48 CFR 2052.242-70 - Resolving differing professional views.

Science.gov (United States)

2010-10-01

... resolution of differing professional views (DPVs) of health and safety related concerns associated with the... professional views. 2052.242-70 Section 2052.242-70 Federal Acquisition Regulations System NUCLEAR REGULATORY....242-70 Resolving differing professional views. As prescribed in 2042.570-1, the contracting officer...

36 CFR 242.13 - Board/agency relationships.

Science.gov (United States)

2010-07-01

... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Board/agency relationships. 242.13 Section 242.13 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE... relationships. (a) General. (1) The Board, in making decisions or recommendations, shall consider and ensure...

24 CFR 242.67 - New corporations, subsidiaries, affiliations, and mergers.

Science.gov (United States)

2010-04-01

..., affiliations, and mergers. 242.67 Section 242.67 Housing and Urban Development Regulations Relating to Housing... Reporting, and Financial Requirements § 242.67 New corporations, subsidiaries, affiliations, and mergers... written approval for all future mergers. ...

40 CFR 86.242-94 - Records required.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 18 2010-07-01 2010-07-01 false Records required. 86.242-94 Section 86.242-94 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED... Later Model Year Gasoline-Fueled New Light-Duty Vehicles, New Light-Duty Trucks and New Medium-Duty...

17 CFR 242.610 - Access to quotations.

Science.gov (United States)

2010-04-01

... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Access to quotations. 242.610...-Regulation of the National Market System § 242.610 Access to quotations. (a) Quotations of SRO trading... national securities exchange or national securities association to the quotations in an NMS stock displayed...

24 CFR 242.26 - Agreed interest rate.

Science.gov (United States)

2010-04-01

... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Agreed interest rate. 242.26... MORTGAGE INSURANCE FOR HOSPITALS Mortgage Requirements § 242.26 Agreed interest rate. (a) The mortgage shall bear interest at the rate or rates agreed upon by the mortgagee and the mortgagor. (b) The amount...

17 CFR 242.405 - Withdrawal of margin.

Science.gov (United States)

2010-04-01

... related positions in the account under this Regulation (§§ 242.400 through 242.406). (b) By the security... the CEA (7 U.S.C. 7a-1); (2) Interest charged on credit maintained in the account; (3) Communication or shipping charges with respect to transactions in the account; (4) Payment of commissions...

19 CFR 24.2 - Persons authorized to receive Customs collections.

Science.gov (United States)

2010-04-01

... 19 Customs Duties 1 2010-04-01 2010-04-01 false Persons authorized to receive Customs collections. 24.2 Section 24.2 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY CUSTOMS FINANCIAL AND ACCOUNTING PROCEDURE § 24.2 Persons authorized to receive...

242-A Evaporator quality assurance plan. Revision 2

International Nuclear Information System (INIS)

Basra, T.S.

1995-01-01

The purpose of this quality assurance project plan (Plan) is to provide requirements for activities pertaining to sampling, shipping, and analyses associated with candidate feed tank samples for the 242-A Evaporator project. The purpose of the 242-A Evaporator project is to reduce the volume of aqueous waste in the Double Shell Tank (DST) System and will result in considerable savings to the disposal of mixed waste. The 242-A Evaporator feed stream originates from DSTs identified as candidate feed tanks. The 242-A Evaporator reduces the volume of aqueous waste contained in DSTs by boiling off water and sending the condensate (called process condensate) to the Liquid Effluent Retention Facility (LEPF) storage basin where it is stored prior to treatment in the Effluent Treatment Facility (ETF). The objective of this quality assurance project plan is to provide the planning, implementation, and assessment of sample collection and analysis, data issuance, and validation activities for the candidate feed tanks

17 CFR 242.505 - Exclusion for news media.

Science.gov (United States)

2010-04-01

... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Exclusion for news media. 242...-Analyst Certification § 242.505 Exclusion for news media. No provision of this Regulation AC shall apply to any person who: (a) Is the publisher of any bona fide newspaper, news magazine or business or...

17 CFR 242.303 - Record preservation requirements for alternative trading systems.

Science.gov (United States)

2010-04-01

... requirements for alternative trading systems. 242.303 Section 242.303 Commodity and Securities Exchanges... REQUIREMENTS FOR SECURITY FUTURES Regulation Ats-Alternative Trading Systems § 242.303 Record preservation requirements for alternative trading systems. (a) To comply with the condition set forth in paragraph (b)(9) of...

48 CFR 2052.242-71 - Procedures for Resolving Differing Professional Views.

Science.gov (United States)

2010-10-01

... Differing Professional Views. 2052.242-71 Section 2052.242-71 Federal Acquisition Regulations System NUCLEAR... Clauses 2052.242-71 Procedures for Resolving Differing Professional Views. As prescribed in 2042.570-2(b... contracting officer. Procedures for Resolving NRC Contractor Differing Professional Views (DPVs) (OCT 1999) (a...

Analysis of Windscale and Bikini atoll sediments for Am-242m

International Nuclear Information System (INIS)

Beasley, T.M.

1976-01-01

Bowen and Livingston have recently reported the existence of 242 Am in both 1962 nuclear test debris and in a marine algae sample (kelp) contaminated by nuclear fuel reprocessing wastes. The presence of 242m Am (T 1/2 = 152y) was deduced by measuring its daughter product, 242C m. In the case of the fallout debris, the long decay time (25 years) between collection and analysis was argued to preclude the possibility of unsupported 242 Cm being present in the sample. The non-adherence to simple radiometric decay of the 242 Cm measured in two aliquots of the algae sample suggested that a small percentage of the isotope (≈ 3%) was in fact supported by its longer lived parent

Determination of the neutron-induced fission cross section of {sup 242}Pu; Bestimmung des neutroneninduzierten Spaltquerschnitts von {sup 242}Pu

Energy Technology Data Exchange (ETDEWEB)

Koegler, Toni Joerg

2016-04-26

Neutron induced fission cross sections of actinides like the Pu-isotopes are of relevance for the development of nuclear transmutation technologies. For {sup 242}Pu, current uncertainties are of around 21%. Sensitivity studies show that the total uncertainty has to be reduced to below 5% to allow for reliable neutron physics simulations. This challenging task was performed at the neutron time-of-flight facility of the new German National Center for High Power Radiation Sources at HZDR, Dresden. Within the TRAKULA project, thin, large and homogeneous deposits of {sup 235}U and {sup 242}Pu have been produced successfully. Using two consecutively placed fission chambers allowed the determination of the neutron induced fission cross section of {sup 242}Pu relative to {sup 235}U. The areal density of the Plutonium targets was calculated using the measured spontaneous fission rate. Experimental results of the fast neutron induced fission of {sup 242}Pu acquired at nELBE will be presented and compared to recent experiments and evaluated data. Corrections addressing the neutron scattering are discussed by using results of different neutron transport simulations (Geant 4, MCNP 6 and FLUKA).

National Low-Level Waste Management Program radionuclide report series. Volume 13, Curium-242

International Nuclear Information System (INIS)

Adams, J.P.

1995-08-01

This report, Volume 13 of the National Low-Level Waste Management Program Radionuclide Report Series, discusses the radiological and chemical characteristics of curium-242 ( 242 Cm). This report also includes discussions about waste types and forms in which 242 Cm can be found and 242 Cm behavior in the environment and in the human body

242-A evaporator dangerous waste permit application

International Nuclear Information System (INIS)

1991-01-01

The 242-A Evaporator is a waste management unit within the Hanford Facility that consists of process vessels and support systems for heating, evaporating, and condensing double-shell tank (DST) waste generated by Hanford Site operations. Operation of the 242-A Evaporator serves to reduce the volume of waste solutions within the DSTs that do not self-boil, while separating inorganic and radionuclide constituents from organic constituents. This operation reduces the number of underground DSTs required for waste storage and also makes the mixed waste more suitable for future treatment and disposal (i.e., grouting and vitrification). The 242-A Evaporator receives mixed-waste streams from the DSTs that contain organic and inorganic constituents and radionuclides. The waste is a dangerous waste (DW) because of corrosivity, reactivity, and toxicity characteristics, and is an extremely hazardous waste (EHW) as a result of toxicity (state criteria only), carcinogenicity, and persistence under the state mixture rule. The waste also contains spent nonhalogenated solvents

National Low-Level Waste Management Program radionuclide report series. Volume 13, Curium-242

Energy Technology Data Exchange (ETDEWEB)

Adams, J.P.

1995-08-01

This report, Volume 13 of the National Low-Level Waste Management Program Radionuclide Report Series, discusses the radiological and chemical characteristics of curium-242 ({sup 242}Cm). This report also includes discussions about waste types and forms in which {sup 242}Cm can be found and {sup 242}Cm behavior in the environment and in the human body.

32 CFR 242b.7 - Officers of the University.

Science.gov (United States)

2010-07-01

..., developing, and directing the military activities and functions of the University. (ii) In the absence of the... Services University of the Health Sciences. (9) Dean of the Military Medical Education Institute. (i) The... 32 National Defense 2 2010-07-01 2010-07-01 false Officers of the University. 242b.7 Section 242b...

