta, R

    Concentrations of dissolved petroleum hydrocarbons during 3 cruises (Nos. 51, 66 and 68) of R V Gaveshani, along the oil tanker route, in the southern Bay of Bengal at 0, 10 and 20 m were 19.95 + or - 3.38, 16.78 + or - 2.53 and 13.45 + or - 2.17 mu...

  11. Brno (k.ú. Bystrc, okr. Brno-město). Rokle. Neolit. Ojedinělý nález. Povrchový průzkum

    Czech Academy of Sciences Publication Activity Database

    Kirchner, Karel; Kuča, M.

    2009-01-01

    Roč. 50, 1-2 (2009), s. 253-254 ISSN 1211-7250 R&D Projects: GA ČR GA205/06/1024 Institutional research plan: CEZ:AV0Z30860518 Keywords : Brno Reservoir * neolithic * surface survey Subject RIV: AC - Archeology, Anthropology, Ethnology

  12. Europejski kryzys migracyjny (Rozważania pozbawione emocji i poprawności politycznej)

    Czech Academy of Sciences Publication Activity Database

    Pánek, Jaroslav

    2016-01-01

    Roč. 6, č. 1 (2016), s. 253-264 ISSN 2084-1213 Institutional support: RVO:67985963 Keywords : Contemporary migration * International Relations * European Union Subject RIV: AB - History OBOR OECD: History (history of science and technology to be 6.3, history of specific sciences to be under the respective headings)

  13. 75 FR 26310 - Self-Regulatory Organizations; International Securities Exchange, LLC; Notice of Filing and...

    Science.gov (United States)

    2010-05-11

    ... Symantec Corp. 162 TIVO TiVo Inc. 253 AMED Amedisys Inc. 163 MNKD MannKind Corp. 255 TM Toyota Motor Corp... 273 EP El Paso Corp. Group Ltd. 215 XLP Consumer Staples 274 SEED Origin Agritech Select Sector SPDR...

  14. Biohydrology research after Landau 2013 conference

    Czech Academy of Sciences Publication Activity Database

    Lichner, Ľ.; Cerdà, A.; Rajkai, K.; Tesař, Miroslav

    2014-01-01

    Roč. 62, č. 4 (2014), s. 253-257 ISSN 0042-790X Institutional support: RVO:67985874 Keywords : biohydrology * hydrological research * biological and hydrological systems * hydrological processes Subject RIV: DA - Hydrology ; Limnology Impact factor: 1.486, year: 2014

  15. Spurious Additional Warming Reconstructed From Borehole\

    Czech Academy of Sciences Publication Activity Database

    Šafanda, Jan

    2018-01-01

    Roč. 45, č. 6 (2018), s. 2780-2785 ISSN 0094-8276 R&D Projects: GA MŠk(CZ) EF16_013/0001792 Institutional support: RVO:67985530 Subject RIV: DC - Siesmology, Volcanology, Earth Structure OBOR OECD: Volcanology Impact factor: 4.253, year: 2016

  16. Sero-prevalence of contagious bovine pleuropneumonia and its ...

    African Journals Online (AJOL)

    Abstract. Contagious bovine pleuropneumonia (CBPP) is a disease of cattle caused by ... of veterinary departments have resulted in CBPP running riot in east and ... 5 334 of Sheep, 9 253 of Goat, 72 of Horses, 601 of Mules, 3 300 of Donkeys.

  17. The pre- versus post-main sequence evolutionary phase of B[e] stars. Constraints from 13CO band emission

    Czech Academy of Sciences Publication Activity Database

    Kraus, Michaela

    2009-01-01

    Roč. 494, č. 1 (2009), s. 253-262 ISSN 0004-6361 R&D Projects: GA AV ČR KJB300030701 Institutional research plan: CEZ:AV0Z10030501 Keywords : star s * winds * circumstellar matter Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 4.179, year: 2009

  18. Gender-related differences in attitudinal disposition of university ...

    African Journals Online (AJOL)

    Gender-related differences in attitudinal disposition of university workers to resolving conflict through mediation. ... df =253, P>0.05). It is therefore recommended that university workers should be adequately trained in the procedures of using mediation so as to build their capacity in resolving conflict at home and workplace.

  19. A review of the methods for signal estimation in stochastic diffusion leaky integrate-and-fire neuronal models

    Czech Academy of Sciences Publication Activity Database

    Lánský, Petr; Ditlevsen, S.

    2008-01-01

    Roč. 99, 4-5 (2008), s. 253-262 ISSN 0340-1200 R&D Projects: GA MŠk(CZ) LC554; GA AV ČR(CZ) 1ET400110401 Institutional research plan: CEZ:AV0Z50110509 Keywords : parameter estimation * stochastic diffusion neuronal model Subject RIV: BO - Biophysics Impact factor: 1.935, year: 2008

  20. Measuring Students' Perceptions of Personal and Social Responsibility and the Relationship to Intrinsic Motivation in Urban Physical Education

    Science.gov (United States)

    Li, Weidong; Wright, Paul M.; Rukavina, Paul Bernard; Pickering, Molly

    2008-01-01

    The purpose of the current study was to test the validity and reliability of a two-factor model of the Personal and Social Responsibility Questionnaire (PSRQ) and examine the relationships between perceptions of personal and social responsibility and intrinsic motivation in physical education. Participants were 253 middle school students who…

  1. The International Diversification of Banks and the Value of their Cross-Border M&A Advice

    NARCIS (Netherlands)

    de Jong, A.; Ongena, S.; van der Poel, M.

    2010-01-01

    This paper investigates the effects of international diversification of banks on the value of their M&A advice. We study bidder returns to 1,253 cross-border M&A announcements. We find that acquirers engaging a more internationally diversified financial advisor generate lower excess returns.

  2. Seasonal variation in particulate organic matter and its cnstituent fractions under the ice covered sea near the shelf, Antarctica

    Digital Repository Service at National Institute of Oceanography (India)

    Dhargalkar, V.K.

    discrete depths. Chl @ia@@ concentration at all the 3 depths varied from 0.026 to 0.253 mu g l@u-1@@ showing minimum values during August-September. POC values varied from 280 to 1058 mu g l@u-1@@ while its constituent fractions such as particulate...

  3. Chemical evolution, petrogenesis, and regional chemical ...

    Indian Academy of Sciences (India)

    R. Narasimhan (Krishtel eMaging) 1461 1996 Oct 15 13:05:22

    (from 84 to 253 ppm), Nb (from 5 to 16 ppm) and Ba (from 63 to 407 ppm), at MgO ranging from ... Sr/. 86. Sr give a range of initial ratios from 0.70558 to 0.70621. A group of flows of the Dhule area has low .... Ca-rich clinopyroxene belongs.

  4. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available EHA1 253.m00087 >1gntA 1 549 4 539 e-171 ... gb|EAL51411.1| hydroxylamine reductase, ...putative [Entamoeba histolytica HM-1:IMSS] ... gb|EAL44619.1| hydroxylamine reductase, putative ...

  5. The Relationship between Organizational Support, Work-Family Conflict, and the Job-Life Satisfaction of University Coaches

    Science.gov (United States)

    Dixon, Marlene A.; Sagas, Michael

    2007-01-01

    This study examined the relationship between organizational support, work-family conflict, and job and life satisfaction among coaches. Data from collegiate head coaches with families (N = 253) were gathered through a mailed questionnaire. Results from a series of covariance structure models indicated that a partially mediated model was the best…

  6. Organizational Support and Volunteering Benefits for Older Adults

    Science.gov (United States)

    Tang, Fengyan; Choi, Eunhee; Morrow-Howell, Nancy

    2010-01-01

    Purpose: This study tested a theoretical model of volunteering benefits and examined the mechanism through which volunteering benefits older adults. Design and Methods: This is a 2-wave study of 253 older adult volunteers serving in 10 volunteer programs. Older volunteers completed the mailed surveys in 2005 and 2006. Structural equation modeling…

  7. Word order and information structure in Czech 3-and 4-year-olds' comprehension.

    Czech Academy of Sciences Publication Activity Database

    Smolík, Filip

    2015-01-01

    Roč. 35, č. 3 (2015), s. 237-253 ISSN 0142-7237 R&D Projects: GA ČR GA13-26779S Institutional support: RVO:68081740 Keywords : Case marking * grammar comprehension * information structure Subject RIV: AN - Psychology Impact factor: 1.254, year: 2015

  8. Two new hexacoordinated coordination polymers of cadmium(II ...

    Indian Academy of Sciences (India)

    cadmium(II) in 2 in a non-ended fashion affording a 3D network structure. In the crystalline state, each ..... Light brown DMF solutions of free bnzd, 1 and 2 show strong absorption at 253, ... 972; (b) Steel P J 2005 Acc. Chem. Res. 38 243; (c).

  9. Soil Fauna: Macroarthropods

    Science.gov (United States)

    M.A. Callaham; D.A. Crossley; D.C. Coleman

    2012-01-01

    The macroarthropods are those large enough to be sampled as individuals, in contrast to the microarthropods that are sampled by extraction from a fragment of habitat (Section 25.3; Dindal, 1990; Borror et al., 1992; Arnett, 1993). Although smaller macroarthropods overlap in size with the larger microarthropods (Figure 25.2), the distinction between them is a practical...

  10. Formalized 2003 ESH/ESC Hypertension Guidelines in Hospital and General Practice

    Czech Academy of Sciences Publication Activity Database

    Peleška, Jan; Anger, Z.; Buchtela, David; Tomečková, Marie; Veselý, Arnošt; Zvárová, Jana

    22 Suppl. 2, - (2004), s. 253 ISSN 0263-6352. [European Meeting on Hypertension /14./. 13.06.2004-17.06.2004, Paris] R&D Projects: GA MŠk LN00B107 Keywords : hypertension guidelines * electronic form Subject RIV: BA - General Mathematics

  11. Sadhana | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    This study presents a scientometric analysis of 253 articles published in Sadhana during the year 2005–2009. Five volumes of the journal are taken up to observe the distribution of contribution, authorship pattern, institution-wise distribution, geographical distribution of contribution, average length of paper, tables and ...

