Chemistry of berkelium: a review
International Nuclear Information System (INIS)
Hobart, D.E.; Peterson, J.R.
1985-01-01
Element 97 was first produced in December 1949, by the bombardment of americium-241 with accelerated alpha particles. This new element was named berkelium (Bk) after Berkeley, California, the city of its discovery [Thompson, Ghiorso, and Seaborg, Phys. Rev. 77, 838 (1950); 80, 781 (1950)]. In the 36 years since the discovery of Bk, a substantial amount of knowledge concerning the physicochemical properties of this relatively scarce transplutonium element has been acquired. All of the Bk isotopes of mass numbers 240 and 242 through 251 are presently known, but only berkelium-249 (β - decay, 0.125 MeV, t/sub 1/2/ = 325 days) is available in sufficient quantities for bulk chemical studies. About 0.7 gram of this isotope has been isolated at the HFIR/TRU Complex in Oak Ridge, Tennessee in the last 18 years. Over the same time period, the scale of experimental work using berkelium-249 has increased from the tracer level to bulk studies at the microgram level to solution and solid state investigations with milligram quantities. Extended knowledge of the physicochemical behavior of berkelium is important in its own right, because Bk is the first member of the second half of the actinide series. In addition, such information should enable more accurate extrapolations to the predicted behavior of heavier elements for which experimental studies are severely limited by lack of material and/or by intense radioactivity
Berkelium (4) and cerium (4) extraction with tertiary amines
International Nuclear Information System (INIS)
Milyukova, M.S.; Malikov, D.A.; Myasoedov, B.V.
1978-01-01
Oxidation of indicator quantities of berkelium and cerium by a mixture of silver nitrate and ammonium persulfate in the solutions of nitric and sulfuric acid has been examined. The stability of the elements in a tetravalent state and their extraction by the solutions of ternary amines have been investigated. It has been established that berkelium and cerium oxidation under these conditions occurs under the effect of ions of divalent silver which is formed owing to oxidation of monovalent silver by peroxide sulfate ions. The following supposition has been put forward: a difference in the behaviour of tetravalent berkelium and cerium during their extraction by ternary amines is explained by their different stability in this state, but not by the formation of complex compounds with nitrate ions
Citric complexes of trivalent cerium and berkelium
International Nuclear Information System (INIS)
Boulhassa, S.
1977-01-01
The extraction by thenoyltrifluoroacetone (TTA) in benzene of trivalent cerium, berkelium and californium, at the indicator scale, hydrolysis and complexation by citric acid of these cations are studied. The radionuclides used were 144 Ce, 249 Bk and 249 Cf respectively γ, β and α emitters. The solvent extraction technique of the elements by TTA in benzene from a perchloric medium at the ionic stength 0.1 was employed. The distribution coefficients D were measured by the γ, β or α radiometry. Cerium and berkelium, which have a comparable redox behavior, show in solution a relatively stable valency IV. Therefore the study by solvent extraction of their trivalent form required the standing up of complete reducing conditions of these elements and their stabilization in solution at the valency III. The thermodynamic data obtained for berkelium and californium contribute to understand the chemistry of these elements and permit to complete the third 'tetrad branch' of 5f elements from Cm 3+ to Es 3+ . This tetrad effect is a manifestation of thermodynamic consequence of the 'nephelauxetic effect'. As for Ce(III), the data confirm the pronounced acid property and may be show no neglected ligand effect for f 1 configuration [fr
Chelation and stabilization of berkelium in oxidation state +IV
Deblonde, Gauthier J.-P.; Sturzbecher-Hoehne, Manuel; Rupert, Peter B.; An, Dahlia D.; Illy, Marie-Claire; Ralston, Corie Y.; Brabec, Jiri; de Jong, Wibe A.; Strong, Roland K.; Abergel, Rebecca J.
2017-09-01
Berkelium (Bk) has been predicted to be the only transplutonium element able to exhibit both +III and +IV oxidation states in solution, but evidence of a stable oxidized Bk chelate has so far remained elusive. Here we describe the stabilization of the heaviest 4+ ion of the periodic table, under mild aqueous conditions, using a siderophore derivative. The resulting Bk(IV) complex exhibits luminescence via sensitization through an intramolecular antenna effect. This neutral Bk(IV) coordination compound is not sequestered by the protein siderocalin—a mammalian metal transporter—in contrast to the negatively charged species obtained with neighbouring trivalent actinides americium, curium and californium (Cf). The corresponding Cf(III)-ligand-protein ternary adduct was characterized by X-ray diffraction analysis. Combined with theoretical predictions, these data add significant insight to the field of transplutonium chemistry, and may lead to innovative Bk separation and purification processes.
International Nuclear Information System (INIS)
Payne, G.F.; Peterson, J.R.
1987-01-01
It appears that we may have prepared Bk(IV) nitrate.nTPAs0 and Bk(IV) perchlorate.nTPAs0 complexes which formed the corresponding Cf(IV) complexes through the beta decay of Bk-249. Definitive proof should come from similar experiments with quantities of Bk-249 large enough to allow spectrophotometric detection of the characteristic f→f transitions in these berkelium and californium species. It is clear, however, that TPAs0 and acetonitrile can play a pivotal role in the stabilization of lanact(IV) species
Isomeric states in 253No and 253Fm
International Nuclear Information System (INIS)
Antalic, S.; Kalaninova, Z.; Saro, S.; Venhart, M.; Hessberger, F.P.; Ackermann, D.; Heinz, S.; Kindler, B.; Khuyagbaatar, J.; Kojouharov, I.; Kuusiniemi, P.; Lommel, B.; Mann, R.; Sulignano, B.; Hofmann, S.; Leino, M.; Nishio, K.; Streicher, B.
2011-01-01
Nuclear structure and decay of isomeric states in 253 No were investigated. The isotope was produced by the reaction 48 Ca + 207 Pb. The excitation energy of the known single-particle isomeric state (5/2 + [622]) was measured by delayed coincidences between γ-rays and implanted evaporation residues and was placed into the level scheme. In addition, decay of a high-lying multi-quasiparticle isomer in 253 No was studied using e - -γ coincidence measurements. A rotational band populated by its de-excitation was identified in 253 No. A new isomeric state in 253 Fm was observed and a partial-level scheme for this isotope is suggested. In addition γ transitions from excited levels are reported for 253 Md. (orig.)
International Nuclear Information System (INIS)
Kadkhodayan, B.; Czerwinski, K.R.; Kreek, S.A.; Hannink, N.J.; Gregorich, K.E.; Lee, D.M.; Nurmia, M.J.; Hoffman, D.C.; Hall, H.L.
1992-01-01
We have measured the half-life and production cross section of the new isotope 253 Md, produced via the 243 Am( 13 C,3n) reaction. Isolation of Md from other activities was accomplished using elution with ammonium α-hydroxyisobutyrate from a cation exchange resin column. Experiments were performed with different irradiation time intervals, but the chemical separation always began and ended at exactly the same length of time after the end of irradiation. All separations with the same irradation lengths were combined and analyzed for growth and decay of the 3.0-d 253 Fm daughter and 20.47-d 253 Es, granddaugther of 253 Md. The amount of 253 Es in each fraction depends on the length of each irradiation and the 253 Md half-life. An increase in the length of irradiation will cause a corresponding increase in the amount of the new isotope 253 Md and hence, in the amount of 253 Es produced, provided the length of irradiations are not very long compared to the half-life of 253 Md. In this way, the Md half-life was estimated to be about 6 minutes with a production cross section of the order of 50 nb. (orig.)
2010-01-01
... 7 Agriculture 4 2010-01-01 2010-01-01 false Administration. 253.4 Section 253.4 Agriculture... GENERAL REGULATIONS AND POLICIES-FOOD DISTRIBUTION ADMINISTRATION OF THE FOOD DISTRIBUTION PROGRAM FOR HOUSEHOLDS ON INDIAN RESERVATIONS § 253.4 Administration. (a) Federal administration. Within the Department...
2010-01-01
... 6 Domestic Security 1 2010-01-01 2010-01-01 false Delegation. 25.3 Section 25.3 Domestic Security DEPARTMENT OF HOMELAND SECURITY, OFFICE OF THE SECRETARY REGULATIONS TO SUPPORT ANTI-TERRORISM BY FOSTERING EFFECTIVE TECHNOLOGIES § 25.3 Delegation. All of the Secretary's responsibilities, powers, and functions...
48 CFR 253.209 - Contractor qualifications.
2010-10-01
... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Contractor qualifications. 253.209 Section 253.209 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE CLAUSES AND FORMS FORMS Prescription of Forms 253.209 Contractor qualifications. ...
28 CFR 25.3 - System information.
2010-07-01
... 28 Judicial Administration 1 2010-07-01 2010-07-01 false System information. 25.3 Section 25.3 Judicial Administration DEPARTMENT OF JUSTICE DEPARTMENT OF JUSTICE INFORMATION SYSTEMS The National Instant Criminal Background Check System § 25.3 System information. (a) There is established at the FBI a...
Alpha-gamma decay studies of 253No and its daughter products 253Md, 249Fm
International Nuclear Information System (INIS)
Hessberger, F.P.; Antalic, S.; Kalaninova, Z.; Saro, S.; Venhart, M.; Ackermann, D.; Heinz, S.; Kindler, B.; Kojouharov, I.; Kuusiniemi, P.; Lommel, B.; Mann, R.; Sulignano, B.; Hofmann, S.; Streicher, B.; Leino, M.; Nishio, K.
2012-01-01
Nuclear structure and decay of the isotope 253 No and its decay products 249 Fm and 253 Md were investigated by means of α - γ spectroscopy. Besides the established strong γ transitions from the 9/2 - [734] Nilsson level in 249 Fm, populated predominantly by the α decay of 253 No, into the ground-state (gs) rotational band, a couple of weaker γ lines (58.3, 129.2, 209.3 and 669.5keV) were observed and placed into the 249 Fm level scheme. The transition from the 7/2 - level in 249 Es, populated by the α decay of 253 Md, into the 9/2 + member of the gs rotational band, so far established for other odd-mass Es isotopes, was observed clearly. GEANT4 simulations were performed to investigate the influence of energy summing between α particles and conversion electrons (CE) on the shape of the α spectra at different implantation energies, leading to evidence for a weak α decay branch of 253 No into the gs of 249 Fm or the ground-state rotational band, respectively. (orig.)
36 CFR 25.3 - Supervision; suspensions.
2010-07-01
... 36 Parks, Forests, and Public Property 1 2010-07-01 2010-07-01 false Supervision; suspensions. 25.3 Section 25.3 Parks, Forests, and Public Property NATIONAL PARK SERVICE, DEPARTMENT OF THE INTERIOR NATIONAL MILITARY PARKS; LICENSED GUIDE SERVICE REGULATIONS § 25.3 Supervision; suspensions. (a) The guide service will operate under the direction...
48 CFR 253.215 - Contracting by negotiation.
2010-10-01
... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Contracting by negotiation. 253.215 Section 253.215 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE CLAUSES AND FORMS FORMS Prescription of Forms 253.215 Contracting by negotiation...
50 CFR 253.18 - Program operating guidelines.
2010-10-01
... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Program operating guidelines. 253.18 Section 253.18 Wildlife and Fisheries NATIONAL MARINE FISHERIES SERVICE, NATIONAL OCEANIC AND ATMOSPHERIC... Guarantee Program § 253.18 Program operating guidelines. The Division may issue Program operating guidelines...
2010-10-01
... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Fees. 253.16 Section 253.16 Wildlife and... Fees. (a) Application fee. The Division will not accept an application without the application fee. Fifty percent of the application fee is fully earned at application acceptance, and is not refundable...
Lifescience Database Archive (English)
Full Text Available VH (Link to library) VHP253 (Link to dictyBase) - - - Contig-U16349-1 - (Link to Or...iginal site) - - VHP253Z 355 - - - - Show VHP253 Library VH (Link to library) Clone ID VHP253 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16349-1 Original site URL http://dictycdb.b...CTTGGGTACCAAGAACTGACCGTCAATTTGCTGGTTCATGGTTTGC sequence update 2002. 9.10 Translated Amino Acid sequence ---MQLFAGIKSICT...VPIMRMYFHTGILDYILFKSWVPRTDRQFAGSWF Translated Amino Acid sequence (All Frames) Frame A: ---MQLFAGIKSICTEMAMD
7 CFR 253.1 - General purpose and scope.
2010-01-01
... 7 Agriculture 4 2010-01-01 2010-01-01 false General purpose and scope. 253.1 Section 253.1... AGRICULTURE GENERAL REGULATIONS AND POLICIES-FOOD DISTRIBUTION ADMINISTRATION OF THE FOOD DISTRIBUTION PROGRAM FOR HOUSEHOLDS ON INDIAN RESERVATIONS § 253.1 General purpose and scope. This part describes the terms...
50 CFR 253.22 - State projects.
2010-10-01
... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false State projects. 253.22 Section 253.22... State projects. (a) General—(1) Designation of state agency. The Governor of each state shall notify the... participation under the Act, to sign project documents, and to receive payments. (2) States that choose to...
4 CFR 25.3 - Admission to the GAO building.
2010-01-01
... 4 Accounts 1 2010-01-01 2010-01-01 false Admission to the GAO building. 25.3 Section 25.3 Accounts GOVERNMENT ACCOUNTABILITY OFFICE GENERAL PROCEDURES CONDUCT IN THE GOVERNMENT ACCOUNTABILITY OFFICE BUILDING AND ON ITS GROUNDS § 25.3 Admission to the GAO building. A person may be admitted to the GAO Building...
14 CFR 23.253 - High speed characteristics.
2010-01-01
... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false High speed characteristics. 23.253 Section... Requirements § 23.253 High speed characteristics. If a maximum operating speed VMO/MMO is established under § 23.1505(c), the following speed increase and recovery characteristics must be met: (a) Operating...
Gamma spectroscopy of the isotope 253No
International Nuclear Information System (INIS)
Kalaninova, Z.
2009-01-01
The first part deals with the evaluation of the relative and absolute efficiency of detectors for the registration of gamma radiation to separator SHIP at GSI Darmstadt (Germany). In the second part we discussed the decay alpha-gamma coincidence spectroscopy of isotope 253 No. In conclusion, the basic characteristics of deexcitation of K-isomeric state in isotope 253 No are evaluated. Only sort abstract is published.
In-beam spectroscopy of 253,254No
International Nuclear Information System (INIS)
Herzberg, R.D.; Amzal, N.; Bastin, J.E.; Brew, P.M.T.; Butler, P.A.; Chewter, A.J.C.; Hammond, N.J.; Humphreys, R.D.; Jones, G.D.; Becker, F.; Hauschild, K.; Houry, M.; Huerstel, A.; Cocks, J.F.C.; Dorvaux, O.; Greenlees, P.T.; Eskola, K.; Gerl, J.; Hessberger, F.; Helariutta, K.; Jones, P.M.; Julin, R.; Juutinen, S.; Kankaanpaeae, H.; Kettunen, H.; Khoo, T.L.; Korten, W.; Kuusiniemi, P.; Le Coz, Y.; Leino, M.; Leppaenen, C.J.; Lister, A.P.; Lucas, R.; Muikku, M.; Nieminen, P.; Page, R.D.; Page, T.; Rahkila, P.; Reiter, P.; Schlegel, Ch.; Scholey, C.; Sletten, G.; Stezowski, O.; Theisen, Ch.; Trzaska, W.H.; Uusitalo, J.; Wollersheim, H.J.
2002-01-01
In-beam conversion electron spectroscopy experiments have been performed on the transfermium nuclei 253, 254 No using the conversion electron spectrometer SACRED in nearly collinear geometry in conjunction with the gas-filled separator RITU at the University of Jyvaeskylae. The experimental setup is discussed and the spectra are compared to Monte Carlo simulations. The implications for the ground-state configuration of 253 No are discussed. (orig.)
50 CFR 253.14 - Economic and financial requirements.
2010-10-01
... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Economic and financial requirements. 253... Obligation Guarantee Program § 253.14 Economic and financial requirements. (a) Income and expense projections... protect the U.S. against the industry's cyclical economics and other risks of loss. (b) Working capital...
30 CFR 253.1 - What is the purpose of this part?
2010-07-01
... 30 Mineral Resources 2 2010-07-01 2010-07-01 false What is the purpose of this part? 253.1 Section 253.1 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR OFFSHORE OIL SPILL FINANCIAL RESPONSIBILITY FOR OFFSHORE FACILITIES General § 253.1 What is the purpose of this part? This part...
Late effects of inhaled 253Es(NO3)3 in rats
International Nuclear Information System (INIS)
Ballou, J.E.; Dagle, G.E.; Gies, R.A.; Smith, L.G.
1979-01-01
Einsteinium-253 nitrate was administered as an aerosol to male Wistar rats and the long-term biological effects were followed for the animals' life span. Lung was the major target organ for absorbed radiation dose and tumor induction, in agreement with results for other inhaled transuranic nitrates. The earlier finding of a high incidence of bone tumors following intratracheal instillation of 253 EsCl 3 was not confirmed in the present study with inhaled 253 Es(NO 3 ) 3 . The reason for the difference in bone tumor production is believed to be related to the different acute toxicities of intratracheally instilled and inhaled 253 Es. Intratracheally instilled 253 EsCl 3 was less acutely toxic (only a single lobe or one-half the lung was irradiated); thus, a larger more tumorigenic dose could be translocated to bone without shortening the life span to the extent that bone tumors could not be expressed. The radiation dose from inhaled 253 Es(NO 3 ) 3 was uniformly spread throughout both lungs and early death due to a generalized radiation pneumonitis precluded the development of long-term effects in bone. (author)
29 CFR 1910.253 - Oxygen-fuel gas welding and cutting.
2010-07-01
... 29 Labor 5 2010-07-01 2010-07-01 false Oxygen-fuel gas welding and cutting. 1910.253 Section 1910..., DEPARTMENT OF LABOR OCCUPATIONAL SAFETY AND HEALTH STANDARDS Welding, Cutting and Brazing § 1910.253 Oxygen-fuel gas welding and cutting. (a) General requirements—(1) Flammable mixture. Mixtures of fuel gases...
50 CFR 216.253 - Prohibitions.
2010-10-01
..., DEPARTMENT OF COMMERCE MARINE MAMMALS REGULATIONS GOVERNING THE TAKING AND IMPORTING OF MARINE MAMMALS Taking Marine Mammals Incidental to Conducting Precision Strike Weapon Missions in the Gulf of Mexico § 216.253... shall: (a) Take any marine mammal not specified in § 216.250(b); (b) Take any marine mammal specified in...
49 CFR 234.253 - Flashing light units and lamp voltage.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Flashing light units and lamp voltage. 234.253... Maintenance, Inspection, and Testing Inspections and Tests § 234.253 Flashing light units and lamp voltage. (a... voltage shall be tested when installed and at least once every 12 months thereafter. (c) Each flashing...
46 CFR 169.253 - Miscellaneous systems and equipment.
2010-10-01
... VESSELS Inspection and Certification Inspections § 169.253 Miscellaneous systems and equipment. (a) At each inspection for certification and periodic inspection all items in the ship's outfit, such as...
14 CFR 25.253 - High-speed characteristics.
2010-01-01
... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false High-speed characteristics. 25.253 Section...-speed characteristics. (a) Speed increase and recovery characteristics. The following speed increase and recovery characteristics must be met: (1) Operating conditions and characteristics likely to cause...
Late effects of inhaled 253Es(NO3)3 in the rat
International Nuclear Information System (INIS)
Ballou, J.E.; Smith, L.G.; Dagle, G.E.; Gies, R.A.
1979-01-01
The lungs of rats exposed to 253 Es(NO 3 ) 3 aerosols sustained the greatest cumulative radiation dose, approximately 6-fold higher than the skeletal dose. Malignant lung tumors (incidence 8.5, 27.6%) were observed after a mean cumulative lung dose of 26 and 400 rad, respectively. Higher lung doses were associated with severe life shortening that precluded the expression of delayed effects. Osteosarcomas of the skeleton (incidence 6.9%) were found after a mean cumulative skeletal dose of 68 rad. Earlier studies, which showed a high incidence of bone tumors and relatively fewer lung tumors after intratracheal instillation of 253 EsCl 3 , were not confirmed in this study with inhaled 253 Es(NO 3 ) 3
Long-term effects of intratracheally instilled 253EsCl3 in rats
International Nuclear Information System (INIS)
Ballou, J.E.; Dagle, G.E.; Morrow, W.
1975-01-01
ts administered 253 EsCl 3 by intratracheal instillation developed more bone tumors and fewer lung tumors than similar rats administered 239 Pu(NO 3 ) 4 . In explanation, it is suggested that 253 Es may irradiatete bone surface cells more effectively while 239 Pu may irradiate a greater total number of cells in the lung. (U.S.)
48 CFR 253.208-2 - DD Form 448-2, Acceptance of MIPR.
2010-10-01
... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false DD Form 448-2, Acceptance... REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE CLAUSES AND FORMS FORMS Prescription of Forms 253.208-2 DD Form 448-2, Acceptance of MIPR. Follow the procedures at PGI 253.208-2 for use of DD Form 448-2. [71 FR 39005...
Local, Andrea; Zhang, Hongying; Benbatoul, Khalid D; Folger, Peter; Sheng, Xia; Tsai, Cheng-Yu; Howell, Stephen B; Rice, William G
2018-06-01
APTO-253 is a phase I clinical stage small molecule that selectively induces CDKN1A (p21), promotes G 0 -G 1 cell-cycle arrest, and triggers apoptosis in acute myeloid leukemia (AML) cells without producing myelosuppression in various animal species and humans. Differential gene expression analysis identified a pharmacodynamic effect on MYC expression, as well as induction of DNA repair and stress response pathways. APTO-253 was found to elicit a concentration- and time-dependent reduction in MYC mRNA expression and protein levels. Gene ontogeny and structural informatic analyses suggested a mechanism involving G-quadruplex (G4) stabilization. Intracellular pharmacokinetic studies in AML cells revealed that APTO-253 is converted intracellularly from a monomer to a ferrous complex [Fe(253) 3 ]. FRET assays demonstrated that both monomeric APTO-253 and Fe(253) 3 stabilize G4 structures from telomeres, MYC, and KIT promoters but do not bind to non-G4 double-stranded DNA. Although APTO-253 exerts a host of mechanistic sequelae, the effect of APTO-253 on MYC expression and its downstream target genes, on cell-cycle arrest, DNA damage, and stress responses can be explained by the action of Fe(253) 3 and APTO-253 on G-quadruplex DNA motifs. Mol Cancer Ther; 17(6); 1177-86. ©2018 AACR . ©2018 American Association for Cancer Research.
30 CFR 253.40 - What OSFR evidence must I submit to MMS?
2010-07-01
... 30 Mineral Resources 2 2010-07-01 2010-07-01 false What OSFR evidence must I submit to MMS? 253.40... § 253.40 What OSFR evidence must I submit to MMS? (a) You must submit to MMS: (1) A single demonstration... unaltered Form MMS-1016; (3) MMS forms that identify your COFs (Form MMS-1021, Form MMS-1022), and the...
48 CFR 253.215-70 - DD Form 1547, Record of Weighted Guidelines Application.
2010-10-01
... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false DD Form 1547, Record of... Forms 253.215-70 DD Form 1547, Record of Weighted Guidelines Application. Follow the procedures at PGI 253.215-70 for completing DD Form 1547. [71 FR 69495, Dec. 1, 2006] ...
37 CFR 253.10 - Cost of living adjustment.
2010-07-01
... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Cost of living adjustment... NONCOMMERCIAL EDUCATIONAL BROADCASTING § 253.10 Cost of living adjustment. (a) (a) On December 1, 2003, the Librarian of Congress shall publish in the Federal Register a notice of the change in the cost of living as...
24 CFR 236.253 - Premiums-operating loss loans.
2010-04-01
... Obligations for Mortgage Insurance § 236.253 Premiums—operating loss loans. All of the provisions of § 207.252a of this chapter relating to mortgage insurance premiums on operating loss loans shall apply to... Act the mortgage insurance premiums due in accordance with § 207.252a shall be calculated on the basis...
14 CFR 253.8 - Qualifications to notice requirements.
2010-01-01
... to notice requirements. (a) If notice is not provided in accordance with § 253.5 at a ticket sales location outside of the United States that is not a U.S. air carrier ticket office, the price paid for the portion of such ticket that is for interstate and overseas air transportation shall be refundable without...
48 CFR 253.213-70 - Completion of DD Form 1155, Order for Supplies or Services.
2010-10-01
... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Completion of DD Form 1155... Forms 253.213-70 Completion of DD Form 1155, Order for Supplies or Services. Follow the procedures at PGI 253.213-70 for completion of DD Form 1155. [71 FR 3413, Jan. 23, 2006] ...
Spectral Energy Distribution and Radio Halo of NGC 253 at Low Radio Frequencies
Energy Technology Data Exchange (ETDEWEB)
Kapińska, A. D.; Staveley-Smith, L.; Meurer, G. R.; For, B.-Q. [International Centre for Radio Astronomy Research (ICRAR), University of Western Australia, 35 Stirling Hwy, WA 6009 (Australia); Crocker, R. [Research School of Astronomy and Astrophysics, Australian National University, Canberra, ACT 2611 (Australia); Bhandari, S.; Callingham, J. R.; Gaensler, B. M.; Hancock, P. J.; Lenc, E. [ARC Centre of Excellence for All-Sky Astrophysics (CAASTRO), Sydney NSW (Australia); Hurley-Walker, N.; Seymour, N. [International Centre for Radio Astronomy Research (ICRAR), Curtin University, Bentley, WA 6102 (Australia); Offringa, A. R. [Netherlands Institute for Radio Astronomy (ASTRON), P.O. Box 2, 7990 AA Dwingeloo (Netherlands); Hanish, D. J. [Spitzer Science Center, California Institute of Technology, MC 220-6, 1200 East California Boulevard, Pasadena, CA 91125 (United States); Ekers, R. D.; Bell, M. E. [CSIRO Astronomy and Space Science (CASS), P.O. Box 76, Epping, NSW 1710 (Australia); Dwarakanath, K. S. [Raman Research Institute, Bangalore 560080 (India); Hindson, L. [Centre of Astrophysics Research, University of Hertfordshire, College Lane, Hatfield AL10 9AB (United Kingdom); Johnston-Hollitt, M. [School of Chemical and Physical Sciences, Victoria University of Wellington, P.O. Box 600, Wellington 6140 (New Zealand); McKinley, B., E-mail: anna.kapinska@uwa.edu.au [School of Physics, The University of Melbourne, Parkville, VIC 3010 (Australia); and others
2017-03-20
We present new radio continuum observations of NGC 253 from the Murchison Widefield Array at frequencies between 76 and 227 MHz. We model the broadband radio spectral energy distribution for the total flux density of NGC 253 between 76 MHz and 11 GHz. The spectrum is best described as a sum of a central starburst and extended emission. The central component, corresponding to the inner 500 pc of the starburst region of the galaxy, is best modeled as an internally free–free absorbed synchrotron plasma, with a turnover frequency around 230 MHz. The extended emission component of the spectrum of NGC 253 is best described as a synchrotron emission flattening at low radio frequencies. We find that 34% of the extended emission (outside the central starburst region) at 1 GHz becomes partially absorbed at low radio frequencies. Most of this flattening occurs in the western region of the southeast halo, and may be indicative of synchrotron self-absorption of shock-reaccelerated electrons or an intrinsic low-energy cutoff of the electron distribution. Furthermore, we detect the large-scale synchrotron radio halo of NGC 253 in our radio images. At 154–231 MHz the halo displays the well known X-shaped/horn-like structure, and extends out to ∼8 kpc in the z -direction (from the major axis).
2010-01-01
... alternative bid provision for payment to contractor for bulk purchase of materials. 1726.253 Section 1726.253... contractor for bulk purchase of materials. When construction is to be performed over an extended period of... AGRICULTURE ELECTRIC SYSTEM CONSTRUCTION POLICIES AND PROCEDURES Modifications to RUS Standard Contract Forms...
G0.253 + 0.016: A MOLECULAR CLOUD PROGENITOR OF AN ARCHES-LIKE CLUSTER
International Nuclear Information System (INIS)
Longmore, Steven N.; Ascenso, Joana; Testi, Leonardo; Bressert, Eli; Rathborne, Jill; Bastian, Nate; Alves, Joao; Meingast, Stefan; Bally, John; Battersby, Cara; Longmore, Andy; Purcell, Cormac; Walsh, Andrew; Jackson, James; Foster, Jonathan; Molinari, Sergio; Amorim, A.; Lima, J.; Marques, R.; Moitinho, A.
2012-01-01
Young massive clusters (YMCs) with stellar masses of 10 4 -10 5 M ☉ and core stellar densities of 10 4 -10 5 stars per cubic pc are thought to be the 'missing link' between open clusters and extreme extragalactic super star clusters and globular clusters. As such, studying the initial conditions of YMCs offers an opportunity to test cluster formation models across the full cluster mass range. G0.253 + 0.016 is an excellent candidate YMC progenitor. We make use of existing multi-wavelength data including recently available far-IR continuum (Herschel/Herschel Infrared Galactic Plane Survey) and mm spectral line (H 2 O Southern Galactic Plane Survey and Millimetre Astronomy Legacy Team 90 GHz Survey) data and present new, deep, multiple-filter, near-IR (Very Large Telescope/NACO) observations to study G0.253 + 0.016. These data show that G0.253 + 0.016 is a high-mass (1.3 × 10 5 M ☉ ), low-temperature (T dust ∼ 20 K), high-volume, and column density (n ∼ 8 × 10 4 cm –3 ; N H 2 ∼4×10 23 cm –2 ) molecular clump which is close to virial equilibrium (M dust ∼ M virial ) so is likely to be gravitationally bound. It is almost devoid of star formation and, thus, has exactly the properties expected for the initial conditions of a clump that may form an Arches-like massive cluster. We compare the properties of G0.253 + 0.016 to typical Galactic cluster-forming molecular clumps and find it is extreme, and possibly unique in the Galaxy. This uniqueness makes detailed studies of G0.253 + 0.016 extremely important for testing massive cluster formation models.
Refinement of the critical 2p25.3 deletion region
DEFF Research Database (Denmark)
De Rocker, Nina; Vergult, Sarah; Koolen, David
2015-01-01
PURPOSE: Submicroscopic deletions of chromosome band 2p25.3 are associated with intellectual disability and/or central obesity. Although MYT1L is believed to be a critical gene responsible for intellectual disability, so far no unequivocal data have confirmed this hypothesis. METHODS: In this study...
7 CFR 2.53 - Administrator, Food Safety and Inspection Service.
2010-01-01
... 7 Agriculture 1 2010-01-01 2010-01-01 false Administrator, Food Safety and Inspection Service. 2... Secretary for Food Safety § 2.53 Administrator, Food Safety and Inspection Service. (a) Delegations... to the Administrator, Food Safety and Inspection Service: (1) Exercise the functions of the Secretary...
30 CFR 206.253 - Coal subject to royalties-general provisions.
2010-07-01
... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Coal subject to royalties-general provisions... MINERALS REVENUE MANAGEMENT PRODUCT VALUATION Federal Coal § 206.253 Coal subject to royalties—general provisions. (a) All coal (except coal unavoidably lost as determined by BLM under 43 CFR part 3400) from a...
Dong, Jin-yang; Zhang, Gui-xin; Wang, Chang-quan
2012-01-01
As a kind of new electric light source, electrodeless discharge lamps are of long life, low mercury and non-stroboscopic light. The lighting effect of electrodeless discharge lamps depends on the radiation efficiency of 253.7 nm resonance spectra line to a large extent. The influence of cold temperature on 253.7 nm resonance spectra line has been studied experimentally by atomic emission spectral analysis. It was found that the radiation efficiency of 253.7 nm resonance spectra line is distributed in a nearly normal fashion with the variation of cold spot temperature, in other words, there is an optimum cold spot temperature for an electrodeless discharge lamp. At last, the results of experiments were analyzed through gas discharge theory, which offers guidance to the improvement of lighting effect for electrodeless discharge lamps.
40 CFR 96.253 - Recordation of CAIR SO2 allowances.
2010-07-01
... 40 Protection of Environment 20 2010-07-01 2010-07-01 false Recordation of CAIR SO2 allowances. 96... (CONTINUED) NOX BUDGET TRADING PROGRAM AND CAIR NOX AND SO2 TRADING PROGRAMS FOR STATE IMPLEMENTATION PLANS CAIR SO2 Allowance Tracking System § 96.253 Recordation of CAIR SO2 allowances. (a)(1) After a...
40 CFR 97.253 - Recordation of CAIR SO2 allowances.
2010-07-01
... 40 Protection of Environment 20 2010-07-01 2010-07-01 false Recordation of CAIR SO2 allowances. 97... (CONTINUED) FEDERAL NOX BUDGET TRADING PROGRAM AND CAIR NOX AND SO2 TRADING PROGRAMS CAIR SO2 Allowance Tracking System § 97.253 Recordation of CAIR SO2 allowances. (a)(1) After a compliance account is...
Trabesinger, Andreas
2017-09-01
The first new element produced after the Second World War has led a rather peaceful life since entering the period table -- until it became the target of those producing superheavy elements, as Andreas Trabesinger describes.
Activation of p38 MAPK pathway in the skull abnormalities of Apert syndrome Fgfr2+P253R mice
Directory of Open Access Journals (Sweden)
Hill Cheryl A
2010-02-01
Full Text Available Abstract Background Apert syndrome is characterized by craniosynostosis and limb abnormalities and is primarily caused by FGFR2 +/P253R and +/S252W mutations. The former mutation is present in approximately one third whereas the latter mutation is present in two-thirds of the patients with this condition. We previously reported an inbred transgenic mouse model with the Fgfr2 +/S252W mutation on the C57BL/6J background for Apert syndrome. Here we present a mouse model for the Fgfr2+/P253R mutation. Results We generated inbred Fgfr2+/P253R mice on the same C56BL/6J genetic background and analyzed their skeletal abnormalities. 3D micro-CT scans of the skulls of the Fgfr2+/P253R mice revealed that the skull length was shortened with the length of the anterior cranial base significantly shorter than that of the Fgfr2+/S252W mice at P0. The Fgfr2+/P253R mice presented with synostosis of the coronal suture and proximate fronts with disorganized cellularity in sagittal and lambdoid sutures. Abnormal osteogenesis and proliferation were observed at the developing coronal suture and long bones of the Fgfr2+/P253R mice as in the Fgfr2+/S252W mice. Activation of mitogen-activated protein kinases (MAPK was observed in the Fgfr2+/P253R neurocranium with an increase in phosphorylated p38 as well as ERK1/2, whereas phosphorylated AKT and PKCα were not obviously changed as compared to those of wild-type controls. There were localized phenotypic and molecular variations among individual embryos with different mutations and among those with the same mutation. Conclusions Our in vivo studies demonstrated that the Fgfr2 +/P253R mutation resulted in mice with cranial features that resemble those of the Fgfr2+/S252W mice and human Apert syndrome. Activated p38 in addition to the ERK1/2 signaling pathways may mediate the mutant neurocranial phenotype. Though Apert syndrome is traditionally thought to be a consistent phenotype, our results suggest localized and regional
Reactor production of 252Cf and transcurium isotopes
International Nuclear Information System (INIS)
Alexander, C.W.; Halperin, J.; Walker, R.L.; Bigelow, J.E.
1990-01-01
Berkelium, californium, einsteinium, and fermium are currently produced in the High Flux Isotope Reactor (HFIR) and recovered in the Radiochemical Engineering Development Center (REDC) at the Oak Ridge National Laboratory (ORNL). All the isotopes are used for research. In addition, 252 Cf, 253 Es, and 255 Fm have been considered or are used for industrial or medical applications. ORNL is the sole producer of these transcurium isotopes in the western world. A wide range of actinide samples were irradiated in special test assemblies at the Fast Flux Test Facility (FFTF) at Hanford, Washington. The purpose of the experiments was to evaluate the usefulness of the two-group flux model for transmutations in the special assemblies with an eventual goal of determining the feasibility of producing macro amounts of transcurium isotopes in the FFTF. Preliminary results from the production of 254g Es from 252 Cf will be discussed. 14 refs., 5 tabs
SHAKEN, NOT STIRRED: THE DISRUPTED DISK OF THE STARBURST GALAXY NGC 253
International Nuclear Information System (INIS)
Davidge, T. J.
2010-01-01
Near-infrared images obtained with WIRCam on the Canada-France-Hawaii Telescope are used to investigate the recent history of the nearby Sculptor Group spiral NGC 253, which is one of the nearest starburst galaxies. Bright asymptotic giant branch (AGB) stars are traced out to projected distances of ∼22-26 kpc (∼13-15 disk scale lengths) along the major axis. The distribution of stars in the disk is lopsided, in the sense that the projected density of AGB stars in the northeast portion of the disk between 10 and 20 kpc from the galaxy center is ∼0.5 dex higher than on the opposite side of the galaxy. A large population of red supergiants is also found in the northeast portion of the disk and, with the exception of the central 2 kpc, this area appears to have been the site of the highest levels of star-forming activity in the galaxy during the past ∼0.1 Gyr. It is argued that such high levels of localized star formation may have produced a fountain that ejected material from the disk, and the extraplanar H I detected by Boomsma et al. may be one manifestation of such activity. Diffuse stellar structures are found in the periphery of the disk, and the most prominent of these is to the south and east of the galaxy. Bright AGB stars, including cool C stars that are identified based on their J - K colors, are detected out to 15 kpc above the disk plane, and these are part of a diffusely distributed, flattened extraplanar component. Comparisons between observed and model luminosity functions suggest that the extraplanar regions contain stars that formed throughout much of the age of the universe. Additional evidence of a diffuse, extraplanar stellar component that contains moderately young stars comes from archival Galaxy Evolution Explorer images. It is suggested that the disk of NGC 253 was disrupted by a tidal encounter with a now defunct companion. This encounter introduced asymmetries that remain to this day, and the projected distribution of stars in and
48 CFR 253.208-1 - DD Form 448, Military Interdepartmental Purchase Request.
2010-10-01
... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false DD Form 448, Military... DD Form 448, Military Interdepartmental Purchase Request. Follow the procedures at PGI 253.208-1 for use of DD Form 448. [71 FR 39005, July 11, 2006] ...
Directory of Open Access Journals (Sweden)
Raphael Marianelli
2009-03-01
Full Text Available O objetivo deste estudo foi rever a experiência do serviço de coloproctologia do HSPM-SP no tratamento cirúrgico da doença hemorroidária. Estudou-se retrospectivamente 253 pacientes portadores de hemorroidas submetidos à cirurgia no período de 10/05/2004 a 31/12/2007. Foram estabelecidos dois grupos: Grupo 1 Pacientes operados pela técnica convencional (212; Grupo 2 Pacientes operados pelo PPH (41. Estudou-se, pela revisão de prontuários, as características epidemiológicas, indicações, resultados e complicações de cada grupo. Entre os 253 pacientes analisados, 170 eram mulheres, com média de idade de 50 anos. O tempo operatório médio foi de 52 minutos para o grupo 1, e 31 minutos para o grupo 2 (p=0,0001. O tempo médio de alta ambulatorial foi de 10 e 6 semanas para o grupo 1 e 2, respectivamente (p=0,021. As complicações totalizaram 28 casos no grupo 1, e 3 casos no grupo 2 (p>0,05. Cerca de 13 casos no grupo 1, e 1 caso no grupo 2 necessitaram de reintervenção cirúrgica. Neste serviço a técnica mais utilizada foi a hemorroidectomia convencional. O método do PPH apresentou tempo operatório mais curto, e recuperação pós-operatória mais breve. Houve uma maior tendência a complicações tardias e recidivas com o grupo de hemorroidectomia convencional, porém sem significância estatística.The aim of this study was to review the experience of the Coloproctology Department of HSPM-SP in the treatment of hemorrhoids. We have retrospectively studied 253 patients submitted to the surgical treatment of hemorrhoids between 05/10/ 2004 and 12/31/2007. Patients were distributed in groups: Group 1 Conventional Hemorrhoidectomy (212; Group 2 Stapled Hemorrhoidopexy (41. Epidemiology, indications, results and complications were studied based on registers. From 253 patients studied, 170 were women, with a mean age of 50 years. Mean operating time was 52 minutes (25 -120 in group 1 and 31 minutes (20 - 65 in group 2 (p=0
Luminescent properties of Sr{sub 2.5-3x/2}Ba{sub 0.5}Sm{sub x}AlO{sub 4}F oxyfluorides
Energy Technology Data Exchange (ETDEWEB)
Park, Sangmoon, E-mail: spark@silla.ac.kr [Department of Engineering in Energy and Applied Chemistry, Silla University, Busan 617-736 (Korea, Republic of)
2012-04-15
Effective orange Sm{sup 3+}-doped Sr{sub 2.5}Ba{sub 0.5}AlO{sub 4}F phosphors excited at 254 and 408 nm excitation were prepared by the solid-state method. The excitation and emission spectra of Sr{sub 2.5-3x/2}Ba{sub 0.5}Sm{sub x}AlO{sub 4}F and Sr{sub 2.5-3x/2}Ba{sub 0.5}Sm{sub x}AlO{sub 4-{alpha}}F{sub 1-{delta}} (x=0.001{approx}0.1) based on photoluminescence spectroscopy are investigated. The defects in anion-deficient Sr{sub 2.5-3x/2}Ba{sub 0.5}Sm{sub x}AlO{sub 4-{alpha}}F{sub 1-{delta}} (x=0.001, 0.01) are monitored by broad-band photoluminescence emission centered near 480 nm along with the orange emission transitions of Sm{sup 3+}. CIE values and relative luminescent intensities of Sr{sub 2.5-3x/2}Ba{sub 0.5}Sm{sub x}AlO{sub 4}F and Sr{sub 2.5-3x/2}Ba{sub 0.5}Sm{sub x}AlO{sub 4-{alpha}}F{sub 1-{delta}} by changing the Sm{sup 3+} content (x=0.001{approx}0.1) are discussed. - Highlights: Black-Right-Pointing-Pointer Under the excitation of 408 nm competent orange emitting Sr{sub 2.5-3x/2}Ba{sub 0.5}Sm{sub x}AlO{sub 4}F phosphor is initiated. Black-Right-Pointing-Pointer Sm{sup 3+}-activated oxyfluoride phosphor is quite effective to prepare white-emitting light for near-UV LED applications. Black-Right-Pointing-Pointer Defects could be visibly created in the Sr{sub 2.5-3x/2}Ba{sub 0.5}Sm{sub x}Al O{sub 4}F host lattices when Sm{sup 3+} ions are doped less than 5 mol %. Black-Right-Pointing-Pointer The gradual substitution of Sm{sup 3+} contents in oxyfluoride hosts is amenable to change CIE values and desired emitting intensity.
30 CFR 253.50 - How can MMS refuse or invalidate my OSFR evidence?
2010-07-01
... 30 Mineral Resources 2 2010-07-01 2010-07-01 false How can MMS refuse or invalidate my OSFR... can MMS refuse or invalidate my OSFR evidence? (a) If MMS determines that any OSFR evidence you submit... acceptable evidence without being subject to civil penalty under § 253.51. (b) MMS may immediately and...
Fujiwara, Tomohiro; Uotani, Koji; Yoshida, Aki; Morita, Takuya; Nezu, Yutaka; Kobayashi, Eisuke; Yoshida, Akihiko; Uehara, Takenori; Omori, Toshinori; Sugiu, Kazuhisa; Komatsubara, Tadashi; Takeda, Ken; Kunisada, Toshiyuki; Kawamura, Machiko; Kawai, Akira; Ochiya, Takahiro; Ozaki, Toshifumi
2017-05-16
Emerging evidence has suggested that circulating microRNAs (miRNAs) in body fluids have novel diagnostic and prognostic significance for patients with malignant diseases. The lack of useful biomarkers is a crucial problem of bone and soft tissue sarcomas; therefore, we investigated the circulating miRNA signature and its clinical relevance in osteosarcoma. Global miRNA profiling was performed using patient serum collected from a discovery cohort of osteosarcoma patients and controls and cell culture media. The secretion of the detected miRNAs from osteosarcoma cells and clinical relevance of serum miRNA levels were evaluated using in vitro and in vivo models and a validation patient cohort. Discovery screening identified 236 serum miRNAs that were highly expressed in osteosarcoma patients compared with controls, and eight among these were also identified in the cell culture media. Upregulated expression levels of miR-17-5p and miR-25-3p were identified in osteosarcoma cells, and these were abundantly secreted into the culture media in tumor-derived exosomes. Serum miR-25-3p levels were significantly higher in osteosarcoma patients than in control individuals in the validation cohort, with favorable sensitivity and specificity compared with serum alkaline phosphatase. Furthermore, serum miR-25-3p levels at diagnosis were correlated with patient prognosis and reflected tumor burden in both in vivo models and patients; these associations were more sensitive than those of serum alkaline phosphatase. Serum-based circulating miR-25-3p may serve as a non-invasive blood-based biomarker for tumor monitoring and prognostic prediction in osteosarcoma patients.
THE GALACTIC CENTER CLOUD G0.253+0.016: A MASSIVE DENSE CLOUD WITH LOW STAR FORMATION POTENTIAL
Energy Technology Data Exchange (ETDEWEB)
Kauffmann, Jens; Pillai, Thushara [Astronomy Department, California Institute of Technology, 1200 East California Boulevard, Pasadena, CA 91125 (United States); Zhang Qizhou, E-mail: jens.kauffmann@astro.caltech.edu [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street MS78, Cambridge, MA 02138 (United States)
2013-03-10
We present the first interferometric molecular line and dust emission maps for the Galactic Center (GC) cloud G0.253+0.016, observed using CARMA and the SMA. This cloud is very dense, and concentrates a mass exceeding the Orion Molecular Cloud Complex (2 Multiplication-Sign 10{sup 5} M{sub Sun }) into a radius of only 3 pc, but it is essentially starless. G0.253+0.016 therefore violates ''star formation laws'' presently used to explain trends in galactic and extragalactic star formation by a factor {approx}45. Our observations show a lack of dense cores of significant mass and density, thus explaining the low star formation activity. Instead, cores with low densities and line widths {approx}< 1 km s{sup -1}-probably the narrowest lines reported for the GC region to date-are found. Evolution over several 10{sup 5} yr is needed before more massive cores, and possibly an Arches-like stellar cluster, could form. Given the disruptive dynamics of the GC region, and the potentially unbound nature of G0.253+0.016, it is not clear that this evolution will happen.
PCA/HEXTE Observations of M82 and NGC253
Rephaeli, Yoel
1999-01-01
The nearby starburst galaxies M82 & NGC 253 were observed by the RXTE satellite during the period February - November 1997. Data reduction and analysis began in summer 1998, and continued through March 1999. The spectral analysis indicates that the main emission in these galaxies is from hot gas. We find a considerable degree of variability in the emission from M82, possibly due to M81 (a known AGN) in the FOV. The main spectral parameters were determined for both sources. The results of the analysis were reported in the March 1999 meeting of the AAS. Summary of the data analysis, theoretical modeling, and interpretation will be presented in a paper which is currently being prepared for publication in the Astrophysical Journal.
H I observations of the nearest starburst galaxy NGC 253 with the SKA precursor KAT-7
Lucero, D. M.; Carignan, C.; Elson, E. C.; Randriamampandry, T. H.; Jarrett, T. H.; Oosterloo, T. A.; Heald, G. H.
We present H I observations of the Sculptor group starburst spiral galaxy NGC 253, obtained with the Karoo Array Telescope (KAT-7). KAT-7 is a pathfinder for the Square Kilometre Array precursor MeerKAT, under construction. The short baselines and low system temperature of the telescope make it very
Directory of Open Access Journals (Sweden)
Feng Zhang
2018-03-01
Full Text Available miR-25, a member of the miR-106b-25 cluster, has been reported as playing an important role in many biological processes by numerous studies, while the role of miR-25 in metabolism and its transcriptional regulation mechanism remain unclear. In this study, gain-of-function and loss-of-function assays demonstrated that miR-25-3p positively regulated the metabolism of C2C12 cells by attenuating phosphoinositide 3-kinase (PI3K gene expression and triglyceride (TG content, and enhancing the content of adenosine triphosphate (ATP and reactive oxygen species (ROS. Furthermore, the results from bioinformatics analysis, dual luciferase assay, site-directed mutagenesis, qRT-PCR, and Western blotting demonstrated that miR-25-3p directly targeted the AKT serine/threonine kinase 1 (Akt1 3′ untranslated region (3′UTR. The core promoter of miR-25-3p was identified, and the transcription factor activator protein-2α (AP-2α significantly increased the expression of mature miR-25-3p by binding to its core promoter in vivo, as indicated by the chromatin immunoprecipitation (ChIP assay, and AP-2α binding also downregulated the expression of Akt1. Taken together, our findings suggest that miR-25-3p, positively regulated by the transcription factor AP-2α, enhances C2C12 cell metabolism by targeting the Akt1 gene.