46 CFR 308.306 - Second Seamen's War Risk Policy, Form MA-242.

Science.gov (United States)

2010-10-01

... 46 Shipping 8 2010-10-01 2010-10-01 false Second Seamen's War Risk Policy, Form MA-242. 308.306... RISK INSURANCE Second Seamen's War Risk Insurance § 308.306 Second Seamen's War Risk Policy, Form MA-242. (a) The standard form of Second Seamen's War Risk Policy Form MA-242, may be obtained from the...

Non-destructive assay of 242Pu by resonance neutron capture

International Nuclear Information System (INIS)

Kane, W.R.; Lu, Ming-Shih; Aronson, A.; Forman, L.; Vanier, P.E.

1995-01-01

For the accurate assay of plutonium by neutron correlation measurements, especially for material derived from high-burnup reactor fuel, the content of 242 Pu in a sample must be determined. Since 242 Pu has a long half-life (387,000 yr) and decays to 238 U by alpha particle emission with the accompanying emission of only weak, low-energy gamma rays, gamma-ray spectrometry methods which are ordinarily employed to determine the isotopic composition of a plutonium sample are not feasible for 242 Pu. The existence of a resonance in the neutron capture cross section of 242 Pu at an energy of 2.67 electron volts (eV) with a large (72, 000 barn) cross section affords the possibility for the quantitative assay of this isotope by epithermal neutron capture. Essential for this purpose is an appropriately designed geometry of neutron moderators and absorbers which will provide maximum flux in the eV region while suppressing thermal neutron capture by the fissile plutonium isotopes. Signatures for neutron capture in 242 Pu include the decay of 243 Pu (4.9 hr), prompt capture gamma rays (total energy 5.034 MeV), and the decay of an isomeric state (330 nanosecond). Experiments to determine the feasibility of this approach are currently in progress

48 CFR 252.242-7004 - Material management and accounting system.

Science.gov (United States)

2010-10-01

... CLAUSES Text of Provisions And Clauses 252.242-7004 Material management and accounting system. As prescribed in 242.7204, use the following caluse: Material Management and Accounting System (JUL 2009) (a) Definitions. As used in this clause— (1) Material management and accounting system (MMAS) means the Contractor...

32 CFR 242.7 - Responsibilities.

Science.gov (United States)

2010-07-01

... ADMISSION POLICIES AND PROCEDURES FOR THE SCHOOL OF MEDICINE, UNIFORMED SERVICES UNIVERSITY OF THE HEALTH SCIENCES § 242.7 Responsibilities. (a) The President of the University shall: (1) Develop and prescribe... procedures prescribed in this part. (3) Coordinate, as required, with the Military Department Secretaries or...

242-A Campaign 99-1 process control plan; FINAL

International Nuclear Information System (INIS)

LE, E.Q.

1999-01-01

242-A Evaporator 99-1 will process approximately one million gallons of waste from tank 102-AW in June 1999. The process control Plan provides a general description of activities, which will occur during 242-A Evaporator Campaign 99-1 and to document analyses conducted to demonstrate that 102-AW waste is acceptable for processing. Predict is a registered trademark of Risk Decisions England Corporation, United Kingdom

32 CFR 242.2 - Applicability.

Science.gov (United States)

2010-07-01

... ADMISSION POLICIES AND PROCEDURES FOR THE SCHOOL OF MEDICINE, UNIFORMED SERVICES UNIVERSITY OF THE HEALTH SCIENCES § 242.2 Applicability. This part applies to the Office of the Secretary of Defense, the Military Departments, the Uniformed Services University of the Health Sciences (USUHS), and the Department of Defense...

Review of fission product yields and delayed neutron data for the actinides NP-237, PU-242, AM-242M, AM-243, CM-243 and CM-245

International Nuclear Information System (INIS)

Mills, R.W.

1990-07-01

A review of fission product yields and delayed neutron data for Np-237, Pu-242, Am-242m, Am-243, Cm-243 and Cm-245 has been undertaken. Gaps in understanding and inconsistencies in existing data were identified and priority areas for further experimental, theoretical and evaluation investigation detailed

24 CFR 242.68 - Disclosure and verification of Social Security and Employer Identification Numbers.

Science.gov (United States)

2010-04-01

... Social Security and Employer Identification Numbers. 242.68 Section 242.68 Housing and Urban Development... Requirements § 242.68 Disclosure and verification of Social Security and Employer Identification Numbers. The requirements set forth in 24 CFR part 5, regarding the disclosure and verification of Social Security Numbers...

24 CFR 242.62 - Releases of lien.

Science.gov (United States)

2010-04-01

... DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES MORTGAGE INSURANCE FOR HOSPITALS Regulatory Agreement, Accounting and Reporting, and Financial Requirements § 242.62...

242-A evaporator vacuum condenser system

International Nuclear Information System (INIS)

Smith, V.A.

1994-01-01

This document is written for the 242-A evaporator vacuum condenser system (VCS), describing its purpose and operation within the evaporator. The document establishes the operating parameters specifying pressure, temperature, flow rates, interlock safety features and interfacing sub-systems to support its operation

24 CFR 242.56 - Form of regulation.

Science.gov (United States)

2010-04-01

... INSURANCE FOR HOSPITALS Regulatory Agreement, Accounting and Reporting, and Financial Requirements § 242.56... contractors, on an ongoing basis for the life of the insured mortgage to ensure against the risk of default...

Determination of the neutron-induced fission cross section of 242Pu

International Nuclear Information System (INIS)

Koegler, Toni Joerg

2016-01-01

Neutron induced fission cross sections of actinides like the Pu-isotopes are of relevance for the development of nuclear transmutation technologies. For 242 Pu, current uncertainties are of around 21%. Sensitivity studies show that the total uncertainty has to be reduced to below 5% to allow for reliable neutron physics simulations. This challenging task was performed at the neutron time-of-flight facility of the new German National Center for High Power Radiation Sources at HZDR, Dresden. Within the TRAKULA project, thin, large and homogeneous deposits of 235 U and 242 Pu have been produced successfully. Using two consecutively placed fission chambers allowed the determination of the neutron induced fission cross section of 242 Pu relative to 235 U. The areal density of the Plutonium targets was calculated using the measured spontaneous fission rate. Experimental results of the fast neutron induced fission of 242 Pu acquired at nELBE will be presented and compared to recent experiments and evaluated data. Corrections addressing the neutron scattering are discussed by using results of different neutron transport simulations (Geant 4, MCNP 6 and FLUKA).

242-A MCS Logic Acceptance Test Report for Year 2000 Upgrade

International Nuclear Information System (INIS)

TEATS, M.C.

1999-01-01

242-A Evaporator distributive control system upgrade to D/3 version 9.0-2 for year 2000 compliance. Testing was performed per test procedure HNF-3568. There were no unresolved exceptions. The system responded correctly to all testing and meets the requirements to operate the 242-A This report documents the acceptance test results for the Evaporator facility

30 CFR 250.242 - What information must accompany the DPP or DOCD?

Science.gov (United States)

2010-07-01

... § 250.248; (g) Air emissions information required by § 250.249; (h) Oil and hazardous substance spills...? 250.242 Section 250.242 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR....258; (q) Sulphur operations information required by § 250.259; (r) Coastal zone management information...

Organic emission calculations for the 242-A evaporator vessel vent system

International Nuclear Information System (INIS)

Bowman, M.R.

1996-01-01

This document contains historical calculations originally published in the 242-A Evaporator Dangerous Waste Permit Application, DOE/RL-90-42, Rev 0. They are being released as a supporting document, along with brief explanatory information, to be used as a reference in Rev 1 of the permit application and in other supporting documents, such as the 242-A Evaporator Data Quality Objectives

21 CFR 1.242 - What does assignment of a registration number mean?

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 1 2010-04-01 2010-04-01 false What does assignment of a registration number mean? 1.242 Section 1.242 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL GENERAL ENFORCEMENT REGULATIONS Registration of Food Facilities Additional Provisions § 1...

242-A evaporator safety analysis report

International Nuclear Information System (INIS)

CAMPBELL, T.A.

1999-01-01

This report provides a revised safety analysis for the upgraded 242-A Evaporator (the Evaporator). This safety analysis report (SAR) supports the operation of the Evaporator following life extension upgrades and other facility and operations upgrades (e.g., Project B-534) that were undertaken to enhance the capabilities of the Evaporator. The Evaporator has been classified as a moderate-hazard facility (Johnson 1990). The information contained in this SAR is based on information provided by 242-A Evaporator Operations, Westinghouse Hanford Company, site maintenance and operations contractor from June 1987 to October 1996, and the existing operating contractor, Waste Management Hanford (WMH) policies. Where appropriate, a discussion address the US Department of Energy (DOE) Orders applicable to a topic is provided. Operation of the facility will be compared to the operating contractor procedures using appropriate audits and appraisals. The following subsections provide introductory and background information, including a general description of the Evaporator facility and process, a description of the scope of this SAR revision,a nd a description of the basic changes made to the original SAR

242-A evaporator safety analysis report

Energy Technology Data Exchange (ETDEWEB)

CAMPBELL, T.A.