  12. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 10; Issue 12. Einstein's Last Dream: The Space - Time Unification of Fundamental Forces. Abdus Salam. Volume 10 Issue 12 December 2005 pp 246-253. Fulltext. Click here to view fulltext PDF. Permanent link:

  13. 75 FR 70947 - Trinity Adaptive Management Working Group

    Science.gov (United States)

    2010-11-19

    ... DEPARTMENT OF THE INTERIOR Fish and Wildlife Service [FWS-R8-FHC-2010-N253; 81331-1334-8TWG-W4] Trinity Adaptive Management Working Group AGENCY: Fish and Wildlife Service, Interior. ACTION: Notice of meeting. SUMMARY: The Trinity Adaptive Management Working Group (TAMWG) affords stakeholders the...

  14. Probing into the diversity of trypanosomatid flagellates parasitizing insect hosts in South-West China reveals both endemism and global dispersal

    Czech Academy of Sciences Publication Activity Database

    Votýpka, Jan; Maslov, D. A.; Yurchenko, V.; Jirků, Milan; Kment, P.; Lun, Z.-R.; Lukeš, Julius

    2010-01-01

    Roč. 54, č. 1 (2010), s. 243-253 ISSN 1055-7903 Institutional research plan: CEZ:AV0Z60220518 Keywords : trypanosomatids * phylogeny * diversity * insects Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.889, year: 2010

  15. Automated Library Networking in American Public Community College Learning Resources Centers.

    Science.gov (United States)

    Miah, Adbul J.

    1994-01-01

    Discusses the need for community colleges to assess their participation in automated library networking systems (ALNs). Presents results of questionnaires sent to 253 community college learning resource center directors to determine their use of ALNs. Reviews benefits of automation and ALN activities, planning and communications, institution size,…

  16. Investigating Primary School Teachers' Perception about Democracy through Metaphor Analysis

    Science.gov (United States)

    Nasirci, Hasan; Sadik, Fatma

    2018-01-01

    The aim of this study is to examine democracy perception of classroom teachers via metaphor analysis. Study group for research is formed of 253 classroom teachers. "Democracy Metaphors Questionnaire" (DMQ) has been used in collecting data. Content analysis has been used on analysis of qualitative data of research and descriptive…

  17. 48 CFR 53.111 - Contract clause.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Contract clause. 53.111... AND FORMS FORMS General 53.111 Contract clause. Contracting officers shall insert the clause at 52.253-1, Computer Generated Forms, in solicitations and contracts that require the contractor to submit...

  18. Studená autoemisní katoda z tuhy do mikrotužky?

    Czech Academy of Sciences Publication Activity Database

    Knápek, Alexandr; Horáček, Miroslav; Chlumská, Jana; Král, Stanislav

    2017-01-01

    Roč. 62, č. 10 (2017), s. 251-253 ISSN 0447-6441 R&D Projects: GA MŠk(CZ) LO1212 Institutional support: RVO:68081731 Keywords : polymer graphite * field emission of electrons Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering OBOR OECD: Materials engineering

  19. Znovuuvedení kritické analýzy diskurzu do českého prostředí

    Czech Academy of Sciences Publication Activity Database

    Homoláč, Jiří; Mrázková, Kamila

    2017-01-01

    Roč. 78, č. 3 (2017), s. 237-253 ISSN 0037-7031 Institutional support: RVO:68378092 Keywords : critical discourse analysis * discourse-historical approach * discursive strategies * topos Subject RIV: AI - Linguistics OBOR OECD: Linguistics Impact factor: 0.625, year: 2016

  20. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education. Nikita Agarwal. Articles written in Resonance – Journal of Science Education. Volume 23 Issue 3 March 2018 pp 253-262 General Article. Maryam Mirzakhani: The Master Artist of Curved Surfaces · Nikita Agarwal Riddhi Shah Geetha Venkataraman.

  1. Common Purpose Liability versus Joint Enterprise: A Practical View on the ICC's Hierarchy of Liability Theories

    NARCIS (Netherlands)

    Cupido, M.

    2016-01-01

    On 7 March 2014, Trial Chamber II of the International Criminal Court (ICC) convicted Germain Katanga for war crimes and crimes against humanity. Katanga's conviction is based on the concept of common purpose liability as regulated in Article 25(3)(d) of the Rome Statute. This liability theory

  2. Identification and functionality of proteomes secreted by rat cardiac stem cells and neonatal cardiomyocytes

    Czech Academy of Sciences Publication Activity Database

    Šťastná, Miroslava; Chimenti, I.; Marban, E.; Van Eyk, J.E.

    2010-01-01

    Roč. 10, č. 2 (2010), s. 245-253 ISSN 1615-9853 Institutional research plan: CEZ:AV0Z40310501 Keywords : animal proteomics * cardiac stem cells * neonatal cardiomyocytes Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 4.815, year: 2010

  3. Optimization of special inductor for induction pre-heating

    Czech Academy of Sciences Publication Activity Database

    Pánek, D.; Kotlan, V.; Doležel, Ivo

    2014-01-01

    Roč. 2014, č. 12 (2014), s. 253-256 ISSN 0033-2097 R&D Projects: GA ČR(CZ) GAP102/11/0498 Grant - others:GA TA ČR(CZ) TA03010354 Institutional support: RVO:61388998 Keywords : induction heating * shape optimization * hard-coupled formulation Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering

  4. A novel sheet topology in the structure of kamitugaite, PbAl[(UO.sub.2./sub.).sub.5./sub.(PO.sub.4./sub.).sub.2.38./sub.(AsO.sub.4./sub.).sub.0.62./sub.O.sub.2./sub.(OH).sub.2./sub.](H.sub.2./sub.O).sub.11.5./sub.

    Czech Academy of Sciences Publication Activity Database

    Plášil, Jakub

    2017-01-01

    Roč. 62, č. 4 (2017), s. 253-260 ISSN 1802-6222 R&D Projects: GA ČR GA17-09161S Institutional support: RVO:68378271 Keywords : kamitugaite * uranyl phosphate * crystal structure * topology Subject RIV: DB - Geology ; Mineralogy OBOR OECD: Geology Impact factor: 0.609, year: 2016

  5. Cell cycle dependent expression of Plk 1 in synchronized porcine fetal fibroblasts

    Czech Academy of Sciences Publication Activity Database

    Anger, M.; Kues, W. A.; Klíma, J.; Mielenz, M.; Kubelka, M.; Motlík, J.; Ešner, M.; Dvořák, Petr; Carnwath, J. W.; Niemann, H.

    2003-01-01

    Roč. 65, - (2003), s. 245-253 ISSN 1040-452X R&D Projects: GA MŠk LN00A065 Institutional research plan: CEZ:AV0Z5039906 Keywords : serum deprivation Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.543, year: 2003

  6. Nature Watch

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 20; Issue 3. Nature Watch: Symbiosis in Coastal Marine Communities. Neelam Pereira. Feature Article Volume 20 Issue 3 March 2015 pp 245-253. Fulltext. Click here to view fulltext PDF. Permanent link:

  7. Product ion distributions for the reactions of NO+ with some physiologically significant volatile organosulfur and organoselenium compounds obtained using a selective reagent ionization time-of-flight mass spectrometer

    Czech Academy of Sciences Publication Activity Database

    Mochalski, P.; Unterkofler, K.; Španěl, Patrik; Smith, D.; Amann, A.

    2014-01-01

    Roč. 28, č. 15 (2014), s. 1683-1690 ISSN 0951-4198 Institutional support: RVO:61388955 Keywords : TRACE GAS-ANALYSIS * ORGANIC-COMPOUNDS * EXHALED-BREATH Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.253, year: 2014

  8. jfewr ©2017 - jfewr Publications

    African Journals Online (AJOL)

    PAPILO

    and expressed as a percentage of the total number .... occurrence and numerical methods from Lower. River Benue .... revealed different weight, age and size classes in ... J. App. Ichthyol. 22: 241-253. Frota L.O., Costa, P.A.S. and Braga, A.C..

  9. Study of ecological consequence of the bloom (Noctiluca miliaris) in off shore waters of the Northern Arabian Sea

    Digital Repository Service at National Institute of Oceanography (India)

    Dwivedi, R.M.; Chauhan, R.; Solanki, H.U.; Raman, M.; Matondkar, S.G.P.; Madhu, V.R.; Meenakumari, B.

    , NO. 4, AUGUST 2012 306 Schools of flying fishes and large size squids were observed during night at one bloom station in March 2007 (FORV-253). Also, on one occasion baby sharks were found swimming inside the bloom patch. These observations...

  10. European communication monitor 2015: excellence in strategic communication: creating communication value through listening, messaging and measurement: results of a survey in 41 countries

    NARCIS (Netherlands)

    Zerfass, A.; Verčič, D.; Verhoeven, P.; Moreno, A.; Tench, R.