En undersøgelse af de 253 første nyrestensbehandlinger med 3. generations Siemens Lithoskop™
DEFF Research Database (Denmark)
Kruckow, Line; Eldrup, Jesper
Introduktion: Kandidatspecialets formål er at undersøge et års behandlinger af nyresten ved ny stenknuser, Siemens Lithoskop. Undersøgelsen fokuserer på hvorvidt stenstørrelse, BMI og stenplacering har indflydelse på stenfrihedsraten. Metode: Mellem 6/12-11 og 11/12-12 blev 253 behandlinger og...
THE COMPACT STAR-FORMING COMPLEX AT THE HEART OF NGC 253
Energy Technology Data Exchange (ETDEWEB)
Davidge, T. J., E-mail: tim.davidge@nrc.ca [Dominion Astrophysical Observatory, National Research Council of Canada, 5071 West Saanich Road, Victoria, BC V9E 2E7 (Canada)
2016-02-20
We discuss integral field spectra of the compact star-forming complex that is the brightest near-infrared (NIR) source in the central regions of the starburst galaxy NGC 253. The spectra cover the H and K passbands and were recorded with the Gemini NIR Spectrograph during subarcsecond seeing conditions. Absorption features in the spectrum of the star-forming complex are weaker than in the surroundings. An absorption feature is found near 1.78 μm that coincides with the location of a C{sub 2} bandhead. If this feature is due to C{sub 2} then the star-forming complex has been in place for at least a few hundred Myr. Emission lines of Brγ, [Fe ii], and He i 2.06 μm do not track the NIR continuum light. Pockets of star-forming activity that do not have associated concentrations of red supergiants, and so likely have ages <8 Myr, are found along the western edge of the complex, and there is evidence that one such pocket contains a rich population of Wolf–Rayet stars. Unless the star-forming complex is significantly more metal-poor than the surroundings, then a significant fraction of its total mass is in stars with ages <8 Myr. If the present-day star formation rate is maintained then the timescale to double its stellar mass ranges from a few Myr to a few tens of Myr, depending on the contribution made by stars older than ∼8 Myr. If—as suggested by some studies—the star-forming complex is centered on the galaxy’s nucleus, which presumably contains a large population of old and intermediate-age stars, then the nucleus of NGC 253 is currently experiencing a phase of rapid growth in its stellar mass.
2010-07-01
... financial statements to verify my unencumbered assets, what standards must they meet? Any audited annual financial statements that you submit must: (a) Meet the standards in § 253.24; and (b) Include a certification by the independent accountant who audited the financial statements that states: (1) The value of...
Nustar and Chandra insight into the nature of the 3-40 kev nuclear emission in NGC 253
DEFF Research Database (Denmark)
Lehmer, B. D.; Wik, D. R.; Hornschemeier, A. E.
2013-01-01
We present results from three nearly simultaneous Nuclear Spectroscopic Telescope Array ( NuSTAR ) and Chandra monitoring observations between 2012 September 2 and 2012 November 16 of the local star-forming galaxy NGC 253. The 3-40 keV intensity of the inner ~ 20 arcsec ( ~ 400 pc) nuclear region...
In-beam study of {sup 253}No using the SAGE spectrometer
Energy Technology Data Exchange (ETDEWEB)
Mistry, A.K.; Herzberg, R.D.; Butler, P.A.; Cox, D.M.; Joss, D.T.; Page, R.D.; Seddon, D.; Thornhill, J.; Wells, D. [University of Liverpool, Oliver Lodge Laboratory, Liverpool (United Kingdom); Greenlees, P.T.; Papadakis, P.; Auranen, K.; Grahn, T.; Jakobsson, U.; Julin, R.; Konki, J.; Leino, M.; Pakarinen, J.; Peura, P.; Rahkila, P.; Sandzelius, M.; Scholey, C.; Sorri, J.; Stolze, S.; Uusitalo, J. [University of Jyvaskyla, Department of Physics, Jyvaskyla (Finland); Garnsworthy, A.B.; Ketelhut, S. [University of British Columbia, TRIUMF, Vancouver, British Columbia (Canada); Hauschild, K.; Lopez-Martens, A. [Universite Paris-Sud, CSNSM, CNRS, IN2P3, Orsay (France); Simpson, J. [STFC, Daresbury Laboratory, Daresbury, Warrington (United Kingdom)
2017-02-15
The heavy actinide nucleus {sup 253}No (Z = 102) was studied using the (S)ilicon (A)nd (Ge)rmanium (SAGE) spectrometer allowing simultaneous in-beam γ-ray and conversion electron spectroscopy at the accelerator laboratory of the University of Jyvaeskylae. Using the recoil-tagging technique, γ-electron coincidences have allowed for the extension of the level scheme in the lower-spin region of the yrast band. In addition, internal conversion coefficient (ICC) measurements to establish the multipolarity of transitions have been performed. Measurement of the interband-intraband branching ratios supports the assignment of the Nilsson band-head configuration 9/2{sup -}[734] assigned in previous studies. The study shows the viability of combined in-beam electron and γ-ray spectroscopy down to μb cross sections. (orig.)
International Nuclear Information System (INIS)
Mccarthy, P.J.; Van breugel, W.; Heckman, T.; Maryland Univ., College Park)
1987-01-01
The results of long-slit spectroscopy and narrow-band imaging of M82 and NGC 253, the two nearest examples of FIR luminous galaxies believed to be undergoing intense bursts of star formation, are presented. The profile of the gas pressure in the emission-line filaments in M82 is derived and found to be in good agreement with the model of Chevalier and Clegg (1985) of a supernovae-driven wind from a starburst nucleus. Lower quality data from NGC 253 support the same interpretation. Analysis of the emission-line ratios suggests that the line-emitting gas may be heated by low-velocity shocks, although photoionization from dilute UV radiation from unusually hot stars in the central starburst may also be important. 56 references
A VST and VISTA study of globular clusters in NGC 253
Cantiello, Michele; Grado, Aniello; Rejkuba, Marina; Arnaboldi, Magda; Capaccioli, Massimo; Greggio, Laura; Iodice, Enrica; Limatola, Luca
2018-03-01
Context. Globular clusters (GCs) are key to our understanding of the Universe, as laboratories of stellar evolution, fossil tracers of the past formation epoch of the host galaxy, and effective distance indicators from local to cosmological scales. Aim. We analyze the properties of the sources in the NGC 253 with the aim of defining an up to date catalog of GC candidates in the galaxy. Given the distance of the galaxy, GCs in NGC 253 are ideal targets for resolved color-magnitude diagram studies of extragalactic GCs with next-generation diffraction limited ground-based telescopes. Methods: Our analysis is based on the science verification data of two ESO survey telescopes, VST and VISTA. Using ugri photometry from VST and JKs from VISTA, GC candidates were selected using as reference the morpho-photometric and color properties of spectroscopically confirmed GCs available in the literature. The strength of the results was verified against available archival HST/ACS data from the GHOSTS survey: all but two of the selected GC candidates appear as star clusters in HST footprints. Results: The adopted GC selection leads to the definition of a sample of ˜350 GC candidates. At visual inspection, we find that 82 objects match all the requirements for selecting GC candidates and 155 are flagged as uncertain GC candidate; however, 110 are unlikely GCs, which are most likely background galaxies. Furthermore, our analysis shows that four of the previously spectroscopically confirmed GCs, i.e., ˜20% of the total spectroscopic sample, are more likely either background galaxies or high-velocity Milky Way stars. The radial density profile of the selected best candidates shows the typically observed r1/4-law radial profile. The analysis of the color distributions reveals only marginal evidence of the presence of color bimodality, which is normally observed in galaxies of similar luminosity. The GC luminosity function does not show the typical symmetry, mainly because of the lack
International Nuclear Information System (INIS)
Nehate, A.K.; Joshi, T.R.; Kathuria, S.P.; Joshi, R.V.
1986-01-01
This paper studies the thermoluminescence (TL) glow curves of NaCl:Ca(T) phosphors to various doses of 253.7-nm ultraviolet (UV) radiation at room temperature. TLD grade NaCl:Ca(T) material was obtained by crystallization from solution and was subsequently annealed at 750 degrees C for 2 h, followed by sudden quenching. We undertook measurement of the effect of variable UV radiation doses (10(2) to 10(6) J m-2) on the TL behaviour of NaCl:Ca(T) phosphors. It was observed that the phosphor exhibits a dominant peak around 167 degrees C along with a weak peak at lower temperature. The high-temperature peak (Peak II) is found to grow linearly with the increase in UV dose in the range of 10(2) to 10(6) J m-2. Since the nature of the glow curves under the influence of different doses remains more or less identical, it is believed that the phosphor does not undergo radiation damage and displays high intrinsic TL around Peak II. Examination of the system for fundamental dosimetry requirements shows that it can be used in dosimetry work at 253.7 nm
XMM-Newton Observations of NGC 253: Resolving the Emission Components in the Disk and Nuclear Area
Pietsch, W.; Borozdin, K. N.; Branduardi-Raymont, G.; Cappi, M.; Ehle, M.; Ferrando, P.; Freyberg, M. J.; Kahn, S. M.; Ponman, T. J.; Ptak, A.
2000-01-01
We describe the first XMM-Newton observations of the starburst galaxy NGC 253. As known from previous X-ray observations, NGC 253 shows a mixture of extended (disk and halo) and point-source emission. The high XMM-Newton throughput allows for the first time a detailed investigation of the spatial, spectral and variability properties of these components simultaneously. We detect a bright X-ray transient approx. 70 sec SSW of the nucleus and show the spectrum and light curve of the brightest point source (approx. 30 sec S of the nucleus, most likely a black-hole X-ray binary, BHXRB). The unprecedented combination of RGS and EPIC also sheds new light on the emission of the complex nuclear region, the X-ray plume and the disk diffuse emission. In particular, EPIC images reveal that the limb-brightening of the plume is mostly seen in higher ionization emission lines, while in the lower ionization lines, and below 0.5 keV, the plume is more homo- geneously structured, pointing to new interpretations as to the make up of the starburst-driven outflow. Assuming that type IIa supernova remnants (SNRs) are mostly responsible for the E greater than 4 keV emission, the detection with EPIC of the 6.7 keV line allows us to estimate a supernova rate within the nuclear starburst of 0.2 /yr.
Direct Evidence for Maser Emission from the 36.2 GHz Class I Transition of Methanol in NGC253
Chen, Xi; Ellingsen, Simon P.; Shen, Zhi-Qiang; McCarthy, Tiege P.; Zhong, Wei-Ye; Deng, Hui
2018-04-01
Observations made with the Jansky Very large Array (JVLA) at an angular resolution of ∼0.″1 have detected class I methanol maser emission from the 36.2 GHz transition toward the starburst galaxy NGC 253. The methanol emission is detected toward four sites which lie within the regions of extended methanol emission detected in previous lower angular resolution (a few arcseconds) observations. The peak flux densities of the detected compact components are in the range 3–9 mJy beam‑1. Combining the JVLA data with single-dish observations from the Shanghai Tianma Radio Telescope (TMRT) and previous interferometric observations with the Australia Telescope Compact Array (ATCA), we show that the 36.2 GHz class I methanol emission consists of both extended and compact structures, with typical scales of ∼6″ (0.1 kpc) and ∼0.″05 (1 pc), respectively. The strongest components have a brightness temperature of >103 K, much higher than the maximum kinetic temperature (∼100 K) of the thermal methanol emission from NGC 253. Therefore, these observations conclusively demonstrate for the first time the presence of maser emission from a class I methanol transition in an external galaxy.
Rocker, N. de; Vergult, S.; Koolen, D.A.; Jacobs, E.; Hoischen, A.; Zeesman, S.; Bang, B.; Bena, F.; Bockaert, N.; Bongers, E.M.H.F.; Ravel, T. de; Devriendt, K.; Giglio, S.; Faivre, L.; Joss, S.; Maas, S.; Marle, N.; Novara, F.; Nowaczyk, M.J.; Peeters, H.; Polstra, A.; Roelens, F.; Rosenberg, C.; Thevenon, J.; Tumer, Z.; Vanhauwaert, S.; Varvagiannis, K.; Willaert, A.; Willemsen, M.H.; Willems, M.; Zuffardi, O.; Coucke, P.; Speleman, F.; Eichler, E.E.; Kleefstra, T.; Menten, B.
2015-01-01
PURPOSE: Submicroscopic deletions of chromosome band 2p25.3 are associated with intellectual disability and/or central obesity. Although MYT1L is believed to be a critical gene responsible for intellectual disability, so far no unequivocal data have confirmed this hypothesis. METHODS: In this study
de Rocker, Nina; Vergult, Sarah; Koolen, David; Jacobs, Eva; Hoischen, Alexander; Zeesman, Susan; Bang, Birgitte; Béna, Frédérique; Bockaert, Nele; Bongers, Ernie M.; de Ravel, Thomy; Devriendt, Koenraad; Giglio, Sabrina; Faivre, Laurence; Joss, Shelagh; Maas, Saskia; Marle, Nathalie; Novara, Francesca; Nowaczyk, Malgorzata J. M.; Peeters, Hilde; Polstra, Abeltje; Roelens, Filip; Rosenberg, Carla; Thevenon, Julien; Tümer, Zeynep; Vanhauwaert, Suzanne; Varvagiannis, Konstantinos; Willaert, Andy; Willemsen, Marjolein; Willems, Marjolaine; Zuffardi, Orsetta; Coucke, Paul; Speleman, Frank; Eichler, Evan E.; Kleefstra, Tjitske; Menten, Björn
2015-01-01
Submicroscopic deletions of chromosome band 2p25.3 are associated with intellectual disability and/or central obesity. Although MYT1L is believed to be a critical gene responsible for intellectual disability, so far no unequivocal data have confirmed this hypothesis. In this study we evaluated a
Luo, Fengtao; Xie, Yangli; Xu, Wei; Huang, Junlan; Zhou, Siru; Wang, Zuqiang; Luo, Xiaoqing; Liu, Mi; Chen, Lin; Du, Xiaolan
2017-01-01
Apert syndrome (AS) is a common genetic syndrome in humans characterized with craniosynostosis. Apert patients and mouse models showed abnormalities in sutures, cranial base and brain, that may all be involved in the pathogenesis of skull malformation of Apert syndrome. To distinguish the differential roles of these components of head in the pathogenesis of the abnormal skull morphology of AS, we generated mouse strains specifically expressing mutant FGFR2 in chondrocytes, osteoblasts, and progenitor cells of central nervous system (CNS) by crossing Fgfr2 +/P253R-Neo mice with Col2a1-Cre, Osteocalcin-Cre (OC-Cre), and Nestin-Cre mice, respectively. We then quantitatively analyzed the skull and brain morphology of these mutant mice by micro-CT and micro-MRI using Euclidean distance matrix analysis (EDMA). Skulls of Col2a1-Fgfr2 +/P253R mice showed Apert syndrome-like dysmorphology, such as shortened skull dimensions along the rostrocaudal axis, shortened nasal bone, and evidently advanced ossification of cranial base synchondroses. The OC-Fgfr2 +/P253R mice showed malformation in face at 8-week stage. Nestin-Fgfr2 +/P253R mice exhibited increased dorsoventral height and rostrocaudal length on the caudal skull and brain at 8 weeks. Our study indicates that the abnormal skull morphology of AS is caused by the combined effects of the maldevelopment in calvarias, cranial base, and brain tissue. These findings further deepen our knowledge about the pathogenesis of the abnormal skull morphology of AS, and provide new clues for the further analyses of skull phenotypes and clinical management of AS.
International Nuclear Information System (INIS)
Samhoun, K.
1976-01-01
The amalgamation of 5f elements from Am to Fm has been studied by using 241 Am, 244 Cm, 249 Bk, 249 Cf, 252 Cf, 253 Es, 254 Es, 252 Fm and 255 Fm with two electrochemical methods, radiocoulometry and radiopolarography, perfectly adapted to investigate extremely diluted solutions when the concentration of electroactive species is as low as 10 -16 M. The theory of radiocoulometry has been developed in the general cases of reversible and irreversible electrode process. It has been used to interpret the experimental data on the kinetic curves of amalgamation, and to estimate the standard rate constant of the electrode process in complexing medium (citric). On the other hand the radiopolarographic method has been applied to study the mechanism of reduction at the dropping mercury electrode of cations M 3+ in aqueous medium to the metal M with formation of amalgam. The results are exploited into two directions: 1- Acquisition of some data concerning the oxidation-reduction properties of elements from Am to Fm. Therefore the standard electrode E 0 [M(III-0)] potentials for Bk, Cf and Es, and the standard electrode E 0 [M(II-0)] potential for Fm are estimated and the relative stability of each oxidation state (from II to VII) of 5f elements is discussed; 2- Acquisition of unknown thermodynamic data on transcalifornium elements. Correlations between 4f and 5f elements are precised and some divergences appear for the second half of 4f and 5f series (i.e. for 65 [fr
H I observations of the nearest starburst galaxy NGC 253 with the SKA precursor KAT-7
Lucero, D. M.; Carignan, C.; Elson, E. C.; Randriamampandry, T. H.; Jarrett, T. H.; Oosterloo, T. A.; Heald, G. H.
2015-07-01
We present H I observations of the Sculptor group starburst spiral galaxy NGC 253, obtained with the Karoo Array Telescope (KAT-7). KAT-7 is a pathfinder for the Square Kilometre Array precursor MeerKAT, under construction. The short baselines and low system temperature of the telescope make it very sensitive to large-scale, low-surface-brightness emission. The KAT-7 observations detected 33 per cent more flux than previous Very Large Array observations, mainly in the outer parts and in the halo for a total H I mass of 2.1 ± 0.1 × 109 M⊙. H I can be found at large distances perpendicular to the plane out to projected distances of ˜9-10 kpc away from the nucleus and ˜13-14 kpc at the edge of the disc. A novel technique, based on interactive profile fitting, was used to separate the main disc gas from the anomalous (halo) gas. The rotation curve (RC) derived for the H I disc confirms that it is declining in the outer parts, as seen in previous optical Fabry-Perot measurements. As for the anomalous component, its RC has a very shallow gradient in the inner parts and turns over at the same radius as the disc, kinematically lagging by 100 km s-1. The kinematics of the observed extra-planar gas is compatible with an outflow due to the central starburst and galactic fountains in the outer parts. However, the gas kinematics shows no evidence for inflow. Analysis of the near-IR WISE data, shows clearly that the star formation rate is compatible with the starburst nature of NGC 253.
El Límite a la Protección de las Tierras Indígenas de la Ley 19.253
Directory of Open Access Journals (Sweden)
Mario Salamanca Huenchullán
Full Text Available Este trabajo aborda el tema del límite a la protección de las tierras indígenas, que como una exigencia del interés nacional introduce en la legislación chilena la Ley Indígena 19.253, en su relación con la expropiación para la construcción de obras públicas, que en virtud de la utilidad pública se construyen sobre estas mismas tierras.
Qian, Yaping; Johnson, Judith A; Connor, Jessica A; Valencia, C Alexander; Barasa, Nathaniel; Schubert, Jeffery; Husami, Ammar; Kissell, Diane; Zhang, Ge; Weirauch, Matthew T; Filipovich, Alexandra H; Zhang, Kejian
2014-06-01
The mutations in UNC13D are responsible for familial hemophagocytic lymphohistiocytosis (FHL) type 3. A 253-kb inversion and two deep intronic mutations, c.118-308C > T and c.118-307G > A, in UNC13D were recently reported in European and Asian FHL3 patients. We sought to determine the prevalence of these three non-coding mutations in North American FHL patients and evaluate the significance of examining these new mutations in genetic testing. We performed DNA sequencing of UNC13D and targeted analysis of these three mutations in 1,709 North American patients with a suspected clinical diagnosis of hemophagocytic lymphohistiocytosis (HLH). The 253-kb inversion, intronic mutations c.118-308C > T and c.118-307G > A were found in 11, 15, and 4 patients, respectively, in which the genetic basis (bi-allelic mutations) explained 25 additional patients. Taken together with previously diagnosed FHL3 patients in our HLH patient registry, these three non-coding mutations were found in 31.6% (25/79) of the FHL3 patients. The 253-kb inversion, c.118-308C > T and c.118-307G > A accounted for 7.0%, 8.9%, and 1.3% of mutant alleles, respectively. Significantly, eight novel mutations in UNC13D are being reported in this study. To further evaluate the expression level of the newly reported intronic mutation c.118-307G > A, reverse transcription PCR and Western blot analysis revealed a significant reduction of both RNA and protein levels suggesting that the c.118-307G > A mutation affects transcription. These specified non-coding mutations were found in a significant number of North American patients and inclusion of them in mutation analysis will improve the molecular diagnosis of FHL3. © 2014 Wiley Periodicals, Inc.
Gene expression response of A253 human salivary cell line to radiation, Cis-Pt, and EGF
International Nuclear Information System (INIS)
Woloschak, G.; Paunesku, T.; Mittal, B.; Dyck, P.; Pauloski, B.; Rademaker, A.; Logemann, J.; Quigg, R.
2003-01-01
We are interested in long and short term effects of head and neck cancers treatment, and prior to the studies of patient samples, experiments were designed to observe treatment effects in cultured cells, and examine gene expression profiles from A253 human salivary cells (derived from a head and neck tumor) following exposure to gamma-rays, cisplatin (cis-Pt), and a combination of either with epidermal growth factor (EGF) treatment. A253 cells were treated by: 2 Gy or 10 Gy of γ-rays (Cs137 source, 77 cGy/min), Cis-Pt at 50 μ/mL, and EGF at 40 ng/mL. RNAs were processed and hybridized with Affymetrix Hu95A arrays according to the manufacturer's instructions. Data were scanned and analyzed and we found significant differences in the expression patterns of numerous genes were observed. Some of the more interesting genes are: Requeim [a protein required for apoptosis]; Cyclin D1 (prad1/bcl1) [a cyclin that can function as an oncogene]; FK506 Binding Protein [which may be competing with TGF-beta type I receptor for binding with FK506 thus acting against this powerful immunosuppressant]; Thioredoxin (TXN) [an oxidoreductase with multiple in vitro substrates, including ribonuclease, choriogonadotropins, coagulation factors, glucocorticoid receptor, and insulin]; Glutathione Peroxidase (GPX) [whose role in protection against oxidative stress was long ago well documented]; Aquaporin 3 (AQP3) [protein with a water-channel function that was confirmed by functional expression in Xenopus oocytes]; Eukaryotic Initiation Factor 1A (EIF1A) [a translation factor, proposed as a candidate gene for Turner syndrome]; and finally Insulin-like Growth Factor-Binding Protein 6 (IGFBP6) [an autocrine growth inhibitor shown to inhibit growth of HaCat cells and other keratinocyte cell lines
A Thorough View of the Nuclear Region of NGC 253: Combined Herschel, SOFIA, and APEX Data Set
Pérez-Beaupuits, J. P.; Güsten, R.; Harris, A.; Requena-Torres, M. A.; Menten, K. M.; Weiß, A.; Polehampton, E.; van der Wiel, M. H. D.
2018-06-01
We present a large set of spectral lines detected in the 40″ central region of the starburst galaxy NGC 253. Observations were obtained with the three instruments SPIRE, PACS, and HIFI on board the Herschel Space Observatory, upGREAT on board the SOFIA airborne observatory, and the ground-based Atacama Pathfinder EXperiment telescope. Combining the spectral and photometry products of SPIRE and PACS, we model the dust continuum spectral energy distribution (SED) and the most complete 12CO line SED reported so far toward the nuclear region of NGC 253. The properties and excitation of the molecular gas were derived from a three-component non-LTE radiative transfer model, using the SPIRE 13CO lines and ground-based observations of the lower-J 13CO and HCN lines, to constrain the model parameters. Three dust temperatures were identified from the continuum emission, and three components are needed to fit the full CO line SED. Only the third CO component (fitting mostly the HCN and PACS 12CO lines) is consistent with a shock-/mechanical-heating scenario. A hot core chemistry is also argued as a plausible scenario to explain the high-J 12CO lines detected with PACS. The effect of enhanced cosmic-ray ionization rates, however, cannot be ruled out and is expected to play a significant role in the diffuse and dense gas chemistry. This is supported by the detection of ionic species like OH+ and H2O+, as well as the enhanced fluxes of the OH lines with respect to those of H2O lines detected in both PACS and SPIRE spectra.
Apert Syndrome: Molecularly Confirmed C.758C>G (P.Pro253Arg) in FGFR2
Energy Technology Data Exchange (ETDEWEB)
Cha Gon, Lee, E-mail: leechagon@eulji.ac.kr [Department of Pediatrics, Eulji General Hospital, College of Medicine, Eulji University, 68 Hangeulbiseok-ro, Nowon-gu, Seoul 139-711 (Korea, Republic of)
2016-03-21
A 5-day-old girl was referred to our clinic for evaluation of congenital malformations. She was identified with a pathogenic mutation c.758C>G (p.Pro253Arg) in FGFR2 gene using targeted exome sequencing. The de novo mutation was confirmed with Sanger sequencing in the patient and her parents. She showed occipital plagiocephaly with frontal bossing (Figure A and B). Skull frontal and lateral radiography revealed fusion of most of the sutures except coronal suture, with convolutional markings (Figure D and E). She had complete cleft palate (Figure C). Her fused bilateral hands showed type II syndactyly with complete syndactyly between the ring and the little fingers (Figure F1-F3). Both toes were simple syndactyly with side-to-side fusion of skin (Figure G1-)
Apert Syndrome: Molecularly Confirmed C.758C>G (P.Pro253Arg) in FGFR2
International Nuclear Information System (INIS)
Cha Gon, Lee
2016-01-01
A 5-day-old girl was referred to our clinic for evaluation of congenital malformations. She was identified with a pathogenic mutation c.758C>G (p.Pro253Arg) in FGFR2 gene using targeted exome sequencing. The de novo mutation was confirmed with Sanger sequencing in the patient and her parents. She showed occipital plagiocephaly with frontal bossing (Figure A and B). Skull frontal and lateral radiography revealed fusion of most of the sutures except coronal suture, with convolutional markings (Figure D and E). She had complete cleft palate (Figure C). Her fused bilateral hands showed type II syndactyly with complete syndactyly between the ring and the little fingers (Figure F1-F3). Both toes were simple syndactyly with side-to-side fusion of skin (Figure G1-)
Tyunina, E. Yu.; Chekunova, M. D.
2017-05-01
The density, dynamic viscosity, and dielectric constant of propylene carbonate solutions with acetonitrile are measured over the composition of a mixed solvent at temperatures of 253.15, 273.15, 293.15, and 313.15 K. The molar volume, molar viscosity, and molar capacity of a mixture of propylene carbonate-acetonitrile and an excess amount of it are calculated. The effect the temperature and composition of the mixture have on the excess molar properties is discussed. A linear correlation is observed between the values of the molar fluidity, capacity, polarization, and molar volume of the studied system.
The new high-resolution IRMS MAT253 ULTRA at Utrecht University
Röckmann, Thomas; Hofmann, Magdalena; Paul, Dipayan; Popa, Elena; Adnew, Getachew
2017-04-01
In 2016, the new high-resolution, multi-collector isotope ratio mass spectrometer MAT253 ULTRA [1] was installed at Utrecht University. This instrument is designed to reach a mass resolving power of 20,000 to 40,000 (M/ΔM). The ion currents are detected with a variable multi-collector unit that allows to register up to 9 ion currents simultaneously with Faraday cups and ion counters. The width of the entrance slit can be varied between 5 and 250μm so that the instrument can be operated under low, medium and high mass resolution, and an optimum balance between resolution and sensitivity can be selected for the respective applications. The central field of application of the new IRMS at Utrecht University is the measurement of multiply substituted isotopologues (clumped isotopes) in atmospheric trace compounds (e.g. 13CDH3, 13C18O16O, 18O18O, 15N14N18O) [1-7]. It is known from thermodynamics that the zero point energy of a chemical bond usually decreases when multiple heavy isotopes clump together in a molecule, and this effect depends on temperature [7]. Therefore, the abundance of clumped isotopes can be used as temperature indicator under thermodynamical equilibrium conditions. However, in the atmosphere, many reactions are controlled kinetically. It has been shown recently for a few examples that negative clumping signatures (anti-clumping) can be produced under non-equilibrium conditions [3,4]. In addition, based on purely statistical reasons, anti-clumping signatures will be produced in any molecule that contains indistinguishable atoms, which originate from isotopically distinct reservoir [5,6]. Thus, the investigation of multiply substituted isotopologues is expected to generate novel isotope signatures that can complement conventional stable isotope analysis in atmospheric science. We will present data on the performance of the MAT 253 ULTRA instrument and first scientific applications to atmospheric research. 1. Eiler, J.M., et al., A high-resolution gas
International Nuclear Information System (INIS)
Schäfer, Michael; Richter, Markus; Span, Roland
2015-01-01
Highlights: • A new rotating-body viscometer for the low-pressure region was presented. • A viscosity dependent offset was compensated by calibrating the viscometer. • The viscosity of carbon dioxide was measured at low pressures. • Measurements were carried out from T = (253.15 to 473.15) K with p ≤ 1.2 MPa. • The relative expanded combined uncertainty (k = 2) was U r,c (η) = (0.20 to 0.41)%. - Abstract: The viscosity of carbon dioxide was measured over the temperature range T = (253.15 to 473.15) K with pressures up to 1.2 MPa utilizing a new rotating-body viscometer. The relative expanded combined uncertainty (k = 2) in viscosity (including uncertainties of temperature and pressure) was (0.20 to 0.41)%. The instrument was specifically designed for measurements at low gas densities and enables measurements of the dynamic viscosity at temperatures between T = 253.15 K and T = 473.15 K with pressures up to 2 MPa. For carbon dioxide, the fluid specific measuring range with regard to pressure was limited to 1.2 MPa due to the formation of disturbing vortices inside the measuring cell at higher pressures. The model function for the viscosity measurement was extended in such a way that the dynamic viscosity was measured relative to helium. Therefore, the influence of the geometry of the concentric cylindrical system inside the measuring cell became almost negligible. Moreover, a systematic offset resulting from a small but inevitable eccentricity of the cylindrical system was compensated for. The residual damping, usually measured in vacuum, was calibrated in the entire temperature range using viscosity values of helium, neon and argon calculated ab initio; at T = 298.15 K recommended reference values were used. A viscosity dependent offset of the measured viscosities, which was observed in previously published data, did not occur when using the calibrated residual damping. The new carbon dioxide results were compared to other experimental literature data
De Rocker, Nina; Vergult, Sarah; Koolen, David; Jacobs, Eva; Hoischen, Alexander; Zeesman, Susan; Bang, Birgitte; Béna, Frédérique; Bockaert, Nele; Bongers, Ernie M; de Ravel, Thomy; Devriendt, Koenraad; Giglio, Sabrina; Faivre, Laurence; Joss, Shelagh; Maas, Saskia; Marle, Nathalie; Novara, Francesca; Nowaczyk, Malgorzata J M; Peeters, Hilde; Polstra, Abeltje; Roelens, Filip; Rosenberg, Carla; Thevenon, Julien; Tümer, Zeynep; Vanhauwaert, Suzanne; Varvagiannis, Konstantinos; Willaert, Andy; Willemsen, Marjolein; Willems, Marjolaine; Zuffardi, Orsetta; Coucke, Paul; Speleman, Frank; Eichler, Evan E; Kleefstra, Tjitske; Menten, Björn
2015-06-01
Submicroscopic deletions of chromosome band 2p25.3 are associated with intellectual disability and/or central obesity. Although MYT1L is believed to be a critical gene responsible for intellectual disability, so far no unequivocal data have confirmed this hypothesis. In this study we evaluated a cohort of 22 patients (15 sporadic patients and two families) with a 2p25.3 aberration to further refine the clinical phenotype and to delineate the role of MYT1L in intellectual disability and obesity. In addition, myt1l spatiotemporal expression in zebrafish embryos was analyzed by quantitative polymerase chain reaction and whole-mount in situ hybridization. Complete MYT1L deletion, intragenic deletion, or duplication was observed in all sporadic patients, in addition to two patients with a de novo point mutation in MYT1L. The familial cases comprise a 6-Mb deletion in a father and his three children and a 5' MYT1L overlapping duplication in a father and his two children. Expression analysis in zebrafish embryos shows specific myt1l expression in the developing brain. Our data strongly strengthen the hypothesis that MYT1L is the causal gene for the observed syndromal intellectual disability. Moreover, because 17 patients present with obesity/overweight, haploinsufficiency of MYT1L might predispose to weight problems with childhood onset.Genet Med 17 6, 460-466.
DEFF Research Database (Denmark)
Wik, D. R.; Lehmer, B. D.; Hornschemeier, A. E.
2014-01-01
for the first time. As a follow up to our initial study of its nuclear region, we present the first results concerning the full galaxy from simultaneous NuSTAR, Chandra, and Very Long Baseline Array monitoring of the local starburst galaxy NGC 253. Above ~10 keV, nearly all the emission is concentrated within...... is detected at E > 40 keV. We report upper limits on diffuse inverse Compton emission for a range of spatial models. For the most extended morphologies considered, these hard X-ray constraints disfavor a dominant inverse Compton component to explain the γ-ray emission detected with Fermi and H.E.S.S. If NGC...
Directed evolution of the periodic table: probing the electronic structure of late actinides.
Marsh, M L; Albrecht-Schmitt, T E
2017-07-25
Recent investigations of the coordination chemistry and physical properties of berkelium (Z = 97) and californium (Z = 98) have revealed fundamental differences between post-curium elements and lighter members of the actinide series. This review highlights these developments and chronicles key findings and concepts from the last half-century that have helped usher in a new understanding of the evolution of electronic structure in the periodic table.
Li, Xiangzheng
2018-06-01
A counterexample is given to show that the product rule of the Caputo fractional derivatives does not hold except on a special point. The function-expansion method of separation variable proposed by Rui[Commun Nonlinear Sci Numer Simulat 47 (2017) 253-266] based on the product rule must be modified.
ALMA MULTI-LINE IMAGING OF THE NEARBY STARBURST NGC 253
Energy Technology Data Exchange (ETDEWEB)
Meier, David S. [New Mexico Institute of Mining and Technology, 801 Leroy Place, Socorro, NM 87801 (United States); Walter, Fabian; Zschaechner, Laura K. [Max-Planck Institut für Astronomie, Königstuhl 17, D-69117 Heidelberg (Germany); Bolatto, Alberto D.; Veilleux, Sylvain; Warren, Steven R. [Department of Astronomy and Joint Space-Science Institute, University of Maryland, College Park, MD 20742 (United States); Leroy, Adam K. [National Radio Astronomy Observatory, 520 Edgemont Road, Charlottesville, VA 22903 (United States); Ott, Jürgen [National Radio Astronomy Observatory, Pete V. Domenici Array Science Center, P.O. Box O, Socorro, NM 87801 (United States); Rosolowsky, Erik [Department of Physics, University of Alberta, Edmonton, AB T6G 2E1 (Canada); Weiß, Axel [Max Planck Institut für Radioastronomie, Auf dem Hügel 69, D-53121 Bonn (Germany); Zwaan, Martin A., E-mail: dmeier@nmt.edu [European Southern Observatory, Karl-Schwarzschild-Str. 2, D-85748 Garching bei München (Germany)
2015-03-01
We present spatially resolved (∼50 pc) imaging of molecular gas species in the central kiloparsec of the nearby starburst galaxy NGC 253, based on observations taken with the Atacama Large Millimeter/submillimeter Array. A total of 50 molecular lines are detected over a 13 GHz bandwidth imaged in the 3 mm band. Unambiguous identifications are assigned for 27 lines. Based on the measured high CO/C{sup 17}O isotopic line ratio (≳350), we show that {sup 12}CO(1-0) has moderate optical depths. A comparison of the HCN and HCO{sup +} with their {sup 13}C-substituted isotopologues shows that the HCN(1-0) and HCO{sup +}(1-0) lines have optical depths at least comparable to CO(1-0). H{sup 13}CN/H{sup 13}CO{sup +} (and H{sup 13}CN/HN{sup 13}C) line ratios provide tighter constraints on dense gas properties in this starburst. SiO has elevated abundances across the nucleus. HNCO has the most distinctive morphology of all the bright lines, with its global luminosity dominated by the outer parts of the central region. The dramatic variation seen in the HNCO/SiO line ratio suggests that some of the chemical signatures of shocked gas are being erased in the presence of dominating central radiation fields (traced by C{sub 2}H and CN). High density molecular gas tracers (including HCN, HCO{sup +}, and CN) are detected at the base of the molecular outflow. We also detect hydrogen β recombination lines that, like their α counterparts, show compact, centrally peaked morphologies, distinct from the molecular gas tracers. A number of sulfur based species are mapped (CS, SO, NS, C{sub 2}S, H{sub 2}CS, and CH{sub 3}SH) and have morphologies similar to SiO.
Henry's Law vaporization studies and thermodynamics of einsteinium-253 metal dissolved in ytterbium
International Nuclear Information System (INIS)
Kleinschmidt, P.D.; Ward, J.W.; Matlack, G.M.; Haire, R.G.
1984-01-01
The cohesive energy of metallic einsteinium determines whether einsteinium is a trivalent or divalent metal. The enthalpy of sublimation, a measure of the cohesive energy, is calculated from the partial pressures of einsteinium over an alloy. The partial pressure of 253 Es has been measured over the range 470--870 K, using combined target and mass spectrometric Knudsen effusion techniques. An alloy was prepared with einsteinium dissolved in a ytterbium solvent to produce a very dilute solution. Partial pressure measurements on the alloy were amenable to the experimental technique and a data analysis using a Henry's law treatment of the data. Vapor pressure data are combined with an estimated crystal entropy S 0 298 and ΔC 0 /sub p/ for ytterbium, to produce enthalpy, entropy, and free energy functions from 298 to 1300 K. The vapor pressure of einsteinium in a dilute einsteinium--ytterbium alloy is described by the equation log P(atm) = -(6815 +- 216)/T+2.576 +- 0.337, from which we calculate for the enthalpy of sublimation of pure einsteinium ΔH 0 298 (second law) = 31.76 kcal/mol. The value of the enthalpy of sublimation is consistent with the conclusion that Es is a divalent metal
Singh, A. K.; Singh, R. K.; Srivastava, M. K.; Mehrotra, B. J.; Murari, V.; Sharma, S. K., , Dr; Mandal, T. K., , Dr; Singh, R. S.; Banerjee, T.; Tiwari, S.
2017-12-01
All the anthropogenic activity, including various festivals, affect the environment. Impact of fireworks done during various festival are well documented in literature. In India, the festival of colors, Holi, is celebrated during spring season. During this festival, wood-log and other natural biomass are burned on the eve of the festival (Holika). Although the festival falls during a season with clear sky, that possibly can allow the pollutants to mix in the free troposphere, but observations made during Holika-2016 showed 2-3-times soot (or Black Carbon, BC) enhancement in nighttimes due to Holika, than the background levels. This observations motivated us to better understand the optical impact of Holika-2017. For this purpose, we planned first-time intensive-observation during Holika-2017 (March 13, 2017). Estimated 450 thousands kgs of wood and biomass is burnt during Holika-2017 in 2250 (± 5%) units of Holika at around 10 pm local time of March 12th, in the vicinity of Varanasi city (25.3N, 83.0E). Intensive observations are being done from 5th to 18th March, 2017. Extensive optical analyses have been done to understand the aerosol radiative impact of Holika burning on environment. The observed AOD was 0.336, 0.392 and 0.47 and daily average BC mass was 7137, 9942 and 8950 ng/m3 for Pre-Holika, Holika and Post-Holika. Top of the atmosphere, at the surface and in atmosphere are 2.53, -40.48 and 43.00 W/m2 for Pre-Holika, 6.45, -53.75 and 60.21 W/m2 for Holika and 8.91, -65.75 and 74.66 W/m2 for Post-Holika burning. Highest BC mass was observed around 0200 hrs on 13th March, just after few hours of Holika-2017. Preliminary results are shown in figure, depicting surface/ top-of-atmosphere/ atmospheric radiative forcing along with changes in heating rates from pre-holika to holika and post-holika days. Heating rates have enhanced 2-times for post-Holika than the background levels.
International Nuclear Information System (INIS)
Bermudo, Raquel; Martínez-A, Carlos; Ortiz, Ángel R; Fernández, Pedro L; Thomson, Timothy M; Abia, David; Ferrer, Berta; Nayach, Iracema; Benguria, Alberto; Zaballos, Ángel; Rey, Javier del; Miró, Rosa; Campo, Elías
2008-01-01
Transcriptional profiling of prostate cancer (PC) has unveiled new markers of neoplasia and allowed insights into mechanisms underlying this disease. Genomewide analyses have also identified new chromosomal abnormalities associated with PC. The combination of both classes of data for the same sample cohort might provide better criteria for identifying relevant factors involved in neoplasia. Here we describe transcriptional signatures identifying distinct normal and tumoral prostate tissue compartments, and the inference and demonstration of a new, highly recurrent copy number gain on chromosome 17q25.3. We have applied transcriptional profiling to tumoral and non-tumoral prostate samples with relatively homogeneous epithelial representations as well as pure stromal tissue from peripheral prostate and cultured cell lines, followed by quantitative RT-PCR validations and immunohistochemical analysis. In addition, we have performed in silico colocalization analysis of co-regulated genes and validation by fluorescent in situ hybridization (FISH). The transcriptomic analysis has allowed us to identify signatures corresponding to non-tumoral luminal and tumoral epithelium, basal epithelial cells, and prostate stromal tissue. In addition, in silico analysis of co-regulated expression of physically linked genes has allowed us to predict the occurrence of a copy number gain at chromosomal region 17q25.3. This computational inference was validated by fluorescent in situ hybridization, which showed gains in this region in over 65% of primary and metastatic tumoral samples. Our approach permits to directly link gene copy number variations with transcript co-regulation in association with neoplastic states. Therefore, transcriptomic studies of carefully selected samples can unveil new diagnostic markers and transcriptional signatures highly specific of PC, and lead to the discovery of novel genomic abnormalities that may provide additional insights into the causes and mechanisms
International Nuclear Information System (INIS)
Abdo, A. A.; Ackermann, M.; Ajello, M.; Bechtol, K.; Berenji, B.; Bloom, E. D.; Borgland, A. W.; Atwood, W. B.; Axelsson, M.; Baldini, L.; Bellazzini, R.; Bregeon, J.; Brez, A.; Ballet, J.; Barbiellini, G.; Bastieri, D.; Bonamente, E.; Brigida, M.; Bruel, P.; Burnett, T. H.
2010-01-01
We report the detection of high-energy γ-ray emission from two starburst galaxies using data obtained with the Large Area Telescope on board the Fermi Gamma-ray Space Telescope. Steady point-like emission above 200 MeV has been detected at significance levels of 6.8σ and 4.8σ, respectively, from sources positionally coincident with locations of the starburst galaxies M82 and NGC 253. The total fluxes of the sources are consistent with γ-ray emission originating from the interaction of cosmic rays with local interstellar gas and radiation fields and constitute evidence for a link between massive star formation and γ-ray emission in star-forming galaxies.
Safety analysis report for packaging: neutron shipping cask, model 0.5T
International Nuclear Information System (INIS)
Peterson, R.T.
1976-01-01
The Safety Analysis Report for Packaging demonstrates that the neutron shipping cask can safely transport, in solid or powder form, all isotopes of uranium, plutonium, americium, curium, berkelium, californium, einsteinium, and fermium. The shipping cask and its contents are described. It also evaluates transport conditions, structural parameters (e.g., load resistance, pressure and impact effects, lifting and tiedown devices), and shielding. Finally, it discusses compliance with Chapter 0529 of the Energy Research and Development Administration Manual
VizieR Online Data Catalog: NGC253 near-infrared H2 emission (Rosenberg+,
Rosenberg, M. J. F.; van der Werf, P. P.; Israel, F. P.
2012-11-01
All observations were made with SINFONI at the ESO VLT. We observed in the H, and K bands using a spatial pixel scale of 0.25" corresponding to a field of view of 8" by 8" per frame and a spectral resolution of 2000, 3000 and 4000 respectively, which corresponds to a velocity resolution of 149.8, 99.9 and 74.9km/s. All science observations were taken in the ABA'nodding mode (300s of object, 300s of sky, 300s of object), where A' is slightly offset from A. The object exposures are aligned and averaged during the reconstruction of the data cube. The observations of NGC 253 were made in visitor mode on August 28th, 2005. In order to capture the full extent of the H2 emission, consecutive frames were taken in the K band moving further away from the center, along the disk until H2 was no longer detected. This resulted in 6 separate pointings. Since there are also H2 transitions in the H band, a similar strategy was used, resulting in 4 separate pointings. We used the standard reduction techniques of the SINFONI pipeline on all observations, including corrections for flat field, dark current, nonlinearity of pixels, distortion, and wavelength calibration. We obtained the flux calibration and atmospheric corrections from observations of a standard star, namely HR 2058 in the H band and HD 20001 in the K band (2 data files).
You, Ao; Li, Yu; Zhang, Ze-Min; Zou, Xun-Zhong; Gu, Jin-Zhong; Kirillov, Alexander M.; Chen, Jin-Wei; Chen, Yun-Bo
2017-10-01
Biphenyl-2,5,3‧-tricarboxylic acid (H3L) was selected as an unexplored tricarboxylate building block and applied for the hydrothermal synthesis of three novel coordination compounds, namely a 0D tetramer [Co4(HL)2(μ3-HL)2(phen)6(H2O)2]·3H2O (1) and two 3D metal-organic frameworks (MOFs) [Cd3(μ5-L)(μ6-L)(py)(μ-H2O)2(H2O)]n·H2O (2) and [Zn3(μ4-L)2(2,2‧-bpy)(μ-4,4‧-bpy)]n·2H2O (3). These products were easily generated in aqueous medium from the corresponding metal(II) chlorides, H3L, and various N-donor ancillary ligands, selected from 1,10-phenanthroline (phen), pyridine (py), 2,2‧-bipyridine (2,2‧-bpy), and 4,4‧-bipyridine (4,4‧-bpy). Compounds 1-3 were isolated as stable crystalline solids and were fully characterized by IR and UV-vis spectroscopy, elemental, thermogravimetric (TGA), powder (PXRD) and single-crystal X-ray diffraction analyses. Compound 1 possesses a discrete tetracobalt(II) structure, which is extended into a 3D H-bonded network with the pcu topology. In contrast, MOF 2 discloses a very complex trinodal 4,5,12-connected net with an undocumented topology, while MOF 3 features the nce/I topological framework. The magnetic (for 1) and luminescence (for 2 and 3) properties were also studied and discussed. The present study thus widens a still very limited family of metal-organic and supramolecular frameworks driven by flexible biphenyl-2,5,3‧-tricarboxylate building blocks.
Gopalswamy, N.; Akiyama, S.; Yashiro, S.; Michalek, G.; Lepping, R. P.
2009-01-01
One of the figures (Fig. 4) in "Solar sources and geospace consequences of interplanetary magnetic Clouds observed during solar cycle 23 -- Paper 1" by Gopalswamy et al. (2008, JASTP, Vol. 70, Issues 2-4, February 2008, pp. 245-253) is incorrect because of a software error in t he routine that was used to make the plot. The source positions of various magnetic cloud (MC) types are therefore not plotted correctly.