1999-05-17

This report provides a revised safety analysis for the upgraded 242-A Evaporator (the Evaporator). This safety analysis report (SAR) supports the operation of the Evaporator following life extension upgrades and other facility and operations upgrades (e.g., Project B-534) that were undertaken to enhance the capabilities of the Evaporator. The Evaporator has been classified as a moderate-hazard facility (Johnson 1990). The information contained in this SAR is based on information provided by 242-A Evaporator Operations, Westinghouse Hanford Company, site maintenance and operations contractor from June 1987 to October 1996, and the existing operating contractor, Waste Management Hanford (WMH) policies. Where appropriate, a discussion address the US Department of Energy (DOE) Orders applicable to a topic is provided. Operation of the facility will be compared to the operating contractor procedures using appropriate audits and appraisals. The following subsections provide introductory and background information, including a general description of the Evaporator facility and process, a description of the scope of this SAR revision,a nd a description of the basic changes made to the original SAR.

36 CFR 242.15 - Rural determination process.

Science.gov (United States)

2010-07-01

... SUBSISTENCE MANAGEMENT REGULATIONS FOR PUBLIC LANDS IN ALASKA Program Structure § 242.15 Rural determination...) Development and diversity of the economy; (iii) Community infrastructure; (iv) Transportation; and (v... years shall be required before the non-rural determination becomes effective. (c) Current determinations...

24 CFR 242.49 - Funds and finances: deposits and letters of credit.

Science.gov (United States)

2010-04-01

... collection under the letter of credit. In the event a demand for payment thereunder is not immediately met... letters of credit. 242.49 Section 242.49 Housing and Urban Development Regulations Relating to Housing and...: deposits and letters of credit. (a) Deposits. Where HUD requires the mortgagor to make a deposit of cash or...

27 CFR 24.242 - Authority to use greater quantities of decolorizing material in juice or wine.

Science.gov (United States)

2010-04-01

... quantities of decolorizing material in juice or wine. 24.242 Section 24.242 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS WINE Storage, Treatment and Finishing of Wine § 24.242 Authority to use greater quantities of decolorizing material in...

242-A evaporator quality assurance project plan: Revision 1

International Nuclear Information System (INIS)

Tucker, B.J.

1994-01-01

The scope of this quality assurance project plan (Plan) is sampling and analytical services including, but not limited to, sample receipt, handling and storage, analytical measurements, submittal of data deliverables, archiving selected portions of samples, returning unneeded sample material to Westinghouse Hanford Company (WHC), and/or sample disposal associated with candidate feed samples and process condensate compliance samples. Sampling and shipping activities are also included within the scope. The purpose of this project is to provide planning, implementation, and assessment guidance for achieving established data quality objectives measurement parameters. This Plan requires onsite and offsite laboratories to conform to that guidance. Laboratory conformance will help ensure that quality data are being generated and therefore, that the 242-A evaporator is operating in a safe and compliant manner. The 242-A evaporator feed stream originates from double-shell tanks (DSTs) identified as candidate feed tanks. The 242-A evaporator reduces the volume of aqueous waste contained in DSTs by boiling off water and sending it to the Liquid Effluent Retention Facility (LERF) storage basin before further treatment. The slurry product is returned to DSTs. Evaporation results in considerable savings by reducing the volume of mixed waste for disposal

24 CFR 242.30 - Application of payments.

Science.gov (United States)

2010-04-01

... insurance; (b) Ground rents, taxes, special assessments, and fire and other hazard insurance premiums; (c... URBAN DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES MORTGAGE INSURANCE FOR HOSPITALS Mortgage Requirements § 242.30 Application of payments. All payments to be...

36 CFR 242.11 - Regional advisory councils.

Science.gov (United States)

2010-07-01

... SUBSISTENCE MANAGEMENT REGULATIONS FOR PUBLIC LANDS IN ALASKA Program Structure § 242.11 Regional advisory... participate in the Federal subsistence management program. The Regional Councils shall be established, and... the members represent commercial and sport interests within a region. The portion of membership that...

242-A Evaporator waste analysis plan. Revision 4

International Nuclear Information System (INIS)

Basra, T.S.; Mulkey, C.H.

1994-01-01

This waste analysis plan (WAP) provides the plan for obtaining information needed for proper waste handling and processing in the 242-A Evaporator located on the Hanford Site. Regulatory and safety issues are addressed by establishing boundary conditions for waste received and treated at the 242-A Evaporator. The boundary conditions are set by establishing limits for items such as potential exothermic reactions, waste compatibility, and control of vessel vent organic emissions. Boundary conditions are also set for operational considerations and to ensure waste acceptance at receiving facilities. The issues that are addressed in this plan include prevention of exotherms in the waste, waste compatibility, vessel vent emissions, and compatibility with the liner in the Liquid Effluent Retention Facility (LERF). The 242-A Evaporator feed stream is separated into two liquid streams: a concentrated slurry stream and a process condensate. A gaseous exhaust stream is also produced. The slurry contains the majority of the radionuclides and inorganic constituents. This stream is pumped back to the double shell tanks (DSTs) and stored for further treatment after being concentrated to target levels. The process condensate (PC) is primarily water that contains trace amounts of organic material and a greatly reduced concentration of radionuclides. The process condensate is presently stored in the (LERF) until it can be further processed in the Effluent Treatment Facility once it is operational

Page 1 242 Ethiopian Journal of Environmental Studies ...

African Journals Online (AJOL)

USER

2015-03-17

Mar 17, 2015 ... Ethiopian Journal of Environmental Studies & Management 8(3): 242 – 251, 2015. .... Central Kenya hardly used innovations on botanical pesticides. ..... science of the pests. Similarly ... Management Project in Western. Kenya ...

In Vitro Probiotic Properties of Lactobacillus salivarius MG242 Isolated from Human Vagina.

Science.gov (United States)

Kang, Chang-Ho; Han, Seul Hwa; Kim, YongGyeong; Paek, Nam-Soo; So, Jae-Seong

2017-08-31

Vulvovaginal candidiasis (VVC) is a very common infection worldwide that is mainly caused by Candida albicans. In a previous study, we showed that Lactobacillus salivarius MG242 has anti-Gardnerella vaginalis activity. In this study, we investigated the potential of using L. salivarius MG242 for biocontrol of C. albicans. In line with the results from a spot overlay assay, MG242 inhibited the growth of C. albicans by 99.99 ± 0.01% in co-culture, suggesting that L. salivarius MG242 has the potential to be developed into a probiotic formula to treat or prevent VVC. Accelerated storage tests using dehydrated live cell powder at 50, 60, and 70 °C were performed, and the results showed that immobilization with 10% skim milk effectively increased the thermal resistance of entrapped microorganisms, resulting in sevenfold longer shelf-life than the control (in PBS). Lower storage temperatures also increased the shelf-life up to 8.31 months.

29 CFR 779.242 - Goods that “have been moved in” commerce.

Science.gov (United States)

2010-07-01

... 29 Labor 3 2010-07-01 2010-07-01 false Goods that âhave been moved inâ commerce. 779.242 Section... Commerce by Any Person § 779.242 Goods that “have been moved in” commerce. For the purpose of section 3(s), goods will be considered to “have been moved * * * in commerce” when they have moved across State lines...

17 CFR 242.607 - Customer account statements.

Science.gov (United States)

2010-04-01

... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Customer account statements... (CONTINUED) REGULATIONS M, SHO, ATS, AC, AND NMS AND CUSTOMER MARGIN REQUIREMENTS FOR SECURITY FUTURES Regulation Nms-Regulation of the National Market System § 242.607 Customer account statements. (a) No broker...

48 CFR 952.242-70 - Technical direction.

Science.gov (United States)

2010-10-01

... contract. (d) All technical direction shall be issued in writing by the COR. (e) The Contractor must... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Technical direction. 952... FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 952.242-70 Technical...

242-A evaporator hazards assessment

International Nuclear Information System (INIS)

Johnson, T.L.

1998-01-01

This document establishes the technical basis in support of Emergency Planning activities for the 242-A Evaporator, on the Hanford Site. Through this document the technical basis for the development of facility specific Emergency Action Levels and the Emergency Planning Zone is demonstrated. The evaporator sues a conventional, forced-circulation, vacuum evaporation system to concentrate radioactive waste solutions. This concentration results in the reduction in waste volume and reduces the number of double-shelled tanks required to store the waste

24 CFR 1000.242 - When does the requirement for exemption from taxation apply to affordable housing activities?

Science.gov (United States)

2010-04-01

... exemption from taxation apply to affordable housing activities? 1000.242 Section 1000.242 Housing and Urban... ACTIVITIES Indian Housing Plan (IHP) § 1000.242 When does the requirement for exemption from taxation apply to affordable housing activities? The requirement for exemption from taxation applies only to rental...

Fast-neutron-induced fission of 242Pu at nELBE

Directory of Open Access Journals (Sweden)

Kögler Toni

2017-01-01

Full Text Available The fast neutron-induced fission cross section of 242Pu was determined in the range of 0.5 MeV to 10 MeV relative to 235U(n,f at the neutron time-of-flight facility nELBE. The number of target nuclei was calculated by means of measuring the spontaneous fission rate of 242Pu. Neutron transport simulations with Geant4 and MCNP6 are used to correct the relative cross section for neutron scattering. The determined results are in good agreement with current experimental and evaluated data sets.