    2015-01-01

    The ECM 2015 survey is based on responses from 2,253 communication professionals in 41 countries. Detailed analyses are available for 20 countries and different types of organisations (companies, non-profits, governmental, agencies). The study was organised by the European Public Relations Education

  11. Fecundity and fertility of ladybird beetle Harmonia axyridis after prolonged cold storage

    Czech Academy of Sciences Publication Activity Database

    Awad, Mona; Kalushkov, P.; Nedvědová, T.; Nedvěd, Oldřich

    2013-01-01

    Roč. 58, č. 5 (2013), s. 657-666 ISSN 1386-6141 Grant - others:MZe ČR(CZ) QH82047 Institutional support: RVO:60077344 Keywords : ladybird * hatching rate * overwintering Subject RIV: ED - Physiology Impact factor: 2.253, year: 2013 http://link.springer.com/article/10.1007%2Fs10526-013-9512-4#

  12. An overview of some recent results on the Euler system of isentropic gas dynamics

    Czech Academy of Sciences Publication Activity Database

    Chiodaroli, E.; Kreml, Ondřej

    2016-01-01

    Roč. 47, č. 1 (2016), s. 241-253 ISSN 1678-7544 Institutional support: RVO:67985840 Keywords : hyperbolic systems of conservation laws * Riemann problem * admissible solutions Subject RIV: BA - General Mathematics Impact factor: 0.400, year: 2016 http://link.springer.com/article/10.1007%2Fs00574-016-0135-0

  13. Fragmentation model of meteoroid motion, mass loss, and radiation in the atmosphere

    Czech Academy of Sciences Publication Activity Database

    Ceplecha, Zdeněk; ReVelle, D.O.

    2005-01-01

    Roč. 40, č. 1 (2005), s. 35-54 ISSN 1086-9379 Institutional research plan: CEZ:AV0Z10030501 Keywords : luminous efficiency * innisfree meteorite Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 2.253, year: 2005

  14. Constituents of the leaf oil of Vietnamese Clausena excavata Burm.f

    NARCIS (Netherlands)

    Leclercq, P.A.; Dung, N.X.; Thin, N.N.

    1994-01-01

    A detailed analvsis of the essential oil of Clausena excavata Burm.f. has been carried out by capillary dc and GC/MS. The oil contains more than 50 components, of which 40 have been identified. The main constituents found were beta-caryophyllene (25.3%), germacrene B (11.8%) !Uld beta-phellandrene

  15. TMFunction data: 663 [TMFunction[Archive

    Lifescience Database Archive (English)

    Full Text Available Lambert G, Forster IC, Stange G, Biber J, Murer H. J Gen Physiol. 1999 Nov;114(5):637-52 cysteine mutagenesis... -25.3 Electrogenic Activity (Ip) electrophysiological ... NPT2A_RAT (Q06496) Helix ... mutagenesis; phosphate transport; electrophysiology; Xenopus laevis oocyte

  16. Humor Climate of the Primary Schools

    Science.gov (United States)

    Sahin, Ahmet

    2018-01-01

    The aim of this study is to determine the opinions primary school administrators and teachers on humor climates in primary schools. The study was modeled as a convergent parallel design, one of the mixed methods. The data gathered from 253 administrator questionnaires, and 651 teacher questionnaires was evaluated for the quantitative part of the…

  17. Labor's charm wins over countryside / Milda Seputyte

    Index Scriptorium Estoniae

    Seputyte, Milda

    2005-01-01

    Küsitluste järgi on Leedu Tööpartei toetus elanike seas tõusnud 25,3 protsendini. Juhul kui praegune peaminister Algirdas Brazauskas peaks skandaali tõttu ametist tagasi astuma, kavatseb sellele kohale kandideerida Tööpartei esimees Viktor Uspaskihh

  18. Mõne läänemeresoome sufiksi taustast / Ago Künnap

    Index Scriptorium Estoniae

    Künnap, Ago, 1941-

    2009-01-01

    Vastukaja artiklile: Grünthal, Riho. The Mordvinic languages between bush and tree : a historical reappraisal // Sámit, sánit, sátnehámit : riepmočála Pekka Sammallahtii miessemánu 21. beaivve 2007. Helsinki : Suomalais-Ugrilainen Seura, 2007. (Suomalais-Ugrilaisen Seuran toimituksia ; 253)

  19. 24 CFR 3285.4 - Incorporation by reference (IBR).

    Science.gov (United States)

    2010-04-01

    ..., Virginia 22206. (1) ACCA Manual J, Residential Load Calculation, 8th Edition, IBR approved for § 3285.503(a)(1)(i)(A). (2) [Reserved] (c) The materials listed below are available for purchase from APA—The...-6600, fax number (253) 565-7265. (1) PS1-95, Construction and Industrial Plywood (with typical APA...

  20. Daily and Momentary Mood and Stress Are Associated with Binge Eating and Vomiting in Bulimia Nervosa Patients in the Natural Environment

    Science.gov (United States)

    Smyth, Joshua M.; Wonderlich, Stephen A.; Heron, Kristin E.; Sliwinski, Martin J.; Crosby, Ross D.; Mitchell, James E.; Engel, Scott G.

    2007-01-01

    The relation of mood and stress to binge eating and vomiting in the natural environments of patients with bulimia nervosa (BN) was examined using real-time data collection. Women (n = 131; mean age = 25.3 years) with BN carried a palmtop computer for 2 weeks and completed ratings of positive affect (PA), negative affect (NA), anger/hostility (AH),…

  1. X-Ray Lithography In Japan

    Science.gov (United States)

    1991-10-01

    electrons hitting the walls of the ring is not in the direct line of sight of a tilted beamline. A translating mirror is then used to expand the...34 Remarch Peromnnel and Facilities for Resist R&D T. Nakayama TOK, 1590 Tabata , Samukawa-cho, Kohza-gun, Kanagawa-ken 253-01 Japan M. Sasago Matsushita

  2. Sadhana | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    pp 241-253. An approximate method for lateral stability analysis of wall-frame buildings including shear deformations of walls ... A study on soil–structure interaction analysis in canyon-shaped topographies ... Stochastic finite element analysis of long-span bridges with CFRP cables under earthquake ground motion.

  3. Impact of Game-Based Training on Classroom Learning Outcomes

    Science.gov (United States)

    2010-09-01

    Erwin, 2000). Several studies support the notion that GBT increases learners’ motivation. Massively multiple online role-playing games ( MMORPGs ) are...synthetic arenas where players interact, collaborate, and strategize with others. The nature of MMORPGs challenges players to think critically and...online role-playing games ( MMORPGs ) foster intrinsic motivation. Educational Technology Research and Development, 55, 253-273. Dondi, C., & Moretti

  4. Controls on pathogen species richness in plants’ introduced and native ranges: roles of residence time, range size and host traits

    Czech Academy of Sciences Publication Activity Database

    Mitchell, C. E.; Blumenthal, D.; Jarošík, Vojtěch; Puckett, E. E.; Pyšek, Petr

    2010-01-01

    Roč. 13, č. 12 (2010), s. 1525-1535 ISSN 1461-023X R&D Projects: GA MŠk LC06073 Grant - others:European Union(XE) KBBE-212459 Institutional research plan: CEZ:AV0Z60050516 Keywords : enemy release * plant invasions * biogeographical comparison Subject RIV: EF - Botanics Impact factor: 15.253, year: 2010

  5. Postoje obyvatel k situaci na trhu s bydlením a bytové politice: existují v České republice „housing classes“?

    Czech Academy of Sciences Publication Activity Database

    Kostelecký, Tomáš

    2005-01-01

    Roč. 41, č. 2 (2005), s. 253-270 ISSN 0038-0288 R&D Projects: GA ČR(CZ) GA403/03/0417 Institutional research plan: CEZ:AV0Z70280505 Keywords : models * electoral predictions * surveys Subject RIV: AO - Sociology, Demography Impact factor: 0.113, year: 2005

  6. Performance of Platinum and Gold Catalysts Supported on Ceria-Zirconia Mixed Oxide in the Oxidation of Chlorobenzene

    Czech Academy of Sciences Publication Activity Database

    Topka, Pavel; Delaigle, R.; Kaluža, Luděk; Gaigneaux, E.M.

    2015-01-01

    Roč. 253, SEP 15 (2015), s. 172-177 ISSN 0920-5861 R&D Projects: GA ČR GP13-24186P Institutional support: RVO:67985858 Keywords : oxidation * chlorobenzene * zirconia Subject RIV: CI - Industrial Chemistry, Chemical Engineering Impact factor: 4.312, year: 2015

  7. Epidemiology of paediatric poisoning reporting to a tertiary hospital ...

    African Journals Online (AJOL)

    Methods. We conducted a retrospective study from January 2007 to January 2012 at the Komfo Anokye Teaching Hospital, a tertiary hospital in Ghana. Results. Poisoning is a significant health problem in the study area. A total of 253 children reported to the hospital with poisoning over the 61month period, with an average ...

  8. Rigidity theorem for Willmore surfaces in a sphere

    Indian Academy of Sciences (India)

    (Math. Sci.) Vol. 126, No. 2, May 2016, pp. 253–260. c Indian Academy of Sciences. Rigidity theorem for Willmore surfaces in a sphere. HONGWEI XU1 and DENGYUN YANG2,∗. 1Center of Mathematical Sciences, Zhejiang University, Hangzhou 310027,. People's Republic of China. 2College of Mathematics and ...

  9. Proceedings – Mathematical Sciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Proceedings – Mathematical Sciences; Volume 126; Issue 2. Volume 126, Issue 2. May 2016, pages 143-287. pp 143-151 Research Article. Existence of ..... pp 253-260 Research Article. Rigidity theorem forWillmore surfaces in a sphere · Hongwei Xu Dengyun Yang · More Details Abstract Fulltext PDF.

  10. 75 FR 7454 - Notice of Commission Meeting and Public Hearing

    Science.gov (United States)

    2010-02-19

    ... existing trickling filter treatment system is proposed to be replaced with an extended aeration system... treatment train will be constructed, consisting of a Vertical Loop Reactor, clarifiers, and aerobic digester... will land discharge to four on-site infiltration beds. The project is located near River Mile 253.64--9...