On the paleoenvironmental potential of 253 newly discovered pine stumps from Zurich, Switzerland
Reinig, Frederick; Nievergelt, Daniel; Esper, Jan; Friedrich, Michael; Helle, Gerhard; Hellmann, Lena; Kromer, Bernd; Morganti, Sandro; Pauly, Maren; Sookdeo, Adam; Tegel, Willy; Treydte, Kerstin; Wacker, Lukas; Büntgen, Ulf
2017-04-01
The transition from the last Ice Age to the early Holocene 15'000-10'000 BP represents a close natural analog to the ongoing and predicted rates of anthropogenic climate change. A reduced quality and quantity of high-resolution proxy archives during this period, however, limits our understanding of the magnitude and pace of Late Glacial (LG) environmental variability. Here, we present the world's best preserved, most replicated and oldest forest remains: A total of 253 subfossil pine stumps were recently discovered in Zurich. The combined approach of tree-ring and radiocarbon (14C) measurements results in an absolutely dated Preboreal Swiss tree-ring width chronology and eight floating chronologies. With tree ages ranging between 41 and 506 years, often including pith and bark, and a mean segment length of 163 years, this exceptional find is distributed over nearly 2'000 years between the Allerød and the Preboreal. Together with 200 previously collected LG pines from the greater Zurich region, this study sets a benchmark in terms of sample replication and dating precision for stable more dynamic climatic periods such as the Laacher See eruption, the Older and Younger Dryas. The paleoenvironmental significance would even increase when annually resolved 14C-measurements help fixing a major, Northern Hemispheric gap in the absolutely dated dendro time series during the Younger Dryas. While overcoming this interlude, our results further emphasize the importance of interdisciplinary research on these striking LG climatic shifts to better understand and assess their ecological and environmental impact.
Directory of Open Access Journals (Sweden)
Tibor Valuch
2017-09-01
Full Text Available The dates next to the names of two interviewees, Imre Lázár and Zoltán Mervó, were shown incorrectly. The original article can be found via the DOI: http://dox.doi.org/10.5195/ahea.2016.253
Safety analysis report for packaging: neutron shipping cask, model 4T
International Nuclear Information System (INIS)
Peterson, R.T.
1977-01-01
This Safety Analysis Report for Packaging demonstrates that the neutron shipping cask can safely transport, in solid or powder form, all isotopes of uranium, plutonium, americium, curium, berkelium, californium, einsteinium, and fermium. The cask and its contents are described. It also evaluates transport conditions, structural parameters (e.g., load resistance, pressure and impact effects, lifting and tiedown devices), and shielding. Finally, it discusses compliance with Chapter 0529 of the Energy Research and Development Administration Manual, Safety Standards for the Packaging of Fissile and Other Radioactive Materials
Chelation and stabilization of berkelium in oxidation state +IV
Czech Academy of Sciences Publication Activity Database
Deblonde, G. J.-P.; Sturzbecher-Hoehne, M.; Rupert, P. B.; An, D. D.; Illy, M.-C.; Ralston, C. Y.; Brabec, Jiří; de Jong, W. A.; Strong, R. K.; Abergel, R. J.
2017-01-01
Roč. 9, č. 9 (2017), s. 843-849 ISSN 1755-4330 Institutional support: RVO:61388955 Keywords : bioorganic chemistry * chemical bonding * mass spectrometry Subject RIV: CF - Physical ; Theoretical Chemistry OBOR OECD: Physical chemistry Impact factor: 25.870, year: 2016
DEFF Research Database (Denmark)
Nilsson, Elna Johanna Kristina; Johnson, Matthew Stanley; Nielsen, Ole John
2009-01-01
Relative rate techniques were used to study the title reactions in 930–1200 mbar of N2 diluent. The reaction rate coefficients measured in the present work are summarized by the expressions k(Cl+CH2F2) = 1.19×10-17 T 2 exp(-1023/T ) cm3 molecule-1 s-1 (253– 553 K), k(Cl+CH3CCl3) = 2.41×10-12 exp(...
International Nuclear Information System (INIS)
Martinot, L.; Fuger, J.
1985-01-01
The oxidation behavior of the actinides is explained on the basis of their electronic structure. The actinide elements, actinium, thorium, protactinium, uranium, neptunium, plutonium, americium, curium, berkelium, californium, einsteinium, fermium, mendelevium, nobelium, and laurencium are included. For all except the last three elements, the points of discussion are oxidation states, Gibbs energies and potentials, and potential diagram for the element in acid solution; and thermodynamic properties of these same elements are tabulated. References are cited following discussion of each element with a total of 97 references being cited. 13 tables
Energy Technology Data Exchange (ETDEWEB)
Velazquez F, G.L.; Martinez, M.; Ruiz, A. [Universidad Nacional Experimental Politecnica (UNEXPO) - Vicerrectorado de Puerto Ordaz, Centro de Estudios de Corrosion. Puerto Ordaz. venezuela (Venezuela)
1998-12-31
It has been detected that the addition of small amounts (<1%) of the so called `reactive elements` such as Cerium to Fe-Cr alloys that was utilized in oxidating environment at high temperatures improving its resistance to oxidation under isothermal and cyclic conditions. In this work, it was evaluated the behavior under cyclic oxidation conditions for an austenitic stainless steel at chromium-nickel (253MA) with cerium addition, and comparing it with the AISI 310S austenitic stainless steel. The cyclic oxidation essays consist of five cycles by 24 hours each one, following of a cooling in air until ambient temperature from the temperatures of 850, 900 and 950 Centigrade, registering the gain mass of the specimen at end of each cycle. In order to this were prepared samples with dimensions of 20 mm. x 10 mm. x 1 mm. Later to the oxidation essays was evaluated the morphology of the corrosion products layer by scanning electron microscopy. The present phases were identified by X-ray diffraction and by chemical microanalysis by Dispersive energy (EDAX). The results obtained show that the steel with cerium addition, presents a higher adherence and resistance to the spalling noting that the cerium promotes the casting anchor of the oxides layer to matrix and by reducing the grain size of the layer improving its plasticity. Additionally the cerium promotes the preferential oxidation of the forming elements of protective layers like the chromium. (Author)
Joint Institute for Nuclear Research Data Analysis Guide - Berkelium Edition
International Nuclear Information System (INIS)
Henderson, R.A.
2009-01-01
This is a data analysis guide to the JINR system developed by Roger Henderson. It is intended as a complete guide to the data format and the calibration parameters utilized for the analysis of the data. This guide will provide the basic structure of the data files, the description of the individual data items, and the basic equations developed for the calculation of the results. Currently (7/17/2009), calculation of the calibration parameters is not a covered topic. It is intended that this will be covered in a future update
International Nuclear Information System (INIS)
Haynes, C.E.
1976-01-01
The Transuranium Research Laboratory (TRL) is the central facility at Oak Ridge National Laboratory (ORNL) for chemical and physical research involving transuranium elements. Transuranium Research Laboratory investigations are about equally divided between studies of inorganic and structural chemistry of the heavy elements and nuclear structure and properties of their isotopes. Elements studied include neptunium, plutonium, americium, curium, berkelium, californium, and einsteinium, each in microgram-to-gram quantities depending upon availability and experimental requirements. This paper describes an eight-step safety procedure followed in planning and approving individual research projects. This procedure should provide an optimum margin of safety and should permit the accomplishment of successful research
Composition containing transuranic elements for use in the homeopathic treatment of aids
International Nuclear Information System (INIS)
Lustig, D.
1996-01-01
A homeopathic remedy consisting of a composition containing one or more transuranic elements, particularly plutonium, for preventing and treating acquired immunodeficiency syndrome (AIDS) in humans, as well as seropositivity for human immunodeficiency virus (HIV). Said composition is characterized in that it uses any chemical or isotopic form of one or more transuranic elements (neptunium, plutonium, americium, curium, berkelium, californium or einsteinium), particularly plutonium, said form being diluted and dynamized according to conventional homeopathic methods, particularly the so-called Hahnemann and Korsakov methods, and provided preferably but not exclusively in the form of lactose and/or saccharose globules or granules impregnated with the active principle of said composition. (author)
Energy Technology Data Exchange (ETDEWEB)
Seaborg, Glenn T.; Street Jr., Kenneth; Thompson, Stanley G.; Ghiorso, Albert
1976-07-01
This volume includes the talks given on January 20, 1975, at a symposium in Berkeley on the occasion of the celebration of the 25th anniversary of the discovery of berkelium and californium. Talks were given at this symposium by the four people involved in the discovery of these elements and by a number of people who have made significant contributions in the intervening years to the investigation of their nuclear and chemical properties. The papers are being published here, without editing, in the form in which they were submitted by the authors in the months following the anniversary symposium, and they reflect rather faithfully the remarks made on that occasion.
Energy Technology Data Exchange (ETDEWEB)
Albrecht-Schmitt, Thomas
2012-03-01
This grant supported the exploratory synthesis of new actinide materials with all of the actinides from thorium to californium with the exceptions of protactinium and berkelium. We developed detailed structure-property relationships that allowed for the identification of novel materials with selective ion-exchange, selective oxidation, and long-range magnetic ordering. We found novel bonding motifs and identified periodic trends across the actinide series. We identified structural building units that would lead to desired structural features and novel topologies. We also characterized many different spectroscopic trends across the actinide series. The grant support the preparation of approximately 1200 new compounds all of which were structurally characterized.
Study of cyclic oxidation for stainless steels AISI 309 T 253 M A, with low additions of cerium
International Nuclear Information System (INIS)
Velazquez F, G.L.; Martinez, M.; Ruiz, A.
1998-01-01
It has been detected that the addition of small amounts (<1%) of the so called 'reactive elements' such as Cerium to Fe-Cr alloys that was utilized in oxidating environment at high temperatures improving its resistance to oxidation under isothermal and cyclic conditions. In this work, it was evaluated the behavior under cyclic oxidation conditions for an austenitic stainless steel at chromium-nickel (253MA) with cerium addition, and comparing it with the AISI 310S austenitic stainless steel. The cyclic oxidation essays consist of five cycles by 24 hours each one, following of a cooling in air until ambient temperature from the temperatures of 850, 900 and 950 Centigrade, registering the gain mass of the specimen at end of each cycle. In order to this were prepared samples with dimensions of 20 mm. x 10 mm. x 1 mm. Later to the oxidation essays was evaluated the morphology of the corrosion products layer by scanning electron microscopy. The present phases were identified by X-ray diffraction and by chemical microanalysis by Dispersive energy (EDAX). The results obtained show that the steel with cerium addition, presents a higher adherence and resistance to the spalling noting that the cerium promotes the casting anchor of the oxides layer to matrix and by reducing the grain size of the layer improving its plasticity. Additionally the cerium promotes the preferential oxidation of the forming elements of protective layers like the chromium. (Author)
Cervero-Aragó, Sílvia; Sommer, Regina; Araujo, Rosa M
2014-12-15
Water systems are the primary reservoir for Legionella spp., where the bacteria live in association with other microorganisms, such as free-living amoebae. A wide range of disinfection treatments have been studied to control and prevent Legionella colonization but few of them were performed considering its relation with protozoa. In this study, the effectiveness of UV irradiation (253.7 nm) using low-pressure lamps was investigated as a disinfection method for Legionella and amoebae under controlled laboratory conditions. UV treatments were applied to 5 strains of Legionella spp., 4 strains of free-living amoeba of the genera Acanthamoeba and Vermamoeba, treating separately trophozoites and cysts, and to two different co-cultures of Legionella pneumophila with the Acanthamoeba strains. No significant differences in the UV inactivation behavior were observed among Legionella strains tested which were 3 logs reduced for fluences around 45 J/m(2). UV irradiation was less effective against free-living amoebae; which in some cases required up to 990 J/m(2) to obtain the same population reduction. UV treatment was more effective against trophozoites compared to cysts; moreover, inactivation patterns were clearly different between the genus Acanthamoeba and Vermamoeba. For the first time data about Vermamoeba vermiformis UV inactivation has been reported in a study. Finally, the results showed that the association of L. pneumophila with free-living amoebae decreases the effectiveness of UV irradiation against the bacteria in a range of 1.5-2 fold. That fact demonstrates that the relations established between different microorganisms in the water systems can modify the effectiveness of the UV treatments applied. Copyright © 2014 Elsevier Ltd. All rights reserved.
Kariminejad, Ariana; Nafissi, Shahriar; Nilipoor, Yalda; Tavasoli, Alireza; Van Veldhoven, Paul P; Bonnard, Carine; Ng, Yeng Ting; Majoie, Charles B; Reversade, Bruno; Hennekam, Raoul C
2015-11-01
We report on a sister and two brothers born to healthy Iranian parents with mild intellectual disability, progressive muscle weakness, and characteristic facies. including highly arched eyebrows, down-slanting palpebral fissures, prominent nasal bridge, prominent nose, columella extending below alae nasi, narrow mouth, narrow palate, and dental caries, and in one of them an inability to abduct the left eye. Electrophysiological studies showed signs of myopathy, and muscle biopsies demonstrated only nonspecific signs. Brain MRIs in two of the sibs showed leukencephalopathy with delayed myelination, frontal and parietal hyperintensities, and hippocampal atrophy in one. We have been unable to find a description of this association of features in literature. Based on the occurrence in siblings, no significant difference in phenotype between the brothers and sister, absence of manifestations in parents, and a likely consanguinity between parents we performed a homozygosity mapping. A single identical-by-descent bloc encompassing 57 genes located at 3p24.3-p25.3 was found to segregate within the family with this phenotype. © 2015 Wiley Periodicals, Inc. © 2015 Wiley Periodicals, Inc.
Mundhofir, Farmaditya E P; Sistermans, Erik A; Faradz, Sultana M H; Hamel, Ben C J
2013-03-01
Apert syndrome (AS) is a rare autosomal dominant disorder characterised by craniosynostosis and limb malformations, and is associated with congenital heart disease and other systemic malformations, including intellectual disability. We report two Indonesian patients with AS, in whom molecular analysis detected p.Ser252Trp (c.755C>G) and p.Pro253Arg (c.758C>G) mutations in the fibroblast growth factor receptor 2 (FGFR2) gene, respectively. Although the syndrome has been frequently described, this is the first clinical report of AS confirmed by molecular analysis in Indonesia. The difference in severity of clinical features in the two patients may be consistent with a genotype-phenotype correlation of the FGFR2mutation. The management of individuals with AS is best achieved within a multidisciplinary setting. However, in most developing countries, early intervention may be delayed due to late diagnosis, a lack of facilities and financial constraints. This report underpins the benefits of early diagnosis for AS management.
SPECTRAL ANALYSIS AND INTERPRETATION OF THE {gamma}-RAY EMISSION FROM THE STARBURST GALAXY NGC 253
Energy Technology Data Exchange (ETDEWEB)
Abramowski, A. [Institut fuer Experimentalphysik, Universitaet Hamburg, Luruper Chaussee 149, D-22761 Hamburg (Germany); Acero, F. [Laboratoire Univers et Particules de Montpellier, Universite Montpellier 2, CNRS/IN2P3, CC 72, Place Eugene Bataillon, F-34095 Montpellier Cedex 5 (France); Aharonian, F.; Bernloehr, K.; Bochow, A. [Max-Planck-Institut fuer Kernphysik, P.O. Box 103980, D-69029 Heidelberg (Germany); Akhperjanian, A. G. [National Academy of Sciences of the Republic of Armenia, Yerevan (Armenia); Anton, G.; Balzer, A.; Brucker, J. [Physikalisches Institut, Universitaet Erlangen-Nuernberg, Erwin-Rommel-Str. 1, D-91058 Erlangen (Germany); Barnacka, A. [Nicolaus Copernicus Astronomical Center, ul. Bartycka 18, 00-716 Warsaw (Poland); Becherini, Y. [APC, AstroParticule et Cosmologie, Universite Paris Diderot, CNRS/IN2P3, CEA/lrfu, Observatoire de Paris, Sorbonne Paris Cite, 10, rue Alice Domon et Leonie Duquet, F-75205 Paris Cedex 13 (France); Becker, J. [Institut fuer Theoretische Physik, Lehrstuhl IV: Weltraum und Astrophysik, Ruhr-Universitaet Bochum, D-44780 Bochum (Germany); Birsin, E. [Institut fuer Physik, Humboldt-Universitaet zu Berlin, Newtonstr. 15, D-12489 Berlin (Germany); Biteau, J.; Brun, F. [Laboratoire Leprince-Ringuet, Ecole Polytechnique, CNRS/IN2P3, F-91128 Palaiseau (France); Boisson, C. [LUTH, Observatoire de Paris, CNRS, Universite Paris Diderot, 5 Place Jules Janssen, F-92190 Meudon (France); Bolmont, J. [LPNHE, Universite Pierre et Marie Curie Paris 6, Universite Denis Diderot Paris 7, CNRS/IN2P3, 4 Place Jussieu, F-75252, Paris Cedex 5 (France); Bordas, P. [Institut fuer Astronomie und Astrophysik, Universitaet Tuebingen, Sand 1, D-72076 Tuebingen (Germany); Brun, P. [CEA Saclay, DSM/IRFU, F-91191 Gif-Sur-Yvette Cedex (France); Bulik, T., E-mail: stefan.ohm@le.ac.uk [Astronomical Observatory, The University of Warsaw, Al. Ujazdowskie 4, 00-478 Warsaw (Poland); Collaboration: H.E.S.S. Collaboration; and others
2012-10-01
Very high energy (VHE; E {>=} 100 GeV) and high-energy (HE; 100 MeV {<=} E {<=} 100 GeV) data from {gamma}-ray observations performed with the H.E.S.S. telescope array and the Fermi-LAT instrument, respectively, are analyzed in order to investigate the non-thermal processes in the starburst galaxy NGC 253. The VHE {gamma}-ray data can be described by a power law in energy with differential photon index {Gamma} = 2.14 {+-} 0.18{sub stat} {+-} 0.30{sub sys} and differential flux normalization at 1 TeV of F{sub 0} = (9.6 {+-} 1.5{sub stat}(+ 5.7, -2.9){sub sys}) Multiplication-Sign 10{sup -14} TeV{sup -1} cm{sup -2} s{sup -1}. A power-law fit to the differential HE {gamma}-ray spectrum reveals a photon index of {Gamma} 2.24 {+-} 0.14{sub stat} {+-} 0.03{sub sys} and an integral flux between 200 MeV and 200 GeV of F(0.2-200 GeV) = (4.9 {+-} 1.0{sub stat} {+-} 0.3{sub sys}) Multiplication-Sign 10{sup -9} cm{sup -2} s{sup -1}. No evidence for a spectral break or turnover is found over the dynamic range of both the LAT instrument and the H.E.S.S. experiment: a combined fit of a power law to the HE and VHE {gamma}-ray data results in a differential photon index {Gamma} = 2.34 {+-} 0.03 with a p-value of 30%. The {gamma}-ray observations indicate that at least about 20% of the energy of the cosmic rays (CRs) capable of producing hadronic interactions is channeled into pion production. The smooth alignment between the spectra in the HE and VHE {gamma}-ray domain suggests that the same transport processes dominate in the entire energy range. Advection is most likely responsible for charged particle removal from the starburst nucleus from GeV to multiple TeV energies. In a hadronic scenario for the {gamma}-ray production, the single overall power-law spectrum observed would therefore correspond to the mean energy spectrum produced by the ensemble of CR sources in the starburst region.
International Nuclear Information System (INIS)
Young, J.P.; Haire, R.G.; Peterson, J.R.; Ensor, D.D.; Fellows, R.L.
1980-01-01
Spectrophotometric and x-ray powder diffraction methods have been applied to a study of the ingrowth of californium-249 by β - decay of berkelium-249 in crystalline 249 BkBr 3 . It was found that the Cf daughter grows in with the same oxidation state and crystal structure as the parent. Thus, six-coordinate BkBr 3 (AlCl 3 -type monoclinic structure) generates six-coordinate CfBr 3 , and eight-coordinate BkBr 3 (PuBr 3 -type orthorhombic structure) generates eight-coordinate CfBr 3 , a previously unknown form of CfBr 3 . It was also found that the daughter Cf(III) in the BkBr 3 parent compound can be reduced to Cf(II) by treatment with H 2 , as it can in pure CfBr 3 . 5 figures
Nuclear fission and the transuranium elements
International Nuclear Information System (INIS)
Seaborg, G.T.
1989-02-01
Many of the transuranium elements are produced and isolated in large quantities through the use of neutrons furnished by nuclear fission reactions: plutonium (atomic number 94) in ton quantities; neptunium (93), americium (95), and curium (96) in kilogram quantities; berkelium (97) in 100 milligram quantities; californium (98) in gram quantities; and einsteinium (99) in milligram quantities. Transuranium isotopes have found many practical applications---as nuclear fuel for the large-scale generation of electricity, as compact, long-lived power sources for use in space exploration, as means for diagnosis and treatment in the medical area, and as tools in numerous industrial processes. Of particular interest is the unusual chemistry and impact of these heaviest elements on the periodic table. This account will feature these aspects. 9 refs., 5 figs
Nuclear fission and the transuranium elements
Energy Technology Data Exchange (ETDEWEB)
Seaborg, G.T.
1989-02-01
Many of the transuranium elements are produced and isolated in large quantities through the use of neutrons furnished by nuclear fission reactions: plutonium (atomic number 94) in ton quantities; neptunium (93), americium (95), and curium (96) in kilogram quantities; berkelium (97) in 100 milligram quantities; californium (98) in gram quantities; and einsteinium (99) in milligram quantities. Transuranium isotopes have found many practical applications---as nuclear fuel for the large-scale generation of electricity, as compact, long-lived power sources for use in space exploration, as means for diagnosis and treatment in the medical area, and as tools in numerous industrial processes. Of particular interest is the unusual chemistry and impact of these heaviest elements on the periodic table. This account will feature these aspects. 9 refs., 5 figs.
Directory of Open Access Journals (Sweden)
Elizabeth De Fransceco Daher
2014-01-01
Full Text Available Introduction: Acute kidney injury (AKI is a frequent and potentially fatal complication in infectious diseases. The aim of this study was to investigate the clinical aspects of AKI associated with infectious diseases and the factors associated with mortality. Methods: This retrospective study was conducted in patients with AKI who were admitted to the intensive care unit (ICU of a tertiary infectious diseases hospital from January 2003 to January 2012. The major underlying diseases and clinical and laboratory findings were evaluated. Results: A total of 253 cases were included. The mean age was 46±16 years, and 72% of the patients were male. The main diseases were human immunodeficiency virus (HIV infection, HIV/acquired immunodeficiency syndrome (AIDS (30%, tuberculosis (12%, leptospirosis (11% and dengue (4%. Dialysis was performed in 70 cases (27.6%. The patients were classified as risk (4.4%, injury (63.6% or failure (32%. The time between AKI diagnosis and dialysis was 3.6±4.7 days. Oliguria was observed in 112 cases (45.7%. The Acute Physiology and Chronic Health Evaluation (APACHE II scores were higher in patients with HIV/AIDS (57±20, p-value=0.01 and dengue (68±11, p-value=0.01. Death occurred in 159 cases (62.8%. Mortality was higher in patients with HIV/AIDS (76.6%, p-value=0.02. A multivariate analysis identified the following independent risk factors for death: oliguria, metabolic acidosis, sepsis, hypovolemia, the need for vasoactive drugs, the need for mechanical ventilation and the APACHE II score. Conclusions: AKI is a common complication in infectious diseases, with high mortality. Mortality was higher in patients with HIV/AIDS, most likely due to the severity of immunosuppression and opportunistic diseases.
Energy Technology Data Exchange (ETDEWEB)
Yang, Yang; Schneider, J.; Dueber, C.; Pitton, M.B. [University Medical Center of the Johannes Gutenberg University Mainz, Department of Diagnostic and Interventional Radiology, Mainz (Germany)
2011-11-15
To analyze the clinical results and complications of fluoroscopy guided internal-external pull-type percutaneous radiological gastrostomy (pull-type-PRG) and conventional external-internal percutaneous radiological gastrostomy (push-type-PRG). A total of 253 patients underwent radiological gastrostomy between January 2002 and January 2010. Data were collected retrospectively from radiology reports, Chart review of clinical notes, procedure reports, discharge summaries and subsequent hospital visits. Statistical analysis was performed to compare the two methods for gastrostomy with respect to peri-interventional aspects and clinical results. 128 patients received the Pull-type-PRG whereas the other 125 patients were served with the Push-type-PRG. Indications for gastrostomy were similar in these two groups. The most frequent indications for the both methods were stenotic oesophageal tumors or head/neck tumors (54.7% in pull-type-PRG, 68% in push-type-PRG). Gastrostomy procedures were successful in 98.3% in pull-type-PRG compared to 92% in push-type-PRG. There was no procedure-related mortality. Compared to Push-type-PRG, the peri-interventional complication rate was significantly reduced in pull-type-PRG (14.8% versus 34.4%, P = 0.002). Compared to the external-internal push-type-PRG, the internal-external Pull-type-PRG showed a high primary success rate and a decreased incidence of peri-interventional complications. (orig.)
International Nuclear Information System (INIS)
Yang, Yang; Schneider, J.; Dueber, C.; Pitton, M.B.
2011-01-01
To analyze the clinical results and complications of fluoroscopy guided internal-external pull-type percutaneous radiological gastrostomy (pull-type-PRG) and conventional external-internal percutaneous radiological gastrostomy (push-type-PRG). A total of 253 patients underwent radiological gastrostomy between January 2002 and January 2010. Data were collected retrospectively from radiology reports, Chart review of clinical notes, procedure reports, discharge summaries and subsequent hospital visits. Statistical analysis was performed to compare the two methods for gastrostomy with respect to peri-interventional aspects and clinical results. 128 patients received the Pull-type-PRG whereas the other 125 patients were served with the Push-type-PRG. Indications for gastrostomy were similar in these two groups. The most frequent indications for the both methods were stenotic oesophageal tumors or head/neck tumors (54.7% in pull-type-PRG, 68% in push-type-PRG). Gastrostomy procedures were successful in 98.3% in pull-type-PRG compared to 92% in push-type-PRG. There was no procedure-related mortality. Compared to Push-type-PRG, the peri-interventional complication rate was significantly reduced in pull-type-PRG (14.8% versus 34.4%, P = 0.002). Compared to the external-internal push-type-PRG, the internal-external Pull-type-PRG showed a high primary success rate and a decreased incidence of peri-interventional complications. (orig.)
Nustar and Chandra Insight into the Nature of the 3-40 Kev Nuclear Emission in Ngc 253
Lehmer, Bret D.; Wik, Daniel R.; Hornschemeier, Ann E.; Ptak, Andrew; Antoniu, V.; Argo, M.K.; Bechtol, K.; Boggs, S.; Christensen, F.E.; Craig, W.W.;
2013-01-01
We present results from three nearly simultaneous Nuclear Spectroscopic Telescope Array (NuSTAR) and Chandra monitoring observations between 2012 September 2 and 2012 November 16 of the local star-forming galaxy NGC 253. The 3-40 kiloelectron volt intensity of the inner approximately 20 arcsec (approximately 400 parsec) nuclear region, as measured by NuSTAR, varied by a factor of approximately 2 across the three monitoring observations. The Chandra data reveal that the nuclear region contains three bright X-ray sources, including a luminous (L (sub 2-10 kiloelectron volt) approximately few × 10 (exp 39) erg per s) point source located approximately 1 arcsec from the dynamical center of the galaxy (within the sigma 3 positional uncertainty of the dynamical center); this source drives the overall variability of the nuclear region at energies greater than or approximately equal to 3 kiloelectron volts. We make use of the variability to measure the spectra of this single hard X-ray source when it was in bright states. The spectra are well described by an absorbed (power-law model spectral fit value, N(sub H), approximately equal to 1.6 x 10 (exp 23) per square centimeter) broken power-law model with spectral slopes and break energies that are typical of ultraluminous X-ray sources (ULXs), but not active galactic nuclei (AGNs). A previous Chandra observation in 2003 showed a hard X-ray point source of similar luminosity to the 2012 source that was also near the dynamical center (Phi is approximately equal to 0.4 arcsec); however, this source was offset from the 2012 source position by approximately 1 arcsec. We show that the probability of the 2003 and 2012 hard X-ray sources being unrelated is much greater than 99.99% based on the Chandra spatial localizations. Interestingly, the Chandra spectrum of the 2003 source (3-8 kiloelectron volts) is shallower in slope than that of the 2012 hard X-ray source. Its proximity to the dynamical center and harder Chandra spectrum
Total neutron cross sections of berkelium-249 and californium-249 below 100 eV
International Nuclear Information System (INIS)
Benjamin, R.W.; Harvey, J.A.; Hill, N.W.; Pandey, M.S.; Carlton, R.F.
1979-01-01
The neutron total cross sections of 249 Bk and 249 Cf have been measured from 0.03 to 100 eV using the Oak Ridge Electron Linear Accelerator (ORELA) as a source of pulsed neutrons. The 1.6 mm dia. cylindrical transmission samples contained initially up to 5.3 mg of 98% 249 Bk and 2% 249 Cf: 4.5 years later, when the final measurements were made, the composition of the samples had become 2.5% 249 Bk, 96.9% 249 Cf, and 0.6% 245 Cm. Samples were cooled with liquid nitrogen to reduce Doppler broadening. Thirty-nine resonances were identified in 249 Bk and analyzed using a single-level Breit-Wigner formalism. Fifty-five resonances were identified in 249 Cf and analyzed using an R-matrix multilevel formalism. Fifty-five resonances were identified in 249 Cf and analyzed using an R-matrix multilevel formalism. The resonance parameters obtained have been used to determine the average level spacings and the s-wave neutron and fission strength functions. Where possible, bound-level parameters were derived to fit the thermal neutron total cross section data
Identification of the new isotope sup 2 sup 4 sup 1 Bk
Asai, M; Ichikawa, S; Nagame, Y; Nishinaka, I; Akiyama, K; Toyoshima, A; Kaneko, T; Sakama, M; Haba, H; Oura, Y; Kojima, Y; Shibata, M
2003-01-01
A new neutron-deficient berkelium isotope sup 2 sup 4 sup 1 Bk produced in the sup 2 sup 3 sup 9 Pu( sup 6 Li, 4n) reaction has been identified using a gas-jet coupled on-line isotope separator. Cm K and L X-rays associated with the EC decay of sup 2 sup 4 sup 1 Bk were observed in the mass-241 fraction, and three gamma transitions were attributed to the EC decay of sup 2 sup 4 sup 1 Bk through X-gamma coincidences. The half-life of sup 2 sup 4 sup 1 Bk was determined to be 4.6+-0.4 min which is 1/2-1/4 of that of theoretical predictions. The half-life value and the observed gamma transitions can be consistently explained as a consequence of the allowed EC transition of pi 7/2 sup + [633] -> nu 7/2 sup + [624]. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Brown, Paul L. [Geochem Australia, Kiama, NSW (Australia); Ekberg, Christian [Chalmers Univ. of Technology, Goeteborg (Sweden). Nuclear Chemistry/Industrial Materials Recycling
2016-07-01
All isotopes of actinium are radioactive and exist in aqueous solution only in the trivalent state. There have been very few studies on the hydrolytic reactions of actinium(III). The hydrolysis reactions for uranium would only be important in alkaline pH conditions. Thermodynamic parameters for the hydrolysis species of uranium(VI) and its oxide and hydroxide phases can be determined from the stability and solubility constants. The hydrolytic behaviour of neptunium(VI) is quite similar to that of uranium(VI). The solubility constant of NpO{sub 2}OH(am) has been reported a number of times for both zero ionic strength and in fixed ionic strength media. Americium can form four oxidation states in aqueous solution, namely trivalent, tetravalent, pentavalent and hexavalent. Desire, Hussonnois and Guillaumont determined stability constants for the species AmOH{sup 2+} for the actinides, plutonium(III), americium(III), curium(III), berkelium(III) and californium(III) using a solvent extraction technique.
International Nuclear Information System (INIS)
Brown, Paul L.; Ekberg, Christian
2016-01-01
All isotopes of actinium are radioactive and exist in aqueous solution only in the trivalent state. There have been very few studies on the hydrolytic reactions of actinium(III). The hydrolysis reactions for uranium would only be important in alkaline pH conditions. Thermodynamic parameters for the hydrolysis species of uranium(VI) and its oxide and hydroxide phases can be determined from the stability and solubility constants. The hydrolytic behaviour of neptunium(VI) is quite similar to that of uranium(VI). The solubility constant of NpO 2 OH(am) has been reported a number of times for both zero ionic strength and in fixed ionic strength media. Americium can form four oxidation states in aqueous solution, namely trivalent, tetravalent, pentavalent and hexavalent. Desire, Hussonnois and Guillaumont determined stability constants for the species AmOH 2+ for the actinides, plutonium(III), americium(III), curium(III), berkelium(III) and californium(III) using a solvent extraction technique.
Nuclear Chemistry Institute, Mainz University. Annual Report 1995
International Nuclear Information System (INIS)
Denschlag, H.O.
1996-03-01
The annual report of the Institut fuer Kernchemie addresses inter alia three main research activities. The first belongs to the area of basic research, covering studies in the fields of nuclear fission, chemistry of the super-heavy elements and of heavy-ion reactions extending from the Coulomb barrier to relativistic energies, and nuclear astrophysics in connection with the ''r process''. By means of laser technology, high-precision data could be measured of the ionization energies of berkelium and californium. Studies of atomic clusters in the vacuum of an ionization trap revealed interesting aspects. The second major activity was devoted to the analysis of environmental media, applying inter alia neutron activation analysis and resonance ionization mass spectroscopy (RIMS). The third activity resulted in the development of novel processes, or the enhancement of existing processes or methods, for applications in basic research work and in environmental analytics. Another item of interest is the summarizing report on the operation of the TRIGA research reactor. (orig./SR) [de
2010-01-01
... structural defect. (d) Structural defect. A defect in the dwelling or unit, installation or set-up of a unit... of the dwelling or unit or site such as faulty wiring, or failure of sewage disposal or water supply systems located on the property securing the loan caused by faulty materials or improper installation. (3...
2010-10-01
... work or investigative study, designed to acquire knowledge of fisheries resources and their habitat... the apportionment formula, which is equal to the price paid at the first point of landing. Volume...
50 CFR 253.15 - Miscellaneous.
2010-10-01
... due diligence investigation of every application it accepts and determine if, in the Division's sole... guarantee life. These must be conducted by competent and impartial inspectors acceptable to the Division...
2010-07-01
... maintain a run-off management system to collect and control at least the water volume resulting from a 24...: If collected leachate or run-off is discharged through a point source to waters of the United States, it is subject to the requirements of section 402 of the Clean Water Act, as amended.] [45 FR 33232...
2010-10-01
... less overutilized species than before; applying new technology; improving safety or fuel efficiency..., growth, productivity, or any other business attribute. Demand means a noteholder's request that the.... Wise use means the wise use of fisheries resources and their development, advancement, management...
2010-01-01
... participation and commitment of local governments, tribal governments, state governments, private sector... same as or different from the lead managing entity. Baseline condition means a measurable condition or... Appropriations Act, 1999 (Public Law 105-277). Round III identifies designations of empowerment zones pursuant to...
2010-01-01
... Regulations of the Department of Agriculture (Continued) RURAL HOUSING SERVICE, RURAL BUSINESS-COOPERATIVE..., sites, buildings, structures, and objects, significant in American history, architecture, archeology... significance in American History, Architecture, Archeology, and the culture is present in districts, sites...
Dau, Phuong D; Vasiliu, Monica; Peterson, Kirk A; Dixon, David A; Gibson, John K
2017-12-06
Actinyl chemistry is extended beyond Cm to BkO 2 + and CfO 2 + through transfer of an O atom from NO 2 to BkO + or CfO + , establishing a surprisingly high lower limit of 73 kcal mol -1 for the dissociation energies, D[O-(BkO + )] and D[O-(CfO + )]. CCSD(T) computations are in accord with the observed reactions, and characterize the newly observed dioxide ions as linear pentavalent actinyls; these being the first Bk and Cf species with oxidation states above IV. Computations of actinide dioxide cations AnO 2 + for An=Pa to Lr reveal an unexpected minimum for D[O-(CmO + )]. For CmO 2 + , and AnO 2 + beyond EsO 2 + , the most stable structure has side-on bonded η 2 -(O 2 ), as An III peroxides for An=Cm and Lr, and as An II superoxides for An=Fm, Md, and No. It is predicted that the most stable structure of EsO 2 + is linear [O=Es V =O] + , einsteinyl, and that FmO 2 + and MdO 2 + , like CmO 2 + , also have actinyl(V) structures as local energy minima. The results expand actinide oxidation state chemistry, the realm of the distinctive actinyl moiety, and the non-periodic character towards the end of the periodic table. © 2017 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.
Archeological Excavations at Two Prehistoric Campsites Near Keystone Dam, El Paso, Texas.
1985-07-19
Flotacion Microdebitate Analysis 246 Groundstone Artifacts 253 Slab Metates 253 Manos 253 PesLIes 253 Groundstone Fragments 263 Anvils 263 Polishing...important new information to our understanding of local prehistory. The bulk ot O’LaugnliLn’s (1980) work in the area was directed toward the excavation...contains or summarizes the bulk of L111 ptiiaisiitd( iaci on iitnic artiract frequenCies irom El Paso ’Ir’Ia Sites. fhese data, along with those from the
Dicty_cDB: Contig-U09533-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 33308 |pid:none) Anabas testudineus cyclin-dependen... 253 1e-65 BC061617_1( BC06..... 253 1e-65 EU006765_1( EU006765 |pid:none) Gossypium hirsutum cultivar des119... 253 1e-65 AY533308_1( AY5
Energy Technology Data Exchange (ETDEWEB)
Newberry, K.J.; Huffman, J.L.; Miller, M.C.; Vazquez-Laslop, N.; Neyfakh, A.A.; Brennan, R.G.
2009-05-22
BmrR is a member of the MerR family and a multidrug binding transcription factor that up-regulates the expression of the bmr multidrug efflux transporter gene in response to myriad lipophilic cationic compounds. The structural mechanism by which BmrR binds these chemically and structurally different drugs and subsequently activates transcription is poorly understood. Here, we describe the crystal structures of BmrR bound to rhodamine 6G (R6G) or berberine (Ber) and cognate DNA. These structures reveal each drug stacks against multiple aromatic residues with their positive charges most proximal to the carboxylate group of Glu-253 and that, unlike other multidrug binding pockets, that of BmrR is rigid. Substitution of Glu-253 with either alanine (E253A) or glutamine (E253Q) results in unpredictable binding affinities for R6G, Ber, and tetraphenylphosphonium. Moreover, these drug binding studies reveal that the negative charge of Glu-253 is not important for high affinity binding to Ber and tetraphenylphosphonium but plays a more significant, but unpredictable, role in R6G binding. In vitro transcription data show that E253A and E253Q are constitutively active, and structures of the drug-free E253A-DNA and E253Q-DNA complexes support a transcription activation mechanism requiring the expulsion of Tyr-152 from the multidrug binding pocket. In sum, these data delineate the mechanism by which BmrR binds lipophilic, monovalent cationic compounds and suggest the importance of the redundant negative electrostatic nature of this rigid drug binding pocket that can be used to discriminate against molecules that are not substrates of the Bmr multidrug efflux pump.
1α,25(OH)2D3 differentially regulates miRNA expression in human bladder cancer cells.
Ma, Yingyu; Hu, Qiang; Luo, Wei; Pratt, Rachel N; Glenn, Sean T; Liu, Song; Trump, Donald L; Johnson, Candace S
2015-04-01
Bladder cancer is the fourth most commonly diagnosed cancer in men and eighth leading cause of cancer-related death in the US. Epidemiological and experimental studies strongly suggest a role for 1α,25(OH)2D3 in cancer prevention and treatment. The antitumor activities of 1α,25(OH)2D3 are mediated by the induction of cell cycle arrest, apoptosis, differentiation and the inhibition of angiogenesis and metastasis. miRNAs play important regulatory roles in cancer development and progression. However, the role of 1α,25(OH)2D3 in the regulation of miRNA expression and the potential impact in bladder cancer has not been investigated. Therefore, we studied 1α,25(OH)2D3-regulated miRNA expression profiles in human bladder cancer cell line 253J and the highly tumorigenic and metastatic derivative line 253J-BV by miRNA qPCR panels. 253J and 253J-BV cells express endogenous vitamin D receptor (VDR), which can be further induced by 1α,25(OH)2D3. VDR target gene 24-hydroxylase was induced by 1α,25(OH)2D3 in both cell lines, indicating functional 1α,25(OH)2D3 signaling. The miRNA qPCR panel assay results showed that 253J and 253J-BV cells have distinct miRNA expression profiles. Further, 1α,25(OH)2D3 differentially regulated miRNA expression profiles in 253J and 253J-BV cells in a dynamic manner. Pathway analysis of the miRNA target genes revealed distinct patterns of contribution to the molecular functions and biological processes in the two cell lines. In conclusion, 1α,25(OH)2D3 differentially regulates the expression of miRNAs, which may contribute to distinct biological functions, in human bladder 253J and 253J-BV cells. This article is part of a Special Issue entitled '17th Vitamin D Workshop'. Copyright © 2014 Elsevier Ltd. All rights reserved.
International Nuclear Information System (INIS)
Belanova, T.S.
1994-12-01
Data on the thermal neutron fission and capture cross-sections as well as their corresponding resonance integrals are reviewed and analysed. The data are classified according to the form of neutron spectra under investigation. The weighted mean values of the cross-sections and resonance integrals for every type of neutron spectra were adopted as evaluated data. (author). 87 refs, 2 tabs
Extraction of transplutonium elements from carbonate solutions by alkylpyrocatechol
International Nuclear Information System (INIS)
Karalova, Z.K.; Myasoedov, B.F.; Rodionova, L.M.; Kuznetsova, V.S.
1983-01-01
Extraction of americium, berkelium as well as Ce, Eu, Th, U, Zr, Cs, Fe with solution of 4(α, α-dioctylethyl)pyrocatechol (DOP) in toluene from carbonate solutions to determine conditions of their separation has been studied. It is established that americium extraction is quite sensitive to the changes of potassium carbonate concentration. The maximum extraction of americium (R >90%) is observed in the case of 0.1-0.5 mol/l of K 2 CO 3 solutions and the minimum one (R=2.5%) - in the case of 8 mol/l K 2 CO 3 . Americium extraction increases sharply when sodium hydroxide is introduced in carbonate solutions. It is shown that varying sodium hydroxide concentration it is possible to achieve qualitative extraction of americium even from saturated solution of potassium carbonate. Reextraction of TPE is easily realized with 3 mol/l HCl solution. The system K 2 CO 3 (KOH)-DOP proved to be perspective for Am separation from Bk, Ce, Cs, actinoid elements as well as from Fe
50 CFR 253.11 - Guarantee policy.
2010-10-01
... inconsistent with wise use, but financing it may be. (2) Vessel refurbishing that materially increases an... financed (or otherwise paid). Refinancing this project cost is not inconsistent with wise use, but financing it may be. (3) Purchasing a used vessel or used fishery facility. The Program will neither finance...
33 CFR 117.253 - Anacostia River.
2010-07-01
... for public vessels of the United States, state and local government vessels, commercial vessels and... sensors, laser scanners, video cameras or marine-radio communications, In these situations, a bridge... condition two board gauges painted white with black figures not less than six inches high to indicate the...
Publications | Page 253 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
... been towards focalization, subsidies on demand, decentralization and privatization. ... Each year, Moroccans use nearly 70% of their annual recoverable water supply ... Adapting fishing policies to address climate change in West Africa.
17 CFR 230.253 - Offering circular.
2010-04-01
.... Repetition of information should be avoided; cross-referencing of information within the document is... COMPLETENESS OF ANY OFFERING CIRCULAR OR OTHER SELLING LITERATURE. THESE SECURITIES ARE OFFERED PURSUANT TO AN...
14 CFR 93.253 - Nonstop operations.
2010-01-01
... AND GENERAL OPERATING RULES SPECIAL AIR TRAFFIC RULES Ronald Reagan Washington National Airport... between Ronald Reagan Washington National Airport and another airport that is more than 1,250 miles away from Ronald Reagan Washington National Airport. ...
256 253 Profitability Analysis of Groundnut
African Journals Online (AJOL)
2008-12-02
Dec 2, 2008 ... Metropolitan Council of Borno State, Nigeria. * A. Iliyasu, I. ... processing and determine the return on investment in groundnut processing in the study area. Structured ... It was recommended that large scale groundnut production should be encouraged .... increasing rate, increases at decreasing rate and.
African Journals Online (AJOL)
AISA
plus fréquemment utilisées contre les cochenilles appartiennent au groupe des organophosphorés. Le chlorpyrifos-éthyl a montré une bonne efficacité comparativement aux pyréthrinoïdes tels que la bifenthrine et la lamdacyhalothrine (Dembélé, 2001). Toutes les formulations à base de chlorpyriphos- éthyl (Dursban 4 E, ...
42 CFR 447.253 - Other requirements.
2010-10-01
... intermediate care services) under conditions similar to those described in section 1861(v)(1)(G) of the Act... agency determines appropriate, of payment rates. (f) Uniform cost reporting. The Medicaid agency must... Medicaid agency must provide for periodic audits of the financial and statistical records of participating...
Format Guide for Scientific and Technical Reports.
1984-01-01
supported by the discussion. Graphkic Services The Graphic Services Section (Code 2632) provides a variety of layout and design services. Camera-ready artwork...complex typography , elaborate graphic elements, extensive computer printouts, and other unusual materials that explain the project. With few exceptions...2630 Publications Branch Office 222/253 72379 S Publications Control Center 222/253 73508 Editorial 222/253 72782 Graphic Services 222/234 72756 73989
Collier, Mary E. W.; Ettelaie, Camille
2011-01-01
The mechanisms that regulate the incorporation and release of tissue factors (TFs) into cell-derived microparticles are as yet unidentified. In this study, we have explored the regulation of TF release into microparticles by the phosphorylation of serine residues within the cytoplasmic domain of TF. Wild-type and mutant forms of TF, containing alanine and aspartate substitutions at Ser253 and Ser258, were overexpressed in coronary artery and dermal microvascular endothelial cells and microparticle release stimulated with PAR2 agonist peptide (PAR2-AP). The release of TF antigen and activity was then monitored. In addition, the phosphorylation state of the two serine residues within the released microparticles and the cells was monitored for 150 min. The release of wild-type TF as procoagulant microparticles peaked at 90 min and declined thereafter in both cell types. The TF within these microparticles was phosphorylated at Ser253 but not at Ser258. Aspartate substitution of Ser253 resulted in rapid release of TF antigen but not activity, whereas TF release was reduced and delayed by alanine substitution of Ser253 or aspartate substitution of Ser258. Alanine substitution of Ser258 prolonged the release of TF following PAR2-AP activation. The release of TF was concurrent with phosphorylation of Ser253 and was followed by dephosphorylation at 120 min and phosphorylation of Ser258. We propose a sequential mechanism in which the phosphorylation of Ser253 through PAR2 activation results in the incorporation of TF into microparticles, simultaneously inducing Ser258 phosphorylation. Phosphorylation of Ser258 in turn promotes the dephosphorylation of Ser253 and suppresses the release of TF. PMID:21310953
Active sites engineering of metal-organic frameworks for heterogeneous catalysis
Energy Technology Data Exchange (ETDEWEB)
Li, Xinle [Iowa State Univ., Ames, IA (United States)
2016-12-17
In conclusion, we have for the first time developed a novel solid base catalyst, Ndoped MOF-253 derived porous carbons (Cz-MOF-253). Cz-MOF-253 is highly porous and exhibit high efficiency in Knoevenagel condensation reaction. Furthermore, Cz-MOF-253 is robust and can be reused up to five times. In comparison, the analogous nitrogen-free catalyst-Cz-DUT-5, and other nitrogen- MOFs derived carbon showed an inferior performance. Moreover, the high basicity and porous nature enable the design of bifunctional catalyst and facilitate tandem condensation-hydrogenation reactions. This work delineates the first attempt that demonstrates MOF-derived carbons as solid base catalyst and its potential application in tandem catalysis. Future work on exploring new catalytic reactions based on such porous Lewis basic MOF-derived carbons is currently underway.
... Tract . Clinical Microbiology Reviews; 23(2): 253–273. Ferris, D.G., Nyirjesy, P., Sobel, J.D., Soper, ... Tract . Clinical Microbiology Reviews; 23(2): 253–273. Ferris, D.G., Nyirjesy, P., Sobel, J.D., Soper, ...
International Nuclear Information System (INIS)
Behrens, R.G.; Roth, S.B.; Jones, S.R.