Estimation of radioactive contaminants in Cm242 and Cm244 isotopic fuels

International Nuclear Information System (INIS)

Terent'ev, V.P.; Makarenko, A.I.

1972-01-01

The radiation properties of Cm 242 and Cm 244 preparations and the effect on them of possible contaminants are considered. One of the most important requirements for K alpha active fuels for radioisotope thermoelectric batteries is ensuring a low ionizing radiation background. In determining the effect of impurities on the radiation properties of a preparation, quantitative evaluation of certain factors is sufficient. In a Cm 242 preparation it is possible to show that Am 241 and Cm 243 are undesirable impurities. The presence of Am 241 increases the soft gamma output by 20%. The presence of Cm 243 may double the dose rate from an unshielded preparation and increase the hard gamma output 10-fold. The properties of Cm 242 preparations deteriorate when Am 243 and Cm 243 are present

48 CFR 242.803 - Disallowing costs after incurrence.

Science.gov (United States)

2010-10-01

... from contractors; (B) Approving interim vouchers for provisional payment (this includes approving the... interim vouchers for provisional payment to the disbursing office for contractors with approved billing... of Costs 242.803 Disallowing costs after incurrence. (a) Contracting officer receipt of vouchers...

Delisting strategy for the Hanford Site 242-A Evaporator PUREX Plant Condensate Treatment Facility

International Nuclear Information System (INIS)

1992-04-01

This document describes the strategy that the US Department of Energy, Richland Field Office intends to use in preparing the delisting petition for the 242-A Evaporator/PUREX Plant Condensate Treatment Facility. Because the 242-A Evaporator/PUREX Plant Condensate Treatment Facility will not be operational until 1994, the delisting petition will be structured as an up-front petition based on the ''multiple waste treatment facility'' approach outline in the 1985 US Environmental Protection Agency's Petitions to Delist Hazardous Waste. The 242-A evaporator/PUREX Plant Condensate Treatment Facility effluent characterization data will not be available to support the delisting petition, because the delisting petition will be submitted to the US Environmental Protection Agency before start-up of the 242-A Evaporator/PUREX Plant Condensate Treatment Facility. Therefore, the delisting petition will be based on data collected during the pilot plant testing for the 242-A Evaporator/PUREX Plant Condensate Treatment Facility. This pilot plant testing will be conducted on synthetic waste. The composition of the synthetic waste will be based on: (1) constituents of regulatory concern, and (2) on process knowledge. The pilot plant testing will be performed to determine the removal efficiencies of the process equipment at concentrations greater than reasonably could be expected in the actual waste. This strategy document also describes the logic used to develop the synthetic waste, to develop the pilot plant testing program, and to prepare the delisting petition. This strategy document also described how full-scale operating data will be collected during initial operation of the 242-A Evaporator/PUREX Plant Condensate Treatment Facility to verify information presented in the delisting petition

48 CFR 2452.242-71 - Contract management system.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Contract management system... 2452.242-71 Contract management system. As prescribed in 2442.1107, insert the following clause: Contract Management System (FEB 2006) (a) The contractor shall use contract management baseline planning...

Neutron spectra of /sup 242/Cm-Be and /sup 244/Cm-Be neutron sources

Energy Technology Data Exchange (ETDEWEB)

Kumar, A; Nagarajan, P S [Bhabha Atomic Research Centre, Bombay (India). Div. of Radiation Protection

1977-02-15

Neutron spectra of /sup 242/Cm-Be(..cap alpha..,n) and /sup 244/Cm-Be(..cap alpha..,n) sources have been calculated including the spontaneous fission contribution which is negligible for /sup 242/Cm and amounts to about 4% for /sup 244/Cm. The agreement of the present work with experimental results is poor.

48 CFR 242.705-2 - Auditor determination procedure.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Auditor determination... Indirect Cost Rates 242.705-2 Auditor determination procedure. (b) Procedures. (2)(iii) When agreement cannot be reached with the contractor, the auditor will issue a DCAA Form 1, Notice of Contract Costs...

Tumor markers CA19-9, CA242 and CEA in the diagnosis of pancreatic cancer: a meta-analysis.

Science.gov (United States)

Zhang, Yimin; Yang, Jun; Li, Hongjuan; Wu, Yihua; Zhang, Honghe; Chen, Wenhu

2015-01-01

Pancreatic cancer has the worst prognosis and early detection is crucial for improving patient prognosis. Therefore, we performed a meta-analysis to evaluate and compare the sensitivity and specificity of single test of CA19-9, CA242, and CEA, as well as combination test in pancreatic cancer detection. We searched PubMed, Embase, Medline, and Wanfang databases for studies that evaluated the diagnostic validity of CA19-9, CA242, and CEA between January 1990 and September 2014. Data were analyzed by Meta-Disc and STATA software. A total of 21 studies including 3497 participants, which fulfilled the inclusion criteria were considered for analysis. The pooled sensitivities for CA19-9, CA242, and CEA were 75.4 (95% CI: 73.4-77.4), 67.8 (95% CI: 65.5-70), and 39.5 (95% CI: 37.3-41.7), respectively. The pooled specificities of CA19-9, CA242, and CEA were 77.6 (95% CI: 75.4-79.7), 83 (95% CI: 81-85), and 81.3 (95% CI: 79.3-83.2), respectively. Parallel combination of CA19-9+CA242 has a higher sensitivity (89, 95% CI: 80-95) without impairing the specificity (75, 95% CI: 67-82). Our meta-analysis showed that CA242 and CA19-9 have better performance in the diagnosis of pancreatic cancer than CEA. Furthermore, parallel combination test of CA19-9+CA242 could be of better diagnostic value than individual CA242 or CA19-9 test.

Process Control Plan for 242-A Evaporator Campaign

International Nuclear Information System (INIS)

LE, E.Q.

2000-01-01

The wastes in tanks 107-AP and 108-AP are designated as feed for 242-A Evaporator Campaign 2000-1, which is currently scheduled for the week of April 17, 2000. Waste in tanks 107-AP and 108-AP is predominantly comprised of saltwell liquor from 200 West Tank Farms

17 CFR 256.242 - Miscellaneous current and accrued liabilities.

Science.gov (United States)

2010-04-01

... COMMISSION (CONTINUED) UNIFORM SYSTEM OF ACCOUNTS FOR MUTUAL SERVICE COMPANIES AND SUBSIDIARY SERVICE COMPANIES, PUBLIC UTILITY HOLDING COMPANY ACT OF 1935 7. Current and Accrued Liabilities § 256.242... as to show the nature of each liability included herein. 8. deferred credits ...

Peaceful berkelium

Science.gov (United States)

Trabesinger, Andreas

2017-09-01

The first new element produced after the Second World War has led a rather peaceful life since entering the period table -- until it became the target of those producing superheavy elements, as Andreas Trabesinger describes.

242-A campaign 95-1 post run document

International Nuclear Information System (INIS)

Guthrie, M.D.

1996-01-01

The 242-A Evaporator Campaign 95-1 was started on June 6, 1995 and finished July 27, 1995. An overall Waste Volume Reduction (WVR) of 8.18 million liters (2.16 mGAL OR 87.6% WVRF) was achieved from 9.35 million liters (2.47 Mgal) of processable waste contained in 108-AP, 107-AP, 106-AW and 102-AW. Slurry generated from Campaign 95-1 consisted of 1.05 million liters (278,000 gal) of dilute double-shell slurry feed (DDSSF) with a SpG of approximately 1.34. Total process condensate discharged to LERF was 10.3 million liters (2.72 Mgal), achieving a condensate/WVR efficiency ratio of 1.26. Total throughout for Campaign 95-1 was 18.1 million liters (4.79 Mgal). B Pond discharges from steam condensate and cooling water were 15.8 and 583 million liters (4.17 and 154 Mgal) respectively. Based on 145 hours of unplanned downtime, the 242-A Evaporator maintained an operating efficiency of 86% during the 49 day campaign

242mAm Fueled Nuclear Battery

International Nuclear Information System (INIS)

Yigal Ronen, Y.; Hatav, A.; Hazenshprung, N.

2004-01-01

A nuclear battery based on a direct energy conversion of the fission products is presented. The principal behind direct-charging or direct-conversion [1] is based on the direct conversion of fission product energy into electrical energy, using a high voltage potential. The kinetic energy of the fission products is thus converted to potential energy and the charges collected in the conductive electrodes create an electrical current. High-power nuclear batteries are important due to the fact that they have almost no moving parts. As a result, maintenance problems (especially important in outer space) are considerably reduced. Such energy conversion is possible by using a nuclear reactor with ultra-thin fuel elements of 0.2 m of 242m Am. The amount of nuclear fuel is 376g and the dimensions of the battery are 2.4*2.4*2.4m (including the vacuum spacing), with a BeO moderator and Be electrodes. The total power of the reactor is 10.6 MW and the electrical power is 0.672 MW. The reactor is composed of 242m Am as a nuclear fuel with a thickness of 0.2μm and a moderator of 4 cm of BeO and two 0.5 cm thickness electrodes of Be, as presented in Fig. 1. The moderator-to-fuel-volume ratio is V m /V f = 250000. The infinite multiplication factor for this design is [2] k ∞ = 1.8

77 FR 55800 - Foreign-Trade Zone 242-Boundary County, ID; Application for Subzone AREVA Enrichment Services...

Science.gov (United States)

2012-09-11

... DEPARTMENT OF COMMERCE Foreign-Trade Zones Board [B-68-2012] Foreign-Trade Zone 242--Boundary County, ID; Application for Subzone AREVA Enrichment Services, LLC; Bonneville County, ID An application... FTZ 242, requesting special-purpose subzone status for the facility of AREVA Enrichment Services, LLC...