  11. The testing of generator circuit-breakers

    NARCIS (Netherlands)

    Smeets, R.P.P.; Linden, van der W.A.

    1998-01-01

    Generator circuit-breakers face much higher current and voltage stress than distribution switchgear. This has led to a special standard (ANSI C37.013). Strictly in accordance with this standard's requirements, test circuits and parameters for a 100 kA and 120 kA (25.3 kV) SF6 generator

  12. Using the Internet to Collaborate with Consumers in Redefining a Psychosocial Agenda for Families with Hereditary Breast Cancer

    Science.gov (United States)

    2007-06-01

    during the PM and reconstruction period are over, but the marks on their bodies and lack of sensation in their nipples and breasts remain with them and...and men - tor discussions (OR=2.53, CI=1.25, 5.14) than recipients with less education. Recipients with living donor transplants were interested in

  13. Fiducial and differential cross sections of Higgs boson production measured in the four-lepton decay channel in pp collisions at √s = 8 TeV with the ATLAS detector

    Czech Academy of Sciences Publication Activity Database

    Aad, G.; Abbott, B.; Abdallah, J.; Böhm, Jan; Chudoba, Jiří; Havránek, Miroslav; Jakoubek, Tomáš; Kepka, Oldřich; Kupčo, Alexander; Kůs, Vlastimil; Lokajíček, Miloš; Lysák, Roman; Marčišovský, Michal; Mikeštíková, Marcela; Němeček, Stanislav; Šícho, Petr; Staroba, Pavel; Svatoš, Michal; Taševský, Marek; Vrba, Václav

    2014-01-01

    Roč. 738, Nov (2014), s. 234-253 ISSN 0370-2693 R&D Projects: GA MŠk(CZ) LG13009 Institutional support: RVO:68378271 Keywords : differential cross section * transverse momentum * lepton * ATLAS * beam transport * CERN LHC Coll * phase space * efficiency * resolution * rapidity Subject RIV: BF - Elementary Particles and High Energy Physics Impact factor: 6.131, year: 2014

  14. 78 FR 19000 - Montezuma National Wildlife Refuge, Cayuga, Seneca, and Wayne Counties, NY; Final Comprehensive...

    Science.gov (United States)

    2013-03-28

    ...-568- 5987 (phone), or Lia McLaughlin, Planning Team Leader, 413-253-8575 (phone); email... Conservation (NYSDEC), and other partners for its role in the conservation of migratory birds, particularly.... Newly acquired lands would not be converted to impoundments. Natural succession would play a larger role...

  15. 77 FR 30312 - Montezuma National Wildlife Refuge, Cayuga, Seneca, and Wayne Counties, NY; Draft Comprehensive...

    Science.gov (United States)

    2012-05-22

    ... INFORMATION CONTACT: Tom Jasikoff, Refuge Manager, 315-568- 5987 (phone), or Lia McLaughlin, Planning Team Leader, 413-253-8575 (phone); [email protected] (email). SUPPLEMENTARY INFORMATION: Introduction... (NYSDEC), and other partners for its role in the conservation of migratory birds, particularly waterfowl...

  16. Comparative Study of the Spherical Downward Continuation

    Czech Academy of Sciences Publication Activity Database

    Sebera, Josef; Pitoňák, M.; Hamáčková, E.; Novák, P.

    2015-01-01

    Roč. 36, č. 2 (2015), s. 253-267 ISSN 0169-3298 Grant - others:GA MŠk(CZ) CZ.1.05/1.1.00/02.0090 Institutional support: RVO:67985815 Keywords : limited airborne gravity * potential-field data * horizontal plane Subject RIV: DE - Earth Magnetism, Geodesy, Geography Impact factor: 3.622, year: 2015

  17. using random amplified polymorphic DNA (RAPD)

    African Journals Online (AJOL)

    To study the pattern of genetic diversity in 45 genotypes of common bean, 19 RAPD primers were used. Of 253 bands produced, 236 bands (94.22%) were polymorphic in which maximum number (20 polymorphic bands) were observed in the profiles of the primer OPB-07. Highest PIC value (0.79) was observed for the ...

  18. Sadhana | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Sadhana. Pawan Kumar Gupta. Articles written in Sadhana. Volume 32 Issue 3 June 2007 pp 253-275. TCP with header checksum option for wireless links: An analytical approach towards performance evaluation · Pawan Kumar Gupta Joy Kuri · More Details Abstract Fulltext PDF. TCP performs poorly in ...

  19. a study of parallel proverbs in akan (twi)

    African Journals Online (AJOL)

    conceptual/semantic similarity in terms of core meaning with regard to behavior towards palm-wine ..... populations and the evolution of human mitochondrial DNA.” Science 253 ..... NEG-REL-have sleep 2SG-NEG-know bedbugs wake. 3SG.

  20. Unit Ministry Team Religious Support to Casualties on the Airland Battlefield

    Science.gov (United States)

    1987-10-28

    Dysentery, Mod 248 Gastrits, Acute 249 Peptic Ulcer, Severe 250 Peptic Ulcer, Mod 251 Regional Ileitis 252 Regional Ileitis, Mod 253 Helminthiasis ...Severe 254 Helminthiasis , Mod 255 Migraine, acute 256 Varicosities, Severe 257 Varicosities, Mod 258 Essential Hypertension 2,)9 Ischemic Heart

  1. Predictors of Emotional Eating during Adolescents' Transition to College: Does Body Mass Index Moderate the Association between Stress and Emotional Eating?

    Science.gov (United States)

    Wilson, Shana M.; Darling, Katherine E.; Fahrenkamp, Amy J.; D'Auria, Alexandra L.; Sato, Amy F.

    2015-01-01

    Objective: This study sought to (1) examine perceived stress and resources to cope with stress as predictors of emotional eating during the transition to college and (2) determine whether body mass index (BMI) moderated the emotional eating-stress relationship. Participants: Participants were 97 college freshmen (73% female; BMI: M = 25.3

  2. Content Validation of Athletic Therapy Clinical Presentations in Canada

    Science.gov (United States)

    Lafave, Mark R.; Yeo, Michelle; Westbrook, Khatija; Valdez, Dennis; Eubank, Breda; McAllister, Jenelle

    2016-01-01

    Context: Competency-based education requires strong planning and a vehicle to deliver and track students' progress across their undergraduate programs. Clinical presentations (CPs) are proposed as 1 method to deliver a competency-based curriculum in a Canadian undergraduate athletic therapy program. Objective: Validation of 253 CPs. Setting:…

  3. Primary School Students' Strategies in Early Algebra Problem Solving Supported by an Online Game

    Science.gov (United States)

    van den Heuvel-Panhuizen, Marja; Kolovou, Angeliki; Robitzsch, Alexander

    2013-01-01

    In this study we investigated the role of a dynamic online game on students' early algebra problem solving. In total 253 students from grades 4, 5, and 6 (10-12 years old) used the game at home to solve a sequence of early algebra problems consisting of contextual problems addressing covarying quantities. Special software monitored the…

  4. Effects of particle size and laser wavelength on heating of silver ...

    Indian Academy of Sciences (India)

    2016-07-15

    Jul 15, 2016 ... heating of nanoparticles is one of the essential stages of selective cell targeting. It is necessary to note that the ... Doping the walls of the microcapsules with ..... [19] A N Volkov, Ca Sevilla and L V Zhigilei, Appl. Surf. Sci. 253,.

  5. Bulletin of Materials Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Articles written in Bulletin of Materials Science. Volume 26 Issue 2 February 2003 pp 247-253 Electrical Properties. Impedance spectroscopy ... the a.c. conductivity data. Volume 26 Issue 7 December 2003 pp 745-747 Electrical Properties. Dielectric properties of piezoelectric 3–0 composites of lithium ferrite/barium titanate.

  6. Vliv podmínek sladování na obsah dextrinů v meziproduktech výroby piva

    Czech Academy of Sciences Publication Activity Database

    Psota, V.; Čmelík, Richard; Sachambula, L.

    2011-01-01

    Roč. 57, 7-8 (2011), 253-259 ISSN 0023-5830 R&D Projects: GA MŠk 2B06037 Institutional research plan: CEZ:AV0Z40310501 Keywords : malting * dextrin * beer Subject RIV: CB - Analytical Chemistry, Separation

  7. Presidendi mõjukus avaliku arvamuse silmade läbi / Marti Taru

    Index Scriptorium Estoniae

    Taru, Marti, 1970-

    2002-01-01

    Uuringu tulemusena selgus, et avaliku arvamuse silmis eristub president teistest riigijuhtidest just riigimehelikkuse poolest - president peaks olema ametiisik, kes seisab kogu ühiskonna arengu ja heaolu eest, mitte aga ei tegutse kitsaste kildkondade huve esindades. Tabelid. Lisa: Valimi sotsiaal-demograafiline kirjeldus lk. 253-256

  8. A case study of a density structure over a vertical magnetic field region in the Martian ionosphere

    Czech Academy of Sciences Publication Activity Database

    Duru, F.; Gurnett, D. A.; Dieval, C.; Morgan, D. D.; Píša, David; Lundin, R.

    2016-01-01

    Roč. 43, č. 10 (2016), s. 4665-4672 ISSN 0094-8276 Institutional support: RVO:68378289 Keywords : mars-express * ionosphere * anomalies * ionospheric plasma * Mars Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 4.253, year: 2016 http://onlinelibrary.wiley.com/doi/10.1002/2016GL068686/abstract

  9. Stress and charge transfer in uniaxially strained CVD graphene

    Czech Academy of Sciences Publication Activity Database

    Bouša, Milan; Anagnostopoulos, G. C.; del Corro, Elena; Drogowska, Karolina; Pekárek, J.; Kalbáč, Martin; Parthenios, J.; Papagelis, K.; Galiotis, C.; Frank, Otakar

    2016-01-01

    Roč. 253, č. 12 (2016), s. 2355-2361 ISSN 0370-1972 R&D Projects: GA ČR GA14-15357S; GA MŠk LL1301 Institutional support: RVO:61388955 Keywords : chemical vapour deposition * graphene * Raman spectroscopy Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.674, year: 2016

  10. MASSIVE PROTOPLANETARY DISKS IN ORION BEYOND THE TRAPEZIUM CLUSTER

    International Nuclear Information System (INIS)

    Mann, Rita K.; Williams, Jonathan P.