1991-01-01
Los Alamos National Laboratory is a multidisciplinary R ampersand D organization and, as such, its nuclear materials inventory is diverse. Accordingly, major inventories of isotopes such as Pu-238, Pu-239, Pu-242, U-235, Th, tritium, and deuterium, and lesser amounts of isotopes of Am, Cm, Np and exotic isotopes such as berkelium must be managed in accordance with Department of Energy Orders and Laboratory policies. Los Alamos also acts as a national resource for many one-of-a-kind materials which are supplied to universities, industry, and other government agencies within the US and throughout the world. Management of these materials requires effective interaction and communication with many nuclear materials custodians residing in over forty technical groups as well as effective interaction with numerous outside organizations. This paper discusses the role, philosophy, and organizational structure of Nuclear Materials Management at Los Alamos and also briefly presents results of two special nuclear materials management projects: 1- Revision of Item Description Codes for use in the Los Alamos nuclear material data base and 2- The recommendation of new economic discard limits for Pu-239. 2 refs., 1 fig
African Journals Online (AJOL)
AISA
de réponses ne favorisent que certaines variétés, laissant presqu'entière la question de la conservation de la biodiversité .... biodiversité de l'igname surtout que son système semencier en ...... framework for valuing on-farm genetic resources.
7 CFR 253.5 - State agency requirements.
2010-01-01
... Federal, State, or local laws, including, but not limited to, laws relating to taxation, welfare, and... advance of the meeting. FNS shall schedule and conduct the meeting and make a decision within 60 days of...
24 CFR 960.253 - Choice of rent.
2010-04-01
... section. Except for financial hardship cases as provided in paragraph (d) of this section, the family may... on the market rent charged for comparable units in the private unassisted rental market. It is equal... determine the flat rent, the PHA must consider: (i) The location, quality, size, unit type and age of the...
African Journals Online (AJOL)
AISA
préalablement stérilisé à l'autoclave (110 °C,. 2 kg/cm2, 3h) et 150 g de sol de chaque échantillon servant d'inoculum (2 plants par pot). Après 75 jours de culture, 50 g de sols de chaque échantillon séché à l'air libre est utilisé pour extraire les spores selon la méthode de tamisage humide (Gerdemann et Nicolson,. 1963).
32 CFR 253.1 - Reissuance and purpose.
2010-07-01
...) MISCELLANEOUS ASSIGNMENT OF AMERICAN NATIONAL RED CROSS AND UNITED SERVICE ORGANIZATIONS, INC., EMPLOYEES TO...”) employees and United Service Organizations, Inc. (USO), staff for the purpose of determining the security acceptability of such personnel for assignment to duty with the Military Services. ...
H:\\PMKER 25(3)\\TRAORE K..xps
African Journals Online (AJOL)
AISA
Laboratoire de Phytopathologie de la Faculté d'Agronomie de l'Université de Parakou (Bénin) pour confirmer ou non la présence des trois virus responsables de maladies chez les Solanaceae à savoir le CMV, le PVMV et le PVYN. Des tampons ont été préparés conformément aux directives de Clarck et al. (1977), il s'agit.
7 CFR 253.7 - Certification of households.
2010-01-01
... savings accounts, savings certificates, stocks, or bonds, or other readily negotiable instruments exceeds... duration of the disqualification (that is, 12 months; 24 months; or permanent). The State agency must also... agency conference. (Approved by the Office of Management and Budget under control number 0584-0071) (44 U...
7 CFR 253.6 - Eligibility of households.
2010-01-01
... resources of a household, only cash on hand, money in checking or savings accounts, savings certificates..., such as a Keogh plan or an Individual Retirement Account (IRA), as long as the funds remain in the... course would be excluded. However, transportation, supplies, and textbook expenses are not uniformly...
40 CFR 98.253 - Calculating GHG emissions.
2010-07-01
... (metric tons/year). NCD = Number of atmospheric crude oil distillation columns at the facility. NPU1... = Methane emission rate from blowdown systems (mt CH4/year). QRef = Quantity of crude oil plus the quantity...) For storage tanks other than those processing unstabilized crude oil, you must either calculate CH4...
H:\\PMKER 25(3)\\BEUGRE F..xps
African Journals Online (AJOL)
AISA
nodules and permitted the application of the herbicide, better development of soybean plants. Herbicide ... négative sur les micro-organismes du sol, en particulier, sur les .... différences significatives entre les traitements sont apparus à partir de 45e jour après le semis. (JAS), et ce, jusqu'au 90e JAS. En effet, pendant ...
H:\\PMKER 25(3)\\NOUATIN G..xps
African Journals Online (AJOL)
AISA
Les institutions de micro finance, de part leur importance dans la réduction de la pauvreté dans les pays en développement, sont de plus en plus au centre des préoccupations aussi bien des politiques que des scientifiques. Au Bénin on compte ... En effet, il existe relativement peu d'analyses d'impact de programmes de ...
40 CFR 25.3 - Policy and objectives.
2010-07-01
... governmental and educational associations. (b) Public participation is that part of the decision-making process... the decision-making process, seeking input from and conducting dialogue with the public, assimilating... considered by the decision-making official. Disagreement on significant issues is to be expected among...
42 CFR 403.253 - Calculation of benefits.
2010-10-01
... the gross premiums are computed to provide coverage. (iv) Reserve for future contingent benefits means... the loss ratio calculation period. (iii) Net premium means the level portion of the gross premium used... period, to— (B) The total policy reserve at the last day of the loss ratio calculation period: and (ii...
H:\\PMKER 25(3)\\BRAHIM I..xps
African Journals Online (AJOL)
AISA
ordinateur. Au cours de ces dictées d'enregistrement de compor- tement et pour chaque femelle, sept paramètres ont été relevés et enregistrés à l'ordinateur : - durée de marche sans balayage (en sec) : pendant laquelle la femelle se déplace sur les.
20 CFR 632.253 - Special operating provisions.
2010-04-01
...; (c) Provide labor market orientation to participants. This orientation may include, as appropriate: vocational exposure, counseling, testing, resume preparation, job interview preparation, providing labor... labor market orientation, skill training and remedial education, each grantee shall make maximum efforts...
Blanchet, P.; Bebin, M.; Bruet, S,; Cooper, G.M.; Thompson, M.L.; Duban-Bedu, B.; Gerard, B.; Piton, A.; Suckno, S.; Deshpande, C.; Clowes, V.; Vogt, J.; Turnpenny, P.; Williamson, M.P.; Alembik, Y.
2017-01-01
Deletions at chromosome 2p25.3 are associated with a syndrome consisting of intellectual disability and obesity. The smallest region of overlap for deletions at 2p25.3 contains PXDN and MYT1L. MYT1L is expressed only within the brain in humans. We hypothesized that single nucleotide variants (SNVs) in MYT1L would cause a phenotype resembling deletion at 2p25.3. To examine this we sought MYT1L SNVs in exome sequencing data from 4, 296 parent-child trios. Further variants were identified throug...
Inflation expectations in the Czech interbank market
Czech Academy of Sciences Publication Activity Database
Fukač, Martin
-, č. 253 (2005), s. 1-30 ISSN 1211-3298 Institutional research plan: CEZ:AV0Z70850503 Keywords : inflation expectations * nominal interest rate * Fisher rule Subject RIV: AH - Economics http://www.cerge-ei.cz/pdf/wp/Wp253.pdf
78 FR 1220 - Agency Information Collection Activities: Guarantee of Payment
2013-01-08
.... Abstract: Section 253 of the Immigration and Nationality Act (INA) requires that an alien crewman found to... provided for by 8 CFR 253.1 and is accessible at: http://forms.cbp.gov/pdf/CBP_Form_i510.pdf . Action: CBP...
4-Chloro-N-(3,4,5-trimethoxybenzylidene)aniline
Czech Academy of Sciences Publication Activity Database
Khalaji, A.D.; Asghari, J.; Fejfarová, Karla; Dušek, Michal
2009-01-01
Roč. 65, - (2009), o253-o253 ISSN 1600-5368 R&D Projects: GA ČR GC202/07/J008 Institutional research plan: CEZ:AV0Z10100521 Keywords : X-ray diffraction * Jana 2006 Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.411, year: 2009
Nakajima, Taku; Takano, Shuro; Kohno, Kotaro; Harada, Nanase; Herbst, Eric
2018-01-01
It is important to investigate the relationships between the power sources and the chemical compositions of galaxies in order to understand the scenario of galaxy evolution. We carried out an unbiased molecular line survey towards active galactic nucleus (AGN) host galaxy NGC1068, and prototypical starburst galaxies, NGC 253 and IC 342, with the Nobeyama 45 m telescope in the 3 mm band. The advantage of this line survey is that the obtained spectra have the highest angular resolution ever obtained with single-dish telescopes. In particular, the beam size of this telescope is ˜15″-19″, which is able to separate spatially the nuclear molecular emission from that of the starburst ring (d ˜ 30″) in NGC 1068. We successfully detected approximately 23 molecular species in each galaxy, and calculated rotation temperatures and column densities. We estimate the molecular fractional abundances with respect to 13CO and CS molecules and compare them among three galaxies in order to investigate the chemical signatures of an AGN environment. As a result, we found clear trends in the abundances of molecules surrounding the AGN on a 1-kpc scale. HCN, H13CN, CN, 13CN, and HC3N are more abundant, and CH3CCH is deficient in NGC 1068 compared with the starburst galaxies. High abundances of HCN, H13CN, and HC3N suggest that the circumnuclear disk in NGC 1068 is in a high-temperature environment. The reason for the non-detection of CH3CCH is likely to be dissociation by high-energy radiation or less sublimation of a precursor of CH3CCH from grains.
Ettelaie, Camille; Elkeeb, Azza M; Maraveyas, Anthony; Collier, Mary Elizabeth W
2013-03-01
We previously showed that the phosphorylation of Ser253 within the cytoplasmic domain of human tissue factor (TF) initiates the incorporation and release of this protein into cell-derived microparticles. Furthermore, subsequent phosphorylation of Ser258 terminates this process. However, the identity of the kinase responsible for the phosphorylation of Ser258 and mode of action of this enzyme remain unknown. In this study, p38α was identified as the proline-directed kinase capable of phosphorylating Ser258 specifically, and without any detectable activity towards Ser253. Furthermore, using synthetic peptides, it was shown that the Km for the reaction decreased by approximately 10 fold on substitution of Ser253 with phospho-Ser253. Either inhibition of p38 using SB202190 or knockdown of p38α expression in coronary artery endothelial cells overexpressing wild-type TF, resulted in decreased phosphorylation of Ser258, following activation of cells with PAR2-agonist peptide (PAR2-AP). In agreement with our previous data, inhibition of phosphorylation of this residue maintained the release of TF. Activation of PAR2 in cells transfected to overexpress TF, resulted in two separate peaks of p38 activity at approximately 40 and 120 min post-activation. Furthermore, overexpression of Ala253-substituted TF enhanced the second p38 activation peak. However, the second peak was absent in cells devoid of TF or in cells overexpressing the Asp253-substituted TF. Our data clearly identifies p38α as a kinase capable of phosphorylating Ser258 within the cytoplasmic domain of TF. Moreover, it appears that the presence of TF within the cells regulates the late activation of p38 and consequently the termination of TF release into microparticles. Copyright © 2012 Elsevier B.V. All rights reserved.
Czech Academy of Sciences Publication Activity Database
Heroldová, Marta; Zejda, J.
2002-01-01
Roč. 51, č. 3 (2002), s. 253-256 ISSN 0139-7893 R&D Projects: GA AV ČR IBS6093003 Institutional research plan: CEZ:AV0Z6093917 Keywords : sika deer * body dimensions * coloration Subject RIV: EG - Zoology Impact factor: 0.234, year: 2002 http://www.ivb.cz/folia/51/3/253-256.pdf
24 CFR 213.259a - Premiums-mortgages insured pursuant to section 238(c) of the Act.
2010-04-01
.... All of the provisions of §§ 213.253 through 213.259 governing mortgage insurance premiums shall apply... mortgage insurance premiums due on such mortgages in accordance with §§ 213.253 through 213.259 shall be... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Premiums-mortgages insured pursuant...
Directory of Open Access Journals (Sweden)
Emmanuelle Masson
Full Text Available Idiopathic chronic pancreatitis (ICP has traditionally been defined as chronic pancreatitis in the absence of any obvious precipitating factors (e.g. alcohol abuse and family history of the disease. Studies over the past 15 years have revealed that ICP has a highly complex genetic architecture involving multiple gene loci. Here, we have attempted to provide a conservative assessment of the major genetic causes of ICP in a sample of 253 young French ICP patients. For the first time, conventional types of mutation (comprising coding sequence variants and variants at intron/exon boundaries and gross genomic rearrangements were screened for in all four major pancreatitis genes, PRSS1, SPINK1, CTRC and CFTR. For the purposes of the study, synonymous, intronic and 5'- or 3'-untranslated region variants were excluded from the analysis except where there was persuasive evidence of functional consequences. The remaining sequence variants/genotypes were classified into causative, contributory or neutral categories by consideration of (i their allele frequencies in patient and normal control populations, (ii their presumed or experimentally confirmed functional effects, (iii the relative importance of their associated genes in the pathogenesis of chronic pancreatitis and (iv gene-gene interactions wherever applicable. Adoption of this strategy allowed us to assess the pathogenic relevance of specific variants/genotypes to their respective carriers to an unprecedented degree. The genetic cause of ICP could be assigned in 23.7% of individuals in the study group. A strong genetic susceptibility factor was also present in an additional 24.5% of cases. Taken together, up to 48.2% of the studied ICP patients were found to display evidence of a genetic basis for their pancreatitis. Whereas these particular proportions may not be extrapolable to all ICP patients, the approach employed should serve as a useful framework for acquiring a better understanding of the
International Nuclear Information System (INIS)
Armbruster, P.; Hessberger, F.P.
1998-01-01
In the last 60 years physicists have created 20 artificial elements beyond uranium. In 1934 Enrico Fermi predicted the creation of new elements by bombarding atoms with neutrons. This method led to the discovery of neptunium (Z=93), plutonium, americium, curium, berkelium, californium, einsteinium and fermium (Z=100). In fact the capture of a neutron is followed by a beta-decay which increases the atomic number (Z) by one unit. Beyond Z=100 beta-decay no more occurs so a new approach was necessary. Between the American Lawrence Berkeley Laboratory and the Russian Dubna Institute a fierce competition broke out to produce new elements by bombarding transuranium nuclei with light elements such as helium, carbon, nitrogen. This new method required heavy equipment: ion accelerator and detectors but led to the creation of all the elements from Z=101 to Z=106. A new idea was to provoke the fusion of heavy nuclei such as lead and bismuth with colliding argon, nickel or zinc ion beams. This method called 'cold fusion' opened the way to reach the nuclei beyond Z=107. In 1996 the element Z=112 was the last discovered. The next step could be the element Z=114 for which a particular stability is expected. (A.C.)
Characterization of a Viking Blade Fabricated by Traditional Forging Techniques
Vo, H.; Frazer, D.; Bailey, N.; Traylor, R.; Austin, J.; Pringle, J.; Bickel, J.; Connick, R.; Connick, W.; Hosemann, P.
2016-12-01
A team of students from the University of California, Berkeley, participated in a blade-smithing competition hosted by the Minerals, Metals, and Materials Society at the TMS 2015 144th annual meeting and exhibition. Motivated by ancient forging methods, the UC Berkeley team chose to fabricate our blade from historical smithing techniques utilizing naturally-occurring deposits of iron ore. This approach resulted in receiving the "Best Example of a Traditional Blade Process/Ore Smelting Technique" award for our blade named "Berkelium." First, iron-enriched sand was collected from local beaches. Magnetite (Fe3O4) was then extracted from the sand and smelted into individual high- and low-carbon steel ingots. Layers of high- and low-carbon steels were forge-welded together, predominantly by hand, to form a composite material. Optical microscopy, energy dispersive spectroscopy, and Vickers hardness mechanical testing were conducted at different stages throughout the blade-making process to evaluate the microstructure and hardness evolution during formation. It was found that the pre-heat-treated blade microstructure was composed of ferrite and pearlite, and contained many nonmetallic inclusions. A final heat treatment was performed, which caused the average hardness of the blade edge to increase by more than a factor of two, indicating a martensitic transformation.
Fluorescence and excitation spectra of Bk3+, Cf3+, and Es3+ ions in single crystals of LaCl3
International Nuclear Information System (INIS)
Hessler, J.P.; Caird, J.A.; Carnall, W.T.; Crosswhite, H.M.; Sjoblom, R.K.; Wagner, F. Jr.
1978-01-01
Dye laser techniques have been used to study the energy level structure of the heavier actinides in single crystals of lanthanum chloride. In the case of einsteinium, fluorescence was detected and measured from the following manifolds: J = 5 at 0.984 μm -1 , J = 4 at 1.572 μm -1 , J = 6 at 2.930 μm -1 . This fluorescence was observed to the five lowest manifolds: J = 8, 5, 7, 2, 6. For californium, fluorescence has been detected from the manifolds: J = 11/2 at 1.190 μm -1 , J = 7/2 at 1.389 μm -1 , J = 5/2 at 1.977 μm -1 . This fluorescence was observed to the three lowest manifolds: J = 15/2, 9/2, 11/2. The fluorescence manifolds of berkelium are J = 6 at 1.540 μm -1 , and J = 4 at 1.953 μm -1 . The three lowest manifolds, J = 6, 5, and 4, have been observed in fluorescence. Absorption spectra data have yielded crystal-field splitting measurements in the higher manifolds of Es + . The location of the manifolds in general confirmed earlier approximate free-ion level structure calculations based on assumed regularities in the energy level parameters derived from spectra of the actinide ions through Cf + . 2 figures
Lifescience Database Archive (English)
Full Text Available Value N AF305060 |AF305060.1 Dictyostelium discoideum Wiscott-Aldrich syndrome protein (wasA) gene, complete...ences producing significant alignments: (bits) Value AF305060_1( AF305060 |pid:none) Dictyostelium discoideum Wiscott
40 CFR 180.253 - Methomyl; tolerances for residues.
2010-07-01
..., grain 1 Oat, hay 10 Oat, straw 10 Onion, green 3 Orange, sweet 2 Parsley, leaves 6 Pea 5 Pea, field...), kale, lettuce, mustard greens, parsley, spinach, Swiss chard, turnip, greens (tops), and watercress] 0...
7 CFR 765.253 - Ceasing to operate security.
2010-01-01
... AGRICULTURE SPECIAL PROGRAMS DIRECT LOAN SERVICING-REGULAR Required Use and Operation of Agency Security § 765... reside in the immediate farming community for reasonable management and operation involvement; (2) The... reside in the immediate farming community for reasonable management and operation involvement; or (3) The...
Lifescience Database Archive (English)
Full Text Available TTTATS*i*sknifyqvslq**f****yqkmilkipf fsl*fln*i*nk*kkkknl Translated Amino Acid s...GMPLQLGYGANGKNGDNGISVWLIYGYTIVDINCNIRPIITAA TIATTTAATTTATTTATTATTTATTTATS*i*sknifyqvslq**f****yqkmilkipf fsl
Lifescience Database Archive (English)
Full Text Available dkeklakkaaeglknakntassyasgin askdqlnsnfknikenissnlnnakhtieenvhnaqrtgyppkvpapgsnkf...igflalgv fglfawkfyegkkykeneqklikqkh*kk--- ---slyy*fvfkkfikikiinfk*ikr*kkmtdnwdkeklakkaaeglknakntassyax ginaskdqlnsnfknike
H:\\PMKER 25(3)\\NGORAN K. E..xps
African Journals Online (AJOL)
AISA
'étable. Comparison of cowshed milk contamination respect with the months. GAM = Germes aérobies mésophiles, CT = Coliformes totaux, CF = Coliformes fécaux,. GAM = Aerobic mesophlile germ, CT = Total coliform, CF = fecal coliform.
SDS-PAGE analysis of high molecular weight glutenin subunits in SP3 from spaceflight carried wheat
International Nuclear Information System (INIS)
Zhang Su'na; Lv Jinyin
2009-01-01
The compositions of high molecular weight glutenin subunits (HMW-GS) of the third generation (SP 3 ) of two wheat varieties spaceflight carried were analyzed by SDS-PAGE. The quality score of Glu-1 of each site was calculated according to the quality rating system. The results showed that the space flight carried could result in a higher frequency of HMW-GS gene mutation. The variance frequency of HMW-GS in SP 3 of Shaan253 and Xinong1043 were 27.08% and 27.45%, and the quality score in SP 3 of Shaan253 and Xinong1043 were 7 and 6, respectively. Shaan253 SP 3 generation mutants were considered as high-quality wheat. (authors)
Protein interactions with quaternized chitosan/heparin multilayers
Czech Academy of Sciences Publication Activity Database
Kumorek, Marta M.; Kubies, Dana; Riedel, Tomáš
2016-01-01
Roč. 65, Suppl. 2 (2016), S253-S261 ISSN 0862-8408 R&D Projects: GA MŠk(CZ) LQ1604 Institutional support: RVO:61389013 Keywords : heparin * chitosan * protein Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.461, year: 2016 http://www.biomed.cas.cz/physiolres/pdf/65%20Suppl%202/65_S253.pdf
DEFF Research Database (Denmark)
Bonde, Lars Ole
2014-01-01
Indeholder underkapitlerne: 2.5.1 Musik som analogi 2.5.2 Musik som metafor 2.5.3 Musikkens psykologiske funktioner - en taxonomi og metaforisk lytning til fire baroksatser......Indeholder underkapitlerne: 2.5.1 Musik som analogi 2.5.2 Musik som metafor 2.5.3 Musikkens psykologiske funktioner - en taxonomi og metaforisk lytning til fire baroksatser...
40 CFR 52.2370 - Identification of plan.
2010-07-01
... Radiation Docket and Information Center, Air Docket (Mail Code 6102T), Room B-108, 1301 Constitution Avenue... nuisance and odor 01/25/78 12/21/78, 43 FR 59496 Section 5-251 Control of nitrogen oxides emissions 01/04... FR 19825 Section 5-253.3 Bulk gasoline plants 10/29/92 04/22/98, 63 FR 19825 Section 5-253.4 Gasoline...
Institute of Scientific and Technical Information of China (English)
无
2008-01-01
253 Million Internet Users vs 46.4 Percent of Women Netizens China Internet Network Information Center(CNNIC) recently issued its 22nd Statistical Survey Report on Internet Development in China. The report indicated China had 253 million Internet users by the end of June 2008, up 56.2 percent over the previous year.For the first time in China's history,the Internet
Energy Technology Data Exchange (ETDEWEB)
Apalara, Tijani A., E-mail: tijani@kfupm.edu.sa [King Fahd University of Petroleum and Minerals, Affiliated Colleges at Hafr Al-Batin, General Science and Studies Unit-Mathematics (Saudi Arabia); Messaoudi, Salim A., E-mail: messaoud@kfupm.edu.sa [King Fahd University of Petroleum and Minerals, Department of Mathematics and Statistics (Saudi Arabia)
2015-06-15
In this paper, we consider a one-dimensional linear thermoelastic system of Timoshenko type with a delay, where the heat flux is given by Cattaneo’s law. We prove an exponential decay result under a smallness condition on the delay and a stability number introduced first in Santos et al. (J Diff Eqs 253:2715–2733, 2012), using a method different from that of Santos et al. (J Diff Eqs 253:2715–2733, 2012). We also reproduce the polynomial decay of Santos et al. (J Diff Eqs 253:2715–2733, 2012) using the multiplier method in the case of absence of delay. The polynomial decay issue in the presence of a small delay is an open question.
Directory of Open Access Journals (Sweden)
Caspar Plomp
2014-08-01
Full Text Available While no business leaders have yet been charged before the International Criminal Court (ICC, such future proceedings will typically be conducted with reference to the accessorial mode of liability of aiding and abetting, under Article 25(3(c of the Rome Statute of the ICC. There exist diverse and competing interpretations of Article 25(3(c. This paper aims to advocate the creation of a dominant interpretation of Article 25(3(c and, consequently, to the clarification of the potential responsibility of business leaders who aid or abet crimes under the jurisdiction of the Rome Statute, in two ways. First, it asks whether Article 25(3(c can be interpreted in harmony with the dominant practice on aiding and abetting in international criminal law generally. Second, it presents a case study on the provision of arms by the Russian corporation Rosoboronexport to the Syrian government, which is likely to have committed crimes against humanity since March 2011 and war crimes since mid-2012. The theoretical conclusions are applied to a discussion on the potential criminal responsibility of the Director General of Rosoboronexport for aiding and abetting the commission of international crimes by high-level Syrian officials.
MASSIVE PROTOPLANETARY DISKS IN ORION BEYOND THE TRAPEZIUM CLUSTER
International Nuclear Information System (INIS)
Mann, Rita K.; Williams, Jonathan P.
2009-01-01
We present Submillimeter Array 1 The Submillimeter Array is a joint project between the Submillimeter Astrophysical Observatory and the Academica Sinica Institute of Astronomy and Astrophysics and is funded by the Smithsonian Institution and the Academica Sinica. observations of the 880 μm continuum emission from three circumstellar disks around young stars in Orion that lie several arcminutes (∼> 1 pc) north of the Trapezium cluster. Two of the three disks are in the binary system 253-1536. Silhouette disks 216-0939 and 253-1536a are found to be more massive than any previously observed Orion disks, with dust masses derived from their submillimeter emission of 0.045 M sun and 0.066 M sun , respectively. The existence of these massive disks reveals that the disk mass distribution in Orion does extend to high masses, and that the truncation observed in the central Trapezium cluster is a result of photoevaporation due to the proximity of O-stars. 253-1536b has a disk mass of 0.018 M sun , making the 253-1536 system the first optical binary in which each protoplanetary disk is massive enough to potentially form solar systems.
Study of the effect of moisture content and bending rate on the fracture toughness of rocks
Czech Academy of Sciences Publication Activity Database
Vavro, Leona; Souček, Kamil
2013-01-01
Roč. 10, č. 2 (2013), s. 247-253 ISSN 1214-9705 R&D Projects: GA MŠk ED2.1.00/03.0082 Institutional support: RVO:68145535 Keywords : fracture toughness * bending rate * tensile strength Subject RIV: DB - Geology ; Mineralogy Impact factor: 0.667, year: 2013 http://www.irsm.cas.cz/materialy/acta_content/2013_02/acta_170_14_Vavro_Soucek_247-253.pdf
Palladium complexes of pyrrole-2-aldehyde thiosemicarbazone ...
Indian Academy of Sciences (India)
Chem. Rev. 253 1384; (j) Lobana T S, Sharma. R, Bawa G and Khanna S 2009 Coord. Chem. Rev. 253. 977; (k) Quiroga A G and Ranninger C N 2004 Coord. Chem. Rev. 248 119; (l) Dilworth J R, Arnold P, Morales. D, Wong Y L and Zheng Y 2002 Modern Coord. Chem. 217; (m) West D X, Liberta A E, Padhye S B, Chikate.
Ma, Yingyu; Luo, Wei; Bunch, Brittany L; Pratt, Rachel N; Trump, Donald L; Johnson, Candace S
2017-09-01
Metastasis is the major cause of bladder cancer death. 1,25D 3 , the active metabolite of vitamin D, has shown anti-metastasis activity in several cancer model systems. However, the role of 1,25D 3 in migration and invasion in bladder cancer is unknown. To investigate whether 1,25D 3 affects migration and invasion, four human bladder cell lines with different reported invasiveness were selected: low-invasive T24 and 253J cells and highly invasive 253J-BV and TCCSUP cells. All of the four bladder cancer cells express endogenous and inducible vitamin D receptor (VDR) as examined by immunoblot analysis. 1,25D 3 had no effect on the proliferation of bladder cancer cells as assessed by MTT assay. In contrast, 1,25D 3 suppressed migration and invasion in the more invasive 253J-BV and TCCSUP cells, but not in the low-invasive 253J and T24 cells using "wound" healing, chemotactic migration and Matrigel-based invasion assays. 1,25D 3 promoted the expression of miR-101-3p and miR-126-3p in 253J-BV cells as examined by qRT-PCR. miR-101-3p inhibitor partially abrogated and pre-miR-101-3p further suppressed the inhibition of 1,25D 3 on migration and invasion in 253J-BV cells. Further, 1,25D 3 enhanced VDR recruitment to the promoter region of miR-101-3p using ChIP-qPCR assay. 1,25D 3 enhanced the promoter activity of miR-101-3p as evaluated by luciferase reporter assay. Taken together, 1,25D 3 suppresses bladder cancer cell migration and invasion in two invasive/migration competent lines but not in two less invasive/motile lines, which is partially through the induction of miR-101-3p expression at the transcriptional level.
DDN (Defence Data Network) Protocol Implementations and Vendors Guide
1988-08-01
Artificial Intelligence Laboratory Room NE43-723 545 Technology Square Cambridge, MA 02139 (617) 253-8843 S John Wroclawski, (JTW@AI.AJ.MIT.EDU...Massachusetts Institute of Technology Artificial Intelligence Laboratory Room NE43-743 545 Technology Square 0 Cambridge, MA 02139 (617) 253-7885 ORDERING...TCP/IP Network Software for PC-DOS Systems CPU: IBM-PC/XT/AT/compatible in conjunction with EXOS 205 Inteligent Ethernet Controller for PCbus 0/s
Czech Academy of Sciences Publication Activity Database
Sulimenko, Vadym; Macůrek, Libor; Dráberová, Eduarda; Richterová, Věra; Sulimenko, Tetyana; Dráberová, Lubica; Marková, Vladimíra; Dráber, Pavel
2009-01-01
Roč. 276, č. 1 (2009), s. 253-253 ISSN 1742-464X. [FEBS Congress /34/. 04.07.2009-09.07.2009, Praha] R&D Projects: GA MŠk 1M0506; GA MŠk LC545; GA ČR GA204/05/2375; GA ČR GA304/04/1273 Institutional research plan: CEZ:AV0Z50520514 Keywords : detergent -resistant membrane * Fyn * PI3K gamma-tubulin Subject RIV: EB - Genetics ; Molecular Biology
Acute Cannabis Intoxication and the Brain's Response to Visual Erotica: An Fmri Study
Czech Academy of Sciences Publication Activity Database
Androvičová, R.; Horáček, J.; Tintěra, J.; Rydlo, J.; Ježová, D.; Balíková, M.; Hložek, T.; Mikšátková, P.; Kuchař, M.; Hlinka, Jaroslav; Roman, M.; Tomíček, P.; Viktorínová, M.; Tylš, F.; Páleníček, T.
2017-01-01
Roč. 14, č. 5 (2017), e253-e253 ISSN 1743-6095. [Congress of the World Association for Sexual Health /23./. 28.05.2017-31.05.2017, Prague] Grant - others:GA MV(CZ) VG20122015080; GA MZd NT13145; GA MŠk(CZ) LO1611 Institutional support: RVO:67985807 Keywords : fMRI * cannabis * sexuality Subject RIV: FH - Neurology http://www.jsm.jsexmed.org/article/S1743-6095(17)30689-6/pdf
International Nuclear Information System (INIS)
Dávila, María J.; Gedanitz, Holger; Span, Roland
2016-01-01
Highlights: • Speed of sound measurements were made in aliphatic alcohols and alkanediols. • Speeds of sound were measured in a wide temperature and pressure range. • A pulse-echo method with a double path type sensor operating at 8 MHz was employed. • A double polynomial equation was used to fit the experimental speed of sound data. • The accurate results were compared with available literature sources. - Abstract: Speeds of sound have been measured in three saturated aliphatic alcohols (propan-2-ol, butan-2-ol, and 2-methylpropan-1-ol) and three alkanediols (ethane-1,2-diol, propane-1,2- and -1,3-diol) in the temperature range from (253.15 to 353.15) K and pressures up to 30 MPa by use of a pulse-echo method with a double path type sensor operating at 8 MHz. The expanded overall uncertainties (k = 2) in the speed of sound measurements are estimated to be 0.013% for propan-2-ol, 0.019% for butan-2-ol, 0.01% for 2-methylpropan-1-ol, 0.009% for ethane-1,2-diol, 0.02% for propane-1,2-diol, and 0.07% for propane-1,3-diol. Experimental speeds of sound data were correlated with the temperature and pressure with an empirical double polynomial equation. Our results were also compared with the available literature data and a satisfactory agreement was found.
The Transplutonium. The superheavy nuclei found in the micas of Madagascar and their interests
International Nuclear Information System (INIS)
Raoelina Andriambololona
1976-01-01
Since June 1976, evidence for the existence of superheavy elements is discussed about. After having recalled artificial elements with atomic numbers Z of wich go from Z=95 (Americium) to Z=107 (built in 1976), superheavy elements having Z greater than 110 are considered. They have been discovered by american searchers in giant halos seen in Madagascar micas. The samples have been recoked in the Fort-Dauphin region (Haut Mandrare). The corresponding numbers Z are 114, 115, 116, 124, 125, 125, 126, 127. It seems that the existence of Z=126 element should be accepted with a greater degree of confidence. But different experiences done by other groups seem to show the evidence of superheavy elements in micas looks weaker. Nevertheless, it is interesting to investigate the evidence or the non-evidence of those elements. We estimate the mass numbers A of those superheavy elements in the liquid drop model if we assume that they are stable versus β. The results thus obtained agree with the shell-model ones within 4 % approximation. We propose if the evidence of superheavies is confirmed to give the name of madagascarium to one of them (Z=126) by similitude with francium, lutetium, polonium, berkelium, americium, europium, ...Their evidence was first conjectured in Madagascar micas in 1976. Superheavy nuclei are to be distinguished from hypernuclei. [fr
37 CFR 253.7 - Recording rights, rates and terms.
2010-07-01
...-distributed program, the royalty fees shall be calculated by multiplying the following per-composition rates... royalty fee shall be calculated by multiplying the following per-composition rates by the number of... royalty fees shall be calculated by multiplying the following per-composition rates by the number of...
253 Education and the Paradox of Graduate Unemployment: The ...
African Journals Online (AJOL)
FIRST LADY
2011-01-18
Jan 18, 2011 ... basically four major types of unemployment; the cyclical, seasonal, frictional and structural. Cyclical unemployment is the type of joblessness that occurs as a result of lower rates of production, during recessions in business cycles resulting in massive layoffs of workers. Seasonal unemployment results from.
253 Education and the Paradox of Graduate Unemployment: The ...
African Journals Online (AJOL)
FIRST LADY
2011-01-18
Jan 18, 2011 ... The paper is an assessment of education, graduate unemployment and the ... acknowledged as a legitimized vehicle for self and societal advancement. The ... curriculum and pedagogical reforms, upgrading existing facilities to match ... It is against this background that the paper examines the issue of.
19 CFR 10.253 - Articles eligible for preferential treatment.
2010-04-01
... limited to, mechanical, quartz digital or quartz analog, if those watches or watch parts contain any... than fair market value, its cost or value will be determined by computing the sum of: (1) All expenses...
All projects related to | Page 253 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Markets in developing countries are often marked by anti-competitive behaviour, concentrated market power, and low access for newcomers. ... Adding a social science perspective to the field of health policy and systems research can help developing countries address health problems in a more comprehensive way.
Strouhal number of bridge cables with ice accretion at low flow turbulence
Czech Academy of Sciences Publication Activity Database
Górski, P.; Pospíšil, Stanislav; Kuznetsov, Sergeii; Tatara, M.; Marušić, Ante
2016-01-01
Roč. 22, č. 2 (2016), s. 253-272 ISSN 1226-6116 R&D Projects: GA MŠk(CZ) LO1219; GA ČR(CZ) GC13-34405J; GA ČR(CZ) GA14-12892S Keywords : bridge cable * ice accretion * Strouhal number * angle of attack * vortex shedding frequency Subject RIV: JM - Building Engineering Impact factor: 0.868, year: 2016 http://koreascience.or.kr/article/ArticleFullRecord.jsp?cn=KJKHCF_2016_v22n2_253
Dynamic temperature fields under Mars landing sites and implications for supporting microbial life.
Ulrich, Richard; Kral, Tim; Chevrier, Vincent; Pilgrim, Robert; Roe, Larry
2010-01-01
While average temperatures on Mars may be too low to support terrestrial life-forms or aqueous liquids, diurnal peak temperatures over most of the planet can be high enough to provide for both, down to a few centimeters beneath the surface for some fraction of the time. A thermal model was applied to the Viking 1, Viking 2, Pathfinder, Spirit, and Opportunity landing sites to demonstrate the dynamic temperature fields under the surface at these well-characterized locations. A benchmark temperature of 253 K was used as a lower limit for possible metabolic activity, which corresponds to the minimum found for specific terrestrial microorganisms. Aqueous solutions of salts known to exist on Mars can provide liquid solutions well below this temperature. Thermal modeling has shown that 253 K is reached beneath the surface at diurnal peak heating for at least some parts of the year at each of these landing sites. Within 40 degrees of the equator, 253 K beneath the surface should occur for at least some fraction of the year; and, within 20 degrees , it will be seen for most of the year. However, any life-form that requires this temperature to thrive must also endure daily excursions to far colder temperatures as well as periods of the year where 253 K is never reached at all.
Gene Therapy for Fracture Repair
2007-05-01
modulator-1; c-myc binding protein [ Homo sapiens ]. regulation of transcription, DNA dependent NM_012488 1.55 2.53 Rattus norvegicus α-2-macroglobulin...myc binding protein [ Homo sapiens ] Regulation of transcription, DNA dependent NM_012488 1.55 2.53 Rattus norvegicus α-2-macroglobulin (A2m) Protease...1-HIV LTR-MLV Promoter EG FP -C el l N um be r (M ea n) 10 ul Vector 50 ul Vector 7 Periosteal/Endosteal Cell Transduction 0 200 400 600 800
Microstructures and Mechanical Properties of Inconel 718 Alloy at Ultralow Temperatures
Yao, C. G.; Lv, H. J.; Yi, D. Q.; Meng, S.; Xiao, L. R.; Wang, B.
2018-05-01
The microstructures and mechanical properties of powder metallurgy Inconel 718 alloy were investigated in the temperatures range between 25 and - 253 °C. Tensile strength increased with the decrease in temperature, while the ductility first increased and then decreased. There was no significant change in impact toughness. When the temperature was - 253 °C, a zigzag stress-strain curve was observed for the alloy, owing to the interaction of dislocation glide and twinning, which effectively maintained the relatively good ductility.
Nuclear structure investigations of neutron deficient nuclei in the region Z=103 to 105
International Nuclear Information System (INIS)
Hessberger, F. P.; Hofmann, S.; Armbruster, P.; Muenzenberg, G.; Stodel, Ch.; Ackermann, D.; Lavrentev, A. Yu.; Popeko, A. G.; Yeremin, A. V.; Saro, S.; Leino, M.
1999-01-01
The isotopes 257,255 Rf, 257,256 Db, 253,252 Lr have been produced in bombardments of 207,208 Pb and 209 Bi target nuclei with 50 Ti and identified by their α-decay. New or improved decay data could be obtained. Analysis of the fine structure of the α-decay pattern of 257 Rf allowed the construction of a first tentative level scheme for the daughter nucleus 253 No and also the identification of a low lying high spin isomeric state, while from α-γ- coincidence measurements for 255 Rf a first tentative level scheme of the daughter nucleus 251 No was derived. For 257 Db we found that two nuclear levels decay by α-emission and populate also different levels in the daughter nucleus 253 Lr. The levels are produced by the reaction process. In bombardments of 209 Bi with 50 Ti at E CN *=26.4 MeV and 30.8 MeV the previously unknown isotopes 256 Db and 252 Lr were identified
Postnatal brain and skull growth in an Apert syndrome mouse model
Hill, Cheryl A.; Martínez-Abadías, Neus; Motch, Susan M.; Austin, Jordan R.; Wang, Yingli; Jabs, Ethylin Wang; Richtsmeier, Joan T.; Aldridge, Kristina
2012-01-01
Craniofacial and neural tissues develop in concert throughout pre- and postnatal growth. FGFR-related craniosynostosis syndromes, such as Apert syndrome (AS), are associated with specific phenotypes involving both the skull and the brain. We analyzed the effects of the FGFR P253R mutation for Apert syndrome using the Fgfr2+/P253R mouse to evaluate the effects of this mutation on these two tissues over the course of development from day of birth (P0) to postnatal day 2 (P2). Three-dimensional magnetic resonance microscopy and computed tomography images were acquired from Fgfr2+/P253R mice and unaffected littermates at P0 (N=28) and P2 (N=23). 3D coordinate data for 23 skull and 15 brain landmarks were statistically compared between groups. Results demonstrate that the Fgfr2+/P253R mice show reduced growth in the facial skeleton and the cerebrum, while the height and width of the neurocranium and caudal regions of the brain show increased growth relative to unaffected littermates. This localized correspondence of differential growth patterns in skull and brain point to their continued interaction through development and suggest that both tissues display divergent postnatal growth patterns relative to unaffected littermates. However, the change in the skull-brain relationship from P0 to P2 implies that each tissue affected by the mutation retains a degree of independence, rather than one tissue directing the development of the other. PMID:23495236
ORF Alignment: Ca19AnnotatedDec2004aaSeq [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available P 192 ... Query: 276 EKIINVDYSYKSPIPLPPDVIQLIDSILISEPSARATIPHIMSSRWFSDIPWDD 329 ... ... ... EKIINVDYSYKSPIPLPPDVIQLIDSILISEPSARATIPHIMSSRWFSDIPWDD Sbjct: 253 EKIINVDYSYKSPIPLPPDVIQLIDSILISEPSARATIPHIMSSRWFSDIPWDD 306
Results of the Elections to the Governing Board of the Pensions Fund
2006-01-01
Voting papers issued Ballot papers returned Ballot papers declared null 3'193 1'338 0 Total number of votes Blank votes Null votes Valid votes 1'338 24 61 1'253 Valid ballot papers cast as follows : 1'253 Michel GOOSSENS Henrik VESTERGARD 820 433 Votes cast (percentage) 41.90 % Thus Mr Michel GOOSSENS is elected member of the Governing Board, as from 1 January 2007 for three years.Mr Henrik VESTERGARD is elected alternate member of the Board as from 1 January 2007 for three years. F. Ranjard J. Lahaye
ORF Alignment: NC_000917 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available us ... Length = 119 ... Query: 253 KPKKVLFLSRSNDCRTKIAEAIFNHISPNNMLAVSAGIEPAQDLDLRAVATMRELGLKIN 312 ... ... ... KPKKVLFLSRSNDCRTKIAEAIFNHISPNNMLAVSAGIEPAQDLDLRAVATMRELGLKIN Sbjct: 1 ... KPKKVLFLSRSNDCRTKIAEAIFNHISPNNMLAVSAGIEPAQDLDLRAVATMRELGLKIN 60 ...
Radiochemical studies of neutron deficient actinide isotopes
International Nuclear Information System (INIS)
Williams, K.E.
1978-04-01
The production of neutron deficient actinide isotopes in heavy ion reactions was studied using alpha, gamma, x-ray, and spontaneous fission detection systems. A new isotope of berkelium, 242 Bk, was produced with a cross-section of approximately 10 μb in reactions of boron on uranium and nitrogen on thorium. It decays by electron capture with a half-life of 7.0 +- 1.3 minutes. The alpha-branching ratio for this isotope is less than 1% and the spontaneous fission ratio is less than 0.03%. Studies of (Heavy Ion, pxn) and (Heavy Ion, αxn) transfer reactions in comparison with (Heavy ion, xn) compound nucleus reactions revealed transfer reaction cross-sections equal to or greater than the compound nucleus yields. The data show that in some cases the yield of an isotope produced via a (H.I.,pxn) or (H.I.,αxn) reaction may be higher than its production via an xn compound nucleus reaction. These results have dire consequences for proponents of the ''Z 1 + Z 2 = Z/sub 1+2/'' philosophy. It is no longer acceptable to assume that (H.I.,pxn) and (H.I.,αxn) product yields are of no consequence when studying compound nucleus reactions. No evidence for spontaneous fission decay of 228 Pu, 230 Pu, 232 Cm, or 238 Cf was observed indicating that strictly empirical extrapolations of spontaneous fission half-life data is inadequate for predictions of half-lives for unknown neutron deficient actinide isotopes
International Nuclear Information System (INIS)
Moeser, Christina
2010-01-01
The development of a disposal in deep geological formations for radioactive waste is a very important task for the future. The safety assessment for more than a hundred thousand years needs a full understanding of all processes of interaction between the radioactive waste and the surrounded formations. This work contributes to this understanding. The interaction between lanthanides (homologues of the actinides americium, curium and berkelium) / uranium and the host rock opalinus clay under influence of organic substances (NOM) have been analyzed and discussed. The complex system was split into 3 binary basic systems with the following interactions - Interactions between lanthanides / uranium and NOM - Interactions between lanthanides / uranium and the opalinus clay - Interactions between NOM and opalinus clay All binary systems can be influenced by geological parameters like pH, ion strength and competing cations. The sorption / desorption of the lanthanides onto the opalinus clay is analyzed via inductively coupled plasma mass spectrometry. For the investigation of the complexation behavior of metals with NOM we used capillary electrophoresis coupled with inductively coupled plasma mass spectrometry. Under these conditions the chosen model organic humic acid affected the sorption of the lanthanides onto opalinus clay favorably. The smaller organic compounds, which dominate in the composition of the clay organics, remobilized the metals after sorption onto clay and the sorption can be inhibited by NOM. Due to the reduced metal sorption onto Opalinus clay by NOM, a migration through the clay may be possible.
People and things. CERN Courier, Apr 1985, v.25(3)
Energy Technology Data Exchange (ETDEWEB)
Anon.
1985-04-15
The article reports on achievements of various people, staff changes and position opportunities within the CERN organization and contains news updates on upcoming or past events. To commemorate the 25th anniversary of Austria's joining CERN and the forming of the first high energy physics group in the country, a celebration took place last November in the Auditorium of the old University of Vienna. From 25-28 February next year, another (the fourth) Vienna Wire Chamber Conference will take place. The fifth US Summer School on High Energy Particle Accelerators is to be held at the Stanford Linear Accelerator Center from 15-26 July.
People and things. CERN Courier, Apr 1985, v.25(3)
International Nuclear Information System (INIS)
Anon.
1985-01-01
The article reports on achievements of various people, staff changes and position opportunities within the CERN organization and contains news updates on upcoming or past events. To commemorate the 25th anniversary of Austria's joining CERN and the forming of the first high energy physics group in the country, a celebration took place last November in the Auditorium of the old University of Vienna. From 25-28 February next year, another (the fourth) Vienna Wire Chamber Conference will take place. The fifth US Summer School on High Energy Particle Accelerators is to be held at the Stanford Linear Accelerator Center from 15-26 July
International Nuclear Information System (INIS)
Gorelic, L.; Parker, D.
1978-01-01
The effects of 254-nm radiation on the structural integrities of free and 50S ribosome-bound 5S and 23S ribosomal ribonucleic acids (rRNA) have been elucidated. Irradiation of aqueous solutions of Escherichia coli 50S ribosomes with 253.7-nm radiation results in the formation of single-strand breaks in double-stranded regions of the 23S rRNA component, but not in rRNA chain scission, and destabilization of the secondary structure of the 23S rRNA toward denaturation. The minimum doses of 253.7-nm radiation required for the first detection of the two effects are 7 x 10 19 quanta for the production of single-strand breaks in double-stranded regions of the 23S rRNA, and 19 quanta for destabilization of the 23S rRNA secondary structure. Free 23S rRNA is resistant toward photoinduced chain breakage at doses of 253.7-nm radiation up to at least 2.3 x 10 20 and is much less sensitive toward destabilization of secondary structure than ribosome-bound 23S rRNA. In contrast to the photosensitivity of 50S ribosome-bound 23S rRNA toward chain breakage, 50S ribosome-bound 5S rRNA is resistant toward chain breakage at doses of 253.7-nm radiation up to at least 2.3 x 10 20 quanta. Ribosome-bound 5S and 23S rRNA are also not photosensitive toward intermolecular 5S/23S rRNA cross-linkage
Some Biological Activities of Malaysian Leech Saliva Extract
Directory of Open Access Journals (Sweden)
Abdualrahman M. Abdualkader
2011-12-01
Full Text Available Normal 0 21 false false false MS X-NONE AR-SA Leeches were fed on the phagostimulatory solution through parafilm membrane. The satiated leeches were forced to regurgitate the solution by soaking them in an ice-container. The anticoagulant activity was ascertained using thrombin time assay (TT. The result revealed that the saliva concentration which increases TT by 100% (IC100 is 43.205µg/ml plasma. The antimicrobial activity of the saliva was tested against several bacterial spp. (E.coli, P.aeruginosa, B.cereus, Sal.typhi and S.aureus and fungi spp. (C.albicans and C.neoformans. It was found that saliva has an inhibition activity against Sal.typhi (minimal inhibitory concentration MIC 78.253µg/ml, S.aureus (MIC 78.253µg/ml and E.coli (MIC 121.256µg/ml.ABSTRAK: Pacat-pacat diberi makan larutan phagostimulatory menerusi membran parafilem. Pacat-pacat yang kekenyangan itu dipaksa memuntahkan larutan tersebut dengan direndam di dalam bekas berisi ais. Aktiviti antigumpal ditentukan menggunakan cerakin masa trombin (TT. Keputusan menunjukkan kepekatan air liur pacat menyebabkan pertambahan TT sebanyak 100% (IC100 iaitu 43.205µg/ml plasma. Aktiviti antimikrob air liur telah diuji dengan pelbagai jenis bakteria (E.coli, P.aeruginosa, B.cereus, Sal.typhi dan S.aureus dan pelbagai jenis kulat (C.albicans and C.neoformans. Didapati air liur menghasilkan aktiviti perencatan terhadap Sal.typhi (kepekatan perencat minima (Minimal inhibitory concentration - MIC 78.253µg/ml, S.aureus (MIC 78.253µg/ml dan E.coli (MIC 121.256µg/ml.