Evaluation of neutron data for plutonium-242

International Nuclear Information System (INIS)

Maslov, V.M.; Porodzinkij, Yu.V.; Sukhovitskij, E.Sh.; Morogovskij, G.B.

1997-11-01

The evaluation of neutron data for 242 Pu is made in the energy region from 10 -5 eV up to 20 MeV. The results of the evaluation are compiled in the ENDF/B-VI format. This work is performed under the Project Agreement CIS-03-95 with the International Science and Technology Center (Moscow). The Financing Party for the Project is Japan. The evaluation was requested by Japan Nuclear Data Center (JAERI). (author)

48 CFR 3052.242-71 - Dissemination of contract information.

Science.gov (United States)

2010-10-01

... CONTRACT CLAUSES Text of Provisions and Clauses 3052.242-71 Dissemination of contract information. As prescribed in (HSAR) 48 CFR 3042.202-70, insert the following clause: Dissemination of Contract Information... 48 Federal Acquisition Regulations System 7 2010-10-01 2010-10-01 false Dissemination of contract...

48 CFR 1252.242-72 - Dissemination of contract information.

Science.gov (United States)

2010-10-01

....242-72 Dissemination of contract information. As prescribed in (TAR) 48 CFR 1242.7000(c), insert the following clause: Dissemination of Contract Information (OCT 1994) The Contractor shall not publish, permit... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Dissemination of contract...

Total cross section of 242Pu between 0.7 and 170 MeV

International Nuclear Information System (INIS)

Moore, M.S.; Lisowski, P.W.; Morgan, G.L.; Auchampaugh, G.F.

1979-01-01

Various evaluations of the neutron cross sections of 242 Pu lead to widely different predictions of bulk neutronics properties such as critical mass. These evaluations also show rather different behavior of the energy dependence of the total cross section. The total cross section of 242 Pu from 0.7 to 170 MeV was measured to a statistical accuracy of = 0.5% below 6 MeV, using 8 g of high purity material and the WNR pulsed neutron facility. Recent evaluations by Madland and Young and by Lagrange and Jary are found to be reasonably consistent with the data obtained. Best agreement, however, is found by using a relationship between the total cross sections for 238 U, 239 Pu, and 235 U. The remarkable accuracy of this description for 242 Pu suggests that it could be extended to other deformed actinides for which inadequate amounts of material exist for direct measurements of sigma/sub T/ in the MeV region, as an evaluation constraint

24 CFR 242.58 - Books, accounts, and financial statements.

Science.gov (United States)

2010-04-01

... Requirements § 242.58 Books, accounts, and financial statements. (a) Books and accounts. The mortgagor's books...: (i) Annual audited financial statements in accordance with the guidance below; (ii) Quarterly... (if the annual audited financial statement has not yet been filed with HUD) and at such other times as...

What's new with the FHA's Section 242?

Science.gov (United States)

Spidel, Alan J

2008-11-01

FHA hospital mortgage insurance, also called the Section 242 program, acts as a credit enhancement that allows borrowers to issue bonds up to the equivalent of an "AAA" rating, with the benefits of lower interest rates. Although the program has operated in relative obscurity over its 40 years of existence, the FHA has undertaken a new marketing campaign to raise its profile. Federal backing may make the program an attractive option amid today's financial turmoil in the capital markets.

Separation negatives from Kodak film types SO-368 and SO-242

Science.gov (United States)

Weinstein, M. S.

1972-01-01

Two master resolution friskets were produced on Kodak film types SO-368 and SO-242. These target masters consisted of 21 density steps with three-bar resolution targets at five modulation levels within each step. The target masters were contact printed onto Kodak separation negative film, type 4131, using both a contact printing frame and enlarger as one method of exposure, and a Miller-Holzwarth contact printer as the other exposing device. Red, green, and blue Wratten filters were used to filter the exposing source. Tray processing was done with DK-50 developer diluted 1:2 at a temperature of 70 F. The resolution values were read for the SO-368 and SO-242 target masters, and the red, green, and blue separation negatives.

Flurbiprofen benzyl nitrate (NBS-242) inhibits the growth of A-431 human epidermoid carcinoma cells and targets β-catenin.

Science.gov (United States)

Nath, Niharika; Liu, Xiaoping; Jacobs, Lloydine; Kashfi, Khosrow

2013-01-01

The Wnt/β-catenin/T cell factor (TCF) signaling pathway is important in the development of nonmelanoma skin cancers (NMSCs). Nitric-oxide-releasing nonsteroidal anti-inflammatory drugs (NO-NSAIDs) are chemopreventive agents consisting of a traditional NSAID attached to an NO-releasing moiety through a chemical spacer. Previously we showed that an aromatic spacer enhanced the potency of a particular NO-NSAID compared to an aliphatic spacer. We synthesized an NO-releasing NSAID with an aromatic spacer (flurbiprofen benzyl nitrate, NBS-242), and using the human skin cancer cell line A-431, we evaluated its effects on cell kinetics, Wnt/β-catenin, cyclin D1, and caspase-3. NBS-242 inhibited the growth of A-431 cancer cells, being ~15-fold more potent than flurbiprofen and up to 5-fold more potent than NO-flurbiprofen with an aliphatic spacer, the half maximal inhibitory concentrations (IC50) for growth inhibition being 60 ± 4 μM, 320 ± 20 μM, and 880 ± 65 μM for NBS-242, NO-flurbiprofen, and flurbiprofen, respectively. This effect was associated with inhibition of proliferation, accumulation of cells in the G0/G1 phase of the cell cycle, and an increase in apoptotic cell population. NBS-242 cleaved β-catenin both in the cytoplasm and the nucleus of A-431 cells. NBS-242 activated caspase-3 whose activation was reflected in the cleavage of procaspase-3. To test the functional consequence of β-catenin cleavage, we determined the expression of cyclin D1, a Wnt-response gene. NBS-242 reduced cyclin D1 levels in a concentration dependent manner. These findings establish a strong inhibitory effect of NBS-242 in A-431 human epidermoid carcinoma cells. NBS-242 modulates parameters that are important in determining cellular mass.

Relationship between peripheral and mesenteric serum levels of CEA and CA 242 with staging and histopathological variables in colorectal adenocarcinoma Níveis séricos periféricos e mesentéricos de CEA e CA 242, estadiamento e variáveis histopatológicas no adenocarcinoma colorretal

Directory of Open Access Journals (Sweden)

Mauro Lamelas Cardoso

2009-10-01

Full Text Available PURPOSE: To compare histopathological variables and staging in colorectal adenocarcinoma cases with CEA and CA 242 in peripheral and mesenteric blood. METHODS: In 169 individuals underwent surgery for colorectal cancer, CEA and CA 242 were analyzed and compared to mesenteric and peripheral blood and correlated with macroscopic tumor's morphology and size, degree of cell differentiation, venous, neural and lymphatic involvement and TNM classification. RESULTS: There was a difference between the mesenteric (M and peripheral (P serum levels of CEA (p=0.020. Higher levels of markers were correlated with venous invasion CEA (P p=0.013, CEA (M p=0.05, CA 242 (M p=0.005 and CA 242 (P p=0.038; with advanced staging CEA (P OBJETIVO: Comparar variáveis histopatológicas e graus de estadiamento do adenocarcinoma colorretal com níveis sanguíneos periféricos e mesentéricos de CEA e CA-242. MÉTODOS: Em 169 doentes submetidos ao tratamento cirúrgico por adenocarcinoma colorretal, CEA e CA-242 foram analisados e comparados quanto aos níveis sanguíneos periféricos e mesentéricos e correlacionados com o tamanho e a morfologia macroscópica do tumor, grau de diferenciação celular, invasões venosa, linfática, neural e a classificação TNM. RESULTADOS: Verificou-se diferença significante entre o nível sérico mesentérico e periférico de CEA (p= 0,02. Níveis séricos mais elevados dos marcadores foram observados e correlacionados com invasão venosa, CEA (P p=0,013, CEA(M, p=0,05, CA-242 (M p=0,005 e CA-242 (P p=0,038. Grau de estadiamento TNM avançado foi associado com CEA(P < CEA(M p<0,05, CA-242(P < CA-242(M p<0,05. Nas maiores dimensões tumorais constatou-se CEA(P < CEA(M p=0,001 e CA 242 (P < CA 242 (M (p < 0.001. O CA 242 periférico e mesentérico aumentados associaram-se com a invasão neural, p=0.014 e p=0.003, respectivamente. CONCLUSÕES: O nível sérico mesentérico de CEA é superior ao nível sérico periférico. Os níveis s

27 CFR 70.242 - Wages, salary and other income.

Science.gov (United States)

2010-04-01

... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false Wages, salary and other... Collection of Excise and Special (Occupational) Tax Limitations § 70.242 Wages, salary and other income. (a... as wages, salary or other income are exempt from levy. This section described the income of a...