    2009-01-01

    We present Submillimeter Array 1 The Submillimeter Array is a joint project between the Submillimeter Astrophysical Observatory and the Academica Sinica Institute of Astronomy and Astrophysics and is funded by the Smithsonian Institution and the Academica Sinica. observations of the 880 μm continuum emission from three circumstellar disks around young stars in Orion that lie several arcminutes (∼> 1 pc) north of the Trapezium cluster. Two of the three disks are in the binary system 253-1536. Silhouette disks 216-0939 and 253-1536a are found to be more massive than any previously observed Orion disks, with dust masses derived from their submillimeter emission of 0.045 M sun and 0.066 M sun , respectively. The existence of these massive disks reveals that the disk mass distribution in Orion does extend to high masses, and that the truncation observed in the central Trapezium cluster is a result of photoevaporation due to the proximity of O-stars. 253-1536b has a disk mass of 0.018 M sun , making the 253-1536 system the first optical binary in which each protoplanetary disk is massive enough to potentially form solar systems.

  11. Spectroscopic classification of SN 2018bxs as a type Ia supernova a few days before maximum

    Science.gov (United States)

    Wyatt, Samuel; Andrews, Jennifer; Sand, David; Smith, Nathan

    2018-06-01

    On UT 2018 May 25.3 we obtained an optical spectrum (range 370-800 nm) of AT2018bxs (=ATLAS18ppz), discovered by ATLAS (Tonry et al. 2011, PASP, 123, 58) with the 2.3m Bok telescope (+ Boller & Chivens spectrograph) on Kitt Peak, Arizona.

  12. Novel antagonistic interactions associated with plant polyploidization influence trait selection and habitat preference

    Czech Academy of Sciences Publication Activity Database

    Arvanitis, L.; Wiklund, C.; Münzbergová, Zuzana; Dahlgren, J. P.; Ehrlén, J.

    2010-01-01

    Roč. 13, č. 3 (2010), s. 330-337 ISSN 1461-023X R&D Projects: GA ČR GA526/08/0706 Institutional research plan: CEZ:AV0Z60050516 Keywords : herbivore * trait * selection Subject RIV: EF - Botanics Impact factor: 15.253, year: 2010

  13. Novel Resuscitation from Lethal Hemorrhage Suspended Animation for Delayed Resuscitation

    Science.gov (United States)

    2005-10-01

    19 X. A ppendices ...Programmed cell death is triggered by acute brain injury yet its reliable detection is complicated by effective clearance of apoptotic cells in vivo. During...Tisherman’s book on hypothermia in acute medicine entitled ’Therapeutic Hypothermia" was published by Kluwer. It included 253 pages and, germane to

  14. A Ligand-Bridged Heterotetranuclear (Fe2Cu2) Redox System with Fc/Fc(+) and Radical Ion Intermediates

    Czech Academy of Sciences Publication Activity Database

    Jana, R.; Lissner, F.; Schwederski, B.; Fiedler, Jan; Kaim, W.

    2013-01-01

    Roč. 32, č. 20 (2013), s. 5879-5886 ISSN 0276-7333 R&D Projects: GA ČR GA203/09/0705 Institutional support: RVO:61388955 Keywords : CHARGE-TRANSFER * COMPLEXES * ELECTRON Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 4.253, year: 2013

  15. "Healthy Habits, Healthy Girls—Brazil": an obesity prevention program with added focus on eating disorders

    Science.gov (United States)

    The purpose of the study was to evaluate the immediate post-intervention and 6-month post-intervention effects of a Brazilian school-based randomized controlled trial for girls targeting shared risk factors for obesity and disordered eating. A total of 253 girls, mean of 15.6 (0.05) years from 1st t...

  16. Griechische Tragödie als Medium der Erfahrung

    Czech Academy of Sciences Publication Activity Database

    Kouba, Petr

    2013-01-01

    Roč. 22, 84-85 (2013), s. 235-253 ISSN 1318-3362 R&D Projects: GA ČR(CZ) GAP401/10/1164 Institutional support: RVO:67985955 Keywords : tragedy * destiny * exteriority * event Subject RIV: AA - Philosophy ; Religion

  17. Instructional Support for Novice Law Students: Reducing Search Processes and Explaining Concepts in Cases

    NARCIS (Netherlands)

    Nievelstein, Fleurie; Van Gog, Tamara; Van Dijck, Gijs; Boshuizen, Els

    2010-01-01

    Nievelstein, F., Van Gog, T., Van Dijck, C., & Boshuizen, H. P. A. (2011). Instructional support for novice law students: Reducing search processes and explaining concepts in cases. Applied Cognitive Psychology, 25(3), 408-413. doi:10.1002/acp.1707

  18. Time Scales of the European Surface Air Temperature Variability: The Role of the 7-8 Year Cycle

    Czech Academy of Sciences Publication Activity Database

    Jajcay, Nikola; Hlinka, Jaroslav; Kravtsov, S.; Tsonis, A.A.; Paluš, Milan

    2016-01-01

    Roč. 43, č. 2 (2016), s. 902-909 ISSN 0094-8276 R&D Projects: GA MŠk LH14001 Institutional support: RVO:67985807 Keywords : 7-8 year cycle * air temperature variability * annual cycle amplitude * cross-scale interactions * seasonality * time scales Subject RIV: DG - Athmosphere Sciences, Meteorology Impact factor: 4.253, year: 2016

  19. Bulletin of Materials Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. N K PANDEY. Articles written in Bulletin of Materials Science. Volume 40 Issue 2 April 2017 pp 253-262. Electrical and optical properties of ZnO–WO 3 nanocomposite and its application as a solid-state humidity sensor · VANDNA SHAKYA N K PANDEY SUNEET KUMAR ...

  20. The Relationship Between Life Course Factors, Parental ...

    African Journals Online (AJOL)

    RESULTS: Out of the 324 adolescents who completed the questionnaire, 25.3% reported visiting a dentist within a period of one year. Childhood dental visit, childhood dental experience, housing, internal and external locus of control and self-efficacy were significantly associated with recent dental visit (p<0.05). Participants ...

  1. A new species of the Camponotus aureopilus VIEHMEYER, 1914 species-group (Hymenoptera: Formicidae) from Papua New Guinea

    Czech Academy of Sciences Publication Activity Database

    Shattuck, S.; Janda, Milan

    2009-01-01

    Roč. 12, - (2009), s. 251-253 ISSN 1994-4136 R&D Projects: GA MŠk LC06073; GA AV ČR KJB612230701 Grant - others:U.S. National Science Foundation(US) DEB-02-11591 Institutional research plan: CEZ:AV0Z50070508 Keywords : taxonomic description * Hymenoptera * Formicidae Subject RIV: EG - Zoology

  2. 76 FR 72087 - Special Conditions: Diamond Aircraft Industries, Model DA-40NG; Electronic Engine Control (EEC...

    Science.gov (United States)

    2011-11-22

    ...; Special Conditions No. 23-253-SC] Special Conditions: Diamond Aircraft Industries, Model DA-40NG..., Model DA-40NG airplane. This airplane will have a novel or unusual design feature(s) associated with an... include the new model DA- 40NG with the Austro Engine GmbH model E4 Aircraft Diesel Engine (ADE). The...

  3. Amoebae of the genera Vannella Bovee, 1965 and Platyamoeba Page, 1969 isolated from fish and their phylogeny inferred from SSU rRNA gene and ITS sequences

    Czech Academy of Sciences Publication Activity Database

    Dyková, Iva; Boháčová, Lenka; Fiala, Ivan; Macháčková, Blanka; Pecková, Hana; Dvořáková, Helena

    2005-01-01

    Roč. 41, č. 3 (2005), s. 219-230 ISSN 0932-4739 R&D Projects: GA AV ČR IAA6022202 Institutional research plan: CEZ:AV0Z60220518 Keywords : fish-isolated amoebae * Vannella * Platyamoeba Subject RIV: EA - Cell Biology Impact factor: 1.253, year: 2005

  4. Strangeness Electromagnetic Production on Nucleons and Nuclei

    Czech Academy of Sciences Publication Activity Database

    Bydžovský, Petr; Sotona, Miloslav

    2010-01-01

    Roč. 835, 1-4 (2010), s. 246-253 ISSN 0375-9474 R&D Projects: GA ČR GA202/08/0984 Institutional research plan: CEZ:AV0Z10480505 Keywords : Kaon * photoproduction * electroproduction Subject RIV: BE - Theoretical Physics Impact factor: 1.986, year: 2010

  5. Relationship between the Religious Attitude, Self-Efficacy, and Life Satisfaction in High School Teachers of Mahshahr City

    Science.gov (United States)

    Bigdeloo, Masoomeh; Bozorgi, Zahra Dasht

    2016-01-01

    This study aims to investigate the relationship between the religious attitude, self-efficacy, and life satisfaction in high school teachers of Mahshahr City. To this end, 253 people of all high school teachers in Mahshahr City, in Iran were selected as the sample using the multistage cluster sampling method. For data collection, Glock and Stark's…

  6. Ponded infiltration in a grid of permanent single-ring infiltrometers: Spatial versus temporal variability

    Czech Academy of Sciences Publication Activity Database

    Votrubová, J.; Dohnal, M.; Vogel, T.; Tesař, Miroslav; Jelínková, V.; Cislerova, M.