Directory of Open Access Journals (Sweden)
Patricia Blanchet
2017-08-01
Full Text Available Deletions at chromosome 2p25.3 are associated with a syndrome consisting of intellectual disability and obesity. The smallest region of overlap for deletions at 2p25.3 contains PXDN and MYT1L. MYT1L is expressed only within the brain in humans. We hypothesized that single nucleotide variants (SNVs in MYT1L would cause a phenotype resembling deletion at 2p25.3. To examine this we sought MYT1L SNVs in exome sequencing data from 4, 296 parent-child trios. Further variants were identified through a genematcher-facilitated collaboration. We report 9 patients with MYT1L SNVs (4 loss of function and 5 missense. The phenotype of SNV carriers overlapped with that of 2p25.3 deletion carriers. To identify the transcriptomic consequences of MYT1L loss of function we used CRISPR-Cas9 to create a knockout cell line. Gene Ontology analysis in knockout cells demonstrated altered expression of genes that regulate gene expression and that are localized to the nucleus. These differentially expressed genes were enriched for OMIM disease ontology terms "mental retardation". To study the developmental effects of MYT1L loss of function we created a zebrafish knockdown using morpholinos. Knockdown zebrafish manifested loss of oxytocin expression in the preoptic neuroendocrine area. This study demonstrates that MYT1L variants are associated with syndromic obesity in humans. The mechanism is related to dysregulated expression of neurodevelopmental genes and altered development of the neuroendocrine hypothalamus.
ORF Alignment: NC_005362 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available TALTKLRSYSRELEKSLKERHFLANCVVLKVRDANFKTI 312 ... ERNRKSIGIERTFNQNLFDENTALTKLR...SYSRELEKSLKERHFLANCVVLKVRDANFKTI Sbjct: 241 ERNRKSIGIERTFNQNLFDENTALTKLRSYSRELEKSLKERHFLANCVVLKVRDANFKTI 300 ... ...ct: 121 PVRIAALLQERIYQRIGLTSSFGVSYNKFLAKMGSEYAKPFGRTVIKPEGARDFLAKQPI 180 ... Query: 253 ERNRKSIGIERTFNQNLFDEN
ORF Alignment: NC_004193 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available PVHFIQGDATEDDTIKKA Sbjct: 1 ... HFIFVGWNERTRQLMKLVLEYYPGRRIVVIDKTVNKLTYKEYPVHFIQGDATEDDTIKKA 60 ... Query: 236 TIIRSN...DFMSNLFFHELD 253 ... TIIRSNDFMSNLFFHELD Sbjct: 121 TIIRSNDFMSNLFFHELD 138
Ring Chromosome 17 Not Involving the Miller-Dieker Region: A Case with Drug-Resistant Epilepsy.
Coppola, Antonietta; Morrogh, Deborah; Farrell, Fiona; Balestrini, Simona; Hernandez-Hernandez, Laura; Krithika, S; Sander, Josemir W; Waters, Jonathan J; Sisodiya, Sanjay M
2017-12-01
Chromosomal abnormalities are often identified in people with neurodevelopmental disorders including intellectual disability, autism, and epilepsy. Ring chromosomes, which usually involve gene copy number loss, are formed by fusion of subtelomeric or telomeric chromosomal regions. Some ring chromosomes, including ring 14, 17, and 20, are strongly associated with seizure disorders. We report an individual with a ring chromosome 17, r(17)(p13.3q25.3), with a terminal 17q25.3 deletion and no short arm copy number loss, and with a phenotype characterized by intellectual disability and drug-resistant epilepsy, including a propensity for nonconvulsive status epilepticus.
African Journals Online (AJOL)
Adeyinka Odunsi
leaves, 2, 3, 4 and 5 times per day were investigated in a 5x5 factorial arrangement fitted into a completely randomized ... maturity, variety, climate, season, exposure .... 2.79a-d. 2.53c-f. 2.59b-f 2.38ef 2.44. J1C1. 1.64h-j. 1.51ij. 1.68h-j. 1.76g-i 1.89gh 1.70. C1J2. 2.53c-f. 2.84ab. 3.00a. 2.98a. 2.81a-c 2.83. Mean. 1.98. 2.46.
Area Handbook for Guinea. Second Edition
1975-01-01
227. 283; and defense assistance, 320, 341 I Eisenhower. Dwight D.: 194 [elders me almt social system): 79. fS. 103; j council« of. 81, 85; and... almt eiectricity): 6. ! 41, 46. 55. 2«t. 291; dams. 289; Konkourp i pn>ject. 223; potential, 273, 277. 28» | lie de Goree: 17. 20 | lies de...375 Prui. 8S tivMtwk itre almt emk-, hc-niing. nu-mt »upplyi; !«»-10l. 245. 253. 2S4, 30*26»; fhM-krt». IS*: fcncm». H»-I«i; «wit*. 1», 253. 3
ORF Alignment: NC_002678 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available esorhizobium ... loti MAFF303099] ... Length = 291 ... Query: 194 YTFATLVDPHEELPPSEISSLRYWAKIAEKM...GVEIEPITRKDLAKLANYDALFIRETTSI 253 ... YTFATLVDPHEELPPSEISSLRYWAKIAEKMGVEIE...PITRKDLAKLANYDALFIRETTSI Sbjct: 1 ... YTFATLVDPHEELPPSEISSLRYWAKIAEKMGVEIEPITRKDLAKLANYDALFIRETTSI 60 ... Query:
Directory of Open Access Journals (Sweden)
Ryuhei Hayashi
Full Text Available Induced pluripotent stem (iPS cells can be established from somatic cells. However, there is currently no established strategy to generate corneal epithelial cells from iPS cells. In this study, we investigated whether corneal epithelial cells could be differentiated from iPS cells. We tested 2 distinct sources: human adult dermal fibroblast (HDF-derived iPS cells (253G1 and human adult corneal limbal epithelial cells (HLEC-derived iPS cells (L1B41. We first established iPS cells from HLEC by introducing the Yamanaka 4 factors. Corneal epithelial cells were successfully induced from the iPS cells by the stromal cell-derived inducing activity (SDIA differentiation method, as Pax6(+/K12(+ corneal epithelial colonies were observed after prolonged differentiation culture (12 weeks or later in both the L1B41 and 253G1 iPS cells following retinal pigment epithelial and lens cell induction. Interestingly, the corneal epithelial differentiation efficiency was higher in L1B41 than in 253G1. DNA methylation analysis revealed that a small proportion of differentially methylated regions still existed between L1B41 and 253G1 iPS cells even though no significant difference in methylation status was detected in the specific corneal epithelium-related genes such as K12, K3, and Pax6. The present study is the first to demonstrate a strategy for corneal epithelial cell differentiation from human iPS cells, and further suggests that the epigenomic status is associated with the propensity of iPS cells to differentiate into corneal epithelial cells.
Galvez-Ruiz, Alberto; Galindo-Ferreiro, Alicia; Schatz, Patrik
2018-04-01
In this study, the authors present a sample of 71 patients with hereditary optic neuropathy and negative genetic test results for OPA1/OPA3/LHON. All of these patients later underwent genetic testing to rule out WFS. As a result, 53 patients (74.7%) were negative and 18 patients (25.3%) were positive for some type of mutation or variation in the WFS gene. The authors believe that this study is interesting because it shows that a sizeable percentage (25.3%) of patients with hereditary optic 25 neuropathy and negative genetic test results for OPA1/OPA3/LHON had WFS mutations or variants.
Radiochemical studies of neutron deficient actinide isotopes
Energy Technology Data Exchange (ETDEWEB)
Williams, K.E.
1978-04-01
The production of neutron deficient actinide isotopes in heavy ion reactions was studied using alpha, gamma, x-ray, and spontaneous fission detection systems. A new isotope of berkelium, /sup 242/Bk, was produced with a cross-section of approximately 10 ..mu..b in reactions of boron on uranium and nitrogen on thorium. It decays by electron capture with a half-life of 7.0 +- 1.3 minutes. The alpha-branching ratio for this isotope is less than 1% and the spontaneous fission ratio is less than 0.03%. Studies of (Heavy Ion, pxn) and (Heavy Ion, ..cap alpha..xn) transfer reactions in comparison with (Heavy ion, xn) compound nucleus reactions revealed transfer reaction cross-sections equal to or greater than the compound nucleus yields. The data show that in some cases the yield of an isotope produced via a (H.I.,pxn) or (H.I.,..cap alpha..xn) reaction may be higher than its production via an xn compound nucleus reaction. These results have dire consequences for proponents of the ''Z/sub 1/ + Z/sub 2/ = Z/sub 1+2/'' philosophy. It is no longer acceptable to assume that (H.I.,pxn) and (H.I.,..cap alpha..xn) product yields are of no consequence when studying compound nucleus reactions. No evidence for spontaneous fission decay of /sup 228/Pu, /sup 230/Pu, /sup 232/Cm, or /sup 238/Cf was observed indicating that strictly empirical extrapolations of spontaneous fission half-life data is inadequate for predictions of half-lives for unknown neutron deficient actinide isotopes.
Paul Scherrer Institute Scientific Report 1999. Volume I: Particles and Matter
International Nuclear Information System (INIS)
Gobrecht, J.; Gaeggeler, H.; Herlach, D.; Junker, K.; Kettle, P.-R.; Kubik, P.; Zehnder, A.
2000-01-01
Although originally planned for fundamental research in nuclear physics, the particle beams of pions, muons, protons and neutrons are now used in a large variety of disciplines in both natural science and medicine. The beams at PSI have the world's highest intensities and therefore allow certain experiments to be performed, which would not be possible elsewhere. The highlight of research this year was the first-ever determination of the chemical properties of the superheavy element 107 Bohrium. This was undertaken, by an international team led by H. Gaeggeler of PSI's Laboratory for Radiochemistry. Bohrium was produced by bombarding a Berkelium target with Neon ions from the Injector I cyclotron and six atoms were detected after having passed through an online gas chromatography device. At the Laboratory for Particle Physics the focus has shifted from nuclear physics to elementary particle physics with about a fifty-fifty split between investigations of rare processes or particle decays using the high intensity muon, pion and recently also polarized neutron beams of PSI, and research at the highest energy frontier at CERN (Geneva) and DESY (Hamburg). Important space instrumentation has been contributed by the Laboratory for Astrophysics to the European Space Agency and NASA satellite programmes. The Laboratory for Micro and Nanotechnology continued to focus on research into molecular nanotechnology and SiGeC nanostructures, the latter with the aim of producing silicon based optoelectronics. Progress in 1999 in these topical areas is described in this report. A list of scientific publications in 1999 is also provided
Paul Scherrer Institute Scientific Report 1999. Volume I: Particles and Matter
Energy Technology Data Exchange (ETDEWEB)
Gobrecht, J.; Gaeggeler, H.; Herlach, D.; Junker, K.; Kettle, P.-R.; Kubik, P.; Zehnder, A. [eds.
2000-07-01
lthough originally planned for fundamental research in nuclear physics, the particle beams of pions, muons, protons and neutrons are now used in a large variety of disciplines in both natural science and medicine. The beams at PSI have the world's highest intensities and therefore allow certain experiments to be performed, which would not be possible elsewhere. The highlight of research this year was the first-ever determination of the chemical properties of the superheavy element {sup 107} Bohrium. This was undertaken, by an international team led by H. Gaeggeler of PSI's Laboratory for Radiochemistry. Bohrium was produced by bombarding a Berkelium target with Neon ions from the Injector I cyclotron and six atoms were detected after having passed through an online gas chromatography device. At the Laboratory for Particle Physics the focus has shifted from nuclear physics to elementary particle physics with about a fifty-fifty split between investigations of rare processes or particle decays using the high intensity muon, pion and recently also polarized neutron beams of PSI, and research at the highest energy frontier at CERN (Geneva) and DESY (Hamburg). Important space instrumentation has been contributed by the Laboratory for Astrophysics to the European Space Agency and NASA satellite programmes. The Laboratory for Micro and Nanotechnology continued to focus on research into molecular nanotechnology and SiGeC nanostructures, the latter with the aim of producing silicon based optoelectronics. Progress in 1999 in these topical areas is described in this report. A list of scientific publications in 1999 is also provided.
Paul Scherrer Institute Scientific Report 1999. Volume I: Particles and Matter
Energy Technology Data Exchange (ETDEWEB)
Gobrecht, J; Gaeggeler, H; Herlach, D; Junker, K; Kettle, P -R; Kubik, P; Zehnder, A [eds.
2000-07-01
lthough originally planned for fundamental research in nuclear physics, the particle beams of pions, muons, protons and neutrons are now used in a large variety of disciplines in both natural science and medicine. The beams at PSI have the world's highest intensities and therefore allow certain experiments to be performed, which would not be possible elsewhere. The highlight of research this year was the first-ever determination of the chemical properties of the superheavy element {sup 107} Bohrium. This was undertaken, by an international team led by H. Gaeggeler of PSI's Laboratory for Radiochemistry. Bohrium was produced by bombarding a Berkelium target with Neon ions from the Injector I cyclotron and six atoms were detected after having passed through an online gas chromatography device. At the Laboratory for Particle Physics the focus has shifted from nuclear physics to elementary particle physics with about a fifty-fifty split between investigations of rare processes or particle decays using the high intensity muon, pion and recently also polarized neutron beams of PSI, and research at the highest energy frontier at CERN (Geneva) and DESY (Hamburg). Important space instrumentation has been contributed by the Laboratory for Astrophysics to the European Space Agency and NASA satellite programmes. The Laboratory for Micro and Nanotechnology continued to focus on research into molecular nanotechnology and SiGeC nanostructures, the latter with the aim of producing silicon based optoelectronics. Progress in 1999 in these topical areas is described in this report. A list of scientific publications in 1999 is also provided.
Sud du Sahara | Page 253 | CRDI - Centre de recherches pour le ...
International Development Research Centre (IDRC) Digital Library (Canada)
Savoir. Innovation. Solutions. Carrières · Communiquez avec nous · Plan du site · Droits d'auteur · Éthique de la recherche · Politique de libre accès · Politique de confidentialité · Transparence · Utilisation du site Web. Suivez-nous; Facebook · Twitter · Youtube · Linked In · RSS Feed. © 2015 CRDI. Tous droits réservés.
253 some biochemical effects of a mainly fruit diet in man
African Journals Online (AJOL)
-carbohydrate diet. Conn" made similar observations. Insulin Secretion. The fruit diet produced a statistically significant reduc- tion in the plasma insulin response after glucose intake in some Bantu while in some Whites there was an inex-.
Radiative and mechanical feedback into the molecular gas of NGC 253
Rosenberg, M. J. F.; Kazandjian, M. V.; van der Werf, P. P.; Israel, F. P.; Meijerink, R.; Weiß, A.; Requena-Torres, M. A.; Güsten, R.
Starburst galaxies are galaxies or regions of galaxies undergoing intense periods of star formation. Understanding the heating and cooling mechanisms in these galaxies can give us insight to the driving mechanisms that fuel the starburst. Molecular emission lines play a crucial role in the cooling
: tous les projets | Page 253 | CRDI - Centre de recherches pour le ...
International Development Research Centre (IDRC) Digital Library (Canada)
Au Sahel, la sécheresse et la piètre fertilité des sols limitent grandement le rendement des cultures. Date de début : 1 mars 2011. End Date: 1 septembre 2014. Sujet: FOOD CROPS, SOIL FERTILITY, FERTILIZERS, FERTILIZING, RAIN FED FARMING, WATER MANAGEMENT, CROP YIELD, Food security. Région: Burkina ...
International Nuclear Information System (INIS)
King, L.J.; Bigelow, J.E.; Collins, E.D.
1977-12-01
During the period January 1, 1977, through June 30, 1977, the following amounts of transuranium elements were recovered from 12 irradiated HFIR targets: 0.1g 243 Am, 21g 244 Cm, 29.5 mg 249 Bk, 288 mg 252 Cf, 1.48 mg 253 Es, and 0.7 pg 257 Fm. One batch of high-purity 248 Cm (approximately 50 mg) was separated from 252 Cf. Twenty-three shipments were made from TRU during the period; recipients and the amounts of nuclides are tabulated. Five HFIR targets, each containing 8 to 9 g of curium, were fabricated. During the next 18 months, we expect to obtain totals of 92 mg of 249 Bk, 910 mg of 252 Cf, 3.8 mg of 253 Es (in a mixture of isotopes), 615 μg of high-purity 253 Es, and 1.6 pg of 257 Fm; we also expect to make available 250 mg of high-purity 248 Cm. No process or equipment changes were made during this report period. Five neutron sources were fabricated during this report period, bringing the total fabricated to date to 97. Two sources that had previously been returned to TRU were reassigned. Special projects included the following: (1) the enrichment of the 244 Pu concentration in 100 mg of plutonium by irradiation to burn out the lighter isotopes, (2) the separation of 245 pg of 254 Cf from 39-hr /sup 254m/Es that was produced by irradiation of 5 μg of 253 Es, and (3) an experimental separation of cerium from the other rare-earth elements in a TRU process waste solution. The values that we are currently using for transuranium element decay data and for cross-section data in planning irradiation-processing cycles, calculating production forecasts, and assaying products are tabulated in the Appendix
Directory of Open Access Journals (Sweden)
Wei Qi
Full Text Available The proteasome inhibitor bortezomib (Velcade is a promising new agent for bladder cancer therapy, but inducible cytoprotective mechanisms may limit its potential efficacy. We used whole genome mRNA expression profiling to study the effects of bortezomib on stress-induced gene expression in a panel of human bladder cancer cell lines. Bortezomib induced strong upregulation of the inducible HSP70 isoforms HSPA1A and HSPA1B isoforms of Hsp72 in 253J B-V and SW780 (HSPA1A(high cells, but only induced the HSPA1B isoform in UM-UC10 and UM-UC13 (HSPA1A(low cells. Bortezomib stimulated the binding of heat shock factor-1 (HSF1 to the HSPA1A promoter in 253JB-V but not in UM-UC13 cells. Methylation-specific PCR revealed that the HSPA1A promoter was methylated in the HSPA1A(low cell lines (UM-UC10 and UM-UC13, and exposure to the chromatin demethylating agent 5-aza-2'-deoxycytidine restored HSPA1A expression. Overexpression of Hsp72 promoted bortezomib resistance in the UM-UC10 and UM-UC13 cells, whereas transient knockdown of HSPA1B further sensitized these cells to bortezomib, and exposure to the chemical HSF1 inhibitor KNK-437 promoted bortezomib sensitivity in the 253J B-V cells. Finally, shRNA-mediated stable knockdown of Hsp72 in 253J B-V promoted sensitivity to bortezomib in vitro and in tumor xenografts in vivo. Together, our results provide proof-of-concept for using Hsp72 inhibitors to promote bortezomib sensitivity in bladder cancers and suggest that selective targeting of HSPA1B could produce synthetic lethality in tumors that display HSPA1A promoter methylation.
Male Specific Gene Expression in Dioecious Phoenix Dactylifera (Date Palm) Tree at Flowering Stage
International Nuclear Information System (INIS)
Al-Ameri, A. A.; Al-Qurainy, F.; Gaafar, A. R. Z.; Khan, S.; Nadeem, M.
2016-01-01
Date palm is a long-living and evergreen important tree in the semiarid regions. Its fruit is rich in carbohydrate and fibres. Transcriptional profiling was compared among male and female trees of dioecious date palm at flowering stage. Male specific genes are expressed at flowering stage which was studied using the cDNA-SCoT marker. We developed sequence characterized amplified region (SCAR) markers of size 253 bp from male tree based on cDNA-SCoT fingerprinting. Further, developed SCAR marker was validated on the independently collected samples of both types of trees at flowering stage. The unique and specific band (253 bp) was amplified from male samples only whereas it was absent from female samples. (author)
VizieR Online Data Catalog: DIB 661.3nm in Cepheid spectra (Kashuba+, 2016)
Kashuba, S. V.; Andrievsky, S. M.; Chekhonadskikh, F. A.; Luck, R. E.; Kovtyukh, V. V.; Korotin, S. A.; Krelowski, J.; Galazutdinov, G. A.
2017-11-01
We used spectra of Northern hemisphere Cepheids obtained by REL - one of the co-authors of this paper, with the High Resolution Spectrograph of the Hobby-Eberly Telescope at the McDonald Observatory of the University of Texas at Austin (Texas, USA) with the resolving power of 30000, a typical signal-to-noise ratio of about 100, and wavelength range of 435-780nm. A total of 253 Cepheid spectra were used in the research. We performed an investigation of the 661.356 nm DIB profile in 253 spectra of 176 Cepheids. After removal of the blending YII line the EW of each DIB was calculated for each spectrum. (1 data file).
Dealing with food allergies in babies and children
National Research Council Canada - National Science Library
Joneja, Janice M. Vickerstaff
2007-01-01
... . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 231 CHAPTER 14 CornAllergy ...243 CHAPTER 15 SeafoodAllergy ...253 CHAPTER 16 The Top Ten Allergens: Avoidance of Milk, Egg, Wheat, Corn, Peanuts, Soy, Tree Nuts...
Biotechnology Process Engineering Center at MIT - Overview
| Facsimile (617) 253-2400 | e-mail: bpec-www@mit.edu THERAPEUTIC GENE BIOTECHNOLOGY INDUSTRIAL CONSORTIUM Board (ICAB) in Therapeutic Gene Biotechnology. ICAB Member Representatives review our research progress
2011-08-02
... 62366:2007. engineering to medical devices. D. General Hospital/General Plastic Surgery: 6-253 Hoists... CLSI H59-A. Thromboembolic Disease; Approved Guideline. F. Nanotechnology: 18-2 Standard Guide for...
75 FR 5925 - Proposed Flood Elevation Determinations
2010-02-05
... Spring County. Martin Luther King Boulevard. Approximately 1,300 None +263 feet downstream of Martin Luther King Boulevard. Town Creek Approximately 2,300 None +253 Unincorporated Areas of feet downstream...
Stemcell Information: SKIP001176 [SKIP Stemcell Database[Archive
Lifescience Database Archive (English)
Full Text Available plication (CiRA), Kyoto University 京都大学iPS細胞研究所 Yamanaka Shinya 山中 伸弥 Information Only ... 18035408 10.1016/j.cell... line derived from a healthy individual dermal fibroblasts. 健常人の皮膚線維芽細胞由来のヒトiPS細胞株。 human ES-like Rese... iPS Cell Research and Application (CiRA), Kyoto University 京都大学iPS細胞研究所 Center for iPS Cell Research and Ap... SKIP001176 ... Normal 253F5 253F5 ... 36 30-39 Female ... -- No Human iPS cell....2007.11.019 Induction of pluripotent stem cells from adult human fibrob
Stemcell Information: SKIP001173 [SKIP Stemcell Database[Archive
Lifescience Database Archive (English)
Full Text Available plication (CiRA), Kyoto University 京都大学iPS細胞研究所 Yamanaka Shinya 山中 伸弥 Information Only ... 18035408 10.1016/j.cell... line derived from a healthy individual dermal fibroblasts. 健常人の皮膚線維芽細胞由来のヒトiPS細胞株。 human ES-like Rese... iPS Cell Research and Application (CiRA), Kyoto University 京都大学iPS細胞研究所 Center for iPS Cell Research and Ap... SKIP001173 ... Normal 253F2 253F2 ... 36 30-39 Female ... -- No Human iPS cell....2007.11.019 Induction of pluripotent stem cells from adult human fibrob
Stemcell Information: SKIP001175 [SKIP Stemcell Database[Archive
Lifescience Database Archive (English)
Full Text Available plication (CiRA), Kyoto University 京都大学iPS細胞研究所 Yamanaka Shinya 山中 伸弥 Information Only ... 18035408 10.1016/j.cell... line derived from a healthy individual dermal fibroblasts. 健常人の皮膚線維芽細胞由来のヒトiPS細胞株。 human ES-like Rese... iPS Cell Research and Application (CiRA), Kyoto University 京都大学iPS細胞研究所 Center for iPS Cell Research and Ap... SKIP001175 ... Normal 253F4 253F4 ... 36 30-39 Female ... -- No Human iPS cell....2007.11.019 Induction of pluripotent stem cells from adult human fibrob
2010-01-01
... in food preparation must be cleaned and sanitized after each use. Kitchens and other food handling... marine mammals except when deemed essential by an attending veterinarian. [66 FR 253, Jan. 3, 2001] ...
Czech Academy of Sciences Publication Activity Database
Kopalová, Kateřina; Van de Vijver, B.
2013-01-01
Roč. 25, č. 2 (2013), s. 239-253 ISSN 0954-1020 Institutional support: RVO:67985939 Keywords : Bacillariophyta * lakes * Maritime Antarctic Region Subject RIV: EF - Botanics Impact factor: 1.417, year: 2013
Czech Academy of Sciences Publication Activity Database
Bábek, O.; Matys Grygar, Tomáš; Faměra, M.; Hron, K.; Nováková, Tereza; Sedláček, J.
2015-01-01
Roč. 135, DEC (2015), s. 240-253 ISSN 0341-8162 Institutional support: RVO:61388980 Keywords : Anthropogenic contamination * Geochemical background * Fluvial sediments Subject RIV: DD - Geochemistry Impact factor: 2.612, year: 2015
Konsolidation und Stoffaustrag von Aufbereitungsrueckstaendendes Uranerzbergbaus
Czech Academy of Sciences Publication Activity Database
Beyer, K. D.; Herrmann, R.; Ohlendorf, F.; Sembdner, T.; von Wolffersdorff, P. A.; Herle, Ivo; Kolymbas, D.
2001-01-01
Roč. 24, č. 4 (2001), s. 253-262 ISSN 0172-6145 Institutional research plan: CEZ:AV0Z2071913 Keywords : consolidation, solute transport, uranium mill tailings. Subject RIV: JM - Building Engineering
Krajina jako prostředí k rekreaci - na příkladu Šuamvy
Czech Academy of Sciences Publication Activity Database
Kušová, Drahomíra; Těšitel, Jan; Bartoš, Michael
2001-01-01
Roč. 35, č. 5 (2001), s. 253-256 ISSN 0044-4863 Institutional research plan: CEZ:AV0Z6087904 Keywords : tourism * leisure time activities * sociological survey Subject RIV: AO - Sociology, Demography
Anthropological perspectives on democratic citizenship education and globalization
Czech Academy of Sciences Publication Activity Database
Červinková, Hana
2013-01-01
Roč. 2013, č. 27 (2013), s. 253-262 ISSN 1233-6688 Institutional support: RVO:68378076 Keywords : citizenship education * anthropology of education * action research * youth * participation * globalization Subject RIV: AC - Archeology, Anthropology, Ethnology
Czech Academy of Sciences Publication Activity Database
D'Ippolito, S.; Vaňková, Radomíra; Joosten, M.H.A.J.; Casalongue, C.A.; Fiol, D.F.
2016-01-01
Roč. 253, DEC (2016), s. 31-39 ISSN 0168-9452 Institutional support: RVO:61389030 Keywords : Auxin * Biotic stress * Cladosporium fulvum Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.437, year: 2016
2010-03-17
The attempted bombing of Northwest flight 253 highlighted the importance of detecting improvised explosive devices on passengers. This testimony focuses on (1) the Transportation Security Administrations (TSA) efforts to procure and deploy advance...
International Nuclear Information System (INIS)
King, L.J.; Bigelow, J.E.; Collins, E.D.
1976-10-01
Between July 1, 1975, and December 31, 1975, maintenance was conducted at TRU for a period of three months, 295 g of curium oxide (enough for approximately 26 HFIR targets) were prepared, 100 mg of high-purity 248 Cm, were separated from 252 Cf that had been purified during earlier periods, 11 HFIR targets were fabricated, and 28 product shipments were made. No changes were made in the chemical processing flowsheets normally used at TRU during this report period. However, three equipment racks were replaced (with two new racks) during this time. In Cubicle 6, the equipment replaced was that used to decontaminate the transplutonium elements from rare earth fission products and to separate curium from the heavier elements by means of the LiCl-based anion-exchange process. In Cubicle 5, the equipment used to separate the transcurium elements by high-pressure ion exchange and to purify berkelium by batch solvent extraction was replaced. Two neutron sources were fabricated, bringing the total fabricated to 79. One source that had been used in a completed project was returned to the TRU inventory and is available for reissue. Three sources, for which no further use was foreseen, were processed to isolate and recover the ingrown 248 Cm and the residual 252 Cf. Eight pellets, each containing 100 μg of high-purity 248 Cm were prepared for irradiation in HFIR to study the production of 250 Cm. The values currently being used for transuranium element decay data and for cross-section data in planning irradiation-processing cycles, calculating production forecasts, and assaying products are tabulated
Fungal diversity notes 253-366: taxonomic and phylogenetic contributions to fungal taxa
Czech Academy of Sciences Publication Activity Database
Li, G.J.; Hyde, K.D.; Zhao, R. L.; Hongsanan, S.; Abdel-Aziz, F.A.; Abdel-Wahab, M. A.; Alvarado, P.; Alves-Silva, G.; Ammirati, J.F.; Ariyawansa, H.A.; Baghela, A.; Bahkali, A. H.; Beug, M.; Bhat, D.J.; Bojantchev, D.; Boonpratuang, T.; Bulgakov, T.S.; Camporesi, E.; Boro, M.C.; Ceska, O.; Chakraborty, D.; Chen, J.J.; Chethana, K.W.T.; Chomnunti, P.; Consiglio, G.; Cui, B.K.; Dai, D. Q.; Dai, Y.C.; Daranagama, D. A.; Das, K.; Vlasák, Josef
2016-01-01
Roč. 78, č. 1 (2016), s. 1-237 ISSN 1560-2745 Institutional support: RVO:60077344 Keywords : lichenized ascomycota ostropales * ribosomal dna-sequences * strictly anaerobic fungus * sp-nov russulaceae * molecular phylogeny * Basidiomycota Subject RIV: EF - Botanics Impact factor: 13.465, year: 2016
Status of Radiotherapy around the World: Sub-Saharan Africa. Chapter 25.3
International Nuclear Information System (INIS)
Kigula Mugambe, J.B.; Kavuma, A.
2017-01-01
Sub-Saharan Africa is faced with numerous socioeconomic and political challenges. These significantly influence the delivery of health services, including radiotherapy. The availability of radiotherapy service in a country does not necessarily mean that its population can access that service. Financial constraints, lack of awareness and poor road infrastructure influence accessibility. For example, the Democratic Republic of the Congo is a vast country with only one centre in Kinshasa, and it is very difficult for people in the eastern part of the country to access it. Late presentation of patients for cancer management is another formidable challenge, aggravated by the issues mentioned above. The countries in this region have to address the problem of increasing cancer burden and the increasingly important role of radiotherapy in cancer management. There is an urgent need for the establishment of radiotherapy centres that are distributed widely across the region, accompanied by the training of more personnel. On the positive side, several countries in this region, e.g. Eritrea, Malawi and Niger, are in the process of establishing radiotherapy facilities in cooperation with the IAEA. Others, such as Ghana, Nigeria and the United Republic of Tanzania, are in the process of expanding the existing services. The countries in this region should address the late presentation problem by increasing awareness and establishing effective prevention and early detection programmes as part of their national cancer control strategies. They should also develop appropriate cancer policies with the continued support of international organizations such as the IAEA and the World Health Organization (WHO).
7 CFR 1710.253 - Engineering and cost studies-addition of generation capacity.
2010-01-01
... must include comprehensive economic present-value analyses of the costs and revenues of the available... assessments of service reliability and financing requirements and risks. Requirements for analyzing purchased... costs; (2) Financing requirements and risks; (3) System reliability; (4) Alternative unit sizes; (5...
A CLUSTER IN THE MAKING: ALMA REVEALS THE INITIAL CONDITIONS FOR HIGH-MASS CLUSTER FORMATION
International Nuclear Information System (INIS)
Rathborne, J. M.; Contreras, Y.; Longmore, S. N.; Bastian, N.; Jackson, J. M.; Alves, J. F.; Bally, J.; Foster, J. B.; Garay, G.; Kruijssen, J. M. D.; Testi, L.; Walsh, A. J.
2015-01-01
G0.253+0.016 is a molecular clump that appears to be on the verge of forming a high-mass cluster: its extremely low dust temperature, high mass, and high density, combined with its lack of prevalent star formation, make it an excellent candidate for an Arches-like cluster in a very early stage of formation. Here we present new Atacama Large Millimeter/Sub-millimeter Array observations of its small-scale (∼0.07 pc) 3 mm dust continuum and molecular line emission from 17 different species that probe a range of distinct physical and chemical conditions. The data reveal a complex network of emission features with a complicated velocity structure: there is emission on all spatial scales, the morphology of which ranges from small, compact regions to extended, filamentary structures that are seen in both emission and absorption. The dust column density is well traced by molecules with higher excitation energies and critical densities, consistent with a clump that has a denser interior. A statistical analysis supports the idea that turbulence shapes the observed gas structure within G0.253+0.016. We find a clear break in the turbulent power spectrum derived from the optically thin dust continuum emission at a spatial scale of ∼0.1 pc, which may correspond to the spatial scale at which gravity has overcome the thermal pressure. We suggest that G0.253+0.016 is on the verge of forming a cluster from hierarchical, filamentary structures that arise from a highly turbulent medium. Although the stellar distribution within high-mass Arches-like clusters is compact, centrally condensed, and smooth, the observed gas distribution within G0.253+0.016 is extended, with no high-mass central concentration, and has a complex, hierarchical structure. If this clump gives rise to a high-mass cluster and its stars are formed from this initially hierarchical gas structure, then the resulting cluster must evolve into a centrally condensed structure via a dynamical process
ORF Alignment: NT_033778 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available de-binding protein [Periplaneta americana] ... pir||JQ0708 lipopolysaccharide-binding protein precurs... NT_033778 gi|24762680 >1qddA 8 141 113 253 1e-15 ... dbj|BAA00616.1| lipopolysacchari
TAA1-Mediated Auxin Biosynthesis Is Essential for Hormone Crosstalk and Plant Development
Czech Academy of Sciences Publication Activity Database
Stepanova, A.N.; Robertson-Hoyt, J.; Yun, J.; Benavente, L.M.; Xie, D.Y.; Doležal, Karel; Schlereth, A.; Jürgens, G.; Alonso, J.M.
2008-01-01
Roč. 133, č. 1 (2008), s. 177-191 ISSN 0092-8674 Institutional research plan: CEZ:AV0Z50380511 Keywords : CELLBIO * SIGNALING * DEVBIO Subject RIV: CE - Biochemistry Impact factor: 31.253, year: 2008
Archeologický výzkum zaniklého těžebního areálu u kostela sv. Václava v Pněvicích (okr. Kutná Hora)
Czech Academy of Sciences Publication Activity Database
Končelová, Markéta; Velímský, Filip
2012-01-01
Roč. 12, prosinec (2012), s. 253-256 ISSN 1801-5972 Institutional research plan: CEZ:AV0Z80020508 Keywords : Kutná Hora * archaeology * Middle Ages * silver mining Subject RIV: AC - Archeology, Anthropology, Ethnology
Predictors of risky sexual behaviour among young people in the era ...
African Journals Online (AJOL)
AJRH Managing Editor
people's practicing risky sexual behaviour in the era of HIV/AIDS. Data used in ... pregnancies, unsafe induced abortion and HIV .... additional selection criteria. ...... India. International. Family. Planning. Perspectives 1999; 25(3): 139-146. 18.
Czech Academy of Sciences Publication Activity Database
Trousil, J.; Spurný, František; Plichta, J.
2006-01-01
Roč. 14, 7/8 (2006), s. 246-253 ISSN 1210-7085 Institutional research plan: CEZ:AV0Z10480505 Keywords : detectors * dosemeters * personal dosimetry Subject RIV: DN - Health Impact of the Environment Quality
Psychosocial risk and protective factors associated with perpetration ...
African Journals Online (AJOL)
and gender violence need to address male depression, anxiety and ... health problems cause difficulties with emotion regulation, and some men may use GBV ..... Student. 253 (56.5). *Two participants reported volunteering full time and.
Directory of Open Access Journals (Sweden)
Leonardo A. de Aquino
2013-05-01
Full Text Available Objetivou-se, neste trabalho, avaliar o estado nutricional, caracteres agronômicos e a produtividade de cultivares de girassol sob irrigação. Os cultivares Embrapa 122 V-2000, Hélio 250, Hélio 251, Hélio 253, Hélio 358, Hélio 360, IAC Iarama, Dow Agroscience M 734 e MG 02, foram semeados em blocos ao acaso, com quatro repetições. O número de folhas por planta no florescimento foi maior nos híbridos Hélio 250, Hélio 251, Hélio 253, Hélio 358, Hélio 360, Dow Agroscience M 734 e MG 02, em relação aos cultivares de polinização aberta Embrapa 122 V-2000 e IAC Iarama. Os teores foliares de N, P, K, Ca, Mg e S foram 40,91; 3,51; 35,91; 33,91; 6,23 e 7,88 g kg-1, respectivamente. Os cultivares Embrapa 122 V-2000 e IAC-Iarama apresentaram teor de P na folha índice menor que os demais cultivares. Os teores foliares de Zn, Cu, Fe e o Mn foram 75,15; 24,11; 98,39 e 348,10 mg kg-1, respectivamente. O teor médio de B na folha índice nos híbridos e nas variedades de polinização aberta foi de 119,25 e 140,35 mg kg-1, respectivamente. Os cultivares Hélio 250, Hélio 251, Hélio 253, Hélio 358, Hélio 360, Dow Agroscience M 734 e MG 02 apresentaram maior produtividade que o Embrapa 122 V-2000 e o IAC Iarama.This work aimed to assess nutritional status, agronomic characteristics, and productivity of sunflower cultivars under irrigation. Embrapa 122 V-2000, Hélio 250, Hélio 251, Hélio 253, Hélio 358, Hélio 360, IAC Iarama, and Dow Agroscience M 734 and MG 02 cultivars were sown in randomized block design with four replications. The number of leaves per plant in full bloom was higher in hybrid Hélio 250, Hélio 251, Hélio 253, Hélio 358, Hélio 360 and Dow Agroscience MG 734 and M 02 related to open-pollinated cultivars Embrapa 122 V-2000 and IAC Iarama. Foliar contents of N, P, K, Ca, Mg, and S were 40.91, 3.51, 35.91, 33.91, 6.23, and 7.88 g kg-1, respectively. Embrapa 122 V-2000 and IAC-Iarama cultivars showed an average
Ecotoxicity and genotoxicity assessment of cytotoxic antineoplastic drugs and their metabolites
Czech Academy of Sciences Publication Activity Database
Zounková, R.; Kovalová, L.; Bláha, Luděk; Dott, W.
2010-01-01
Roč. 81, č. 2 (2010), s. 253-260 ISSN 0045-6535 Institutional research plan: CEZ:AV0Z60050516 Keywords : cytotoxic drugs * ecotoxicity * metabolite Subject RIV: EF - Botanics Impact factor: 3.155, year: 2010
Czech Academy of Sciences Publication Activity Database
Štrbáňová, Soňa
2015-01-01
Roč. 22, č. 2 (2015), s. 251-253 ISSN 1230-1159 Institutional support: RVO:68378114 Keywords : history of science and technology * hungarian history of science and technology * women in science Subject RIV: AB - History
Microsporidia and ‘The Art of Living Together’
Czech Academy of Sciences Publication Activity Database
Vávra, Jiří; Lukeš, Julius
2013-01-01
Roč. 82, č. 2013 (2013), s. 253-319 ISSN 0065-308X Institutional support: RVO:60077344 Keywords : Microsporidia * polar tube protein * ribosomal RNA Subject RIV: EE - Microbiology, Virology Impact factor: 4.360, year: 2013
77 FR 65899 - Agency Information Collection Activities: Guarantee of Payment
2012-10-31
... Payment. OMB Number: 1651-00127. Form Number: Form I-510. Abstract: Section 253 of the Immigration and....gov/pdf/CBP_Form_i510.pdf Action: CBP proposes to extend the expiration date of this information...
Taking notes as an interactive process
Hornig, Wolfgang
1984-01-01
Taking notes as an interactive process : how to improve students´ notes / Hornig W. ; Nowak, J. - In: Nowak, Johann: Textverstehen und Textrekonstruktion in Vorlesungen. - Augsburg : HDZ, 1984. - S. 227-253. - (Augsburger Studien zur Hochschuldidaktik ; 12)
File list: Unc.Neu.05.AllAg.Hypothalamus [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available Unc.Neu.05.AllAg.Hypothalamus mm9 Unclassified Neural Hypothalamus SRX956254,SRX956...253 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Unc.Neu.05.AllAg.Hypothalamus.bed ...
Czech Academy of Sciences Publication Activity Database
Mochalski, P.; Unterkofler, K.; Španěl, Patrik; Smith, D.; Amann, A.
2014-01-01
Roč. 28, č. 15 (2014), s. 1683-1690 ISSN 0951-4198 Institutional support: RVO:61388955 Keywords : TRACE GAS-ANALYSIS * ORGANIC-COMPOUNDS * EXHALED-BREATH Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.253, year: 2014
ORF Alignment: EHA1 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available EHA1 253.m00087 >1gntA 1 549 4 539 e-171 ... gb|EAL51411.1| hydroxylamine reductase, ...putative [Entamoeba histolytica HM-1:IMSS] ... gb|EAL44619.1| hydroxylamine reductase, putative ...
Quenching of photoluminescence of Rhodamine 6G molecules on functionalized graphene
Czech Academy of Sciences Publication Activity Database
Valeš, Václav; Kovaříček, Petr; Ji, X.; Ling, X.; Kong, J.; Dresselhaus, M. S.; Kalbáč, Martin
2016-01-01
Roč. 253, č. 12 (2016), s. 2347-2350 ISSN 0370-1972 Institutional support: RVO:61388955 Keywords : atomic force microscopy * functionalized graphene * photoluminiscence quenching Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.674, year: 2016
Zvířecí skelet z laténského objektu v Nových Dvorech, okr. Kutná Hora
Czech Academy of Sciences Publication Activity Database
Kyselý, René
2011-01-01
Roč. 63, č. 2 (2011), s. 253-255 ISSN 0323-1267 Institutional research plan: CEZ:AV0Z80020508 Keywords : ritual * La Tène period * osteology * Bos taurus * cattle Subject RIV: AC - Archeology, Anthropology, Ethnology
Separation of yttrium from strontium in the aqueous phase of the water/nitrobenzene system
Czech Academy of Sciences Publication Activity Database
Vaňura, P.; Makrlík, E.; Vobecký, Miloslav
2002-01-01
Roč. 253, č. 1 (2002), s. 171-172 ISSN 0236-5731 Institutional research plan: CEZ:AV0Z4031919 Keywords : stroncium * yttrium * separation Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 0.502, year: 2002
Separation of microamounts of yttrium from strontium in the two-phase water/nitrobenzene system
Czech Academy of Sciences Publication Activity Database
Makrlík, E.; Vaňura, P.; Vobecký, Miloslav
2002-01-01
Roč. 253, č. 1 (2002), s. 153-155 ISSN 0236-5731 Institutional research plan: CEZ:AV0Z4031919 Keywords : separation * stroncium * yttrium Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 0.502, year: 2002
Effects of the Size of Cosmological N-body Simulations on Physical ...
Indian Academy of Sciences (India)
Apart from N-body simulations, an analytical prescription given by Press & ...... Little, B., Weinberg, D. H., Park, C. 1991, MNRAS, 253, 295. Ma, C.-P. ... Padmanabhan, T. 1993, Structure Formation in the Universe, Cambridge University Press.
Synthesis of C3-symmetric tri(alkylamino) guests and their interaction with cyclodextrins
Czech Academy of Sciences Publication Activity Database
Bednaříková, T.; Tošner, Z.; Horský, Jiří; Jindřich, J.
2015-01-01
Roč. 81, 1-2 (2015), s. 141-152 ISSN 0923-0750 Institutional support: RVO:61389013 Keywords : cyclodextrin * supramolecular interactions * C3-symmetric guests Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 1.253, year: 2015
Gentegreerde woordeboekgebruik van vakwoordeboeke vir ...
African Journals Online (AJOL)
Riette Ruthven
word bespreek asook daardie vakwoordeboeke wat op aanleerders van sowel 'n taal as die vak gerig is. ... Abstract: Integrated Dictionary Use of Specialised Dictionaries for Learn- ers. ...... Applied Language Studies 25(3): 319-331. Gouws ...
Apoptosis and necrosis during the circadian cycle in the centipede midgut
Czech Academy of Sciences Publication Activity Database
Rost-Roszkowska, M.M.; Chajec, Ł.; Vilímová, J.; Tajovský, Karel
2016-01-01
Roč. 253, č. 4 (2016), s. 1051-1061 ISSN 0033-183X Institutional support: RVO:60077344 Keywords : cell death * centipede * digestive cells * midgut epithelium * ultrastructure Subject RIV: EG - Zoology Impact factor: 2.870, year: 2016
The Prevalence and Outcome of Asymptomatic Chlamydial Infection ...
African Journals Online (AJOL)
Annals of Medical and Health Sciences Research | Mar-Apr 2014 | Vol 4 | Issue 2 |. 253. Address for .... effect may further compromise the reproductive chance of such women .... easy evaluation and this exercise has been encouraged. Some.
5 original article pcr detection of entamoeba histolytica
African Journals Online (AJOL)
boaz
STOOL SAMPLES OF HOSPITAL PATIENTS IN SOROTI, EASTERN UGANDA. Ekou1, 3*, J. ... Department of Wildlife and Animal resources management, Makerere University. P.O Box ... In Mexico, E.histolytica prevalence of. 25.3% in the ...
Czech Academy of Sciences Publication Activity Database
Fianchini, M.; Campana, C.F.; Chilukuri, B.; Cundari, T.R.; Petříček, Václav; Dias, H.V.
2013-01-01
Roč. 32, č. 10 (2013), s. 3034-3041 ISSN 0276-7333 Institutional support: RVO:68378271 Keywords : organometallic compounds * X-ray structure analysis Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 4.253, year: 2013
Czech Academy of Sciences Publication Activity Database
Trigo-Rodríguez, J.M.; Borovička, Jiří; Llorca, J.; Madiedo, J.M.; Zamorano, J.; Izquierdo, J.
2009-01-01
Roč. 44, č. 2 (2009), s. 175-186 ISSN 1086-9379 Institutional research plan: CEZ:AV0Z10030501 Keywords : meteor * meteorite Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 3.253, year: 2009
Czech Academy of Sciences Publication Activity Database
Šimon, Petr; Jambor, R.; Růžička, A.; Dostál, I.
2013-01-01
Roč. 32, č. 1 (2013), s. 239-248 ISSN 0276-7333 Institutional support: RVO:61388971 Keywords : MAIN-GROUP ELEMENTS * BOND COVALENT RADII * CRYSTAL-STRUCTURES Subject RIV: CA - Inorganic Chemistry Impact factor: 4.253, year: 2013
File list: ALL.Neu.05.AllAg.Hypothalamus [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available ALL.Neu.05.AllAg.Hypothalamus mm9 All antigens Neural Hypothalamus SRX956254,SRX956...253 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/ALL.Neu.05.AllAg.Hypothalamus.bed ...