17 CFR 242.604 - Display of customer limit orders.

Science.gov (United States)

2010-04-01

... such security; and (ii) The full size of each customer limit order held by the OTC market maker that... in relation to the size associated with the OTC market maker's bid or offer. (b) Exceptions. The... Regulation Nms-Regulation of the National Market System § 242.604 Display of customer limit orders. (a...

48 CFR 1252.242-70 - Dissemination of information-educational institutions.

Science.gov (United States)

2010-10-01

... Provisions and Clauses 1252.242-70 Dissemination of information—educational institutions. As prescribed in (TAR) 48 CFR 1242.7000(a), insert the following clause: Dissemination of Information—Educational... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Dissemination of...

1998 242-A interim evaporator tank system integrity assessment plan

Energy Technology Data Exchange (ETDEWEB)

Jensen, C.E.

1998-03-31

Portions of the 242-A Evaporator on the Hanford Site must be assessed to meet the requirements of the Washington State Department of Ecology`s Dangerous Waste Regulation, Washington Administrative Code (WAC) 173-303. The assessment is limited to the provisions of Section 173-303-640. This Integrity Assessment Plan (IAP) identifies tasks which will be performed during the assessment phase and describes the intended assessment techniques. The 242-A Evaporator facility processes waste solutions from most of the operating laboratories and plants of the Hanford Site. The waste solutions are concentrated in the evaporator to a slurry of liquid and crystallized salts. This concentrated slurry is returned to the Tank Farms at a significantly reduce volume. The water vapor from the evaporation process is condensed, filtered, and can be pumped through an ion exchange bed before transfer to a retention basin. The non-condensable portion of the vapor is filtered and continuously monitored before venting to the atmosphere. The 242-A Evaporator will be assessed as seven subsystems. Four of the subsystems store, transport or treat Washington State Dangerous wastes, the other three subsystems are integral parts of the process, however, they do not directly store, transfer, or treat listed dangerous wastes. The facility will be inspected, tested, and analyzed through this assessment. The seven subsystems, defined in detail in Appendix B, are: Evaporator Process and Slurry Subsystem; Vapor Condenser Subsystem; Vessel Vent Subsystem; Process Condensate Subsystem; Steam Condensate Subsystem; Raw Water Disposal Subsystem; and Building and Secondary Containment Subsystem.

1998 242-A interim evaporator tank system integrity assessment plan

International Nuclear Information System (INIS)

Jensen, C.E.

1998-01-01

Portions of the 242-A Evaporator on the Hanford Site must be assessed to meet the requirements of the Washington State Department of Ecology's Dangerous Waste Regulation, Washington Administrative Code (WAC) 173-303. The assessment is limited to the provisions of Section 173-303-640. This Integrity Assessment Plan (IAP) identifies tasks which will be performed during the assessment phase and describes the intended assessment techniques. The 242-A Evaporator facility processes waste solutions from most of the operating laboratories and plants of the Hanford Site. The waste solutions are concentrated in the evaporator to a slurry of liquid and crystallized salts. This concentrated slurry is returned to the Tank Farms at a significantly reduce volume. The water vapor from the evaporation process is condensed, filtered, and can be pumped through an ion exchange bed before transfer to a retention basin. The non-condensable portion of the vapor is filtered and continuously monitored before venting to the atmosphere. The 242-A Evaporator will be assessed as seven subsystems. Four of the subsystems store, transport or treat Washington State Dangerous wastes, the other three subsystems are integral parts of the process, however, they do not directly store, transfer, or treat listed dangerous wastes. The facility will be inspected, tested, and analyzed through this assessment. The seven subsystems, defined in detail in Appendix B, are: Evaporator Process and Slurry Subsystem; Vapor Condenser Subsystem; Vessel Vent Subsystem; Process Condensate Subsystem; Steam Condensate Subsystem; Raw Water Disposal Subsystem; and Building and Secondary Containment Subsystem

242-A Evaporator crystallizer facility integrated annual safety appraisal

International Nuclear Information System (INIS)

1991-01-01

This report provides the results of the Fiscal Year (FY) 1991 Annual Integrated Safety Appraisal of the 242-A Evaporator Crystallizer Facility in the Hanford 200 East Area. The appraisal was conducted in December 1990 and January 1991, by the Waste Tank Safety Assurance (WTSA) organizations in conjunction with Radiological Engineering, Criticality Safety, Packaging and Shipping Safety, Emergency Preparedness, Environmental Compliance, and Quality Assurance. Reports of these eight organizations are presented as Sections 2 through 7 of this report. The purpose of the appraisal was to verify that the 242-A Evaporator meets US Department of Energy (DOE) and Westinghouse Hanford Company (WHC) requirements and current industry standards of good practice for the areas being appraised. A further purpose was to identify areas in which program effectiveness could be improved. In accordance with the guidance of WHC Management Requirements and Procedures (MRP)5.6, previously identified deficiencies which are being resolved by line management were not repeated as Findings or Observations unless progress or intended disposition was considered to be unsatisfactory

48 CFR 1852.242-73 - NASA contractor financial management reporting.

Science.gov (United States)

2010-10-01

... Provisions and Clauses 1852.242-73 NASA contractor financial management reporting. As prescribed in 1842.7202, insert the following clause: NASA Contractor Financial Management Reporting (NOV 2004) (a) The Contractor... instructions in NASA Procedures and Guidelines (NPR) 9501.2, NASA Contractor Financial Management Reporting...

Critical mass calculations for 241Am, 242mAm and 243Am

International Nuclear Information System (INIS)

Dias, Hemanth; Tancock, Nigel; Clayton, Angela

2003-01-01

Criticality mass calculations are reported for 241 Am, 242m Am and 243 Am using the MONK and MCNP computer codes with the UKNDL, JEF-2.2, ENDF/B-VI and JENDL-3.2 nuclear data libraries. Results are reported for spheres of americium metal and dioxide in bare, water reflected and steel reflected systems. Comparison of results led to the identification of a serious inconsistency in the 241 Am ENDF/B-VI DICE library used by MONK - this demonstrates the importance of using different codes to verify critical mass calculations. The 241 Am critical mass estimates obtained using UKNDL and ENDF/B-VI show good agreement with experimentally inferred data, whilst both JEF-2.2 and JENDL-3.2 produce higher estimates of critical mass. The computed critical mass estimates for 242m Am obtained using ENDF/B-VI are lower than the results produced using the other nuclear data libraries - the ENDF/B-VI fission cross-section for 242m Am is significantly higher than the other evaluations in the fast region and is not supported by recent experimental data. There is wide variation in the computed 243 Am critical mass estimates suggesting that there is still considerable uncertainty in the 243 Am nuclear data. (author)

17 CFR 242.602 - Dissemination of quotations in NMS securities.

Science.gov (United States)

2010-04-01

... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Dissemination of quotations in... FUTURES Regulation Nms-Regulation of the National Market System § 242.602 Dissemination of quotations in... establish and maintain procedures and mechanisms for collecting bids, offers, quotation sizes, and aggregate...

The solubility of {sup 242}PuO{sub 2} in the presence of aqueous Fe(II). The impact of precipitate preparation

Energy Technology Data Exchange (ETDEWEB)

Felmy, Andrew R.; Moore, Dean A.; Buck, Edgar; Kukkadapu, Ravi; Sweet, Lucas; Abrecht, David; Ilton, Eugene S. [Pacific Northwest National Laboratory, Richland, WA (United States); Conrados, Steven D. [Los Alamos National Laboratory, Los Alamos, NM (United States)

2014-07-01

The solubility of different forms of precipitated {sup 242}PuO{sub 2}(am) were examined in solutions containing aqueous Fe(II) over a range of pH values. The first series of {sup 242}PuO{sub 2}(am) suspensions were prepared from a {sup 242}Pu(IV) stock that had been treated with thenoyltrifluoroacetone (TTA) to remove the {sup 241}Am originating from the decay of {sup 241}Pu. These {sup 242}PuO{sub 2}(am) suspensions showed much higher solubilities at the same pH value and Fe(II) concentration than previous studies using {sup 239}PuO{sub 2}(am). X-ray absorption fine structure (XAFS) spectroscopy of the precipitates showed a substantially reduced Pu-Pu backscatter over that previously observed in {sup 239}PuO{sub 2}(am) precipitates, indicating that the {sup 242}PuO{sub 2}(am) precipitates purified using TTA lacked the long range order previously found in{sup 239}PuO{sub 2}(am) precipitates. The Pu(IV) stock solution was subsequently re-purified using an ion exchange resin and an additional series of {sup 242}PuO{sub 2}(am) precipitates prepared. These suspensions showed higher redox potentials and total aqueous Pu concentrations than the TTA purified stock solution. The higher redox potential and aqueous Pu concentrations were in general agreement with previous studies on {sup 242}PuO{sub 2}(am) precipitates, presumably due to the removal of possible organic compounds originally present in the TTA purified stock. {sup 242}PuO{sub 2}(am) suspensions prepared with both stock solutions showed almost identical solubilities in Fe(II) containing solutions even though the initial aqueous Pu concentrations before the addition of Fe(II) were orders of magnitude different. By examining the solubility of {sup 242}PuO{sub 2}(am) prepared from both stocks in this way we have essentially approached equilibrium from both the undersaturated and oversaturated conditions. The final aqueous Pu concentrations are predictable using a chemical equilibrium model which includes the

24 CFR 242.47 - Insured advances for building components stored off-site.

Science.gov (United States)

2010-04-01

... HOUSING ACT AND OTHER AUTHORITIES MORTGAGE INSURANCE FOR HOSPITALS Construction § 242.47 Insured advances... only for components stored off-site in a quantity required to permit uninterrupted installation at the...