    2017-01-01

    Roč. 65, č. 3 (2017), s. 244-253 ISSN 0042-790X R&D Projects: GA ČR GA16-05665S Institutional support: RVO:67985874 Keywords : soil infiltrability * infiltration instability * infiltration modes * burrowing animals * preferential flow Subject RIV: DA - Hydrology ; Limnology OBOR OECD: Hydrology Impact factor: 1.654, year: 2016

  7. Surface pollen-vegetation relationships in the forest-steppe, taiga and tundra landscapes of the Russian Altai Mountains

    Czech Academy of Sciences Publication Activity Database

    Pelánková, Barbora; Chytrý, M.

    2009-01-01

    Roč. 157, 3-4 (2009), s. 253-265 ISSN 0034-6667 Institutional research plan: CEZ:AV0Z60050516 Keywords : modern pollen spectra * pollen deposition * southern Siberia Subject RIV: EF - Botanics Impact factor: 2.145, year: 2009

  8. Sadhana | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Effects of the different atmospheric steam curing processes on the properties of self-compacting-concrete containing microsilica · Abdulkadir Cüneyt Aydin Ali Öz Riza Polat ... Volume 41 Issue 2 February 2016 pp 253-264. The effect of blast furnace slag on the self-compactability of pumice aggregate lightweight concrete.

  9. 75 FR 55455 - Airworthiness Directives; The Boeing Company Model 737-700 (IGW) Series Airplanes Equipped With...

    Science.gov (United States)

    2010-09-13

    ... modification of PATS Aircraft, LLC, auxiliary fuel tanks. This AD results from fuel system reviews conducted by... Aircraft Systems, 21652 Nanticoke Avenue, Georgetown, Delaware 19947; telephone 302-253-6157; fax 302-855... proposed to require deactivation or modification of PATS Aircraft, LLC, auxiliary fuel tanks. Comments We...

  10. Impact of Robotic Dispensing Machines in German Pharmacies on ...

    African Journals Online (AJOL)

    To assess the impact of robotic dispensing machines in community pharmacies on staff efficiency and sales of over-the-counter drugs. Setting: The study was done on 253 community pharmacies in Germany that use a robotic dispensing machine manufactured by ROWA during 2008. Method: Data concerning the financial ...

  11. The Vulnerability of the United States Railroad System to Terrorist Attacks

    Science.gov (United States)

    2015-06-12

    can also assist during special political and sporting events, and provide humanitarian assistance after major weather events...essential to economic growth―not just for travel and tourism , but also for the mobility of the labor force.253 Many of Russia’s natural resources

  12. CASTLE BRAVO: Fifty Years of Legend and Lore. A Guide to Off-Site Radiation Exposures

    Science.gov (United States)

    2013-01-31

    depressions , may grow rapidly from small beginnings—from small perturbations in a broad, unstable air stream—has led to the suggestion that the...Hygiene and Toxicology 25(7)253–274. ——. 1974. Paper presented in Radiology Centennial . Radiology Centennial , Inc., Reston, VA. Fehner, T. R., and F. G

  13. Avian basal metabolic rates : their association with body composition and energy expenditure in nature

    NARCIS (Netherlands)

    Daan, Serge; Masman, Dirkjan; Groenewold, Alex

    Measurements of basal metabolic rate (BMR), body water, fat, and lean dry mass of different organs were obtained in 22 bird species, ranging from 10.8 to 1,253 g body mass. Residuals of BMR (after subtracting BMR allometrically predicted from body mass) were positively correlated with residuals of

  14. Guidelines for Developing Habitat-Based Threatened and Endangered Species Population Goals on Army Installations

    Science.gov (United States)

    2005-10-01

    Many plants have both sexual and vegetative reproduction, and this may be best handled with separate classes that reflect meaningful differ- ences in... Transmutation and functional representation of heterogeneous landscapes.” Landscape Ecology 5: 239-253. LaGro, J.Jr. 1991. “Assessing patch

  15. Associative Ionization of Excited Sodium Species with Various Ligands: Assessing Relative Bonding Strengths of Ion-ligand Interactions

    Czech Academy of Sciences Publication Activity Database

    Gilligan, J. J.; McCunn, L. R.; Leskiw, B. D.; Herman, Zdeněk; Castleman Jr., A. W.

    2001-01-01

    Roč. 204, 1/3 (2001), s. 247-253 ISSN 1387-3806 Institutional research plan: CEZ:AV0Z4040901 Keywords : associative ionization * cluster ions * sodium bonding energies Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.176, year: 2001

  16. effects of some physico-chemical parameters on prevalence of ...

    African Journals Online (AJOL)

    Usman et al.

    /10.1016/S0140-6736(12)61728-0. Ndifon, G. T. and Ukoli F. M. (1989). Ecology of Fresh Water. Snails in South – Western Nigeria. Distribution and. Habitat Preferences. Hydrobiologia 171:231-253. Njoku-Tony, R.F. (2007) Ecological Studies ...

  17. Knowledge, attitude and practice about sexually transmitted ...

    African Journals Online (AJOL)

    More female (33.5%) students had heard about Trichomonas vaginalis than males (23%); (C 2 = 17.1; < 0.0001). This study has shown that more female than male students got information from their parents (C 2 = 25.3; p < 0.001) while more male students had their source of information from previous sexual intercourse (C ...

  18. Bank Risk-Taking Abroad : Does Home-Country Regulation and Supervision Matter

    NARCIS (Netherlands)

    Ongena, S.; Popov, A.; Udell, G.F.

    2011-01-01

    This paper provides the first empirical evidence on how home-country regulation and supervision affects bank risk-tailing in host-country markets. We analyze lending by 136 banks to 8,253 firms in 1,513 different localities across 13 countries. We find strong evidence that laxer regulatory

  19. Bank Risk-Taking Abroad : Does Home-Country Regulation and Supervision Matter

    NARCIS (Netherlands)

    Ongena, S.; Popov, A.; Udell, G.F.

    2011-01-01

    This paper provides the first empirical evidence on how home-country regulation and supervision affects bank risk-tailing in hostr-country markets. We analyze lending by 136 banks to 8,253 firms in 1,513 different localities across 13 countries. We find strong evidence that laxer regulatory

  20. Predikční systém ELVÍRA pro predikci spotřeby zemního plynu

    Czech Academy of Sciences Publication Activity Database

    Pelikán, Emil; Eben, Kryštof; Šimůnek, Milan; Kolman, M.; Hais, J.

    2000-01-01

    Roč. 80, č. 11 (2000), s. 253-255 ISSN 0032-1761 Institutional research plan: AV0Z1030915 Keywords : predikční modely * systémy pro podporu rozhodování * regresní metody * umělé neuronové sítě Subject RIV: BB - Applied Statistics, Operational Research

  1. "Českoslovenství" na konci světa: krajané na Tasmánii.

    Czech Academy of Sciences Publication Activity Database

    Brouček, Stanislav

    2013-01-01

    Roč. 23, č. 4 (2013), s. 241-253 ISSN 0862-8351 R&D Projects: GA MZV(CZ) RM01/15/04 Institutional support: RVO:68378076 Keywords : emigration * migration policy * Czech-Slovakian relations * Czechs and Slovaks in Tasmania Subject RIV: AC - Archeology, Anthropology, Ethnology

  2. Vampirical Stick Pins, Deleuzian Folds, Noir Pastiches and other Wearability Conundrums: Fashion in Film

    DEFF Research Database (Denmark)

    Langkjær, Michael Alexander

    2012-01-01

    Anmeldelsesartikel (review article) overfjorten bidrag i antologien Fashion in Film, som belyser forskellige sider af forholdet mellem mode og film.Fashion in Film er redigeret af Adrienne Munich (Bloomington: Indiana University Press, 2011, 360 sider, ISBN 978-0-253-22299-2)....

  3. Behavioral and Biological Effects of Housing Conditions and Stress in Male Rats - Relevance to Heart Disease

    Science.gov (United States)

    2006-08-01

    Baum, Gatchel, & Krantz, 1997; Park, Cambell , & Diamond, 2001; Bauer, Perks, Lightman, & Shanks, 2001). These categories of findings are consistent...Henriksson, & Mohammad, 1997; Baum, Gatchel, & Krantz, 1997; Park, Cambell , & Diamond, 2001; Bauer, Perks, Lightman, & Shanks, 2001; Bielajew...Biobehavioral Review, 25(3), 219-33. Park, C. R., Cambell , A. M., & Diamond, D. M. (2001). Chronic psychosocial stress impairs learning and memory and

  4. Reactions of the selected ion flow tube mass spectrometry reagent ions H3O+ and NO+ with a series of volatile aldehydes of biogenic significance

    Czech Academy of Sciences Publication Activity Database

    Smith, D.; Chippendale, T. W. E.; Španěl, Patrik

    2014-01-01

    Roč. 28, č. 17 (2014), s. 1917-1928 ISSN 0951-4198 R&D Projects: GA ČR GA13-28882S Institutional support: RVO:61388955 Keywords : SOLID-PHASE MICROEXTRACTION * TRACE GAS- ANALYSIS * ON-FIBER-DERIVATIZATION Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.253, year: 2014

  5. Light Noble Gases and a Cosmic Ray Exposure Age for the Bunburra Rockhole Meteorite

    Czech Academy of Sciences Publication Activity Database

    Meier, M.M.M.; Bland, P.A.; Welten, K.C.; Spurný, Pavel; Baur, H.; Wieler, R.