Griechische Tragödie als Medium der Erfahrung
Czech Academy of Sciences Publication Activity Database
Kouba, Petr
2013-01-01
Roč. 22, 84-85 (2013), s. 235-253 ISSN 1318-3362 R&D Projects: GA ČR(CZ) GAP401/10/1164 Institutional support: RVO:67985955 Keywords : tragedy * destiny * exteriority * event Subject RIV: AA - Philosophy ; Religion
75 FR 57396 - List of Nonconforming Vehicles Decided To Be Eligible for Importation
2010-09-21
... 150 ...... ...... Chevrolet Astro Van 1997 298 ...... ...... Chevrolet Blazer 1986 405... (MC) FX, FL, XL Series..... 1998 253 ...... ...... Harley Davidson (MC) FX, FL, XL Series..... 1999 281 ...... ...... Harley Davidson (MC) FX, FL, XL Series..... 2000 321 ...... ...... Harley Davidson...
ORF Alignment: NC_002928 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002928 gi|33596750 >1v7zA 3 253 1 251 8e-40 ... ref|NP_884393.1| putative creatini...ne amidohydrolase [Bordetella parapertussis 12822] ... emb|CAE37436.1| putative creatinine amidohydro
Czech Academy of Sciences Publication Activity Database
Votýpka, Jan; Maslov, D. A.; Yurchenko, V.; Jirků, Milan; Kment, P.; Lun, Z.-R.; Lukeš, Julius
2010-01-01
Roč. 54, č. 1 (2010), s. 243-253 ISSN 1055-7903 Institutional research plan: CEZ:AV0Z60220518 Keywords : trypanosomatids * phylogeny * diversity * insects Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.889, year: 2010
Digital Repository Service at National Institute of Oceanography (India)
Harji, R.R.; Yvenat, A.; Bhosle, N.B.
anthropogenic hydrocarbon inputs. Mar Environ Res 1992;33:223-253. Stout SA, Uhler AD, McCarthy KJ, Emsbo-Mattingly S. Chemical fingerprinting of hydrocarbons. In: Murphy BL, Morrison R (Eds.), Introduction to Environmental Forensics. Academic Press, Boston...
Gorski, Mark; Ott, Jürgen; Rand, Richard; Meier, David S.; Momjian, Emmanuel; Schinnerer, Eva
2018-04-01
The Survey of Water and Ammonia in Nearby galaxies (SWAN) studies atomic and molecular species across the nuclei of four star-forming galaxies: NGC 253, IC 342, NGC 6946, and NGC 2146. As part of this survey, we present Karl G. Jansky Very Large Array molecular line observations of three galaxies: IC 342, NGC 6946, and NGC 2146. NGC 253 is covered in a previous paper. These galaxies were chosen to span an order of magnitude in star formation rates and to select a variety of galaxy types. We target the metastable transitions of ammonia NH3(1, 1) to (5, 5), the 22 GHz water (H2O) (616–523) transition, and the 36.1 GHz methanol (CH3OH) (4‑1–30) transition. We use the NH3 metastable lines to perform thermometry of the dense molecular gas. We show evidence for uniform heating across the central kiloparsec of IC 342 with two temperature components for the molecular gas, similar to NGC 253, of 27 and 308 K, and that the dense molecular gas in NGC 2146 has a temperature 36 GHz CH3OH masers in IC 342 and NGC 6946. For the four external galaxies the total CH3OH luminosity in each galaxy suggests a correlation with galactic star formation rate, whereas the morphology of the emission is similar to that of HNCO, a weak shock tracer.
Directory of Open Access Journals (Sweden)
Nadzariah Kamarul Zaman
2018-03-01
Full Text Available Aerobic rice technology is still new in Malaysia, and information regarding MARDI Aerob 1 (MA1, the first local aerobic rice variety, is still lacking. Therefore, comparative studies were carried out to determine the physiological performance of aerobic rice variety MA1 and lowland rice variety MR253 under water stress given at the panicle initiation, flowering and ripening stages. This experiment was arranged in a randomized complete block design. Stomatal conductance (gs, chlorophyll a fluorescence (Fv/Fm, leaf relative water content (leaf RWC, and soil moisture content (SMC as well as yield component parameters such as panicle number, grain yield and 100-grain weight were measured. Results revealed that gs and leaf RWC for both varieties decreased with depletion of SMC. The correlation study between the physiological parameters and SMC indicated that Fv/Fm was not affected by water stress, regardless of varieties. The yield components (panicle number, grain yield and 100-grain weight for both varieties greatly decreased when water stress was imposed at the panicle initiation stage. This study showed that the panicle initiation period was the most sensitive stage to water stress that contributed to a substantial reduction in yield for both varieties. Under the aerobic condition (control, MR253 produced higher panicle number, 100-grain weight and yield than MA1. Although MR253 is bred for lowland, it is well adapted to aerobic condition.
TGF-β1 targets a microRNA network that regulates cellular adhesion and migration in renal cancer.
Bogusławska, Joanna; Rodzik, Katarzyna; Popławski, Piotr; Kędzierska, Hanna; Rybicka, Beata; Sokół, Elżbieta; Tański, Zbigniew; Piekiełko-Witkowska, Agnieszka
2018-01-01
In our previous study we found altered expression of 19 adhesion-related genes in renal tumors. In this study we hypothesized that disturbed expression of adhesion-related genes could be caused by microRNAs: short, non-coding RNAs that regulate gene expression. Here, we found that expression of 24 microRNAs predicted to target adhesion-related genes was disturbed in renal tumors and correlated with expression of their predicted targets. miR-25-3p, miR-30a-5p, miR-328 and miR-363-3p directly targeted adhesion-related genes, including COL5A1, COL11A1, ITGA5, MMP16 and THBS2. miR-363-3p and miR-328 inhibited proliferation of renal cancer cells, while miR-25-3p inhibited adhesion, promoted proliferation and migration of renal cancer cells. TGF-β1 influenced the expression of miR-25-3p, miR-30a-5p, and miR-328. The analyzed microRNAs, their target genes and TGF-β1 formed a network of strong correlations in tissue samples from renal cancer patients. The expression signature of microRNAs linked with TGF-β1 levels correlated with poor survival of renal cancer patients. The results of our study suggest that TGF-β1 coordinates the expression of microRNA network that regulates cellular adhesion in cancer. Copyright © 2017 Elsevier B.V. All rights reserved.
Differential effects of FGFR2 mutations on syndactyly and cleft palate in Apert syndrome
Energy Technology Data Exchange (ETDEWEB)
Slaney, S.F.; Oldridge, M.; Wilkie, A.O.M. [Univ. of Oxford (United Kingdom)] [and others
1996-05-01
Apert syndrome is a distinctive human malformation characterized by craniosynostosis and severe syndactyly of the hands and feet. It is caused by specific missense substitutions involving adjacent amino acids (Ser252Trp or Pro253Arg) in the linker between the second and third extracellular immunoglobulin domains of fibroblast growth factor receptor 2 (FGFR2). We have developed a simple PCR assay for these mutations in genomic DNA, based on the creation of novel SfiI and BstUI restriction sites. Analysis of DNA from 70 unrelated patients with Apert syndrome showed that 45 had the Ser252Trp mutation and 25 had the Pro253Arg mutation. Phenotypic differences between these two groups of patients were investigated. Significant differences were found for severity of syndactyly and presence of cleft palate. The syndactyly was more severe with the Pro253Arg mutation, for both the hands and the feet. In contrast, cleft palate was significantly more common in the Ser252Trp patients. No convincing differences were found in the prevalence of other malformations associated with Apert syndrome. We conclude that, although the phenotype attributable to the two mutations is very similar, there are subtle differences. The opposite trends for severity of syndactyly and cleft palate in relation to the two mutations may relate to the varying patterns of temporal and tissue-specific expression of different fibroblast growth factors, the ligands for FGFR2. 54 refs., 5 figs., 3 tabs.
Integrated system for recommending fertilization rates in pineapple (Ananas comosus (L. Merr. crop
Directory of Open Access Journals (Sweden)
Sergio Salgado García
2017-10-01
Full Text Available In recent years much attention has focused on the impacts of agriculture on climate change, due to this stage specialists in plant nutrition and soil fertility have achieved the task of generating adequate fertilization doses for pineapple to reduce effects on environment. A methodology for Integrated System for Recommending Fertilizer Dose (ISRFD was used. As a result, seven Thiessen polygons of the average annual rainfall, where rainfall ranged from 1640 to 2841 mm was correlated. Therefore, three major soil groups were defined and classified as subunit level. Likewise, eight doses of fertilizers were generated as follows: N, P2O5 and K2O, with a fertilizer dose, a map is generated according to the cultivar: 230-138-300 for Creole pineapple in Acrisol Cutanic (Chromic, Ferric; 460-161-480 for Cayenne and MD2 in Acrisol Cutanic (Endoclayic, Ferric; 345-161-450 for Cayenne and MD2, 253-138-450 for Creole in Acrisol Cutanic (Endoclayic, Hyperdystric, Ferric; 391-161-450 for Cayenne and MD2 in Acrisol Umbric Cutanic (Endoclayic, Hyperdystric and Acrisol Umbric Cutanic (Endoclayic, Hyperdystric, Ferric; 207-138-300 for Creole in Acrisol Umbric Cutanic (Endoclayic, Hyperdystric; 253-138-300 for Creole in Acrisol Umbric Cutanic (Endoclayic,Hyperdystric, Ferric; 253-138-360 for Creole in Acrisol Umbric Gleyic (Hyperdystric, Ferric; and 391-161-360 in Cambisol Endogleyic (Clayic, Eutric. These fertilizer doses were supplemented with micronutrients to obtain the expected results.
Energy levels and radiative rates for transitions in Ti VI
International Nuclear Information System (INIS)
Aggarwal, K M; Keenan, F P; Msezane, A Z
2013-01-01
We report on calculations of energy levels, radiative rates, oscillator strengths and line strengths for transitions among the lowest 253 levels of the (1s 2 2s 2 2p 6 ) 3s 2 3p 5 , 3s3p 6 , 3s 2 3p 4 3d, 3s3p 5 3d, 3s 2 3p 3 3d 2 , 3s 2 3p 4 4s, 3s 2 3p 4 4p and 3s 2 3p 4 4d configurations of Ti VI. The general-purpose relativistic atomic structure package and flexible atomic code are adopted for the calculations. Radiative rates, oscillator strengths and line strengths are reported for all electric dipole (E1), magnetic dipole (M1), electric quadrupole (E2) and magnetic quadrupole (M2) transitions among the 253 levels, although calculations have been performed for a much larger number of levels. Comparisons are made with existing available results and the accuracy of the data is assessed. Additionally, lifetimes for all 253 levels are listed, although comparisons with other theoretical results are limited to only 88 levels. Our energy levels are estimated to be accurate to better than 1% (within 0.03 Ryd), whereas results for other parameters are probably accurate to better than 20%. A reassessment of the energy level data on the National Institute of Standards and Technology website for Ti VI is suggested. (paper)
Czech Academy of Sciences Publication Activity Database
Pelánková, Barbora; Chytrý, M.
2009-01-01
Roč. 157, 3-4 (2009), s. 253-265 ISSN 0034-6667 Institutional research plan: CEZ:AV0Z60050516 Keywords : modern pollen spectra * pollen deposition * southern Siberia Subject RIV: EF - Botanics Impact factor: 2.145, year: 2009
Fragmentation model of meteoroid motion, mass loss, and radiation in the atmosphere
Czech Academy of Sciences Publication Activity Database
Ceplecha, Zdeněk; ReVelle, D.O.
2005-01-01
Roč. 40, č. 1 (2005), s. 35-54 ISSN 1086-9379 Institutional research plan: CEZ:AV0Z10030501 Keywords : luminous efficiency * innisfree meteorite Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 2.253, year: 2005
a study of parallel proverbs in akan (twi)
African Journals Online (AJOL)
conceptual/semantic similarity in terms of core meaning with regard to behavior towards palm-wine ..... populations and the evolution of human mitochondrial DNA.” Science 253 ..... NEG-REL-have sleep 2SG-NEG-know bedbugs wake. 3SG.
2010-05-11
... SYMC Symantec Corp. 162 TIVO TiVo Inc 253 AMED Amedisys Inc. 163 MNKD MannKind Corp 255 TM Toyota Motor... Marvell Technology Group 273 EP El Paso Corp. Ltd. 215 XLP Consumer Staples Select 274 SEED Origin...
2010-05-10
... Symantec Corp. 162 TIVO TiVo Inc 253 AMED Amedisys Inc. 163 MNKD MannKind Corp 255 TM Toyota Motor Corp... Marvell Technology Group 273 EP El Paso Corp. Ltd. 215 XLP Consumer Staples Select 274 SEED Origin...
Biohydrology research after Landau 2013 conference
Czech Academy of Sciences Publication Activity Database
Lichner, Ľ.; Cerdà, A.; Rajkai, K.; Tesař, Miroslav
2014-01-01
Roč. 62, č. 4 (2014), s. 253-257 ISSN 0042-790X Institutional support: RVO:67985874 Keywords : biohydrology * hydrological research * biological and hydrological systems * hydrological processes Subject RIV: DA - Hydrology ; Limnology Impact factor: 1.486, year: 2014
PLASMA SPRAYING OF REFRACTORY CERMETS BY THE WATER-STABILIZED SPRAY (WSP®) SYSTEM
Czech Academy of Sciences Publication Activity Database
Ctibor, Pavel; Brožek, V.; Cheong, D.-I.; Chráska, Pavel
2009-01-01
Roč. 54, č. 3 (2009), s. 241-253 ISSN 0001-7043 Institutional research plan: CEZ:AV0Z20430508 Keywords : Plasma spraying * cermet coatings * microhardness * zirconium carbide * tungsten Subject RIV: JH - Ceramics, Fire-Resistant Materials and Glass
Czech Academy of Sciences Publication Activity Database
Tkadlec, Emil; Heroldová, Marta; Víšková, V.; Bednář, M.; Zejda, Jan
2012-01-01
Roč. 61, 3-4 (2012), s. 246-253 ISSN 0139-7893 R&D Projects: GA MZe QH72075 Institutional support: RVO:68081766 Keywords : Cricetus cricetus * questionnaire * Rodentia Subject RIV: EG - Zoology Impact factor: 0.494, year: 2012
ORF Alignment: NC_002927 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002927 gi|33600518 >1v7zA 3 253 1 251 1e-39 ... ref|NP_888078.1| putative creatini...ne amidohydrolase [Bordetella bronchiseptica RB50] ... emb|CAE32030.1| putative creatinine amidohydro
Vliv podmínek sladování na obsah dextrinů v meziproduktech výroby piva
Czech Academy of Sciences Publication Activity Database
Psota, V.; Čmelík, Richard; Sachambula, L.
2011-01-01
Roč. 57, 7-8 (2011), 253-259 ISSN 0023-5830 R&D Projects: GA MŠk 2B06037 Institutional research plan: CEZ:AV0Z40310501 Keywords : malting * dextrin * beer Subject RIV: CB - Analytical Chemistry, Separation
Combat Neurosis in the Battered Teacher.
Science News, 1978
1978-01-01
Investigates the effect of school violence on classroom teachers. The study of 253 Los Angeles inner city classroom teachers reveals that many of them have developed conditions similar to the combat neurosis found in soldiers at war. (HM)
Koolera paneb Haiti valmiduse proovile / Hendrik Vosman
Vosman, Hendrik
2010-01-01
Haitis puhkenud koolerapuhang on nõudnud juba 253 inimelu, nakatunute arv ületab 3100 piiri, bakter võib sealsete ebahügieeniliste olude tõttu kaasa tuua teise humanitaarkatastroofi pärast 12. jaanuari maavärinat. Kaart
Gas hydrate contribution to Late Permian global warming
Czech Academy of Sciences Publication Activity Database
Majorowicz, J.; Grasby, S. E.; Šafanda, Jan; Beauchamp, B.
2014-01-01
Roč. 393, May (2014), s. 243-253 ISSN 0012-821X Institutional support: RVO:67985530 Keywords : Latest Permian extinction * gas hydrates * carbon isotope shift Subject RIV: DC - Siesmology, Volcanology, Earth Structure Impact factor: 4.734, year: 2014
Nova espécie de Bronia Gray, 1845, do Estado do Tocantins, Brasil (Squamata: Amphisbaenidae
Directory of Open Access Journals (Sweden)
Carolina Castro-Mello
2003-01-01
Full Text Available Bronia saxosa, sp. n., localidade tipo UHE Luis Eduardo Magalhães, Estado do Tocantins, difere das demais espécies de Bronia Gray, 1865, principalmente por possuir nasais pequenas separadas pela rostral. A nova espécie possui 4 poros, 253-272 anéis corporais, 17-21 anéis caudais, 18-24/1621 segmentos em um anel no meio do corpo.Bronia saxosa, sp. n. from the state of Tocantins, Brasil, (Hydroelectric Dam Luis Eduardo Magalhães, 09°45'S, 48°21'W, a cerrado area, differs from the remainining species of the genus mainly by having small nasals scutes separated by the rostral. It has (82 specimens 4 preanal pores, 253-272 body annuli, 17-21 tail annuli and 18-24/16-21 segments to a midbody annulus.
Znovuuvedení kritické analýzy diskurzu do českého prostředí
Czech Academy of Sciences Publication Activity Database
Homoláč, Jiří; Mrázková, Kamila
2017-01-01
Roč. 78, č. 3 (2017), s. 237-253 ISSN 0037-7031 Institutional support: RVO:68378092 Keywords : critical discourse analysis * discourse-historical approach * discursive strategies * topos Subject RIV: AI - Linguistics OBOR OECD: Linguistics Impact factor: 0.625, year: 2016
2010-05-11
... Symantec Corp. 162 TIVO TiVo Inc. 253 AMED Amedisys Inc. 163 MNKD MannKind Corp. 255 TM Toyota Motor Corp... 273 EP El Paso Corp. Group Ltd. 215 XLP Consumer Staples 274 SEED Origin Agritech Select Sector SPDR...
Large-Scale Systems Control Design via LMI Optimization
Czech Academy of Sciences Publication Activity Database
Rehák, Branislav
2015-01-01
Roč. 44, č. 3 (2015), s. 247-253 ISSN 1392-124X Institutional support: RVO:67985556 Keywords : Combinatorial linear matrix inequalities * large-scale system * decentralized control Subject RIV: BC - Control Systems Theory Impact factor: 0.633, year: 2015
Nievelstein, Fleurie; Van Gog, Tamara; Van Dijck, Gijs; Boshuizen, Els
2010-01-01
Nievelstein, F., Van Gog, T., Van Dijck, C., & Boshuizen, H. P. A. (2011). Instructional support for novice law students: Reducing search processes and explaining concepts in cases. Applied Cognitive Psychology, 25(3), 408-413. doi:10.1002/acp.1707
Gender differences in Parkinson's disease
Haaxma, Charlotte A.; Bloem, Bastiaan R.; Borm, George F.; Oyen, Wim J. G.; Leenders, Klaus L.; Eshuis, Silvia; Booij, Jan; Dluzen, Dean E.; Horstink, Martin W. I. M.
Objective: To investigate gender differences in basic disease characteristics, motor deterioration and nigrostriatal degeneration in Parkinson's disease (PD). Methods: We studied 253 consecutive PD patients who were not receiving levodopa or dopamine agonists ( disease duration Results: Age at onset
Gender differences in Parkinson's disease.
Haaxma, C.A.; Bloem, B.R.; Borm, G.F.; Oyen, W.J.G.; Leenders, K.L.; Eshuis, S.; Booij, J.; Dluzen, D.E.; Horstink, M.W.I.M.
2007-01-01
OBJECTIVE: To investigate gender differences in basic disease characteristics, motor deterioration and nigrostriatal degeneration in Parkinson's disease (PD). METHODS: We studied 253 consecutive PD patients who were not receiving levodopa or dopamine agonists (disease duration < or = 10 years). We
Gender differences in Parkinson's disease
Haaxma, Charlotte A.; Bloem, Bastiaan R.; Borm, George F.; Oyen, Wim J. G.; Leenders, Klaus L.; Eshuis, Silvia; Booij, Jan; Dluzen, Dean E.; Horstink, Martin W. I. M.
2007-01-01
OBJECTIVE: To investigate gender differences in basic disease characteristics, motor deterioration and nigrostriatal degeneration in Parkinson's disease (PD). METHODS: We studied 253 consecutive PD patients who were not receiving levodopa or dopamine agonists (disease duration < or = 10 years). We
Characterization of 6 Bacillus subtilis β-mannanases and their genes
African Journals Online (AJOL)
STORAGESEVER
2009-09-15
Sep 15, 2009 ... seeds of Lactuca sativa (Nascimento et al., 2004), ..... 25(3): 25-32. Mao S (2000). Application of β-mannanase in production of animals [J]. ... endo-β-mannanase activity during lettuce seed germination at high temperature[J].
Fossil mega- and microflora from the Březno Beds s.s. (Bohemian Cretaceous Basin, Coniacian)
Czech Academy of Sciences Publication Activity Database
Halamski, A. T.; Kvaček, J.; Svobodová, Marcela
2018-01-01
Roč. 253, June 2018 (2018), s. 123-138 ISSN 0034-6667 Institutional support: RVO:67985831 Keywords : fossil plant * Cretaceous * taxonomy * paleobotany * Coniacian * Czech Republic Subject RIV: DB - Geology ; Mineralogy OBOR OECD: Paleontology Impact factor: 1.817, year: 2016
UV irradiation of Shigella dysenteriae induced the transformation ...
African Journals Online (AJOL)
253.7 nm) with in-tervening outgrowth of survivors gave rise to clear bacteriophage plaques. Isolation, propagation and partial purification of the new Shd-4L10 phages showed that they are similar in morphology to the Myxobacteriaphage ...
Pediatric Palliative Care: A Personal Story
Full Text Available ... views 5:27 The Ugly Truth of Pediatric Cancer - Duration: 5:21. KidsCancerChannel 64,265 views 5: ... Health - Meriter 253,329 views 13:34 Teen Cancer Stories | UCLA Daltrey/Townshend Teen & Young Adult Cancer ...
Labor's charm wins over countryside / Milda Seputyte
Seputyte, Milda
2005-01-01
Küsitluste järgi on Leedu Tööpartei toetus elanike seas tõusnud 25,3 protsendini. Juhul kui praegune peaminister Algirdas Brazauskas peaks skandaali tõttu ametist tagasi astuma, kavatseb sellele kohale kandideerida Tööpartei esimees Viktor Uspaskihh
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 20; Issue 3. Nature Watch: Symbiosis in Coastal Marine Communities. Neelam Pereira. Feature Article Volume 20 Issue 3 March 2015 pp 245-253. Fulltext. Click here to view fulltext PDF. Permanent link:
Czech Academy of Sciences Publication Activity Database
Šťastná, Miroslava; Chimenti, I.; Marban, E.; Van Eyk, J.E.
2010-01-01
Roč. 10, č. 2 (2010), s. 245-253 ISSN 1615-9853 Institutional research plan: CEZ:AV0Z40310501 Keywords : animal proteomics * cardiac stem cells * neonatal cardiomyocytes Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 4.815, year: 2010
Digital Repository Service at National Institute of Oceanography (India)
Dwivedi, R.M.; Chauhan, R.; Solanki, H.U.; Raman, M.; Matondkar, S.G.P.; Madhu, V.R.; Meenakumari, B.
, NO. 4, AUGUST 2012 306 Schools of flying fishes and large size squids were observed during night at one bloom station in March 2007 (FORV-253). Also, on one occasion baby sharks were found swimming inside the bloom patch. These observations...
A Fascination with Folk Art. Modernism and the Avant-Garde in Munich, Prague and Moscow around 1913
Czech Academy of Sciences Publication Activity Database
Winter, Tomáš
2016-01-01
Roč. 64, 3/4 (2016), s. 240-253 ISSN 0049-5123 R&D Projects: GA ČR GA15-07456S Institutional support: RVO:68378033 Keywords : primitivism * cosmopolitanism * 20th-century art Subject RIV: AL - Art, Architecture, Cultural Heritage
Household measures for river flood risk reduction in the Czech Republic
Czech Academy of Sciences Publication Activity Database
Duží, B.; Vikhrov, Dmytro; Kelman, I.; Stojanov, R.; Juřička, D.
2017-01-01
Roč. 10, č. 2 (2017), s. 253-266 ISSN 1753-318X Institutional support: Progres-Q24 Keywords : Becva river basin * Czech Republic * flood damage Subject RIV: AH - Economics OBOR OECD: Applied Economics, Econometrics Impact factor: 3.121, year: 2016
Directory of Open Access Journals (Sweden)
Neil D.L. Clark
2015-12-01
Full Text Available Book review: Félix Pérez-Lorente 2015. Dinosaur Footprints and Trackways of La Rioja. 376 pp. Indiana University Press. Hardcover. ISBN: 978-0-253-01515-0. Price $85.00/£61.00; e-book $84.99.
Czech Academy of Sciences Publication Activity Database
Zajícová, Alena; Javorková, Eliška; Trošan, Peter; Chudíčková, Milada; Krulová, Magdaléna; Holáň, Vladimír
2014-01-01
Roč. 60, č. 6 (2014), s. 253-260 ISSN 0015-5500 R&D Projects: GA MŠk LO1309 Institutional support: RVO:68378041 Keywords : enzyme-linked immunosorbent assay * interferon * interleukin Subject RIV: EC - Immunology Impact factor: 1.000, year: 2014
Knowledge and practices relating to malaria in a semi-urban area of ...
African Journals Online (AJOL)
urban setting. The survey consisted of 253 volunteer ... 23(27.1%) participants with correct knowledge of malarial resistance were in the 31-35 age group bracket compared with other age groups (P=0.1). There was a significant difference in ...
Formalized 2003 ESH/ESC Hypertension Guidelines in Hospital and General Practice
Czech Academy of Sciences Publication Activity Database
Peleška, Jan; Anger, Z.; Buchtela, David; Tomečková, Marie; Veselý, Arnošt; Zvárová, Jana
22 Suppl. 2, - (2004), s. 253 ISSN 0263-6352. [European Meeting on Hypertension /14./. 13.06.2004-17.06.2004, Paris] R&D Projects: GA MŠk LN00B107 Keywords : hypertension guidelines * electronic form Subject RIV: BA - General Mathematics
DEFF Research Database (Denmark)
Langkjær, Michael Alexander
2012-01-01
Anmeldelsesartikel (review article) overfjorten bidrag i antologien Fashion in Film, som belyser forskellige sider af forholdet mellem mode og film.Fashion in Film er redigeret af Adrienne Munich (Bloomington: Indiana University Press, 2011, 360 sider, ISBN 978-0-253-22299-2)....
Czech Academy of Sciences Publication Activity Database
Gilligan, J. J.; McCunn, L. R.; Leskiw, B. D.; Herman, Zdeněk; Castleman Jr., A. W.
2001-01-01
Roč. 204, 1/3 (2001), s. 247-253 ISSN 1387-3806 Institutional research plan: CEZ:AV0Z4040901 Keywords : associative ionization * cluster ions * sodium bonding energies Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.176, year: 2001
Czech Academy of Sciences Publication Activity Database
Boccaccini, D. N.; Ševeček, O.; Frandsen, L. H.; Dlouhý, Ivo; Molin, S.; Cannio, M.; Hjelm, J.; Hendriksen, P. V.
2016-01-01
Roč. 162, č. 1 (2016), s. 250-253 ISSN 0167-577X Institutional support: RVO:68081723 Keywords : Metal-ceramic bond strength * Schwickerath crack-initiation test * SOC interfaces Subject RIV: JL - Materials Fatigue, Friction Mechanics Impact factor: 2.572, year: 2016
Concordance of MRI and EEG Focal Slowing in Nonsyndromic Epilepsy
Directory of Open Access Journals (Sweden)
J Gordon Millichap
2013-04-01
Full Text Available Investigators at the Kangwon National University, Korea, and The Epilepsy Center, Lurie Children’s Hospital of Chicago, USA studied the correlation and significance of EEG focal slowing and focal MRI abnormalities in 253 children with nonsyndromic epilepsy.
Indication of Importance of Including Soil Microbial Characteristics into Biotope Valuation Method.
Czech Academy of Sciences Publication Activity Database
Trögl, J.; Pavlorková, Jana; Packová, P.; Seják, J.; Kuráň, P.; Kuráň, J.; Popelka, J.; Pacina, J.
2016-01-01
Roč. 8, č. 3 (2016), č. článku 253. ISSN 2071-1050 Institutional support: RVO:67985858 Keywords : biotope assessment * biotope valuation method * soil microbial communities Subject RIV: DJ - Water Pollution ; Quality Impact factor: 1.789, year: 2016
Retreived bacteria from Noctiluca miliaris (green) bloom of the northeastern Arabian Sea
Basu, Subhajit; Matondkar, S. G. Prabhu; Furtado, Irene
2013-01-01
In recent years, seasonal blooms of the dinoflagellate Noctiluca miliaris have appeared in the open-waters of the northern Arabian Sea (NAS). This study provides the first characterization of bacteria from a seasonal bloom of green Noctiluca of NAS (20°N-17°N and 64°E-70°E), during the spring-inter-monsoon cruise of Sagar Sampada 253, in March 2007. Bacterial growth as assessed by most-probable number (MPN) and plate counts, revealed `variable-physiotypes' over a wide range of salinities (0%-25% w/v NaCl), pH levels (5-8.5), and organic nutrient strengths, in comparison to non-bloom waters. MPN indices of bacteria in surface waters of bloom stations *DWK and *PRB, corresponded to (3.08-4.41)×103 cells/mL at 3.5% NaCl (w/v), and (2.82-9.49)×102 cells/mL at 25% (w/v) NaCl in tryptone-yeast extract broth (TYE). Plate counts were (1.12-4)×106 CFU/mL at 0% (w/v) NaCl, (1.28-3.9)×106 CFU/mL at 3.5% (w/v) NaCl, and (0.4-7)×104 CFU/mL at 25% NaCl (w/v) on TYE. One-tenth-strength Zobell's gave (0.6-3.74)×105 CFU/mL at pH 5 to (3.58-7.5)×105 CFU/mL at pH 8.5. These bacteria were identified to the genera Bacillus, Cellulomonas, Staphylococcus, Planococcus, Dietzia, Virgibacillus, Micrococcus, Sporosarcinae, Leucobacter, and Halomonas. The identity of three strains (GUFBSS253N2, GUFBSS253N30, and GUFBSS253N84) was confirmed through 16S rDNA sequence homology as Bacillus cohnii, Bacillus flexus, and Bacillus cereus. The ˜2-3-fold higher plate counts of culturable bacteria from the open-waters of the NAS indicate that these bacteria could critically determine the biogeochemical dynamics of the bloom and its milieu. The role of these bacteria in sustaining/terminating the bloom is under evaluation.
The Vulnerability of the United States Railroad System to Terrorist Attacks
2015-06-12
can also assist during special political and sporting events, and provide humanitarian assistance after major weather events...essential to economic growth―not just for travel and tourism , but also for the mobility of the labor force.253 Many of Russia’s natural resources
Czech Academy of Sciences Publication Activity Database
Topka, Pavel; Delaigle, R.; Kaluža, Luděk; Gaigneaux, E.M.
2015-01-01
Roč. 253, SEP 15 (2015), s. 172-177 ISSN 0920-5861 R&D Projects: GA ČR GP13-24186P Institutional support: RVO:67985858 Keywords : oxidation * chlorobenzene * zirconia Subject RIV: CI - Industrial Chemistry, Chemical Engineering Impact factor: 4.312, year: 2015
Studená autoemisní katoda z tuhy do mikrotužky?
Czech Academy of Sciences Publication Activity Database
Knápek, Alexandr; Horáček, Miroslav; Chlumská, Jana; Král, Stanislav
2017-01-01
Roč. 62, č. 10 (2017), s. 251-253 ISSN 0447-6441 R&D Projects: GA MŠk(CZ) LO1212 Institutional support: RVO:68081731 Keywords : polymer graphite * field emission of electrons Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering OBOR OECD: Materials engineering
Zerfass, A.; Verčič, D.; Verhoeven, P.; Moreno, A.; Tench, R.
2015-01-01
The ECM 2015 survey is based on responses from 2,253 communication professionals in 41 countries. Detailed analyses are available for 20 countries and different types of organisations (companies, non-profits, governmental, agencies). The study was organised by the European Public Relations Education
2012-05-22
... INFORMATION CONTACT: Tom Jasikoff, Refuge Manager, 315-568- 5987 (phone), or Lia McLaughlin, Planning Team Leader, 413-253-8575 (phone); [email protected] (email). SUPPLEMENTARY INFORMATION: Introduction... (NYSDEC), and other partners for its role in the conservation of migratory birds, particularly waterfowl...
Unit Ministry Team Religious Support to Casualties on the Airland Battlefield
1987-10-28
Dysentery, Mod 248 Gastrits, Acute 249 Peptic Ulcer, Severe 250 Peptic Ulcer, Mod 251 Regional Ileitis 252 Regional Ileitis, Mod 253 Helminthiasis ...Severe 254 Helminthiasis , Mod 255 Migraine, acute 256 Varicosities, Severe 257 Varicosities, Mod 258 Essential Hypertension 2,)9 Ischemic Heart
jfewr ©2017 - jfewr Publications
African Journals Online (AJOL)
PAPILO
and expressed as a percentage of the total number .... occurrence and numerical methods from Lower. River Benue .... revealed different weight, age and size classes in ... J. App. Ichthyol. 22: 241-253. Frota L.O., Costa, P.A.S. and Braga, A.C..
Spurious Additional Warming Reconstructed From Borehole\
Czech Academy of Sciences Publication Activity Database
Šafanda, Jan
2018-01-01
Roč. 45, č. 6 (2018), s. 2780-2785 ISSN 0094-8276 R&D Projects: GA MŠk(CZ) EF16_013/0001792 Institutional support: RVO:67985530 Subject RIV: DC - Siesmology, Volcanology, Earth Structure OBOR OECD: Volcanology Impact factor: 4.253, year: 2016
Sero-prevalence of contagious bovine pleuropneumonia and its ...
African Journals Online (AJOL)
Abstract. Contagious bovine pleuropneumonia (CBPP) is a disease of cattle caused by ... of veterinary departments have resulted in CBPP running riot in east and ... 5 334 of Sheep, 9 253 of Goat, 72 of Horses, 601 of Mules, 3 300 of Donkeys.
Settlement problems in the Czech borderland
Czech Academy of Sciences Publication Activity Database
Vaishar, Antonín; Dvořák, Petr; Nováková, Eva; Zapletalová, Jana
2008-01-01
Roč. 60, č. 3 (2008), s. 241-253 ISSN 0016-7193 R&D Projects: GA MŠk 2D06001 Institutional research plan: CEZ:AV0Z30860518 Keywords : borderland * social infrastructure * education * micro-regions Subject RIV: DE - Earth Magnetism, Geodesy, Geography
Phenotypic plasticity and local adaptation in two extreme ...
African Journals Online (AJOL)
Principal coordinate analysis (PCoA) of allozymes revealed little genetic overlap among populations. Keywords: allozyme, genotype×environment interaction, genetic variation, local adaptation, reaction norms, starch gel electrophoresis, trade-off. African Journal of Range & Forage Science 2008, 25(3): 121–130 ...
Brno (k.ú. Bystrc, okr. Brno-město). Rokle. Neolit. Ojedinělý nález. Povrchový průzkum
Czech Academy of Sciences Publication Activity Database
Kirchner, Karel; Kuča, M.
2009-01-01
Roč. 50, 1-2 (2009), s. 253-254 ISSN 1211-7250 R&D Projects: GA ČR GA205/06/1024 Institutional research plan: CEZ:AV0Z30860518 Keywords : Brno Reservoir * neolithic * surface survey Subject RIV: AC - Archeology, Anthropology, Ethnology
Illness perceptions and quality of life among tuberculosis patients in ...
African Journals Online (AJOL)
used to distinguish health effects from other factors in- fluencing a ... A study from India has shown that the ..... Employee. 0.16. 0.26. 0.04. 1.67. Laborer. 0.33. 0.40. 0.07. 2.53. Employer* ..... Tuberculosis stigma and discrimination worldwide:.
Czech Academy of Sciences Publication Activity Database
Jana, R.; Lissner, F.; Schwederski, B.; Fiedler, Jan; Kaim, W.
2013-01-01
Roč. 32, č. 20 (2013), s. 5879-5886 ISSN 0276-7333 R&D Projects: GA ČR GA203/09/0705 Institutional support: RVO:61388955 Keywords : CHARGE-TRANSFER * COMPLEXES * ELECTRON Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 4.253, year: 2013
2013-05-24
... (``My position at Sears had nothing to do with Analytics or space Management. I worked in Marketing... firm clarified that one petitioner supplied print marketing management services, another petitioner... DEPARTMENT OF LABOR Employment and Training Administration [TA-W-81,253] Sears Holdings Management...
Can we predict agitation in patients with suicide attempts in the ...
African Journals Online (AJOL)
liberate self-poisoning or self-harm, with a rate of 38%4. Furthermore ... agitated in EDs, as this will affect resistance to treatment, as well as .... Benzodiazepine in urine. 11 (25.3%) .... Agitation is a severe form of anxiety associated with mo-.
African Journals Online (AJOL)
Synthese
économique des services rendus par les écosystèmes marins. La richesse ... croissance plus rapide que la moyenne de l‟économie ...... services and natural capital. Nature. 387, 253-260. .... d‟interactions où l‟humain est partie prenante. In.
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 10; Issue 12. Einstein's Last Dream: The Space - Time Unification of Fundamental Forces. Abdus Salam. Volume 10 Issue 12 December 2005 pp 246-253. Fulltext. Click here to view fulltext PDF. Permanent link:
Word order and information structure in Czech 3-and 4-year-olds' comprehension.
Czech Academy of Sciences Publication Activity Database
Smolík, Filip
2015-01-01
Roč. 35, č. 3 (2015), s. 237-253 ISSN 0142-7237 R&D Projects: GA ČR GA13-26779S Institutional support: RVO:68081740 Keywords : Case marking * grammar comprehension * information structure Subject RIV: AN - Psychology Impact factor: 1.254, year: 2015
effects of some physico-chemical parameters on prevalence of ...
African Journals Online (AJOL)
Usman et al.
/10.1016/S0140-6736(12)61728-0. Ndifon, G. T. and Ukoli F. M. (1989). Ecology of Fresh Water. Snails in South – Western Nigeria. Distribution and. Habitat Preferences. Hydrobiologia 171:231-253. Njoku-Tony, R.F. (2007) Ecological Studies ...
Normative Values for a Functional Capacity Evaluation
Soer, Remko; van der Schans, Cees P.; Geertzen, Jan H.; Groothoff, Johan W.; Brouwer, Sandra; Dijkstra, Pieter U.; Reneman, Michiel F.
2009-01-01
Objective: To establish normative values for a functional capacity evaluation (FCE) of healthy working subjects. Design: Descriptive. Setting: Rehabilitation center. Participants: Healthy working subjects (N=701; 448 men, 253 women) between 20 and 60 years of age, working in more than 180
Czech Academy of Sciences Publication Activity Database
Hellemans, S.; Fournier, D.; Hanus, Robert; Roisin, Y.
2017-01-01
Roč. 19, č. 6 (2017), s. 253-262 ISSN 1520-541X Institutional support: RVO:61388963 Keywords : facultative parthenogenesis * replacement queens * termites * asexual queen succession * ontogeny * Cavitermes Subject RIV: EG - Zoology OBOR OECD: Developmental biology Impact factor: 2.243, year: 2016
Long-term variability of temperature and precipitation in the Czech Lands: an attribution analysis
Czech Academy of Sciences Publication Activity Database
Mikšovský, J.; Brázdil, Rudolf; Štěpánek, Petr; Zahradníček, Pavel; Pišoft, P.
2014-01-01
Roč. 125, č. 2 (2014), s. 253-264 ISSN 0165-0009 Institutional support: RVO:67179843 Keywords : north-atlantic oscillacion * souothern oscillacion * global climate * neutral network * Europe * fluctuations * extensions * trends * periods * signal Subject RIV: EH - Ecology, Behaviour Impact factor: 3.430, year: 2014
Vplyv postihnutia na copingové stratégie a osobnostnú štruktúru rannej adolescencie
Czech Academy of Sciences Publication Activity Database
Karaffová, Eva
2009-01-01
Roč. 44, č. 3 (2009), s. 253-268 ISSN 0555-5574 R&D Projects: GA ČR GA406/09/2096 Institutional research plan: CEZ:AV0Z70250504 Keywords : coping strategies * personality factors * physical disability * early adolescence Subject RIV: AN - Psychology
Czech Academy of Sciences Publication Activity Database
Collett, S.; Štípská, P.; Kusbach, Vladimír; Schulmann, K.; Marciniak, G.
2017-01-01
Roč. 35, č. 3 (2017), s. 253-280 ISSN 0263-4929 Institutional support: RVO:67985530 Keywords : eclogite * Bohemian Massif * thermodynamic modelling * micro-fabric analysis * subduction and exhumation dynamics Subject RIV: DB - Geology ; Mineralogy OBOR OECD: Geology Impact factor: 3.594, year: 2016
Czech Academy of Sciences Publication Activity Database
Perez-Juarez, H.; Serrano-Vazquez, A.; Kosakyan, Anush; Mitchell, E.A.D.; Rivera Aguilar, V. M.; Lahr, D. J. G.; Hernandez Moreno, M. M.; Macías Cuellar, H.; Eguiarte, L. E.; Lara, E.
2017-01-01
Roč. 61, 17 July (2017), s. 253-264 ISSN 0932-4739 Institutional support: RVO:60077344 Keywords : Adaptation * Biological soil crust desert * Protist * Tehuacain-Cuicatlain Biosphere Reserve * Testate amoebae Subject RIV: EG - Zoology OBOR OECD: Zoology Impact factor: 2.581, year: 2016
Electrocatalysis of hemoglobin in ionic liquid BMIMPF 6 and CuS ...
African Journals Online (AJOL)
The results indicated that the BMIMPF6-CuS nanocomposite could be used for the preparation of electrochemical biosensor. KEY WORDS: Hemoglobin, Direct electrochemistry, Copper sulfide nanosphere, 1-Butyl-3-methylimidazolium hexafluorophosphate, Hydrogen peroxide. Bull. Chem. Soc. Ethiop. 2011, 25(3) ...
Calprotectin - a Pleiotropic Molecule in Acute and Chronic Inflammation
Czech Academy of Sciences Publication Activity Database
Stříž, I.; Trebichavský, Ilja
2004-01-01
Roč. 53, - (2004), s. 245-253 ISSN 0862-8408 R&D Projects: GA MŠk ME 580; GA MZd NI6843 Keywords : calprotectin * mrp8/14 * s100a9 Subject RIV: EE - Microbiology, Virology Impact factor: 1.140, year: 2004
Actinide production in the reaction of heavy ions with curium-248
International Nuclear Information System (INIS)
Moody, K.J.
1983-07-01
Chemical experiments were performed to examine the usefulness of heavy ion transfer reactions in producing new, neutron-rich actinide nuclides. A general quasi-elastic to deep-inelastic mechanism is proposed, and the utility of this method as opposed to other methods (e.g. complete fusion) is discussed. The relative merits of various techniques of actinide target synthesis are discussed. A description is given of a target system designed to remove the large amounts of heat generated by the passage of a heavy ion beam through matter, thereby maximizing the beam intensity which can be safely used in an experiment. Also described is a general separation scheme for the actinide elements from protactinium (Z=91) to mendelevium (Z=101), and fast specific procedures for plutonium, americium and berkelium. The cross sections for the production of several nuclides from the bombardment of 248 Cm with 18 O, 86 Kr and 136 Xe projectiles at several energies near and below the Coulomb barrier were determined. The results are compared with yields from 48 Ca and 238 U bombardments of 248 Cm. Simple extrapolation of the product yields into unknown regions of charge and mass indicates that the use of heavy ion transfer reactions to produce new, neutron-rich above-target species is limited. The substantial production of neutron-rich below-target species, however, indicates that with very heavy ions like 136 Xe and 238 U the new species 248 Am, 249 Am and 247 Pu should be produced with large cross sections from a 248 Cm target. A preliminary, unsuccessful attempt to isolate 247 Pu is outlined. The failure is probably due to the half life of the decay, which is calculated to be less than 3 minutes. The absolute gamma ray intensities from 251 Bk decay, necessary for calculating the 251 Bk cross section, are also determined
Minor Actinides Recycling in PWRs
International Nuclear Information System (INIS)
Delpech, M.; Golfier, H.; Vasile, A.; Varaine, F.; Boucher, L.; Greneche, D.
2006-01-01
Recycling of minor actinides in current and near future PWR is considered as one of the options of the general waste management strategy. This paper presents the analysis of this option both from the core physics and fuel cycle point of view. A first indicator of the efficiency of different neutron spectra for transmutation purposes is the capture to fission cross sections ratio which is less favourable by a factor between 5 to 10 in PWRs compared to fast reactors. Another indicator presented is the production of high ranking isotopes like Curium, Berkelium or Californium in the thermal or epithermal spectrum conditions of PWR cores by successive neutron captures. The impact of the accumulation of this elements on the fabrication process of such PWR fuels strongly penalizes this option. The main constraint on minor actinides loadings in PWR (or fast reactors) fuels are related to their direct impact (or the impact of their transmutation products) on the reactivity coefficients, the reactivity control means and the core kinetics parameters. The main fuel cycle physical parameters like the neutron source, the alpha decay power, the gamma and neutrons dose rate and the criticality aspects are also affected. Recent neutronic calculations based on a reference core of the Evolutionary Pressurized Reactor (EPR), indicates typical maximum values of 1 % loadings. Different fuel design options for minor actinides transmutation purposes in PWRs are presented: UOX and MOX, homogeneous and heterogeneous assemblies. In this later case, Americium loading is concentrated in specific pins of a standard UOX assembly. Recycling of Neptunium in UOX and MOX fuels was also studied to improve the proliferation resistance of the fuel. The impact on the core physics and penalties on Uranium enrichment were underlined in this case. (authors)
30 CFR 253.3 - How are the terms used in this regulation defined?
2010-07-01
... in this regulation defined? Terms used in this part have the following meaning: Advertise means... well drilled from a mobile offshore drilling unit (MODU) and the associated riser and well control...
Method and apparatus for monitoring the flow of mercury in a system
Grossman, M.W.
1987-12-15
An apparatus and method for monitoring the flow of mercury in a system are disclosed. The equipment enables the entrainment of the mercury in a carrier gas e.g., an inert gas, which passes as mercury vapor between a pair of optically transparent windows. The attenuation of the emission is indicative of the quantity of mercury (and its isotopes) in the system. A 253.7 nm light is shone through one of the windows and the unabsorbed light is detected through the other window. The absorption of the 253.7 nm light is thereby measured whereby the quantity of mercury passing between the windows can be determined. The apparatus includes an in-line sensor for measuring the quantity of mercury. It includes a conduit together with a pair of apertures disposed in a face to face relationship and arranged on opposite sides of the conduit. A pair of optically transparent windows are disposed upon a pair of viewing tubes. A portion of each of the tubes is disposed inside of the conduit and within each of the apertures. The two windows are disposed in a face to face relationship on the ends of the viewing tubes and the entire assembly is hermetically sealed from the atmosphere whereby when 253.7 nm ultraviolet light is shone through one of the windows and detected through the other, the quantity of mercury which is passing by can be continuously monitored due to absorption which is indicated by attenuation of the amplitude of the observed emission. 4 figs.
TMFunction data: 663 [TMFunction[Archive
Lifescience Database Archive (English)
Full Text Available Lambert G, Forster IC, Stange G, Biber J, Murer H. J Gen Physiol. 1999 Nov;114(5):637-52 cysteine mutagenesis... -25.3 Electrogenic Activity (Ip) electrophysiological ... NPT2A_RAT (Q06496) Helix ... mutagenesis; phosphate transport; electrophysiology; Xenopus laevis oocyte
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education. Nikita Agarwal. Articles written in Resonance – Journal of Science Education. Volume 23 Issue 3 March 2018 pp 253-262 General Article. Maryam Mirzakhani: The Master Artist of Curved Surfaces · Nikita Agarwal Riddhi Shah Geetha Venkataraman.
Cell cycle dependent expression of Plk 1 in synchronized porcine fetal fibroblasts
Czech Academy of Sciences Publication Activity Database
Anger, M.; Kues, W. A.; Klíma, J.; Mielenz, M.; Kubelka, M.; Motlík, J.; Ešner, M.; Dvořák, Petr; Carnwath, J. W.; Niemann, H.