242-A evaporator safety analysis report

International Nuclear Information System (INIS)

Campbell, T.A.

1998-01-01

In compliance with DOE Orders, an update of the 242-A SAR has been prepared, as documented in the referenced ECN. Several categories of changes were identified for inclusion in this revision of the SAR. These categories will be utilized to simplify the discussion of the changes for this USQ document. However, it is important to note that no new tests or experiments were included in this revision of the SAR. Editorial changes and/or informational updates to Chapters 9 and 11 were included as part of this revision. However, no changes to Operational Safety Requirements (OSRs) contained in Chapter 11 were required. General categories of changes included in this revision are listed

1998 Annual Cathodic Protection Survey Report for the 242-A Evaporator Area

International Nuclear Information System (INIS)

BOWMAN, T.J.

1999-01-01

This report is the second annual cathodic protection report for the 242-A evaporator. The report documents and trends annual polarization survey data, rectifier inspection data, and continuity data from 1994 through mid-1999

242A Distributed Control System Year 2000 Acceptance Test Report

Energy Technology Data Exchange (ETDEWEB)

TEATS, M.C.

1999-08-31

This report documents acceptance test results for the 242-A Evaporator distributive control system upgrade to D/3 version 9.0-2 for year 2000 compliance. This report documents the test results obtained by acceptance testing as directed by procedure HNF-2695. This verification procedure will document the initial testing and evaluation of the potential 242-A Distributed Control System (DCS) operating difficulties across the year 2000 boundary and the calendar adjustments needed for the leap year. Baseline system performance data will be recorded using current, as-is operating system software. Data will also be collected for operating system software that has been modified to correct year 2000 problems. This verification procedure is intended to be generic such that it may be performed on any D/3{trademark} (GSE Process Solutions, Inc.) distributed control system that runs with the VMSTM (Digital Equipment Corporation) operating system. This test may be run on simulation or production systems depending upon facility status. On production systems, DCS outages will occur nine times throughout performance of the test. These outages are expected to last about 10 minutes each.

Process control plan for 242-A Evaporator Campaign 95-1

Energy Technology Data Exchange (ETDEWEB)

Le, E.Q.; Guthrie, M.D.

1995-05-18

The wastes from tanks 106-AP, 107-AP, and 106-AW have been selected to be candidate feed wastes for Evaporator Campaign 95-1. The wastes in tank 106-AP and 107-AP are primarily from B-Plant strontium processing and PUREX neutralized cladding removal, respectively. The waste in tank 106-AW originated primarily from the partially concentrated product from 242-A Evaporator Campaign 94-2. Approximately 8.67 million liters of waste from these tanks will be transferred to tank 102-AW during the campaign. Tank 102-AW is the dedicated waste feed tank for the evaporator and currently contains 647,000 liters of processable waste. The purpose of the 242-A Evaporator Campaign 95-1 Process Control Plan (hereafter referred to as PCP) is to certify that the wastes in tanks 106-AP, 107-AP, 102-AW, and 106-AW are acceptable for processing through evaporator and provide a general description of process strategies and activities which will take place during Campaign 95-1. The PCP also summarizes and presents a comprehensive characterization of the wastes in these tanks.

242A Distributed Control System Year 2000 Acceptance Test Report

International Nuclear Information System (INIS)

TEATS, M.C.

1999-01-01

This report documents acceptance test results for the 242-A Evaporator distributive control system upgrade to D/3 version 9.0-2 for year 2000 compliance. This report documents the test results obtained by acceptance testing as directed by procedure HNF-2695. This verification procedure will document the initial testing and evaluation of the potential 242-A Distributed Control System (DCS) operating difficulties across the year 2000 boundary and the calendar adjustments needed for the leap year. Baseline system performance data will be recorded using current, as-is operating system software. Data will also be collected for operating system software that has been modified to correct year 2000 problems. This verification procedure is intended to be generic such that it may be performed on any D/3(trademark) (GSE Process Solutions, Inc.) distributed control system that runs with the VMSTM (Digital Equipment Corporation) operating system. This test may be run on simulation or production systems depending upon facility status. On production systems, DCS outages will occur nine times throughout performance of the test. These outages are expected to last about 10 minutes each

Process control plan for 242-A Evaporator Campaign 95-1

International Nuclear Information System (INIS)

Le, E.Q.; Guthrie, M.D.

1995-01-01

The wastes from tanks 106-AP, 107-AP, and 106-AW have been selected to be candidate feed wastes for Evaporator Campaign 95-1. The wastes in tank 106-AP and 107-AP are primarily from B-Plant strontium processing and PUREX neutralized cladding removal, respectively. The waste in tank 106-AW originated primarily from the partially concentrated product from 242-A Evaporator Campaign 94-2. Approximately 8.67 million liters of waste from these tanks will be transferred to tank 102-AW during the campaign. Tank 102-AW is the dedicated waste feed tank for the evaporator and currently contains 647,000 liters of processable waste. The purpose of the 242-A Evaporator Campaign 95-1 Process Control Plan (hereafter referred to as PCP) is to certify that the wastes in tanks 106-AP, 107-AP, 102-AW, and 106-AW are acceptable for processing through evaporator and provide a general description of process strategies and activities which will take place during Campaign 95-1. The PCP also summarizes and presents a comprehensive characterization of the wastes in these tanks

Hanford facility dangerous waste permit application, 242-A evaporator

International Nuclear Information System (INIS)

Engelmann, R.H.

1997-01-01

The Hanford Facility Dangerous Waste Permit Application is considered to be a single application organized into a General Information Portion (document number DOE/RL-91-28) and a Unit-Specific Portion. The scope of the Unit-Specific Portion is limited to Part B permit application documentation submitted for individual, 'operating' treatment, storage, and/or disposal units, such as the 242-A Evaporator (this document, DOE/RL-90-42)

Combined detection of preoperative serum CEA, CA19-9 and CA242 improve prognostic prediction of surgically treated colorectal cancer patients.

Science.gov (United States)

Wang, Jingtao; Wang, Xiao; Yu, Fudong; Chen, Jian; Zhao, Senlin; Zhang, Dongyuan; Yu, Yang; Liu, Xisheng; Tang, Huamei; Peng, Zhihai

2015-01-01

We assessed the prognostic significance of preoperative serum carcinoembryonic antigen (CEA), carbohydrate antigen 19-9 (CA19-9) and carbohydrate antigen 242 (CA242) levels in surgically treated colorectal cancer patients. The relationship of preoperative serum CEA, CA19-9 and CA242 levels with disease characteristics was investigated in 310 patients. Correlation between tumor markers was investigated using Pearson correlation test. Univariate and multivariate survival analyses were used to study the relationship between preoperative tumor markers and prognosis [disease free survival (DFS) and overall survival (OS)]. Kaplan-Meier analysis with log rank test was used to assess the impact of tumor marker levels on survival. Positive rate of preoperative serum CEA, CA19-9 and CA242 were 54.84%, 47.42% and 37.10%, respectively. High preoperative CEA level was associated with tumor size (P = 0.038), T stage (P tumor AJCC stage (P = 0.023). Preoperative CA242 positively correlated with CEA (P markers was of independent prognostic value in CRC (HR = 2.532, 95% CI: 1.400-4.579, P = 0.002 for OS; and HR = 2.366, 95% CI: 1.334-4.196, P = 0.003 for DFS). Combined detection of preoperative serum CEA, CA19-9 and CA242 is of independent prognostic value for management of CRC patients treated surgically.