    2009-01-01

    Roč. 44, Supplement (2009), A138-A138 ISSN 1086-9379. [Annual Meeting of the Meteoritical Society /72./. Nancy, 13.06.2009-18.06.2009] Institutional research plan: CEZ:AV0Z10030501 Keywords : Bunburra Rockhole * light noble gas * concentration Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 3.253, year: 2009

  6. The Association of Latino Children's Kindergarten School Readiness Profiles with Grade 2-5 Literacy Achievement Trajectories

    Science.gov (United States)

    Quirk, Matthew; Grimm, Ryan; Furlong, Michael J.; Nylund-Gibson, Karen; Swami, Sruthi

    2016-01-01

    This study utilized latent class analysis (LCA) to identify 5 discernible profiles of Latino children's (N = 1,253) social-emotional, physical, and cognitive school readiness at the time of kindergarten entry. In addition, a growth mixture modeling (GMM) approach was used to identify 3 unique literacy achievement trajectories, across Grades 2-5,…

  7. Synthesis and Catalytic Activity of [Cp′Co(COD)] Complexes Bearing Pendant N-Containing Groups

    Czech Academy of Sciences Publication Activity Database

    Thiel, I.; Lamač, Martin; Jiao, H.; Spannenberg, A.; Hapke, M.

    2013-01-01

    Roč. 32, č. 11 (2013), s. 3415-3418 ISSN 0276-7333 R&D Projects: GA ČR GPP207/10/P200 Institutional support: RVO:61388955 Keywords : FUNCTIONALIZED CYCLOPENTADIENYL LIGANDS * SANDWICH COBALT COMPLEXES * METALLOCENE COMPLEXES Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 4.253, year: 2013

  8. Reply to the comment by U. Leonhardt on “Aharonov-Bohm scattering of neutral atoms with induced electric dipole moments”

    Science.gov (United States)

    Audretsch, Jürgen; Skarzhinsky, Vladimir D.

    1999-03-01

    We reply to the comment of Leonhardt [Phys. Lett. A 253 (1999) 370] on our paper [Phys. Lett. A 241 (1998) 7]. The partial-wave approach can be adjusted to the Aharanov-Bohm scattering. For the scattering of neutral atoms, it enables the treatment of total absorption in a consistent way.

  9. Vztah theologie a filosofie u Órigena a úkoly současné dogmatiky

    Czech Academy of Sciences Publication Activity Database

    Milko, Pavel

    2007-01-01

    Roč. 2, č. 2 (2007), s. 3-29 ISSN 1337-0111 R&D Projects: GA ČR GP401/07/P534 Institutional research plan: CEZ:AV0Z90920516 Keywords : Órigenés, ca 185-ca 253 * doctrinal the ology * philosophy Subject RIV: AA - Philosophy ; Religion

  10. Cross-Cultural Comparison of Anxiety Symptoms in Colombian and Australian Children

    Science.gov (United States)

    Amaya, Andrea Crane; Campbell, Marilyn

    2010-01-01

    Introduction: This cross-cultural study compared both the symptoms of anxiety and their severity in a community sample of children from Colombia and Australia. Method: The sample comprised 516 children (253 Australian children and 263 Colombian children), aged 8 to 12-years-old. The Spence Children's Anxiety Scale (SCAS) was used to measure both…

  11. "I work all the time- he just waits for the animals to come back": social impacts of climate changes: a Greenlandic case study

    NARCIS (Netherlands)

    van Voorst, R.

    2009-01-01

    Understanding human adaptation to climate changes is one of the most important research issues within the area of global environmental change, accounting for the fact that people worldwide are currently adapting to their changing environment (Adger and Kelly 2000: 253; Smit et al. 2008). The

  12. comparative effects of theobromine and cocoa bean shell

    African Journals Online (AJOL)

    Mr. Oluyemi

    GLOBAL JOURNAL OF PURE AND APPLIED SCIENCES VOL 14, NO. 3, 2008: 253 - 255 ... (Received 12, July 2007; Revision Accepted 26, March 2008) .... in membrane achitecture of the cells leasing to spillage into serum (Bell et al ... analysis of vegetable drugs. Farmaa's ... Plasma lipid profile and target organ effect of.

  13. Adult-onset epilepsy in focal cortical dysplasia of Taylor type

    NARCIS (Netherlands)

    Siegel, A. M.; Cascino, G. D.; Elger, C. E.; Devinsky, O.; Laff, R.; Najjar, S.; Sperling, M. R.; LoRusso, G.; Cossu, M.; Urbach, H.; Aronica, E.; Meyer, F. B.; Scheithauer, B. W.; Dubeau, F.; Andermann, F.

    2005-01-01

    Focal cortical dysplasia of Taylor type (FCDT) usually presents with seizures at an early age, whereas adult onset of epilepsy is uncommon. We reviewed the medical records of 213 patients with FCDT. In 21 patients (10%), age at seizure onset ranged from 18 to 55 years (mean 25.3). The outcome of

  14. Mukhopadhyay, Prof. Dhrubajyoti

    Indian Academy of Sciences (India)

    Home; Fellowship. Fellow Profile. Elected: 1988 Section: Earth & Planetary Sciences. Mukhopadhyay, Prof. Dhrubajyoti Ph.D. (London), FNA, FNASc. Date of birth: 19 September 1938. Specialization: Structural Geology, Precambrian Geology Address: G-7, MIG Housing Colony, 25/3, Raja Manindra Road, Kolkata 700 037, ...

  15. Physiological, biochemical and psychological markers of strenuous training-induced fatigue.

    NARCIS (Netherlands)

    Rietjens, G.J.; Kuipers, H.; Adam, J.; Saris, W.H.M.; Breda, E. van; Hamont, D. van; Keizer, H.A.

    2005-01-01

    The purpose of the study was to investigate whether severe fatigue, possibly leading to overreaching, could be diagnosed at an early stage by a combination of parameters. Seven well-trained male subjects (age [mean +/- SD]: 25.3 +/- 4.7 yr; body mass: 76 +/- 6.6 kg; VO2max: 61.1 +/- 7

  16. Flow Cytometry for Age Assessment of a Yeast Population and its Application in Beer Fermentations

    Czech Academy of Sciences Publication Activity Database

    Kuřec, M.; Baszczyňski, Martin; Lehnert, R.; Mota, A.; Teixeira, J.A.; Brányik, T.

    2009-01-01

    Roč. 115, č. 3 (2009), s. 253-258 ISSN 0046-9750 R&D Projects: GA ČR GA104/06/1418 Institutional research plan: CEZ:AV0Z40720504 Keywords : aging * beer * bud scar Subject RIV: CI - Industrial Chemistry, Chemical Engineering Impact factor: 1.000, year: 2009

  17. Experimental evaluation of mechanical and electrical properties of RBC suspensions under flow. Role of RBC aggregating agent

    Czech Academy of Sciences Publication Activity Database

    Antonova, N.; Říha, Pavel; Ivanov, I.

    2010-01-01

    Roč. 45, 2-4 (2010), s. 253-261 ISSN 1386-0291 R&D Projects: GA AV ČR IAA200600803 Institutional research plan: CEZ:AV0Z20600510 Keywords : apparent viscosity * conductivity * unsteady flow * RBC suspensions * dextrans * PEG Subject RIV: BK - Fluid Dynamics Impact factor: 2.838, year: 2010

  18. Vapor Pressure of Selected Aliphatic Alcohols by Ebulliometry. Part 1

    Czech Academy of Sciences Publication Activity Database

    Čenský, M.; Roháč, V.; Růžička, K.; Fulem, M.; Aim, Karel

    2010-01-01

    Roč. 298, č. 2 (2010), s. 192-198 ISSN 0378-3812 R&D Projects: GA AV ČR IAA400720710 Institutional research plan: CEZ:AV0Z40720504 Keywords : vapor pressure * ebulliometry * aliphatic alcohols Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.253, year: 2010

  19. CAMKII inhibition in the parabrachial nuclei elicits conditioned taste aversion in rats

    Czech Academy of Sciences Publication Activity Database

    Sacchetti, B.; Baldi, E.; Tassoni, G.; Bielavská, Edita

    2001-01-01

    Roč. 75, č. 3 (2001), s. 253-261 ISSN 1074-7427 R&D Projects: GA AV ČR IAA7011706 Institutional research plan: CEZ:AV0Z5011922 Keywords : CA2+/calmodulin-dependent protein kinase * conditioned taste aversion Subject RIV: FH - Neurology Impact factor: 1.830, year: 2001

  20. Data ingestion and assimilation in ionospheric models

    Czech Academy of Sciences Publication Activity Database

    Burešová, Dalia; Nava, B.; Galkin, I.; Angling, M.; Stankov, S. M.; Coisson, P.

    2009-01-01

    Roč. 52, 3/4 (2009), s. 235-253 ISSN 1593-5213 R&D Projects: GA ČR GA205/08/1356; GA MŠk OC 091 Institutional research plan: CEZ:AV0Z30420517 Keywords : ionosphere * models * data assimilation * data ingestion Subject RIV: DG - Athmosphere Sciences, Meteorology Impact factor: 0.548, year: 2009

  1. A Fascination with Folk Art. Modernism and the Avant-Garde in Munich, Prague and Moscow around 1913

    Czech Academy of Sciences Publication Activity Database

    Winter, Tomáš

    2016-01-01

    Roč. 64, 3/4 (2016), s. 240-253 ISSN 0049-5123 R&D Projects: GA ČR GA15-07456S Institutional support: RVO:68378033 Keywords : primitivism * cosmopolitanism * 20th-century art Subject RIV: AL - Art, Architecture, Cultural Heritage

  2. Investigation of medical board reports of disability due to mental health problems

    Directory of Open Access Journals (Sweden)

    Mesut Yildiz

    2016-06-01

    Conclusion: We think that this report might be helpful for regulations related to disabled people, and might guide adult psychiatric services for patients who present to medical boards for disability due to mental health problems. [Cukurova Med J 2016; 41(2.000: 253-258

  3. 1531-IJBCS-Article-Petemagnan Jean Marie

    African Journals Online (AJOL)

    hp

    state anaerobic digestion of Korean food wastes. Bioressource Technology, 22: 245-253. Chynoweth DP, Owens JM, Legrand R. 2001. Renewable methane from anaerobic digestion of biomass. Renewable Energy,. 22: 1-8. Duncker LC, Matsebe GN, Moilwa N. 2007. The social/cultural acceptability of using human excreta ...