2003-01-01
Roč. 65, - (2003), s. 245-253 ISSN 1040-452X R&D Projects: GA MŠk LN00A065 Institutional research plan: CEZ:AV0Z5039906 Keywords : serum deprivation Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.543, year: 2003
The International Diversification of Banks and the Value of their Cross-Border M&A Advice
de Jong, A.; Ongena, S.; van der Poel, M.
2010-01-01
This paper investigates the effects of international diversification of banks on the value of their M&A advice. We study bidder returns to 1,253 cross-border M&A announcements. We find that acquirers engaging a more internationally diversified financial advisor generate lower excess returns.
Mukhopadhyay, Prof. Dhrubajyoti
Indian Academy of Sciences (India)
Home; Fellowship. Fellow Profile. Elected: 1988 Section: Earth & Planetary Sciences. Mukhopadhyay, Prof. Dhrubajyoti Ph.D. (London), FNA, FNASc. Date of birth: 19 September 1938. Specialization: Structural Geology, Precambrian Geology Address: G-7, MIG Housing Colony, 25/3, Raja Manindra Road, Kolkata 700 037, ...
van Voorst, R.
2009-01-01
Understanding human adaptation to climate changes is one of the most important research issues within the area of global environmental change, accounting for the fact that people worldwide are currently adapting to their changing environment (Adger and Kelly 2000: 253; Smit et al. 2008). The
A.R. Wood (Andrew); T. Esko (Tõnu); J. Yang (Jian); S. Vedantam (Sailaja); T.H. Pers (Tune); S. Gustafsson (Stefan); A.Y. Chu (Audrey Y); K. Estrada Gil (Karol); J. Luan; Z. Kutalik; N. Amin (Najaf); M.L. Buchkovich (Martin); D.C. Croteau-Chonka (Damien); F.R. Day (Felix); Y. Duan (Yanan); M. Fall (Magnus); R.S.N. Fehrmann (Rudolf); T. Ferreira (Teresa); A.U. Jackson (Anne); J. Karjalainen (Juha); K.S. Lo (Ken Sin); A. Locke (Adam); R. Mägi (Reedik); E. Mihailov (Evelin); E. Porcu (Eleonora); J.C. Randall (Joshua); A. Scherag (Andre); A.A.E. Vinkhuyzen (Anna A.); H.J. Westra (Harm-Jan); T.W. Winkler (Thomas W.); T. Workalemahu (Tsegaselassie); J.H. Zhao (Jing Hua); D. Absher (Devin); E. Albrecht (Eva); J. Baron (Jeffrey); M. Beekman (Marian); A. Demirkan (Ayşe); G.B. Ehret (Georg); B. Feenstra; M.F. Feitosa (Mary Furlan); K. Fischer (Krista); R.M. Fraser (Ross); A. Goel (Anuj); J. Gong (Jian); A.E. Justice (Anne); S. Kanoni (Stavroula); M.E. Kleber (Marcus); K. Kristiansson (Kati); U. Lim (Unhee); V. Lotay (Vaneet); J.C. Lui (Julian C); M. Mangino (Massimo); I.M. Leach (Irene Mateo); M.C. Medina-Gomez (Carolina); M.A. Nalls (Michael); A.S. Dimas (Antigone); C. Palmer (Cameron); D. Pasko (Dorota); S. Pechlivanis (Sonali); I. Prokopenko (Inga); J.S. Ried (Janina); S. Ripke (Stephan); D. Shungin (Dmitry); A. Stancáková (Alena); R.J. Strawbridge (Rona); Y.J. Sung (Yun Ju); T. Tanaka (Toshiko); A. Teumer (Alexander); S. Trompet (Stella); S.W. Van Der Laan (Sander W.); J. van Setten (Jessica); J.V. van Vliet-Ostaptchouk (Jana); Z. Wang (Zhaoming); L. Yengo (Loic); W. Zhang (Weihua); U. Afzal (Uzma); J. Ärnlöv (Johan); G.M. Arscott (Gillian M.); S. Bandinelli (Stefania); A. Barrett (Angela); C. Bellis (Claire); A.J. Bennett (Amanda); C. Berne (Christian); M. Blüher (Matthias); J.L. Bolton (Jennifer); Y. Böttcher (Yvonne); H.A. Boyd; M. Bruinenberg (M.); B.M. Buckley (Brendan M.); S. Buyske (Steven); I.H. Caspersen (Ida H.); P.S. Chines (Peter); R. Clarke (Robert); S. Claudi-Boehm (Simone); M.N. Cooper (Matthew); E.W. Daw (E Warwick); P.A. De Jong (Pim A); J. Deelen (Joris); G. Delgado; J.C. Denny (Josh C); R.A.M. Dhonukshe-Rutten (Rosalie); M. Dimitriou (Maria); A.S.F. Doney (Alex); M. Dörr (Marcus); N. Eklund (Niina); E. Eury (Elodie); L. Folkersen (Lasse); M. Garcia (Melissa); F. Geller (Frank); V. Giedraitis (Vilmantas); A. Go (Attie); H. Grallert (Harald); T.B. Grammer (Tanja B); J. Gräßler (Jürgen); H. Grönberg (Henrik); L.C.P.G.M. de Groot (Lisette); C.J. Groves (Christopher J.); J. Haessler (Jeff); P. Hall (Per); T. Haller (Toomas); G. Hallmans (Göran); M. Hannemann (Mario); C.A. Hartman (Catharina); M. Hassinen (Maija); C. Hayward (Caroline); N.L. Heard-Costa (Nancy); Q. Helmer (Quinta); G. Hemani; A.K. Henders (Anjali); H.L. Hillege (Hans); M.A. Hlatky (Mark); W. Hoffmann (Wolfgang); P. Hoffmann (Per); O.L. Holmen (Oddgeir); J.J. Houwing-Duistermaat (Jeanine); T. Illig (Thomas); A. Isaacs (Aaron); A.L. James (Alan); J. Jeff (Janina); B. Johansen (Berit); A. Johansson (Åsa); G.J. Jolley (Jason); T. Juliusdottir (Thorhildur); M.J. Junttila (Juhani); M.M.L. Kho (Marcia); L. Kinnunen (Leena); N. Klopp (Norman); T. Kocher; W. Kratzer (Wolfgang); P. Lichtner (Peter); L. Lind (Lars); J. Lindström (Jaana); S. Lobbens (Stéphane); M. Lorentzon (Mattias); Y. Lu (Yingchang); V. Lyssenko (Valeriya); P.K. Magnusson (Patrik); A. Mahajan (Anubha); M. Maillard (Marc); W.L. McArdle (Wendy); C.A. McKenzie (Colin A.); S. McLachlan (Stela); P.J. McLaren (Paul J); C. Menni (Cristina); S. Merger (Sigrun); L. Milani (Lili); A. Moayyeri (Alireza); K.L. Monda (Keri); M.A. Morken (Mario); G. Müller (Gabriele); M. Müller-Nurasyid (Martina); A.W. Musk (Arthur); N. Narisu (Narisu); M. Nauck (Matthias); I.M. Nolte (Ilja M.); M.M. Nöthen (Markus); L. Oozageer (Laticia); S. Pilz (Stefan); N.W. Rayner (Nigel William); F. Renström (Frida); N.R. Robertson (Neil R.); L.M. Rose (Lynda M.); R. Roussel (Ronan); S. Sanna (Serena); H. Scharnagl (Hubert); S. Scholtens (Salome); F.R. Schumacher (Fredrick R); H. Schunkert (Heribert); R.A. Scott (Robert); J.S. Sehmi (Joban); T. Seufferlein (Thomas); J. Shi (Jianxin); K. Silventoinen (Karri); J.H. Smit (Johannes); G.D. Smith; J. Smolonska (Joanna); A. Stanton (Alice); K. Stirrups (Kathy); D.J. Stott (David J); H.M. Stringham (Heather); J. Sundstrom (Johan); M. Swertz (Morris); A.C. Syvanen; B. Tayo (Bamidele); G. Thorleifsson (Gudmar); J.P. Tyrer (Jonathan); S. Van Dijk (Suzanne); N.M. van Schoor (Natasja); N. van der Velde (Nathalie); D. van Heemst (Diana); F.V.A. Van Oort (Floor V A); S.H.H.M. Vermeulen (Sita); N. Verweij (Niek); J.M. Vonk (Judith M); L. Waite (Lindsay); M. Waldenberger (Melanie); R. Wennauer (Roman); L.R. Wilkens (Lynne R.); C. Willenborg (Christina); T. Wilsgaard (Tom); M.K. Wojczynski (Mary ); A. Wong (Andrew); A. Wright (Alan); Q. Zhang (Qunyuan); D. Arveiler (Dominique); S.J.L. Bakker (Stephan); J. Beilby (John); R.N. Bergman (Richard); S.M. Bergmann (Sven); R. Biffar; J. Blangero (John); D.I. Boomsma (Dorret); S.R. Bornstein (Stefan R.); P. Bovet (Pascal); P. Brambilla (Paolo); M.J. Brown (Morris); H. Campbell (Harry); M. Caulfield (Mark); A. Chakravarti (Aravinda); F.S. Collins (Francis); D.C. Crawford (Dana); L.A. Cupples (Adrienne); J. Danesh (John); U. de Faire (Ulf); H.M. den Ruijter (Hester ); R. Erbel (Raimund); J. Erdmann (Jeanette); J. Eriksson; M. Farrall (Martin); E. Ferrannini (Ele); J. Ferrieres (Jean); I. Ford; N.G. Forouhi (Nita); T. Forrester (Terrence); R.T. Gansevoort (Ron); P.V. Gejman (Pablo); C. Gieger (Christian); A. Golay (Alain); R.F. Gottesman (Rebecca); V. Gudnason (Vilmundur); U. Gyllensten (Ulf); D.W. Haas (David W); A.S. Hall (Alistair); T.B. Harris (Tamara); A.T. Hattersley (Andrew); A.C. Heath (Andrew C); C. Hengstenberg (Christian); A.A. Hicks (Andrew); L.A. Hindorff (Lucia A); A. Hingorani (Aroon); A. Hofman (Albert); G.K. Hovingh (Kees); S.E. Humphries (Steve E.); S.C. Hunt (Steven); E. Hypponen (Elina); K.B. Jacobs (Kevin); M.-R. Jarvelin (Marjo-Riitta); P. Jousilahti (Pekka); A. Jula (Antti); J. Kaprio (Jaakko); J.J.P. Kastelein (John); M.H. Kayser (Manfred); F. Kee (Frank); S. Keinanen-Kiukaanniemi (Sirkka); L.A.L.M. Kiemeney (Bart); J.S. Kooner (Jaspal S.); C. Kooperberg (Charles); S. Koskinen (Seppo); P. Kovacs (Peter); A. Kraja (Aldi); M. Kumari (Meena); J. Kuusisto (Johanna); T.A. Lakka (Timo); C. Langenberg (Claudia); L. Le Marchand (Loic); T. Lehtimäki (Terho); S. Lupoli (Sara); P.A. Madden; S. Männistö (Satu); P. Manunta (Paolo); A. Marette (Andre'); T.C. Matise (Tara C.); B. McKnight (Barbara); T. Meitinger (Thomas); F.L. Moll (Frans); G.W. Montgomery (Grant W.); A.D. Morris (Andrew); A.P. Morris (Andrew); J.C. Murray (Jeffrey); M. Nelis (Mari); C. Ohlsson (Claes); A.J. Oldehinkel (Albertine); K.K. Ong (Ken K.); W.H. Ouwehand (Willem); G. Pasterkamp (Gerard); A. Peters (Annette); P.P. Pramstaller (Peter Paul); J.F. Price (Jackie F.); L. Qi (Lu); O. Raitakari (Olli); T. Rankinen (Tuomo); D.C. Rao (Dabeeru C.); T.K. Rice (Treva K.); M.D. Ritchie (Marylyn D.); I. Rudan (Igor); V. Salomaa (Veikko); N.J. Samani (Nilesh); J. Saramies (Jouko); M.A. Sarzynski (Mark A.); P.E.H. Schwarz (Peter E. H.); S. Sebert (Sylvain); P. Sever (Peter); A.R. Shuldiner (Alan); J. Sinisalo (Juha); V. Steinthorsdottir (Valgerdur); R.P. Stolk; J.-C. Tardif (Jean-Claude); A. Tönjes (Anke); A. Tremblay (Angelo); E. Tremoli (Elena); J. Virtamo (Jarmo); M.-C. Vohl (Marie-Claude); P. Amouyel (Philippe); F.W. Asselbergs (Folkert W.); T.L. Assimes (Themistocles); M. Bochud (Murielle); B.O. Boehm (Bernhard); E.A. Boerwinkle (Eric); E.P. Bottinger (Erwin P.); C. Bouchard (Claude); S. Cauchi (Stéphane); J.C. Chambers (John C.); S.J. Chanock (Stephen); R.S. Cooper (Richard S.); P.I.W. de Bakker (Paul); G.V. Dedoussis (George); L. Ferrucci (Luigi); P.W. Franks; P. Froguel (Philippe); L. Groop (Leif); C.A. Haiman (Christopher); A. Hamsten (Anders); M.G. Hayes (M. Geoffrey); J. Hui (Jennie); D. Hunter (David); K. Hveem (Kristian); J.W. Jukema (Jan Wouter); R.C. Kaplan (Robert); M. Kivimaki (Mika); D. Kuh (Diana); M. Laakso (Markku); Y. Liu (YongMei); N.G. Martin (Nicholas); W. März (Winfried); M. Melbye (Mads); S. Moebus (Susanne); P. Munroe (Patricia); I. Njølstad (Inger); B.A. Oostra (Ben); C.N.A. Palmer (Colin); N.L. Pedersen (Nancy L.); M. Perola (Markus); L. Perusse (Louis); U. Peters (Ulrike); J.E. Powell (Joseph); C. Power (Christine); T. Quertermous (Thomas); R. Rauramaa (Rainer); E. Reinmaa (Eva); P.M. Ridker (Paul); F. Rivadeneira Ramirez (Fernando); J.I. Rotter (Jerome I.); T. Saaristo (Timo); D. Saleheen; D. Schlessinger (David); P.E. Slagboom (P Eline); H. Snieder (Harold); T.D. Spector (Timothy); K. Strauch (Konstantin); M. Stumvoll (Michael); J. Tuomilehto (Jaakko); M. Uusitupa (Matti); P. van der Harst (Pim); H. Völzke (Henry); M. Walker (Mark); N.J. Wareham (Nick); H. Watkins (Hugh); H.E. Wichmann (Heinz Erich); J.F. Wilson (James F); P. Zanen (Pieter); P. Deloukas (Panagiotis); I.M. Heid (Iris); C.M. Lindgren (Cecilia); K.L. Mohlke (Karen); E.K. Speliotes (Elizabeth); U. Thorsteinsdottir (Unnur); I.E. Barroso (Inês); C.S. Fox (Caroline S.); K.E. North (Kari); D.P. Strachan (David P.); J.S. Beckmann (Jacques); S.I. Berndt (Sonja); M. Boehnke (Michael); I.B. Borecki (Ingrid); M.I. McCarthy (Mark); A. Metspalu (Andres); J-A. Zwart (John-Anker); A.G. Uitterlinden (André); C.M. van Duijn (Cornelia); L. Franke (Lude); C.J. Willer (Cristen); A. Price (Alkes); G. Lettre (Guillaume); R.J.F. Loos (Ruth); M.N. Weedon (Michael); E. Ingelsson (Erik); J.R. O´Connell; G.R. Abecasis (Gonçalo); D.I. Chasman (Daniel); D. Anderson (Denise); M.E. Goddard (Michael); P.M. Visscher (Peter); J.N. Hirschhorn (Joel); T.M. Frayling (Timothy)
2014-01-01
textabstractUsing genome-wide data from 253,288 individuals, we identified 697 variants at genome-wide significance that together explained one-fifth of the heritability for adult height. By testing different numbers of variants in independent studies, we show that the most strongly associated
Micro and nanohardness testing of laser welds
Czech Academy of Sciences Publication Activity Database
Šebestová, H.; Čtvrtlík, Radim; Chmelíčková, H.; Tomáštík, J.
2014-01-01
Roč. 15, č. 3 (2014), s. 247-253 ISSN 1454-9069 R&D Projects: GA TA ČR TA01010517 Institutional support: RVO:68378271 Keywords : Vickers microhardness * depth sensing indentation * laser welding Subject RIV: JP - Industrial Processing Impact factor: 1.658, year: 2014
Biosorption of mercury on magnetically modified yeast cells
Czech Academy of Sciences Publication Activity Database
Yavuz, H.; Denizli, A.; Gungunes, H.; Šafaříková, Miroslava; Šafařík, Ivo
2006-01-01
Roč. 52, - (2006), s. 253-260 ISSN 1383-5866 R&D Projects: GA MŠk(CZ) OC 108 Institutional research plan: CEZ:AV0Z60870520 Keywords : mercury removal * magnetic biosorbents * yeast Subject RIV: EI - Biotechnology ; Bionics Impact factor: 2.497, year: 2006
Strangeness Electromagnetic Production on Nucleons and Nuclei
Czech Academy of Sciences Publication Activity Database
Bydžovský, Petr; Sotona, Miloslav
2010-01-01
Roč. 835, 1-4 (2010), s. 246-253 ISSN 0375-9474 R&D Projects: GA ČR GA202/08/0984 Institutional research plan: CEZ:AV0Z10480505 Keywords : Kaon * photoproduction * electroproduction Subject RIV: BE - Theoretical Physics Impact factor: 1.986, year: 2010
Prognostic Importance of Cardiovascular Risk Factors in Myocardial Infarction Patients
Czech Academy of Sciences Publication Activity Database
Monhart, Z.; Grünfeldová, H.; Zvárová, Jana; Janský, P.
2010-01-01
Roč. 122, č. 2 (2010), e253 ISSN 0009-7322. [World Congress of Cardiology . 16.06.2010-19.06.2010, Beijing] Institutional research plan: CEZ:AV0Z10300504 Keywords : cardiology * risk factors * myocardioal infarction Subject RIV: FA - Cardiovascular Diseases incl. Cardiotharic Surgery
Czech Academy of Sciences Publication Activity Database
Plánka, L.; Nečas, A.; Gál, P.; Kecová, H.; Filová, Eva; Křen, L.; Kroupa, P.
2007-01-01
Roč. 76, - (2007), s. 253-263 ISSN 0001-7213 R&D Projects: GA MŠk 2B06130 Institutional research plan: CEZ:AV0Z50390512 Keywords : Growth plate injury * Physis * Growth arrest Subject RIV: FI - Traumatology, Orthopedics Impact factor: 0.687, year: 2007
Lichens of the virgin forest reserve Žofínský prales (Czech Republic) and surrounding woodlands
Czech Academy of Sciences Publication Activity Database
Malíček, J.; Palice, Zdeněk
2013-01-01
Roč. 26, č. 2 (2013), s. 253-292 ISSN 0018-0971 R&D Projects: GA MK(CZ) DF12P01OVV025 Keywords : epiphytic and epixylic lichen s * biodiversity * old-growth forest Subject RIV: EF - Botanics Impact factor: 0.919, year: 2013
In search of the main properties of phthalocyanines participating in toxicity against cyanobacteria
Czech Academy of Sciences Publication Activity Database
Jančula, Daniel; Maršálek, Blahoslav; Novotná, Zlatica; Černý, J.; Karásková, M.; Rakušan, J.
2009-01-01
Roč. 77, č. 11 (2009), s. 1520-1525 ISSN 0045-6535 R&D Projects: GA MŠk 1M0571 Institutional research plan: CEZ:AV0Z60050516 Keywords : phthalocyanine s * cyanobycteria * toxicity Subject RIV: EF - Botanics Impact factor: 3.253, year: 2009
Czech Academy of Sciences Publication Activity Database
Arvanitis, L.; Wiklund, C.; Münzbergová, Zuzana; Dahlgren, J. P.; Ehrlén, J.
2010-01-01
Roč. 13, č. 3 (2010), s. 330-337 ISSN 1461-023X R&D Projects: GA ČR GA526/08/0706 Institutional research plan: CEZ:AV0Z60050516 Keywords : herbivore * trait * selection Subject RIV: EF - Botanics Impact factor: 15.253, year: 2010
Effects of particle size and laser wavelength on heating of silver ...
Indian Academy of Sciences (India)
2016-07-15
Jul 15, 2016 ... heating of nanoparticles is one of the essential stages of selective cell targeting. It is necessary to note that the ... Doping the walls of the microcapsules with ..... [19] A N Volkov, Ca Sevilla and L V Zhigilei, Appl. Surf. Sci. 253,.
Presidendi mõjukus avaliku arvamuse silmade läbi / Marti Taru
Taru, Marti, 1970-
2002-01-01
Uuringu tulemusena selgus, et avaliku arvamuse silmis eristub president teistest riigijuhtidest just riigimehelikkuse poolest - president peaks olema ametiisik, kes seisab kogu ühiskonna arengu ja heaolu eest, mitte aga ei tegutse kitsaste kildkondade huve esindades. Tabelid. Lisa: Valimi sotsiaal-demograafiline kirjeldus lk. 253-256
Investigation of medical board reports of disability due to mental health problems
Directory of Open Access Journals (Sweden)
Mesut Yildiz
2016-06-01
Conclusion: We think that this report might be helpful for regulations related to disabled people, and might guide adult psychiatric services for patients who present to medical boards for disability due to mental health problems. [Cukurova Med J 2016; 41(2.000: 253-258
Characterization of natural leaf senescence in tobacco (Nicotiana tabacum) plants grown in vitro
Czech Academy of Sciences Publication Activity Database
Uzelac, B.; Janošević, D.; Simonović, A.; Motyka, Václav; Dobrev, Petre; Budimir, S.
2016-01-01
Roč. 253, č. 2 (2016), s. 259-275 ISSN 0033-183X R&D Projects: GA ČR(CZ) GAP506/11/0774 Institutional support: RVO:61389030 Keywords : Leaf senescence * Mesophyll ultrastructure * Phytohormones Subject RIV: EF - Botanics Impact factor: 2.870, year: 2016
Biodegradation of brominated aromatics by cultures and laccase of Trametes versicolor
Czech Academy of Sciences Publication Activity Database
Uhnáková, Bronislava; Petříčková, Alena; Biedermann, David; Homolka, Ladislav; Vejvoda, Vojtěch; Bednář, P.; Papoušková, B.; Šulc, Miroslav; Martínková, Ludmila
2009-01-01
Roč. 76, č. 6 (2009), s. 826-832 ISSN 0045-6535 R&D Projects: GA MŠk 2B06151 Institutional research plan: CEZ:AV0Z50200510 Keywords : Brominated phenols * Tetrabromobisphenol A * Laccase Subject RIV: CE - Biochemistry Impact factor: 3.253, year: 2009
The birth weight of apparently healthy Nigerian newborns in Sokoto ...
African Journals Online (AJOL)
. 253 babies were enrolled. Results: There were 131 males and 122 females giving a male: female ratio of 1.1:1. Gestational age by maternal dates ranged from 28 to 44 weeks. There was a consistent increase in mean values of weight as the ...
The Relationship of Visual Evoked Potential Asymmetries to the Performance of Sonar Operators
1981-08-11
also been related to EP variability. Schizophrenic adults and patients with Korsakoff’s Syndrome have shown higher evoked potential variability than...average evoked response in Korsakoff patients. J. Psychiatry Res. 6: 253-260, 1969. Santoro, T. and D. Fender. Rules for the perception of
78 FR 51712 - Endangered Species; File No. 16733
2013-08-21
... DEPARTMENT OF COMMERCE National Oceanic and Atmospheric Administration RIN 0648-XC253 Endangered... coriacea), and olive ridley (L. olivacea) sea turtles for purposes of scientific research. ADDRESSES: The... olive ridley sea turtles had been submitted by the above-named organization. The requested permit has...
2005-10-01
Many plants have both sexual and vegetative reproduction, and this may be best handled with separate classes that reflect meaningful differ- ences in... Transmutation and functional representation of heterogeneous landscapes.” Landscape Ecology 5: 239-253. LaGro, J.Jr. 1991. “Assessing patch
"Českoslovenství" na konci světa: krajané na Tasmánii.
Czech Academy of Sciences Publication Activity Database
Brouček, Stanislav
2013-01-01
Roč. 23, č. 4 (2013), s. 241-253 ISSN 0862-8351 R&D Projects: GA MZV(CZ) RM01/15/04 Institutional support: RVO:68378076 Keywords : emigration * migration policy * Czech-Slovakian relations * Czechs and Slovaks in Tasmania Subject RIV: AC - Archeology, Anthropology, Ethnology
Specific language impairment is associated with maternal and family factors
Diepeveen, F.B.; Dommelen, P. van; Oudesluys-Murphy, A.M.; Verkerk, P.H.
2017-01-01
Background: This study aimed to identify risk factors associated with specific language impairment (SLI). Methods: In a nested case–control design, 253 children attending special needs schools for severe speech and language difficulties in the Netherlands were matched for sex and date of birth with
75 FR 44809 - Office of the Secretary Submission for OMB Review: Comment Request
2010-07-29
..., electronic, mechanical, or other technological collection techniques or other forms of information technology... Administration. Type of Review: Extension without change of a previously approved collection. Title of Collection: Aerial Lifts (29 CFR 1926.253). OMB Control Number: 1218-0216. Affected Public: Business or other for...
48 CFR 752.7019 - Participant training.
2010-10-01
... contract. The current version of Chapter 253 may be obtained directly from the USAID website at http://www... Agency. The website for academic programs is: http://www.iie.org/fulbright/posts/restrict. U.S.-based... (website: http://policyworks.gov). [64 FR 5011, Feb. 2, 1999] ...
2007-07-24
subsidies to support such services were increased. Innovative providers, however, may find ways to expand access to health care by the indigent using...Microstructure of Stock Markets,” Institut d’Économie Industrielle (IDEI) working paper #253, Toulouse, France, May 28, 2004; and Ananth Madhavan
2010-09-13
... modification of PATS Aircraft, LLC, auxiliary fuel tanks. This AD results from fuel system reviews conducted by... Aircraft Systems, 21652 Nanticoke Avenue, Georgetown, Delaware 19947; telephone 302-253-6157; fax 302-855... proposed to require deactivation or modification of PATS Aircraft, LLC, auxiliary fuel tanks. Comments We...
Czech Academy of Sciences Publication Activity Database
Kostelecký, Tomáš
2005-01-01
Roč. 41, č. 2 (2005), s. 253-270 ISSN 0038-0288 R&D Projects: GA ČR(CZ) GA403/03/0417 Institutional research plan: CEZ:AV0Z70280505 Keywords : models * electoral predictions * surveys Subject RIV: AO - Sociology, Demography Impact factor: 0.113, year: 2005
Sadhana | Indian Academy of Sciences
Indian Academy of Sciences (India)
pp 241-253. An approximate method for lateral stability analysis of wall-frame buildings including shear deformations of walls ... A study on soil–structure interaction analysis in canyon-shaped topographies ... Stochastic finite element analysis of long-span bridges with CFRP cables under earthquake ground motion.
2013-03-28
...-568- 5987 (phone), or Lia McLaughlin, Planning Team Leader, 413-253-8575 (phone); email... Conservation (NYSDEC), and other partners for its role in the conservation of migratory birds, particularly.... Newly acquired lands would not be converted to impoundments. Natural succession would play a larger role...
Book Reviews: Social justice and neoliberalism | Vally | New ...
African Journals Online (AJOL)
Social justice and neoliberalism - Global perspectives. Adriaan Smith, Alison Stenning, Kate Willis (Eds). Zed Books: London and New York. 2008, 253 pp. Full Text: EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT · AJOL African Journals Online. HOW TO USE AJOL.
Czech Academy of Sciences Publication Activity Database
Plášil, Jakub
2017-01-01
Roč. 62, č. 4 (2017), s. 253-260 ISSN 1802-6222 R&D Projects: GA ČR GA17-09161S Institutional support: RVO:68378271 Keywords : kamitugaite * uranyl phosphate * crystal structure * topology Subject RIV: DB - Geology ; Mineralogy OBOR OECD: Geology Impact factor: 0.609, year: 2016
Digital Repository Service at National Institute of Oceanography (India)
Dhargalkar, V.K.
discrete depths. Chl @ia@@ concentration at all the 3 depths varied from 0.026 to 0.253 mu g l@u-1@@ showing minimum values during August-September. POC values varied from 280 to 1058 mu g l@u-1@@ while its constituent fractions such as particulate...
Vapor Pressure of Selected Aliphatic Alcohols by Ebulliometry. Part 1
Czech Academy of Sciences Publication Activity Database
Čenský, M.; Roháč, V.; Růžička, K.; Fulem, M.; Aim, Karel
2010-01-01
Roč. 298, č. 2 (2010), s. 192-198 ISSN 0378-3812 R&D Projects: GA AV ČR IAA400720710 Institutional research plan: CEZ:AV0Z40720504 Keywords : vapor pressure * ebulliometry * aliphatic alcohols Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.253, year: 2010
Czech Academy of Sciences Publication Activity Database
Krištofíková, Z.; Čermák, M.; Benešová, O.; Klaschka, Jan; Zach, P.
2005-01-01
Roč. 30, č. 2 (2005), s. 253-262 ISSN 0364-3190 R&D Projects: GA MZd NF7576 Keywords : magnetic nanoparticles * choline transport * cholinergic * functional impairment * hippocampus * laterality * magnetoreception * static magnetic field Subject RIV: BB - Applied Statistics, Operational Research Impact factor: 2.187, year: 2005
Epigenetic regulation – contribution to herbicide resistance in weeds?
Czech Academy of Sciences Publication Activity Database
Markus, C.; Pečinka, Aleš; Karan, R.; Barney, J. N.; Merotto, A.
2018-01-01
Roč. 74, č. 2 (2018), s. 275-281 ISSN 1526-498X Institutional support: RVO:61389030 Keywords : DNA methylation * epigenetic s * gene expression * gene regulation * herbicide detoxification * plant stress response Subject RIV: EF - Botanics OBOR OECD: Plant sciences, botany Impact factor: 3.253, year: 2016
Czech Academy of Sciences Publication Activity Database
Dyková, Iva; Boháčová, Lenka; Fiala, Ivan; Macháčková, Blanka; Pecková, Hana; Dvořáková, Helena
2005-01-01
Roč. 41, č. 3 (2005), s. 219-230 ISSN 0932-4739 R&D Projects: GA AV ČR IAA6022202 Institutional research plan: CEZ:AV0Z60220518 Keywords : fish-isolated amoebae * Vannella * Platyamoeba Subject RIV: EA - Cell Biology Impact factor: 1.253, year: 2005
Global Journal of Pure and Applied Sciences - Vol 14, No 3 (2008)
African Journals Online (AJOL)
Comparative effects of theobromine and Cocoa Bean Shell (CBS) extract on the performance, serum constituent profile and physiological parameters in rabbits · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. AO Adeyina, SO Oguntoye, OA Olatunde, DF Apata, 253- ...
Spectroscopic classification of SN 2018bxs as a type Ia supernova a few days before maximum
Wyatt, Samuel; Andrews, Jennifer; Sand, David; Smith, Nathan
2018-06-01
On UT 2018 May 25.3 we obtained an optical spectrum (range 370-800 nm) of AT2018bxs (=ATLAS18ppz), discovered by ATLAS (Tonry et al. 2011, PASP, 123, 58) with the 2.3m Bok telescope (+ Boller & Chivens spectrograph) on Kitt Peak, Arizona.
Effect of stress on structural brain asymmetry
Czech Academy of Sciences Publication Activity Database
Zach, P.; Valeš, Karel; Stuchlík, Aleš; Čermáková, P.; Mrzílková, J.; Koutella, A.; Kutová, M.
2016-01-01
Roč. 37, č. 4 (2016), s. 253-264 ISSN 0172-780X R&D Projects: GA ČR(CZ) GBP304/12/G069 Institutional support: RVO:67985823 Keywords : laterality * asymmetry * brain * evolution * stress * neuropsychiatric disorders Subject RIV: FH - Neurology Impact factor: 0.918, year: 2016
Architecture of European Plastic Surgery
Nicolai, J. -P. A.; Banic, A.; Molea, G.; Mazzola, R.; Poell, J. G.
2006-01-01
The architecture of European Plastic Surgery was published in 1996 [Nicolai JPA, Scuderi N. Plastic surgical Europe in an organogram. Eur J Plast Surg 1996; 19: 253-6.] It is the objective of this paper to update information of that article. Continuing medical education (CME), science, training,
1531-IJBCS-Article-Petemagnan Jean Marie
African Journals Online (AJOL)
hp
state anaerobic digestion of Korean food wastes. Bioressource Technology, 22: 245-253. Chynoweth DP, Owens JM, Legrand R. 2001. Renewable methane from anaerobic digestion of biomass. Renewable Energy,. 22: 1-8. Duncker LC, Matsebe GN, Moilwa N. 2007. The social/cultural acceptability of using human excreta ...
Digital Repository Service at National Institute of Oceanography (India)
Devi, K.S.
Nine stations over a stretch of 21 km of Periyar river estuary were sampled during January to December 1981. Particulate matter varied from 3-253 mg.1 super(1) at the surface and 24.8-257mg.1 super(1) at the bottom. Particulate organic carbon ranged...
Interhemispheric Asymmetries in Visual Evoked Potential Amplitude
1980-06-12
Layne, 1965) and of patients with Korsakoff’s syndrome (Malerstein and Callaway, 1969) . In the schizophrenics, the high variability is related to poor...communication. Malerstein, A. J., Callaway, E. Two-tone average evoked response in Korsakoff patients. J. Psychiatr. Res. 6: 253-260, 1969. Marsh, G
Czech Academy of Sciences Publication Activity Database
Chatoutsidou, S.E.; Mašková, Ludmila; Ondráčková, Lucie; Ondráček, Jakub; Lazaridis, M.; Smolík, Jiří
2015-01-01
Roč. 89, JUL (2015), s. 253-263 ISSN 0360-1323 EU Projects: European Commission(XE) 315760 Grant - others:EEA(NO) A/CZ0046/2/001 Institutional support: RVO:67985858 Keywords : infiltration factor * penetration * deposition Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 3.394, year: 2015
van der Poel, HG; Molenaar, B; van Beusechem, VW; Haisma, HJ; Rodriguez, R; Curiel, DT; Gerritsen, WR
Purpose: We evaluated the delivery and oncolytic potential of targeted replication competent adenoviruses in bladder cancer lines. Materials and Methods: Seven established human bladder cancer tumor lines (5637, SW800, TCCsup, J82, Scaber, T24 and 253J) were studied for the expression of integrins
75 FR 70947 - Trinity Adaptive Management Working Group
2010-11-19
... DEPARTMENT OF THE INTERIOR Fish and Wildlife Service [FWS-R8-FHC-2010-N253; 81331-1334-8TWG-W4] Trinity Adaptive Management Working Group AGENCY: Fish and Wildlife Service, Interior. ACTION: Notice of meeting. SUMMARY: The Trinity Adaptive Management Working Group (TAMWG) affords stakeholders the...
Two new hexacoordinated coordination polymers of cadmium(II ...
Indian Academy of Sciences (India)
cadmium(II) in 2 in a non-ended fashion affording a 3D network structure. In the crystalline state, each ..... Light brown DMF solutions of free bnzd, 1 and 2 show strong absorption at 253, ... 972; (b) Steel P J 2005 Acc. Chem. Res. 38 243; (c).
Bank Risk-Taking Abroad : Does Home-Country Regulation and Supervision Matter
Ongena, S.; Popov, A.; Udell, G.F.
2011-01-01
This paper provides the first empirical evidence on how home-country regulation and supervision affects bank risk-tailing in host-country markets. We analyze lending by 136 banks to 8,253 firms in 1,513 different localities across 13 countries. We find strong evidence that laxer regulatory
Bank Risk-Taking Abroad : Does Home-Country Regulation and Supervision Matter
Ongena, S.; Popov, A.; Udell, G.F.
2011-01-01
This paper provides the first empirical evidence on how home-country regulation and supervision affects bank risk-tailing in hostr-country markets. We analyze lending by 136 banks to 8,253 firms in 1,513 different localities across 13 countries. We find strong evidence that laxer regulatory
Temporal and spatial variations in hydrographic conditions of Mandovi estuary
Digital Repository Service at National Institute of Oceanography (India)
Varma, K.K.; Rao, L.V.G.; Cherian, T.
Nine stations over a stretch of 21 km of Periyar river estuary were sampled during January to December 1981. Particulate matter varied from 3-253 mg.1 super(1) at the surface and 24.8-257mg.1 super(1) at the bottom. Particulate organic carbon ranged...
Phase morphology of PP/COC blends
Czech Academy of Sciences Publication Activity Database
Šlouf, Miroslav; Kolařík, Jan; Fambri, L.
2003-01-01
Roč. 91, č. 1 (2003), s. 253-259 ISSN 0021-8995 R&D Projects: GA ČR GP106/02/P029 Institutional research plan: CEZ:AV0Z4050913 Keywords : polypropylene * norbornene * polyolefin Subject RIV: CD - Macromolecular Chemistry Impact factor: 1.017, year: 2003
Issues related to adapting assessment practices
African Journals Online (AJOL)
Erna Kinsey
they leave school, then teaching and specifically assessment have failed. Gruender ... argues that the success of any system of assessment can be judged by the modeling ... proposed to replace the previous eight design features of Curriculum. 2005. ... ment of formative and continuous assessment (Chisholm, 1999:253).
77 FR 58812 - Endangered Species; File No. 16733
2012-09-24
.... SUPPLEMENTARY INFORMATION: The subject permit is requested under the authority of the Endangered Species Act of... exporting of endangered and threatened species (50 CFR 222-226). The SEFSC requests a five-year permit to... DEPARTMENT OF COMMERCE National Oceanic and Atmospheric Administration RIN 0648-XC253 Endangered...
75 FR 38543 - Patent, Trademark and Copyright Acts
2010-07-02
... DEPARTMENT OF THE INTERIOR Geological Survey Patent, Trademark and Copyright Acts AGENCY: Geological Survey, Interior. ACTION: Notice of prospective intent to award exclusive license. SUMMARY: The... Technologies Group, Inc., 253 Portman Lane, Suite 107, Bridgeville, PA 15017 on U.S. Patent No. 6,485,696 B1...
77 FR 36611 - Core Principles and Other Requirements for Designated Contract Markets
2012-06-19
... vii. Sec. 38.156--Automated Trade Surveillance System viii. Sec. 38.157--Real-Time Market Monitoring...--Additional Requirements for Physical-Delivery Contracts iii. Sec. 38.253--Additional Requirements for Cash... Commission's oversight program, serving as a key tool for monitoring a DCM's compliance with the core...
DEFF Research Database (Denmark)
Qiu, Weimin; Andersen, Tom; Bollerslev, Jens
2007-01-01
in iliac crest bone biopsies from patients with the HBM phenotype and controls. We also used retrovirus-mediated gene transduction to establish three different human mesenchymal stem cell (hMSC) strains stably expressing wildtype LRP5 (hMSC-LRP5WT), LRP5T244 (hMSC-LRP5T244, inactivation mutation leading...... to osteoporosis), or LRP5T253 (hMSC-LRP5T253, activation mutation leading to high bone mass). We characterized Wnt signaling activation using a dual luciferase assay, cell proliferation, lineage biomarkers using real-time PCR, and in vivo bone formation. Results: In bone biopsies, we found increased trabecular...... mineralized bone when implanted subcutaneously with hydroxyapatite/tricalcium phosphate in SCID/NOD mice. Conclusions: LRP5 mutations and the level of Wnt signaling determine differentiation fate of hMSCs into osteoblasts or adipocytes. Activation of Wnt signaling can thus provide a novel approach to increase...
Effect of the loading rate on compressive properties of goose eggs
Czech Academy of Sciences Publication Activity Database
Nedomová, Š.; Kumbár, V.; Trnka, Jan; Buchar, J.
2016-01-01
Roč. 42, č. 2 (2016), s. 223-233 ISSN 0092-0606 Institutional support: RVO:61388998 Keywords : goose egg * compression * rupture force * deformation Subject RIV: BO - Biophysics Impact factor: 1.241, year: 2016 http://download.springer.com/static/pdf/770/art%253A10.1007%252Fs10867-015-9403-2.pdf?originUrl=http%3A%2F%2Flink.springer.com%2Farticle%2F10.1007%2Fs10867-015-9403-2&token2=exp=1460539397~acl=%2Fstatic%2Fpdf%2F770%2Fart%25253A10.1007%25252Fs10867-015-9403-2.pdf%3ForiginUrl%3Dhttp%253A%252F%252Flink.springer.com%252Farticle%252F10.1007%252Fs10867-015-9403-2*~hmac=fd2b9956908d60e519ce45c412eaf5c228f6f96333e62a06285950a2123f7739
Directory of Open Access Journals (Sweden)
Satoshi Nori
2015-03-01
Full Text Available Previously, we described the safety and therapeutic potential of neurospheres (NSs derived from a human induced pluripotent stem cell (iPSC clone, 201B7, in a spinal cord injury (SCI mouse model. However, several safety issues concerning iPSC-based cell therapy remain unresolved. Here, we investigated another iPSC clone, 253G1, that we established by transducing OCT4, SOX2, and KLF4 into adult human dermal fibroblasts collected from the same donor who provided the 201B7 clone. The grafted 253G1-NSs survived, differentiated into three neural lineages, and promoted functional recovery accompanied by stimulated synapse formation 47 days after transplantation. However, long-term observation (for up to 103 days revealed deteriorated motor function accompanied by tumor formation. The tumors consisted of Nestin+ undifferentiated neural cells and exhibited activation of the OCT4 transgene. Transcriptome analysis revealed that a heightened mesenchymal transition may have contributed to the progression of tumors derived from grafted cells.
Nuclear structure data from in beam and decay studies around 254No
International Nuclear Information System (INIS)
Jones, P.
2005-01-01
The study of trans-fermium nuclei, the heaviest nuclei for which in-beam spectroscopy studies are possible has provided over recent years a rich tapestry of data. These have enhanced the mean field theories important for the prediction of nuclear properties at the limits of the nuclear chart. Developments in spectrometer and data-acquisition techniques at the Department of Physics, University of Jyvaskyla have further enhanced the studies. Utilising the RITU gas-filled spectrometer, the GREAT focal plane spectrometer, the identification recoils and their subsequent decay modes (alpha-, fission-, and gamma-ray decay) have been studied. The JUROGAM gamma-ray array of 43 Compton-suppressed HPGe detectors has been employed in the in-beam spectroscopy of the trans-fermium region. In-beam gamma-ray spectroscopy studies of trans-fermium nuclei 253 No, 254 No, 250 Fm, 251 Md, 253 No and 255 Lr have been performed, as well as detailed focal plane spectroscopy. Selected highlights of the work will be presented
LENUS (Irish Health Repository)
Reyad, A
2009-06-01
We have assessed the efficacy of anti retroviral therapy (ART) using undetectable viral load (VL) (<50 RNA copies\\/ml) as a marker of virological success, in patients who have Human Immunodeficiency Virus (HIV) attending the Department of Infectious Disease. A cross-sectional review of patients\\' case notes was used to obtain their demographics and treatment details. 79% (253) of the hospital case notes of clinic population was available for analysis, which represents 90% of those receiving ART in the clinic. 166\\/253 of the cohort were receiving treatment at the time of this study and 95% (157\\/166) of these were on treatment for greater than 6 months. The total virological success rate is 93%, which is comparable to other centres and are as good as those from published clinical trials. 56% of those on therapy who have virological failure were Intravenous Drug Users (IVDUs). Case by case investigation for those with treatment failure is warranted.
Energy Technology Data Exchange (ETDEWEB)
Carre, J C; Vidal, R [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires
1964-07-01
The phase oscillation technique used at ZOE has the property of reducing of a marked factor the effect of neutron scattering by the sample. The absorption cross sections of poorly absorbing and highly scattering materials have been measured; for neutrons of 2,200 m/s, the following values are obtained: 229 {+-} 3 mb for Al; 64.2 {+-} 1.5 mb for Mg, 2.53 {+-} 0.03 b for Fe and 3.74 {+-} 0.04 b for Cu. (authors) [French] La methode d'oscillation de phase utilisee a ZOE possede la propriete de diminuer d'un facteur important l'influence de la diffusion. Les sections efficaces de capture de materiaux peu capturants et tres diffusants, ont ete mesurees; pour des neutrons de 2200 m/s, on obtient pour l'Al: 229 {+-} 3mb, pour le Mg: 64,2 {+-} 1,5 mb, pour le Fe: 2,53 {+-} 0,03 b et pour le Cu: 3,74 {+-} 0,04 b. (auteurs)
International Nuclear Information System (INIS)
Capello, R.; Stretti, G.; Cesari, F.G.
1989-01-01
An LMFBR plant has many piping systems subjected to elevated temperature (> 427 o C) which, depending on their function and safety criteria, are classified as of quality level 1 or 2. The design of class 1 and class 2 piping for elevated temperatures is performed in accordance with ASME CCN-47 and CCN-253 respectively. This paper discusses what level of knowledge and analysis is necessary, to apply the rules of class 2 (CCN-253) rather than those of class 1 (CCN-47) for the design analysis of piping systems. From the designer viewpoint the burden of verification is much greater in class 1 than in class 2. This paper also examines the reliability of class 2 rules for elevated temperature when used to obtain structural results and justify the design of class 1 systems. In fact it can be shown that in some cases it is possible to design class 1 piping systems using class 2 rules. (author)
The influence of dose distributions on the results of UV-biodosimetry
International Nuclear Information System (INIS)
Cabaj, A.; Sommer, R.; Kundi, M.
1996-01-01
Disinfection of drinking water with ultraviolet radiation has become a common method in Austria and in many other countries. The water usually is disinfected in flow through systems with low pressure mercury lamps as UV source, which emit predominantly UV radiation with wavelength 253.7 nm. Because of varying residence times of microorganizms and the special distribution of fluence rate in the irradiation volume, caused by different distances from the radiation source, by absorption of radiation in the water and by reflexion at the walls of the reactor, the microorganizms passing through in a turbulent flow, receive different fluences. In Austria UV-disinfection plants for drinking water must deliver a minimal dose of 400 Jm -2 for radiation of wavelength 253.7 nm. The fulfillment of this demand is proved during type testing. As dosimeter suspensions of bacterial spores are used whose UV-susceptibility has to be measured in a laboratory irradiation device. The dose, determined in this way, is called Reduction Equivalent Dose'. (author)
Energy-conserving programming of VVI pacemakers: a telemetry-supported, long-term, follow-up study.
Klein, H H; Knake, W
1990-06-01
Thirty patients with VVI pacemakers (Quantum 253-09, 253-19, Intermedics Inc., Freeport, TX) were observed for a mean of 65 months. Within 12 months after implantation, optimized output programming was performed in 29 patients. This included a decrease in pulse amplitude (22 patients), pulse width (4 patients), and/or pacing rate (11 patients). After 65 months postimplantation, telemetered battery voltage and battery impedance were compared with the predicted values expected when the pulse generator constantly stimulates at nominal program conditions (heart rate 72.3 beats/min, pulse amplitude 5.4 V, pulse width 0.61 ms). Instead of an expected cell voltage of 2.6 V and a cell impedance of 10 k omega mean telemetered values amounted to 2.78 V and 1.4 k omega, respectively. These data correspond to a battery age of 12-15 months at nominal program conditions. This long-term follow-up study suggests that adequate programming will extend battery longevity and thus pulse generator survival in many patients.
A retrospective investigation of HLA-B*5801 in hyperuricemia patients in a Han population of China.
Cheng, Heng; Yan, Dewen; Zuo, Xin; Liu, Junying; Liu, Wenlan; Zhang, Youming
2018-05-01
Hyperuricemia and gout have become increasingly prevalent in China. Allopurinol is an effective urate-lowering therapy, but it has severe side effects. HLA-B*5801 is highly associated with the allopurinol-induced toxic epidermal necrolysis and Stevens-Johnson syndrome. In this retrospective report, we had genotyped HLA-B*5801 in 253 cases of hyperuricemia and gout patients in a Han population in Shenzhen and analyzed the clinical management of medications. We found 30 carriers of the HLA-B*5801 allele in 253 cases of hyperuricemia or gout patients in the population (11.9%). Allopurinol was prescribed in both HLA-B*5801-positive and HLA-B*5801-negative groups. The evaluation of four models with or without genetic screening and management of allopurinol or febuxostat indicated that the HLA-B*5801 screening had significant cost benefit for clinical management. For appropriate management and cost-effectiveness, the HLA-B*5801 allele should be screened in all patients with hyperuricemia and gout in the Chinese population.
Rheological Model for Describing Viscometric Flows of Melts of Branched Polymers
Czech Academy of Sciences Publication Activity Database
Merzlikina, D.A.; Pyshnograi, G.; Pivokonský, Radek; Filip, Petr
2016-01-01
Roč. 89, č. 3 (2016), s. 652-659 ISSN 1062-0125 Grant - others:Russian Foundation for Basic Research(RU) 15-4-04003 Institutional support: RVO:67985874 Keywords : rheology * polymer melts * mesoscopic approach * rheological equation of state * viscometric fl ows Subject RIV: BK - Fluid Dynamics http://download.springer.com/static/pdf/8/art%253A10.1007%252Fs10891-016-1423-7.pdf?originUrl=http%3A%2F%2Flink.springer.com%2Farticle%2F10.1007%2Fs10891-016-1423-7&token2=exp=1481193683~acl=%2Fstatic%2Fpdf%2F8%2Fart%25253A10.1007%25252Fs10891-016-1423-7.pdf%3ForiginUrl%3Dhttp%253A%252F%252Flink.springer.com%252Farticle%252F10.1007%252Fs10891-016-1423-7*~hmac=cb34c324456883ecc6fc41d3feb0677836d7c454728829b5e085aac5ce7de417
Directory of Open Access Journals (Sweden)
MARIA JOSÉ MOREIRA BATATINHA
2011-09-01
Full Text Available The aim of this experiment was to evaluate the in vitro effects of the aqueous and methanol extracts of the leaves and fruits of Prosopis juliflora (Sw D.C., respectively, on larvae cultures of gastrointestinal nematodes of goats. Six different concentrations of the methanol extract (724.5; 557.3; 428.7; 329.8; 253.7; 195.1mg/mL and one of the aqueous extracts (110.0mg/mL were used for thetreatment of larvae cultures, in triple assays. Destilled water and doramectin were used to treat cultures considered to be negative and positive control, respectively. The results revealed a reduction of more than 90% of the infective larvae between the concentrations of724.5 up to 253.7 mg/mL for the methanol extract and a low percentage of reduction (59.87% for the aqueous extract. Only the methanol extract of Prosopis juliflora (Sw D.C. was effective in the in vitro treatment of gastrointestinal nematodes of goat.
Impact of Robotic Dispensing Machines in German Pharmacies on ...
African Journals Online (AJOL)
To assess the impact of robotic dispensing machines in community pharmacies on staff efficiency and sales of over-the-counter drugs. Setting: The study was done on 253 community pharmacies in Germany that use a robotic dispensing machine manufactured by ROWA during 2008. Method: Data concerning the financial ...
Mõne läänemeresoome sufiksi taustast / Ago Künnap
Künnap, Ago, 1941-
2009-01-01
Vastukaja artiklile: Grünthal, Riho. The Mordvinic languages between bush and tree : a historical reappraisal // Sámit, sánit, sátnehámit : riepmočála Pekka Sammallahtii miessemánu 21. beaivve 2007. Helsinki : Suomalais-Ugrilainen Seura, 2007. (Suomalais-Ugrilaisen Seuran toimituksia ; 253)
75 FR 7454 - Notice of Commission Meeting and Public Hearing
2010-02-19
... existing trickling filter treatment system is proposed to be replaced with an extended aeration system... treatment train will be constructed, consisting of a Vertical Loop Reactor, clarifiers, and aerobic digester... will land discharge to four on-site infiltration beds. The project is located near River Mile 253.64--9...
Betz, Regina C; Petukhova, Lynn; Ripke, Stephan; Huang, Hailiang; Menelaou, Androniki; Redler, Silke; Becker, Tim; Heilmann, Stefanie; Yamany, Tarek; Duvic, Madeliene; Hordinsky, Maria; Norris, David; Price, Vera H; Mackay-Wiggan, Julian; de Jong, Annemieke; DeStefano, Gina M; Moebus, Susanne; Böhm, Markus; Blume-Peytavi, Ulrike; Wolff, Hans; Lutz, Gerhard; Kruse, Roland; Bian, Li; Amos, Christopher I; Lee, Annette; Gregersen, Peter K; Blaumeiser, Bettina; Altshuler, David; Clynes, Raphael; de Bakker, Paul I W; Nöthen, Markus M; Daly, Mark J; Christiano, Angela M
2015-01-01
Alopecia areata (AA) is a prevalent autoimmune disease with 10 known susceptibility loci. Here we perform the first meta-analysis of research on AA by combining data from two genome-wide association studies (GWAS), and replication with supplemented ImmunoChip data for a total of 3,253 cases and
Cupido, M.
2016-01-01
On 7 March 2014, Trial Chamber II of the International Criminal Court (ICC) convicted Germain Katanga for war crimes and crimes against humanity. Katanga's conviction is based on the concept of common purpose liability as regulated in Article 25(3)(d) of the Rome Statute. This liability theory
Czech Academy of Sciences Publication Activity Database
Kraus, Michaela
2009-01-01
Roč. 494, č. 1 (2009), s. 253-262 ISSN 0004-6361 R&D Projects: GA AV ČR KJB300030701 Institutional research plan: CEZ:AV0Z10030501 Keywords : star s * winds * circumstellar matter Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 4.179, year: 2009
Gender-related differences in attitudinal disposition of university ...
African Journals Online (AJOL)
Gender-related differences in attitudinal disposition of university workers to resolving conflict through mediation. ... df =253, P>0.05). It is therefore recommended that university workers should be adequately trained in the procedures of using mediation so as to build their capacity in resolving conflict at home and workplace.
Europejski kryzys migracyjny (Rozważania pozbawione emocji i poprawności politycznej)
Czech Academy of Sciences Publication Activity Database
Pánek, Jaroslav
2016-01-01
Roč. 6, č. 1 (2016), s. 253-264 ISSN 2084-1213 Institutional support: RVO:67985963 Keywords : Contemporary migration * International Relations * European Union Subject RIV: AB - History OBOR OECD: History (history of science and technology to be 6.3, history of specific sciences to be under the respective headings)
CAMKII inhibition in the parabrachial nuclei elicits conditioned taste aversion in rats
Czech Academy of Sciences Publication Activity Database
Sacchetti, B.; Baldi, E.; Tassoni, G.; Bielavská, Edita
2001-01-01
Roč. 75, č. 3 (2001), s. 253-261 ISSN 1074-7427 R&D Projects: GA AV ČR IAA7011706 Institutional research plan: CEZ:AV0Z5011922 Keywords : CA2+/calmodulin-dependent protein kinase * conditioned taste aversion Subject RIV: FH - Neurology Impact factor: 1.830, year: 2001
Flow Cytometry for Age Assessment of a Yeast Population and its Application in Beer Fermentations
Czech Academy of Sciences Publication Activity Database
Kuřec, M.; Baszczyňski, Martin; Lehnert, R.; Mota, A.; Teixeira, J.A.; Brányik, T.
2009-01-01
Roč. 115, č. 3 (2009), s. 253-258 ISSN 0046-9750 R&D Projects: GA ČR GA104/06/1418 Institutional research plan: CEZ:AV0Z40720504 Keywords : aging * beer * bud scar Subject RIV: CI - Industrial Chemistry, Chemical Engineering Impact factor: 1.000, year: 2009
Synthesis and Catalytic Activity of [Cp′Co(COD)] Complexes Bearing Pendant N-Containing Groups
Czech Academy of Sciences Publication Activity Database
Thiel, I.; Lamač, Martin; Jiao, H.; Spannenberg, A.; Hapke, M.
2013-01-01
Roč. 32, č. 11 (2013), s. 3415-3418 ISSN 0276-7333 R&D Projects: GA ČR GPP207/10/P200 Institutional support: RVO:61388955 Keywords : FUNCTIONALIZED CYCLOPENTADIENYL LIGANDS * SANDWICH COBALT COMPLEXES * METALLOCENE COMPLEXES Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 4.253, year: 2013
Vztah theologie a filosofie u Órigena a úkoly současné dogmatiky
Czech Academy of Sciences Publication Activity Database
Milko, Pavel
2007-01-01
Roč. 2, č. 2 (2007), s. 3-29 ISSN 1337-0111 R&D Projects: GA ČR GP401/07/P534 Institutional research plan: CEZ:AV0Z90920516 Keywords : Órigenés, ca 185-ca 253 * doctrinal the ology * philosophy Subject RIV: AA - Philosophy ; Religion
Factors Affecting the Job Satisfaction of Latino/a Immigrants in the Midwest
Valdivia, Corinne; Flores, Lisa Y.
2012-01-01
This study examined the job satisfaction of 253 Latino/a newcomers in three rural communities in the Midwest. Specifically, the authors explored the effects of ethnic identity, Anglo acculturation, Latino/a acculturation, perceptions of the community (social relations, discrimination/racism, and language pressures), job tenure, work hours, and…
Family Relationships and Perfectionism in Middle-School Students
DiPrima, Amy J.; Ashby, Jeffrey S.; Gnilka, Philip B.; Noble, Christina L.
2011-01-01
Several authors have suggested that perfectionism develops in the context of a person's family of origin. However, there are few empirical studies that address the relationship between family variables and perfectionism. This study examined the relationship between family variables and multidimensional perfectionism among a sample of 253…
Role of light in the mediation of acute effects of a single afternoon ...
Indian Academy of Sciences (India)
Home; Journals; Journal of Biosciences; Volume 25; Issue 3. Role of light in the mediation of acute effects of a single afternoon melatonin injection on steroidogenic activity of testis in the rat. Saumen K Maitra Arun K Ray. Articles Volume 25 Issue 3 September 2000 pp 253-256 ...
Martialia hyadesi is considered to be an Antarctic circumpolar ...
African Journals Online (AJOL)
spamer
09/1989. 1. 280. 8. R.V. Oca Balda 1995. 17/11/1995. 3. 253 – 317. (b) Juveniles in relation to surface temperature (°C) during spring of 1988 and 1989 and historical data from Rodhouse et al. (1992a). Star refers to October–November 1990/91, ...
Acidic and Catalytic Properties of Mo-MCM-22 in Methane Aromatization: An FTIR Study
Czech Academy of Sciences Publication Activity Database
Sobalík, Zdeněk; Tvarůžková, Zdenka; Wichterlová, Blanka; Fíla, V.; Špatenka, Š.
2003-01-01
Roč. 253, - (2003), s. 271-282 ISSN 0926-860X R&D Projects: GA ČR GA104/99/0432 Institutional research plan: CEZ:AV0Z4040901 Keywords : methane aromatization * FTIR technique * MCM-22 Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.825, year: 2003
DEFF Research Database (Denmark)
Alghabiwi, Reem; Palianopoulou, Maria; Eklund Karlsson, Leena
2018-01-01
-efficacy in self-managing chronic disease in 253 female patients aged 18-55 years from six primary care clinics in Riyadh, Saudi Arabia. The data were collected using two standard questionnaires (PDRQ-9 and SEMCD) and analysis was performed using the Kruskal-Wallis test (SPSS Software). Our findings showed...
A case study of a density structure over a vertical magnetic field region in the Martian ionosphere
Czech Academy of Sciences Publication Activity Database
Duru, F.; Gurnett, D. A.; Dieval, C.; Morgan, D. D.; Píša, David; Lundin, R.
2016-01-01
Roč. 43, č. 10 (2016), s. 4665-4672 ISSN 0094-8276 Institutional support: RVO:68378289 Keywords : mars-express * ionosphere * anomalies * ionospheric plasma * Mars Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 4.253, year: 2016 http://onlinelibrary.wiley.com/doi/10.1002/2016GL068686/abstract
Content Validation of Athletic Therapy Clinical Presentations in Canada
Lafave, Mark R.; Yeo, Michelle; Westbrook, Khatija; Valdez, Dennis; Eubank, Breda; McAllister, Jenelle
2016-01-01
Context: Competency-based education requires strong planning and a vehicle to deliver and track students' progress across their undergraduate programs. Clinical presentations (CPs) are proposed as 1 method to deliver a competency-based curriculum in a Canadian undergraduate athletic therapy program. Objective: Validation of 253 CPs. Setting:…
Bulletin of Materials Science | Indian Academy of Sciences
Indian Academy of Sciences (India)
Articles written in Bulletin of Materials Science. Volume 26 Issue 2 February 2003 pp 247-253 Electrical Properties. Impedance spectroscopy ... the a.c. conductivity data. Volume 26 Issue 7 December 2003 pp 745-747 Electrical Properties. Dielectric properties of piezoelectric 3–0 composites of lithium ferrite/barium titanate.
Měření indexu lomu vzduchu pomocí interferometrie nízké koherence
Czech Academy of Sciences Publication Activity Database
Pikálek, Tomáš; Buchta, Zdeněk
2017-01-01
Roč. 62, č. 10 (2017), s. 253-256 ISSN 0447-6441 R&D Projects: GA MŠk(CZ) LO1212 Institutional support: RVO:68081731 Keywords : air refractive index * laser interferometry * low-coherence interferometry Subject RIV: BH - Optics, Masers, Lasers OBOR OECD: Optics (including laser optics and quantum optics)
Improved preservation effects of litchi fruit by combining chitosan ...
African Journals Online (AJOL)
USER
2010-05-31
May 31, 2010 ... and attractive red color of anthocyanins at full maturity. (Holcroft and Mitcham, 1996). Tragically .... An Amplex Red Hydrogen Peroxide Assay kit (Molecular. Probes, Invitrogen Detection Technologies, ..... control of rotting and browning of litchi fruit by hot benomyl and plastic film. Sci. Hortic. 16: 253-262.
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education. Riddhi Shah. Articles written in Resonance – Journal of Science Education. Volume 23 Issue 3 March 2018 pp 253-262 General Article. Maryam Mirzakhani: The Master Artist of Curved Surfaces · Nikita Agarwal Riddhi Shah Geetha Venkataraman · More Details ...
2017-2018 Travel Expense Reports for John McArthur, Governor
International Development Research Centre (IDRC) Digital Library (Canada)
Chantal Taylor
Purpose: Board Meetings. Date(s):. 2017-10-05. Destination(s):. Ottawa. Airfare: $0.00. Other. Transportation: $203.40. Accommodation: $0.00. Meals and. Incidentals: $50.55. Other: $0.00. Total: $253.95. Comments: Travel expenses claimed in October 2017 for June 2016 Board meeting. 2017-2018 Travel Expense ...
Automated Library Networking in American Public Community College Learning Resources Centers.
Miah, Adbul J.
1994-01-01
Discusses the need for community colleges to assess their participation in automated library networking systems (ALNs). Presents results of questionnaires sent to 253 community college learning resource center directors to determine their use of ALNs. Reviews benefits of automation and ALN activities, planning and communications, institution size,…
48 CFR 53.111 - Contract clause.
2010-10-01
... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Contract clause. 53.111... AND FORMS FORMS General 53.111 Contract clause. Contracting officers shall insert the clause at 52.253-1, Computer Generated Forms, in solicitations and contracts that require the contractor to submit...
Sadhana | Indian Academy of Sciences
Indian Academy of Sciences (India)
This study presents a scientometric analysis of 253 articles published in Sadhana during the year 2005–2009. Five volumes of the journal are taken up to observe the distribution of contribution, authorship pattern, institution-wise distribution, geographical distribution of contribution, average length of paper, tables and ...
Daan, Serge; Masman, Dirkjan; Groenewold, Alex
Measurements of basal metabolic rate (BMR), body water, fat, and lean dry mass of different organs were obtained in 22 bird species, ranging from 10.8 to 1,253 g body mass. Residuals of BMR (after subtracting BMR allometrically predicted from body mass) were positively correlated with residuals of
Czech Academy of Sciences Publication Activity Database
Smith, D.; Chippendale, T. W. E.; Španěl, Patrik
2014-01-01
Roč. 28, č. 17 (2014), s. 1917-1928 ISSN 0951-4198 R&D Projects: GA ČR GA13-28882S Institutional support: RVO:61388955 Keywords : SOLID-PHASE MICROEXTRACTION * TRACE GAS- ANALYSIS * ON-FIBER-DERIVATIZATION Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.253, year: 2014
Wood, Andrew R.; Esko, Tonu; Yang, Jian; Vedantam, Sailaja; Pers, Tune H.; Gustafsson, Stefan; Chu, Audrey Y.; Estrada, Karol; Luan, Jian'an; Kutalik, Zoltán; Amin, Najaf; Buchkovich, Martin L.; Croteau-Chonka, Damien C.; Day, Felix R.; Duan, Yanan; Fall, Tove; Fehrmann, Rudolf; Ferreira, Teresa; Jackson, Anne U.; Karjalainen, Juha; Lo, Ken Sin; Locke, Adam E.; Mägi, Reedik; Mihailov, Evelin; Porcu, Eleonora; Randall, Joshua C.; Scherag, André; Vinkhuyzen, Anna A. E.; Westra, Harm-Jan; Winkler, Thomas W.; Workalemahu, Tsegaselassie; Zhao, Jing Hua; Absher, Devin; Albrecht, Eva; Anderson, Denise; Baron, Jeffrey; Beekman, Marian; Demirkan, Ayse; Ehret, Georg B.; Feenstra, Bjarke; Feitosa, Mary F.; Fischer, Krista; Fraser, Ross M.; Goel, Anuj; Gong, Jian; Justice, Anne E.; Kanoni, Stavroula; Kleber, Marcus E.; Kristiansson, Kati; Lim, Unhee; Lotay, Vaneet; Lui, Julian C.; Mangino, Massimo; Mateo Leach, Irene; Medina-Gomez, Carolina; Nalls, Michael A.; Nyholt, Dale R.; Palmer, Cameron D.; Pasko, Dorota; Pechlivanis, Sonali; Prokopenko, Inga; Ried, Janina S.; Ripke, Stephan; Shungin, Dmitry; Stancáková, Alena; Strawbridge, Rona J.; Sung, Yun Ju; Tanaka, Toshiko; Teumer, Alexander; Trompet, Stella; van der Laan, Sander W.; van Setten, Jessica; van Vliet-Ostaptchouk, Jana V.; Wang, Zhaoming; Yengo, Loïc; Zhang, Weihua; Afzal, Uzma; Arnlöv, Johan; Arscott, Gillian M.; Bandinelli, Stefania; Barrett, Amy; Bellis, Claire; Bennett, Amanda J.; Berne, Christian; Blüher, Matthias; Bolton, Jennifer L.; Böttcher, Yvonne; Boyd, Heather A.; Bruinenberg, Marcel; Buckley, Brendan M.; Buyske, Steven; Caspersen, Ida H.; Chines, Peter S.; Clarke, Robert; Claudi-Boehm, Simone; Cooper, Matthew; Daw, E. Warwick; de Jong, Pim A.; Deelen, Joris; Delgado, Graciela; Denny, Josh C.; Dhonukshe-Rutten, Rosalie; Dimitriou, Maria; Doney, Alex S. F.; Dörr, Marcus; Eklund, Niina; Eury, Elodie; Folkersen, Lasse; Garcia, Melissa E.; Geller, Frank; Giedraitis, Vilmantas; Go, Alan S.; Grallert, Harald; Grammer, Tanja B.; Gräßler, Jürgen; Grönberg, Henrik; de Groot, Lisette C. P. G. M.; Groves, Christopher J.; Haessler, Jeffrey; Hall, Per; Haller, Toomas; Hallmans, Goran; Hannemann, Anke; Hartman, Catharina A.; Hassinen, Maija; Hayward, Caroline; Heard-Costa, Nancy L.; Helmer, Quinta; Hemani, Gibran; Henders, Anjali K.; Hillege, Hans L.; Hlatky, Mark A.; Hoffmann, Wolfgang; Hoffmann, Per; Holmen, Oddgeir; Houwing-Duistermaat, Jeanine J.; Illig, Thomas; Isaacs, Aaron; James, Alan L.; Jeff, Janina; Johansen, Berit; Johansson, Åsa; Jolley, Jennifer; Juliusdottir, Thorhildur; Junttila, Juhani; Kho, Abel N.; Kinnunen, Leena; Klopp, Norman; Kocher, Thomas; Kratzer, Wolfgang; Lichtner, Peter; Lind, Lars; Lindström, Jaana; Lobbens, Stéphane; Lorentzon, Mattias; Lu, Yingchang; Lyssenko, Valeriya; Magnusson, Patrik K. E.; Mahajan, Anubha; Maillard, Marc; McArdle, Wendy L.; McKenzie, Colin A.; McLachlan, Stela; McLaren, Paul J.; Menni, Cristina; Merger, Sigrun; Milani, Lili; Moayyeri, Alireza; Monda, Keri L.; Morken, Mario A.; Müller, Gabriele; Müller-Nurasyid, Martina; Musk, Arthur W.; Narisu, Narisu; Nauck, Matthias; Nolte, Ilja M.; Nöthen, Markus M.; Oozageer, Laticia; Pilz, Stefan; Rayner, Nigel W.; Renstrom, Frida; Robertson, Neil R.; Rose, Lynda M.; Roussel, Ronan; Sanna, Serena; Scharnagl, Hubert; Scholtens, Salome; Schumacher, Fredrick R.; Schunkert, Heribert; Scott, Robert A.; Sehmi, Joban; Seufferlein, Thomas; Shi, Jianxin; Silventoinen, Karri; Smit, Johannes H.; Smith, Albert Vernon; Smolonska, Joanna; Stanton, Alice V.; Stirrups, Kathleen; Stott, David J.; Stringham, Heather M.; Sundström, Johan; Swertz, Morris A.; Syvänen, Ann-Christine; Tayo, Bamidele O.; Thorleifsson, Gudmar; Tyrer, Jonathan P.; van Dijk, Suzanne; van Schoor, Natasja M.; van der Velde, Nathalie; van Heemst, Diana; van Oort, Floor V. A.; Vermeulen, Sita H.; Verweij, Niek; Vonk, Judith M.; Waite, Lindsay L.; Waldenberger, Melanie; Wennauer, Roman; Wilkens, Lynne R.; Willenborg, Christina; Wilsgaard, Tom; Wojczynski, Mary K.; Wong, Andrew; Wright, Alan F.; Zhang, Qunyuan; Arveiler, Dominique; Bakker, Stephan J. L.; Beilby, John; Bergman, Richard N.; Bergmann, Sven; Biffar, Reiner; Blangero, John; Boomsma, Dorret I.; Bornstein, Stefan R.; Bovet, Pascal; Brambilla, Paolo; Brown, Morris J.; Campbell, Harry; Caulfield, Mark J.; Chakravarti, Aravinda; Collins, Rory; Collins, Francis S.; Crawford, Dana C.; Cupples, L. Adrienne; Danesh, John; de Faire, Ulf; den Ruijter, Hester M.; Erbel, Raimund; Erdmann, Jeanette; Eriksson, Johan G.; Farrall, Martin; Ferrannini, Ele; Ferrières, Jean; Ford, Ian; Forouhi, Nita G.; Forrester, Terrence; Gansevoort, Ron T.; Gejman, Pablo V.; Gieger, Christian; Golay, Alain; Gottesman, Omri; Gudnason, Vilmundur; Gyllensten, Ulf; Haas, David W.; Hall, Alistair S.; Harris, Tamara B.; Hattersley, Andrew T.; Heath, Andrew C.; Hengstenberg, Christian; Hicks, Andrew A.; Hindorff, Lucia A.; Hingorani, Aroon D.; Hofman, Albert; Hovingh, G. Kees; Humphries, Steve E.; Hunt, Steven C.; Hypponen, Elina; Jacobs, Kevin B.; Jarvelin, Marjo-Riitta; Jousilahti, Pekka; Jula, Antti M.; Kaprio, Jaakko; Kastelein, John J. P.; Kayser, Manfred; Kee, Frank; Keinanen-Kiukaanniemi, Sirkka M.; Kiemeney, Lambertus A.; Kooner, Jaspal S.; Kooperberg, Charles; Koskinen, Seppo; Kovacs, Peter; Kraja, Aldi T.; Kumari, Meena; Kuusisto, Johanna; Lakka, Timo A.; Langenberg, Claudia; Le Marchand, Loic; Lehtimäki, Terho; Lupoli, Sara; Madden, Pamela A. F.; Männistö, Satu; Manunta, Paolo; Marette, André; Matise, Tara C.; McKnight, Barbara; Meitinger, Thomas; Moll, Frans L.; Montgomery, Grant W.; Morris, Andrew D.; Morris, Andrew P.; Murray, Jeffrey C.; Nelis, Mari; Ohlsson, Claes; Oldehinkel, Albertine J.; Ong, Ken K.; Ouwehand, Willem H.; Pasterkamp, Gerard; Peters, Annette; Pramstaller, Peter P.; Price, Jackie F.; Qi, Lu; Raitakari, Olli T.; Rankinen, Tuomo; Rao, D. C.; Rice, Treva K.; Ritchie, Marylyn; Rudan, Igor; Salomaa, Veikko; Samani, Nilesh J.; Saramies, Jouko; Sarzynski, Mark A.; Schwarz, Peter E. H.; Sebert, Sylvain; Sever, Peter; Shuldiner, Alan R.; Sinisalo, Juha; Steinthorsdottir, Valgerdur; Stolk, Ronald P.; Tardif, Jean-Claude; Tönjes, Anke; Tremblay, Angelo; Tremoli, Elena; Virtamo, Jarmo; Vohl, Marie-Claude; Amouyel, Philippe; Asselbergs, Folkert W.; Assimes, Themistocles L.; Bochud, Murielle; Boehm, Bernhard O.; Boerwinkle, Eric; Bottinger, Erwin P.; Bouchard, Claude; Cauchi, Stéphane; Chambers, John C.; Chanock, Stephen J.; Cooper, Richard S.; de Bakker, Paul I. W.; Dedoussis, George; Ferrucci, Luigi; Franks, Paul W.; Froguel, Philippe; Groop, Leif C.; Haiman, Christopher A.; Hamsten, Anders; Hayes, M. Geoffrey; Hui, Jennie; Hunter, David J.; Hveem, Kristian; Jukema, J. Wouter; Kaplan, Robert C.; Kivimaki, Mika; Kuh, Diana; Laakso, Markku; Liu, Yongmei; Martin, Nicholas G.; März, Winfried; Melbye, Mads; Moebus, Susanne; Munroe, Patricia B.; Njølstad, Inger; Oostra, Ben A.; Palmer, Colin N. A.; Pedersen, Nancy L.; Perola, Markus; Pérusse, Louis; Peters, Ulrike; Powell, Joseph E.; Power, Chris; Quertermous, Thomas; Rauramaa, Rainer; Reinmaa, Eva; Ridker, Paul M.; Rivadeneira, Fernando; Rotter, Jerome I.; Saaristo, Timo E.; Saleheen, Danish; Schlessinger, David; Slagboom, P. Eline; Snieder, Harold; Spector, Tim D.; Strauch, Konstantin; Stumvoll, Michael; Tuomilehto, Jaakko; Uusitupa, Matti; van der Harst, Pim; Völzke, Henry; Walker, Mark; Wareham, Nicholas J.; Watkins, Hugh; Wichmann, H.-Erich; Wilson, James F.; Zanen, Pieter; Deloukas, Panos; Heid, Iris M.; Lindgren, Cecilia M.; Mohlke, Karen L.; Speliotes, Elizabeth K.; Thorsteinsdottir, Unnur; Barroso, Inês; Fox, Caroline S.; North, Kari E.; Strachan, David P.; Beckmann, Jacques S.; Berndt, Sonja I.; Boehnke, Michael; Borecki, Ingrid B.; McCarthy, Mark I.; Metspalu, Andres; Stefansson, Kari; Uitterlinden, André G.; van Duijn, Cornelia M.; Franke, Lude; Willer, Cristen J.; Price, Alkes L.; Lettre, Guillaume; Loos, Ruth J. F.; Weedon, Michael N.; Ingelsson, Erik; O'Connell, Jeffrey R.; Abecasis, Goncalo R.; Chasman, Daniel I.; Goddard, Michael E.; Visscher, Peter M.; Hirschhorn, Joel N.; Frayling, Timothy M.; McCarty, Catherine A.; Starren, Justin; Peissig, Peggy; Berg, Richard; Rasmussen, Luke; Linneman, James; Miller, Aaron; Choudary, Vidhu; Chen, Lin; Waudby, Carol; Kitchner, Terrie; Reeser, Jonathan; Fost, Norman; Wilke, Russell A.; Chisholm, Rex L.; Avila, Pedro C.; Greenland, Philip; Hayes, M. Geoff; Kho, Abel; Kibbe, Warren A.; Lemke, Amy A.; Lowe, William L.; Smith, Maureen E.; Wolf, Wendy A.; Pacheco, Jennifer A.; Thompson, William K.; Humowiecki, Joel; Law, May; Chute, Christopher; Kullo, Iftikar; Koenig, Barbara; de Andrade, Mariza; Bielinski, Suzette; Pathak, Jyotishman; Savova, Guergana; Wu, Joel; Henriksen, Joan; Ding, Keyue; Hart, Lacey; Palbicki, Jeremy; Larson, Eric B.; Newton, Katherine; Ludman, Evette; Spangler, Leslie; Hart, Gene; Carrell, David; Jarvik, Gail; Crane, Paul; Burke, Wylie; Fullerton, Stephanie Malia; Trinidad, Susan Brown; Carlson, Chris; Hutchinson, Fred; McDavid, Andrew; Roden, Dan M.; Clayton, Ellen; Haines, Jonathan L.; Masys, Daniel R.; Churchill, Larry R.; Cornfield, Daniel; Crawford, Dana; Darbar, Dawood; Denny, Joshua C.; Malin, Bradley A.; Ritchie, Marylyn D.; Schildcrout, Jonathan S.; Xu, Hua; Ramirez, Andrea Havens; Basford, Melissa; Pulley, Jill; Alizadeh, Behrooz Z.; de Boer, Rudolf A.; Boezen, H. Marike; van der Klauw, Melanie M.; Navis, Gerjan; Ormel, Johan; Postma, Dirkje S.; Rosmalen, Judith G. M.; Slaets, Joris P.; Wolffenbuttel, Bruce H. R.; Wijmenga, Cisca; Kathiresan, Sekar; Voight, Benjamin F.; Purcell, Shaun; Musunuru, Kiran; Ardissino, Diego; Mannucci, Pier M.; Anand, Sonia; Engert, James C.; Reilly, Muredach P.; Rader, Daniel J.; Morgan, Thomas; Spertus, John A.; Stoll, Monika; Girelli, Domenico; McKeown, Pascal P.; Patterson, Chris C.; Siscovick, David S.; O'Donnell, Christopher J.; Elosua, Roberto; Peltonen, Leena; Schwartz, Stephen M.; Melander, Olle; Altshuler, David; Merlini, Pier Angelica; Berzuini, Carlo; Bernardinelli, Luisa; Peyvandi, Flora; Tubaro, Marco; Celli, Patrizia; Ferrario, Maurizio; Fetiveau, Raffaela; Marziliano, Nicola; Casari, Giorgio; Galli, Michele; Ribichini, Flavio; Rossi, Marco; Bernardi, Francesco; Zonzin, Pietro; Piazza, Alberto; Yee, Jean; Friedlander, Yechiel; Marrugat, Jaume; Lucas, Gavin; Subirana, Isaac; Sala, Joan; Ramos, Rafael; Meigs, James B.; Williams, Gordon; Nathan, David M.; MacRae, Calum A.; Havulinna, Aki S.; Berglund, Goran; Asselta, Rosanna; Duga, Stefano; Spreafico, Marta; Daly, Mark J.; Nemesh, James; Korn, Joshua M.; McCarroll, Steven A.; Surti, Aarti; Guiducci, Candace; Gianniny, Lauren; Mirel, Daniel; Parkin, Melissa; Burtt, Noel; Gabriel, Stacey B.; Thompson, John R.; Braund, Peter S.; Wright, Benjamin J.; Balmforth, Anthony J.; Ball, Stephen G.; Schunkert, I. Heribert; Linsel-Nitschke, Patrick; Lieb, Wolfgang; Ziegler, Andreas; König, Inke R.; Fischer, Marcus; Stark, Klaus; Grosshennig, Anika; Preuss, Michael; Schreiber, Stefan; Ouwehand, Willem; Scholz, Michael; Cambien, Francois; Goodall, Alison; Li, Mingyao; Chen, Zhen; Wilensky, Robert; Matthai, William; Qasim, Atif; Hakonarson, Hakon H.; Devaney, Joe; Burnett, Mary-Susan; Pichard, Augusto D.; Kent, Kenneth M.; Satler, Lowell; Lindsay, Joseph M.; Waksman, Ron; Knouff, Christopher W.; Waterworth, Dawn M.; Walker, Max C.; Mooser, Vincent; Epstein, Stephen E.; Scheffold, Thomas; Berger, Klaus; Huge, Andreas; Martinelli, Nicola; Olivieri, Oliviero; Corrocher, Roberto; Hólm, Hilma; Do, Ron; Xie, Changchun; Siscovick, David; Matise, Tara; Buyske, Steve; Higashio, Julia; Williams, Rasheeda; Nato, Andrew; Ambite, Jose Luis; Deelman, Ewa; Manolio, Teri; Hindorff, Lucia; Heiss, Gerardo; Taylor, Kira; Franceschini, Nora; Avery, Christy; Graff, Misa; Lin, Danyu; Quibrera, Miguel; Cochran, Barbara; Kao, Linda; Umans, Jason; Cole, Shelley; MacCluer, Jean; Person, Sharina; Pankow, James; Gross, Myron; Fornage, Myriam; Durda, Peter; Jenny, Nancy; Patsy, Bruce; Arnold, Alice; Buzkova, Petra; Haines, Jonathan; Murdock, Deborah; Glenn, Kim; Brown-Gentry, Kristin; Thornton-Wells, Tricia; Dumitrescu, Logan; Bush, William S.; Mitchell, Sabrina L.; Goodloe, Robert; Wilson, Sarah; Boston, Jonathan; Malinowski, Jennifer; Restrepo, Nicole; Oetjens, Matthew; Fowke, Jay; Zheng, Wei; Spencer, Kylee; Pendergrass, Sarah; Le Marchand, Loïc; Wilkens, Lynne; Park, Lani; Tiirikainen, Maarit; Kolonel, Laurence; Cheng, Iona; Wang, Hansong; Shohet, Ralph; Haiman, Christopher; Stram, Daniel; Henderson, Brian; Monroe, Kristine; Schumacher, Fredrick; Anderson, Garnet; Prentice, Ross; LaCroix, Andrea; Wu, Chunyuan; Carty, Cara; Rosse, Stephanie; Young, Alicia; Haessler, Jeff; Kocarnik, Jonathan; Lin, Yi; Jackson, Rebecca; Duggan, David; Kuller, Lew
2014-01-01
Using genome-wide data from 253,288 individuals, we identified 697 variants at genome-wide significance that together explained one-fifth of the heritability for adult height. By testing different numbers of variants in independent studies, we show that the most strongly associated ∼2,000, ∼3,700
Tazouti, Youssef; Viriot-Goeldel, Caroline; Matter, Cornelie; Geiger-Jaillet, Anemone; Carol, Rita; Deviterne, Dominique
2011-01-01
The present article investigates the effects of individual and contextual variables on children's early learning in French nursery schools and German kindergartens. Our study of 552 children at preschools in France (299 children from French nursery schools) and Germany (253 children from German kindergartens) measured skills that facilitate the…
Chemical Plume Tracing Experimental Results with a REMUS AUV
2003-09-01
in moths at ranges of 100-1000 m [11] and in Antartic pro- cellariiform seabirds over 1000 km [5]. This article presents a algorithm that... Antartic Proellariiform Seabirds: Life at High Reynolds Numbers,” Biol. Bull., 198: 245--253, April 2000. 6. J. Basil, “Lobster orientation in
On the Scientific Foundations of Level 2 Fusion
2004-03-01
Development of Decision Aids”, CMIF Report 2-99, Feb 1999 KN2-49 Theories of Groups, Teams, Coalitions, etc -Adaptive Behaviors- • There is a huge literature...Investigations of Trust-related System Vulnerabilities in Aided, Adversarial Decision Making”, CMIF Report, Jan 2000 KN2-53 Summarizing Algorithm re Thing
Czech Academy of Sciences Publication Activity Database
Proyer, R.T.; Ruch, W.; Ali, N.S.; Al-Olimat, H. S.; Amemiya, T.; Adal, T.A.; Ansari, S. A.; Arhar, Š.; Asem, G.; Baudin, N.; Bawab, S.; Bergen, D.; Brdar, I.; Brites, R.; Brunner-Sciarra, M.; Carrell, A.; Dios, H.C.; Celik, M.; Ceschi, G.; Chang, K.; Cheryomukhin, A.; Chik, M.P.Y.; Chlopicki, W.; Cranney, J.; Dahourou, D.; Doosje, S.; Dore, M.; El-Arousy, N.; Ficková, E.; Führ, M.; Gallivan, J.; Geling, H.; Germikova, L.; Goh, A.; Gonzáles, R.D.; Ho, S.K.; Hřebíčková, Martina; Jaime, B.; Hertzberg Kaare, B.; Kamble, S.; Kazarian, S.; Kerkkänen, P.; Klementová, M.; Kobozeva, I.M.; Kovjanic, S.; Kumaraswamy, N.; Lampert, M.; Liao, Ch.; Levesque, M.; Loizou, L.; Loving, R.D.; Lyttle, J.; Machline, V.C.; McGoldrick, S.; McRorie, M.; Min, L.; Mottus, R.; Munyae, M.; Navia, C.E.; Nkhalamba, M.; Pedrini, P.P.; Petkova, M.; Platt, T.; Popa, D-E.; Radomska, A.; Rashid, T.; Rawlings, D.; Rubio, V.J.; Samson, A.C.; Sarid, O.; Shams, S.; Sisokohm, S.; Smári, J.; Sneddon, I.; Snikhovska, I.; Stephanenko, E.A.; Stokenberga, L.; Stuer, B.; Tanoto, Y.S.R.; Tapia, L.; Taylor, J.; Thibault, P.; Thompson, A.; Thőrn, H.; Toyota, H.; Ujlaky, J.; Vanno, V.; van der Westhuizen, B.; Wijayathilake, D.; Wong, P.S.O.; Wycoff, E.B.; Yeun, E.J.
2009-01-01
Roč. 22, 1/2 (2009), s. 253-279 ISSN 0933-1719 R&D Projects: GA ČR GA406/07/1561 Institutional research plan: CEZ:AV0Z70250504 Keywords : cross -cultural comparisons * gelotophobia * humor * multi-national study Subject RIV: AN - Psychology Impact factor: 0.771, year: 2009
Poznatky o psychické odolnosti malých skupin izolovaných v náročných podmínkách
Czech Academy of Sciences Publication Activity Database
Šolcová, Iva
2008-01-01
Roč. 52, č. 3 (2008), s. 253-264 ISSN 0009-062X R&D Projects: GA AV ČR(CZ) IAA700250701 Institutional research plan: CEZ:AV0Z70250504 Keywords : space flights * space flight simulation * cultural differences Subject RIV: AN - Psychology Impact factor: 0.101, year: 2008
Influence of feeding thermally peroxidized soybean oil on oxidative status in growing pigs
The objectives of this study were to determine whether feeding thermally processed peroxidized soybean oil (SO) induces markers of oxidative stress and alters antioxidant status in pig tissue, blood, and urine. Fifty-six barrows (25.3 ± 3.3 kg initial BW) were randomly assigned to dietary treatments...
Short-term impact of dry olive mill residue addition to soil on the resident microbiota
Czech Academy of Sciences Publication Activity Database
Sampedro, I.; Giubilei, M. A.; Cajthaml, Tomáš; Federici, E.; Federici, F.; Petruccioli, M.; D´Annibale, A.
2009-01-01
Roč. 100, č. 23 (2009), s. 6098-6106 ISSN 0960-8524 R&D Projects: GA MŠk LC06066 Institutional research plan: CEZ:AV0Z50200510 Keywords : Dry olive mill residue * Microbial community profiling * Toxicity Subject RIV: EE - Microbiology, Virology Impact factor: 4.253, year: 2009
International Nuclear Information System (INIS)
Farhana, A.; Shamshuddin, J.; Fauziah, C.I.; Panhwar, Q.A.
2017-01-01
The acid sulfate soils contain pyrite (FeS/sub 2/) which is due to oxidation results in the production of high amount of acidity, aluminum and iron significantly affecting rice growth. A glasshouse study was arranged to determine the effect of ground magnesium limestone (GML) in combination with bio-organic fertilizer (JITUTM) application on the chemical properties of soils and rice yield. Three rice seedlings were transplanted in pots which were previously amended with 0, 2, 4, 6 and 8 t/ha GML with or without bio-organic fertilizer. The common rice varieties (MR 219 and MR 253) were cultivated for two seasons in the same pots. The critical Fe2+ and Al3+ activities for MR 219 were 14.45 and 4.23 mu M, while for MR 253 were 7.45 and 5.53 mu M, respectively. However, without applying the amendments, rice grown on the soils was affected severely by the high acidity (Fe2+ and Al3+ toxicity). The soil pH increased to 5 and the higher grain yield of MR 219 (99.77 and 121.38 g/pot) and MR253 (98.63 and 112.60 g/pot) was in first and second season with the application of 2 t GML application combined with 0.25 t JITUTM/ha respectively. In addition, 1000 grain weight, number of panicle, number of spikelets panicle-1 and the percentage of filled spikelet, were also higher than without the soil amendments. Hence, the infertility of acid sulfate soils for sustainable rice cultivation in Malaysia can be improved by applying 2 t GML/ha combined with 0.25 t JITUTM/ha for two seasons in long run. (author)
International Nuclear Information System (INIS)
Ma, Liang-Hua; Li, Guang; Zhang, Hong-Wei; Wang, Zhi-Yu; Dang, Jun; Zhang, Shuo; Yao, Lei
2016-01-01
The purpose of this study was to investigate the impact of histology on survival stratified by the Graded Prognostic Assessment (GPA) for non-small cell lung cancer (NSCLC) in a group of selected patients treated recently. A total of 171 NSCLC patients with brain metastases treated by hypofractionated stereotactic radiotherapy with or without whole-brain radiotherapy between 2001 and 2011 were included. The GPA score was calculated for each patient. Tumor histologies were categorized into adenocarcinoma (ADCA) and non-ADCA. Median survival time (MST, in months) was calculated using the Kaplan-Meier method. The log-rank test was used to determine statistical differences. MSTs by histology were: ADCA 15 (n = 92) and non-ADCA 10 (n = 79) (p < 0.001). For all patients, the MSTs by GPA score were: GPA 3.5-4, 24; GPA 2.5-3, 15; GPA 1.5-2, 9 and GPA 0-1, 6 (p < 0.001). The histology of ADCA showed a statistically significant higher MST than non-ADCA for patients with GPA 2.5-4. For GPA 2.5-3, MSTs were: ADCA 18, non-ADCA 10 (p = 0.007); for GPA 3.5-4, MSTs were: ADCA 30, non-ADCA 17 (p = 0.046). For GPA 0-2, MSTs did not differ significantly by histology. For GPA 0-1, MSTs were: ADCA 8, non-ADCA 4 (p = 0.146); GPA 1.5-2, MSTs were: ADCA 10, non-ADCA 8 (p = 0.291). We further found that non-ADCA in upper GPA class (3.5–4) had similar survival with ADCA in lower GPA class (2.5–3) (MSTs were 17 and 18, respectively, p = 0.775). This phenomenon also happened between patients of non-ADCA in upper GPA class (2.5–3) and those of ADCA in lower GPA class (1.5–2) (MSTs were both 10, p = 0.724). We confirmed that the histology of NSCLC had effect on the GPA in these selected patients treated recently. ADCA showed a statistically significant higher MST than non-ADCA with GPA 2.5-4. The non-ADCA in upper GPA classes (3.5-4 and 2.5-3) had similar survival to ADCA in lower GPA classes (2.5-3 and 1.5-2, respectively). The histology as a new factor should be added to the original
CASTLE BRAVO: Fifty Years of Legend and Lore. A Guide to Off-Site Radiation Exposures
2013-01-31
depressions , may grow rapidly from small beginnings—from small perturbations in a broad, unstable air stream—has led to the suggestion that the...Hygiene and Toxicology 25(7)253–274. ——. 1974. Paper presented in Radiology Centennial . Radiology Centennial , Inc., Reston, VA. Fehner, T. R., and F. G
Sadhana | Indian Academy of Sciences
Indian Academy of Sciences (India)
Effects of the different atmospheric steam curing processes on the properties of self-compacting-concrete containing microsilica · Abdulkadir Cüneyt Aydin Ali Öz Riza Polat ... Volume 41 Issue 2 February 2016 pp 253-264. The effect of blast furnace slag on the self-compactability of pumice aggregate lightweight concrete.
An overview of some recent results on the Euler system of isentropic gas dynamics
Czech Academy of Sciences Publication Activity Database
Chiodaroli, E.; Kreml, Ondřej
2016-01-01
Roč. 47, č. 1 (2016), s. 241-253 ISSN 1678-7544 Institutional support: RVO:67985840 Keywords : hyperbolic systems of conservation laws * Riemann problem * admissible solutions Subject RIV: BA - General Mathematics Impact factor: 0.400, year: 2016 http://link.springer.com/article/10.1007%2Fs00574-016-0135-0
Constituents of the leaf oil of Vietnamese Clausena excavata Burm.f
Leclercq, P.A.; Dung, N.X.; Thin, N.N.
1994-01-01
A detailed analvsis of the essential oil of Clausena excavata Burm.f. has been carried out by capillary dc and GC/MS. The oil contains more than 50 components, of which 40 have been identified. The main constituents found were beta-caryophyllene (25.3%), germacrene B (11.8%) !Uld beta-phellandrene
Sadhana | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Journals; Sadhana. Pawan Kumar Gupta. Articles written in Sadhana. Volume 32 Issue 3 June 2007 pp 253-275. TCP with header checksum option for wireless links: An analytical approach towards performance evaluation · Pawan Kumar Gupta Joy Kuri · More Details Abstract Fulltext PDF. TCP performs poorly in ...
Proceedings – Mathematical Sciences | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Journals; Proceedings – Mathematical Sciences; Volume 126; Issue 2. Volume 126, Issue 2. May 2016, pages 143-287. pp 143-151 Research Article. Existence of ..... pp 253-260 Research Article. Rigidity theorem forWillmore surfaces in a sphere · Hongwei Xu Dengyun Yang · More Details Abstract Fulltext PDF.
West African Journal of Medicine - Vol 23, No 3 (2004)
African Journals Online (AJOL)
Circulating immune complexes, immunoglobulin classes (IgG, IgA and IgM) and complement components (C3c, C4 and Factor B) in diabetic Nigerians. EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. KS Akinlade, OG Arinola, LS Salimonu, GO Oyeyinka, 253-255.
Optimization of special inductor for induction pre-heating
Czech Academy of Sciences Publication Activity Database
Pánek, D.; Kotlan, V.; Doležel, Ivo
2014-01-01
Roč. 2014, č. 12 (2014), s. 253-256 ISSN 0033-2097 R&D Projects: GA ČR(CZ) GAP102/11/0498 Grant - others:GA TA ČR(CZ) TA03010354 Institutional support: RVO:61388998 Keywords : induction heating * shape optimization * hard-coupled formulation Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering
Li, Weidong; Wright, Paul M.; Rukavina, Paul Bernard; Pickering, Molly
2008-01-01
The purpose of the current study was to test the validity and reliability of a two-factor model of the Personal and Social Responsibility Questionnaire (PSRQ) and examine the relationships between perceptions of personal and social responsibility and intrinsic motivation in physical education. Participants were 253 middle school students who…
Czech Academy of Sciences Publication Activity Database
Antonova, N.; Říha, Pavel; Ivanov, I.
2010-01-01
Roč. 45, 2-4 (2010), s. 253-261 ISSN 1386-0291 R&D Projects: GA AV ČR IAA200600803 Institutional research plan: CEZ:AV0Z20600510 Keywords : apparent viscosity * conductivity * unsteady flow * RBC suspensions * dextrans * PEG Subject RIV: BK - Fluid Dynamics Impact factor: 2.838, year: 2010