  4. 2017-2018 Travel Expense Reports for John McArthur, Governor

    International Development Research Centre (IDRC) Digital Library (Canada)

    Chantal Taylor

    Purpose: Board Meetings. Date(s):. 2017-10-05. Destination(s):. Ottawa. Airfare: $0.00. Other. Transportation: $203.40. Accommodation: $0.00. Meals and. Incidentals: $50.55. Other: $0.00. Total: $253.95. Comments: Travel expenses claimed in October 2017 for June 2016 Board meeting. 2017-2018 Travel Expense ...

  5. Riddhi Shah

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education. Riddhi Shah. Articles written in Resonance – Journal of Science Education. Volume 23 Issue 3 March 2018 pp 253-262 General Article. Maryam Mirzakhani: The Master Artist of Curved Surfaces · Nikita Agarwal Riddhi Shah Geetha Venkataraman · More Details ...

  6. Transactors, Transformers and Beyond. A Multi-Method Development of a Theoretical Typology of Leadership.

    Science.gov (United States)

    Pearce, Craig L.; Sims, Henry P., Jr.; Cox, Jonathan F.; Ball, Gail; Schnell, Eugene; Smith, Ken A.; Trevino, Linda

    2003-01-01

    To extend the transactional-transformational model of leadership, four theoretical behavioral types of leadership were developed based on literature review and data from studies of executive behavior (n=253) and subordinate attitudes (n=208). Confirmatory factor analysis of a third data set (n=702) support the existence of four leadership types:…

  7. Can we predict agitation in patients with suicide attempts in the ...

    African Journals Online (AJOL)

    liberate self-poisoning or self-harm, with a rate of 38%4. Furthermore ... agitated in EDs, as this will affect resistance to treatment, as well as .... Benzodiazepine in urine. 11 (25.3%) .... Agitation is a severe form of anxiety associated with mo-.

  8. Prevention of bone bridge formation using transplantation of the autogenous mesenchymal stem cells to physeal defects: An experimental study in rabbits

    Czech Academy of Sciences Publication Activity Database

    Plánka, L.; Nečas, A.; Gál, P.; Kecová, H.; Filová, Eva; Křen, L.; Kroupa, P.

    2007-01-01

    Roč. 76, - (2007), s. 253-263 ISSN 0001-7213 R&D Projects: GA MŠk 2B06130 Institutional research plan: CEZ:AV0Z50390512 Keywords : Growth plate injury * Physis * Growth arrest Subject RIV: FI - Traumatology, Orthopedics Impact factor: 0.687, year: 2007

  9. Histopathology of carp (Cyprinus carpio L.) larvae exposed to Cyanobacteria extract

    Czech Academy of Sciences Publication Activity Database

    Palíková, M.; Navrátil, S.; Tichý, F.; Štěrba, F.; Maršálek, Blahoslav; Bláha, L.

    2004-01-01

    Roč. 73, - (2004), s. 253-257 ISSN 0001-7213 R&D Projects: GA AV ČR KSK6005114; GA ČR GP524/01/P027 Institutional research plan: CEZ:AV0Z6005908 Keywords : microcystins * embryo-larval test * liver damage Subject RIV: EF - Botanics Impact factor: 0.449, year: 2004

  10. Corporate volunteerism and corporate social responsibility: a chance to counter the stigma of persons affected by a serious mental illness and to promote their labour integration

    Directory of Open Access Journals (Sweden)

    Carlos De Fuentes Garcia

    2014-12-01

    Full Text Available De Fuentes, C. et al. (2014: “El voluntariado corporativo y la responsabilidad social empresarial: una oportunidad en la lucha contra el estigma y el impulso de la inserción laboral de las personas con trastorno mental grave”, Revista Española de Discapacidad, 2 (2: 247-253.

  11. 78 FR 31590 - Sears Holdings Management Corporation, A Division Of Sears Holdings Corporation, Hoffman Estates...

    Science.gov (United States)

    2013-05-24

    ... (``My position at Sears had nothing to do with Analytics or space Management. I worked in Marketing... firm clarified that one petitioner supplied print marketing management services, another petitioner... DEPARTMENT OF LABOR Employment and Training Administration [TA-W-81,253] Sears Holdings Management...

  12. Effect of stress on structural brain asymmetry

    Czech Academy of Sciences Publication Activity Database

    Zach, P.; Valeš, Karel; Stuchlík, Aleš; Čermáková, P.; Mrzílková, J.; Koutella, A.; Kutová, M.

    2016-01-01

    Roč. 37, č. 4 (2016), s. 253-264 ISSN 0172-780X R&D Projects: GA ČR(CZ) GBP304/12/G069 Institutional support: RVO:67985823 Keywords : laterality * asymmetry * brain * evolution * stress * neuropsychiatric disorders Subject RIV: FH - Neurology Impact factor: 0.918, year: 2016

  13. Měření indexu lomu vzduchu pomocí interferometrie nízké koherence

    Czech Academy of Sciences Publication Activity Database

    Pikálek, Tomáš; Buchta, Zdeněk

    2017-01-01

    Roč. 62, č. 10 (2017), s. 253-256 ISSN 0447-6441 R&D Projects: GA MŠk(CZ) LO1212 Institutional support: RVO:68081731 Keywords : air refractive index * laser interferometry * low-coherence interferometry Subject RIV: BH - Optics, Masers, Lasers OBOR OECD: Optics (including laser optics and quantum optics)

  14. Improved preservation effects of litchi fruit by combining chitosan ...

    African Journals Online (AJOL)

    USER

    2010-05-31

    May 31, 2010 ... and attractive red color of anthocyanins at full maturity. (Holcroft and Mitcham, 1996). Tragically .... An Amplex Red Hydrogen Peroxide Assay kit (Molecular. Probes, Invitrogen Detection Technologies, ..... control of rotting and browning of litchi fruit by hot benomyl and plastic film. Sci. Hortic. 16: 253-262.

  15. Architecture of European Plastic Surgery

    NARCIS (Netherlands)

    Nicolai, J. -P. A.; Banic, A.; Molea, G.; Mazzola, R.; Poell, J. G.

    2006-01-01

    The architecture of European Plastic Surgery was published in 1996 [Nicolai JPA, Scuderi N. Plastic surgical Europe in an organogram. Eur J Plast Surg 1996; 19: 253-6.] It is the objective of this paper to update information of that article. Continuing medical education (CME), science, training,

  16. Computer Programs in Marine Science

    Science.gov (United States)

    1976-04-01

    Technology Room 5-207 Cambridge, HA 02139 Telephone (617) 253-5941 Currcnt Profiles from Tilt Data Language - Hardware - ,.alculate3 current profiles gene ...HORIZCNTAL FANC -E 120 FORTRAN CCC 3800 LINE FRINTER PLOTS 16 FORTRAN CDC 1800 INTERNAL GkAVITY UAVLS CISPER 186 107 FIRTRAN CDC 3800 ANNOTATED TRACK ON

  17. Toward Active Control of Noise from Hot Supersonic Jets

    Science.gov (United States)

    2012-11-15

    et al. (2011a), the Mach number chosen for this study is not typical of commercial or military aircraft engines, and bears little relevance to most...CHRISTOPHER K. W., VISWANATHAN, K., AHUJA, K. K. & PANDA , J. 2008 The sources of jet noise: experimental evidence. J. Fluid Mech. 615, 253-292. TANNA, H. K

  18. Synthesis of C3-symmetric tri(alkylamino) guests and their interaction with cyclodextrins

    Czech Academy of Sciences Publication Activity Database

    Bednaříková, T.; Tošner, Z.; Horský, Jiří; Jindřich, J.

    2015-01-01

    Roč. 81, 1-2 (2015), s. 141-152 ISSN 0923-0750 Institutional support: RVO:61389013 Keywords : cyclodextrin * supramolecular interactions * C3-symmetric guests Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 1.253, year: 2015

  19. Geomorphological inventory of rock landforms on Mt. Kamenec in the Novohradské hory Mts. (the Czech Republic)

    Czech Academy of Sciences Publication Activity Database

    Rypl, J.; Kirchner, Karel; Dvořáčková, S.

    2014-01-01

    Roč. 9, č. 3 (2014), s. 253-260 ISSN 1842-4090 Institutional support: RVO:68145535 Keywords : Novohradské hory Mts. * large protection * Mt. Kamenec * GPS mapping * geomorphological inventory Subject RIV: DE - Earth Magnetism, Geodesy, Geography Impact factor: 0.630, year: 2014 http://www.ubm.ro/sites/CJEES/viewTopic.php?topicId=464

  20. 49 CFR Appendix A to Part 593 - List of Vehicles Determined To Be Eligible for Importation

    Science.gov (United States)

    2010-10-01

    ... 900 1999 444 Carrocerias Cimarron trailer 2006-2007 37 Chevrolet 400SS 1995 150 Chevrolet Astro Van... Freightliner FTLD112064SD 1991-1996 178 GMC Suburban 1992-1994 134 Harley Davidson (MC) FX, FL, XL Series 1998 253 Harley Davidson (MC) FX, FL, XL Series 1999 281 Harley Davidson (MC) FX, FL, XL Series 2000 321...