Flurbiprofen benzyl nitrate (NBS-242 inhibits the growth of A-431 human epidermoid carcinoma cells and targets ß-catenin

Directory of Open Access Journals (Sweden)

Nath N

2013-05-01

Full Text Available Niharika Nath,1,2 Xiaoping Liu,3 Lloydine Jacobs,1 Khosrow Kashfi1,3 1Department of Physiology, Pharmacology, and Neuroscience, Sophie Davis School of Biomedical Education, City University of New York Medical School, New York, NY, USA; 2Department of Life Sciences, New York Institute of Technology, New York, NY, USA; 3Division of Cancer Prevention, Department of Medicine, Stony Brook University, Stony Brook, NY, USA Background: The Wnt/ß-catenin/T cell factor (TCF signaling pathway is important in the development of nonmelanoma skin cancers (NMSCs. Nitric-oxide-releasing nonsteroidal anti-inflammatory drugs (NO-NSAIDs are chemopreventive agents consisting of a traditional NSAID attached to an NO-releasing moiety through a chemical spacer. Previously we showed that an aromatic spacer enhanced the potency of a particular NO-NSAID compared to an aliphatic spacer. Methods: We synthesized an NO-releasing NSAID with an aromatic spacer (flurbiprofen benzyl nitrate, NBS-242, and using the human skin cancer cell line A-431, we evaluated its effects on cell kinetics, Wnt/ß-catenin, cyclin D1, and caspase-3. Results: NBS-242 inhibited the growth of A-431 cancer cells, being ~15-fold more potent than flurbiprofen and up to 5-fold more potent than NO-flurbiprofen with an aliphatic spacer, the half maximal inhibitory concentrations (IC50 for growth inhibition being 60 ± 4 µM, 320 ± 20 µM, and 880 ± 65 µM for NBS-242, NO-flurbiprofen, and flurbiprofen, respectively. This effect was associated with inhibition of proliferation, accumulation of cells in the G0/G1 phase of the cell cycle, and an increase in apoptotic cell population. NBS-242 cleaved ß-catenin both in the cytoplasm and the nucleus of A-431 cells. NBS-242 activated caspase-3 whose activation was reflected in the cleavage of procaspase-3. To test the functional consequence of ß-catenin cleavage, we determined the expression of cyclin D1, a Wnt-response gene. NBS-242 reduced cyclin D1 levels

Determination of the fast-neutron-induced fission cross-section of 242Pu at nELBE

Science.gov (United States)

Kögler, Toni; Beyer, Roland; Junghans, Arnd R.; Schwengner, Ronald; Wagner, Andreas

2018-03-01

The fast-neutron-induced fission cross section of 242Pu was determined in the energy range of 0.5 MeV to 10MeV at the neutron time-of-flight facility nELBE. Using a parallel-plate fission ionization chamber this quantity was measured relative to 235U(n,f). The number of target nuclei was thereby calculated by means of measuring the spontaneous fission rate of 242Pu. An MCNP 6 neutron transport simulation was used to correct the relative cross section for neutron scattering. The determined results are in good agreement with current experimental and evaluated data sets.

Thermochemical Erosion Modeling of the 25-MM M242/M791 Gun System

National Research Council Canada - National Science Library

Sopok, Samuel

1997-01-01

The MACE gun barrel thermochemical erosion modeling code addresses wall degradations due to transformations, chemical reactions, and cracking coupled with pure mechanical erosion for the 25-mm M242/M791 gun system...

Tumour associated antigen CA-50, CA-242 immunoradiometric assay (IRMA) in genitourinary malignancy and gastrointestinal carcinoma early diagnosis

International Nuclear Information System (INIS)

Chen Zhizhou.

1992-04-01

Tumour markers CA-50 and CA-242 were measured by immunometric assay (IRMA) to investigate their usefulness in the diagnosis of cancer of the pancreas, biliary tract, liver, breast, lung, gastrointestinal and genitourinary systems. The cutoff points, derived from studies on normal subjects and those with proven benign disease, were 20 u/ml and 12 u/ml for CA-50 and CA-242 respectively. Both markers were found to be generally useful with significant differences between malignant and non malignant disease. The highest positive rates, were found in cancers of the pancreas and gall bladder. The overall rate of false positives was low. It is concluded that measurements of CA-50 and CA-242 are useful in the detection of malignancy, particularly of the pancreas and biliary tract. 2 figs, 2 tabs

Determination of the fast-neutron-induced fission cross-section of 242Pu at nELBE

Directory of Open Access Journals (Sweden)

Kögler Toni

2018-01-01

Full Text Available The fast-neutron-induced fission cross section of 242Pu was determined in the energy range of 0.5 MeV to 10MeV at the neutron time-of-flight facility nELBE. Using a parallel-plate fission ionization chamber this quantity was measured relative to 235U(n,f. The number of target nuclei was thereby calculated by means of measuring the spontaneous fission rate of 242Pu. An MCNP 6 neutron transport simulation was used to correct the relative cross section for neutron scattering. The determined results are in good agreement with current experimental and evaluated data sets.

Estimation of 242Cm neutron cross sections for total file creation

International Nuclear Information System (INIS)

Bakhanovich, L.A.; Klepatskij, A.B.; Maslov, V.M.; Porodzinskij, Yu.V.; Sukhovitskij, E.Sh.

1989-01-01

Description of evaluation of 242 Cm neutron cross sections in 10 -5 eV-20 MeV energy range is given. Due to the lack of experimental data the evaluation is largely based on the application of theoretical models and systematics. The data obtained are compared to evaluations by other authors. 10 refs.; 2 figs.; 2 tabs

Project C-018H, 242-A Evaporator/PUREX Plant Process Condensate Treatment Facility, functional design criteria. Revision 3

International Nuclear Information System (INIS)

Sullivan, N.

1995-01-01

This document provides the Functional Design Criteria (FDC) for Project C-018H, the 242-A Evaporator and Plutonium-Uranium Extraction (PUREX) Plant Condensate Treatment Facility (Also referred to as the 200 Area Effluent Treatment Facility [ETF]). The project will provide the facilities to treat and dispose of the 242-A Evaporator process condensate (PC), the Plutonium-Uranium Extraction (PUREX) Plant process condensate (PDD), and the PUREX Plant ammonia scrubber distillate (ASD)

Functional design criteria for the 242-A evaporator and PUREX [Plutonium-Uranium Extraction] Plant condensate interim retention basin

International Nuclear Information System (INIS)

Cejka, C.C.

1990-01-01

This document contains the functional design criteria for a 26- million-gallon retention basin and 10 million gallons of temporary storage tanks. The basin and tanks will be used to store 242-A Evaporator process condensate, the Plutonium-Uranium Extraction (PUREX) Plant process distillate discharge stream, and the PUREX Plant ammonia scrubber distillate stream. Completion of the project will allow both the 242-A Evaporator and the PUREX Plant to restart. 4 refs

Determination of transfer coefficient between oyster mushrooms and cultivating medium using 242Pu and 241Am tracers

International Nuclear Information System (INIS)

Galanda, D.; Matel, L.

2003-01-01

The present work is devoted to an estimation of the transfer coefficient between reared oyster mushrooms and their support die, which was injected with known activity of Am-241 and Pu-242. After 2 months when we get the reared mushrooms of cane oyster mushrooms were dried and prepared by liquid extraction with Aliquat 336. The samples were measured by α-spectrometry. The results of activity Am-241 and Pu-242 in the mushrooms body and residual activity in the support were detected and calculated. (authors)

Sequence and batch language programs and alarm related C Programs for the 242-A MCS

International Nuclear Information System (INIS)

Berger, J.F.

1996-01-01

A Distributive Process Control system was purchased by Project B-534, 242-A Evaporator/Crystallizer Upgrades. This control system, called the Monitor and Control system (MCS), was installed in the 242-A evaporator located in the 200 East Area. The purpose of the MCS is to monitor and control the Evaporator and monitor a number of alarms and other signals from various Tank Farm facilities. Applications software for the MCS was developed by the Waste Treatment Systems Engineering (WTSE) group of Westinghouse. The standard displays and alarm scheme provide for control and monitoring, but do not directly indicate the signal location or depict the overall process. To do this, WTSE developed a second alarm scheme

The value of combined tumor markers of CEA, CA19-9 and CA242 for diagnosis of patients with colorectal cancer

International Nuclear Information System (INIS)

Hu Hongyong; Tang Jianlin; Li Yuying; Gao Liuyan; Tang Xiuping

2010-01-01

Objective: To explore the clinical value of serum tumor markers carcinoembryonic antigen (CEA), carbohydrate antigen 19-9 (CA19-9) and carbohydrate antigen 242 (CA242) levels in patients with colorectal cancer using single item and multi-items determination. Methods: Serum levels of CEA, CA19-9 and CA242 were measured with chemiuminescent immunoassay (CLIA) and radioimmunoassay (RIA) in 89 cases of colorectal cancer patients and 50 cases of normal people. Results: The serum levels of this three tumor markers were significantly higher than those in the control group (t=3.97, 3.55 and 7.44, P 2 =30.552, 32.076, 18.365, 7.130 and 8.862, P<0.01). Combined determination of those three could enhance the sensitivity (85.39%) and accuracy (90.60%), but the specificity was decreased (88.00%). Conclusion: Determination of serum CEA, CA19-9 and CA242 levels are valuable for the diagnosis and evaluation of patients with colorectal cancer, and the diagnosis sensitivity can be enhanced with combined determinations. (authors)

Changes in the expression of serum markers CA242, CA199, CA125, CEA, TNF-α and TSGF after cryosurgery in pancreatic cancer patients.

Science.gov (United States)

Zhou, Gang; Niu, Lizhi; Chiu, David; He, Lihua; Xu, Kecheng

2012-07-01

The presence of serum tumor markers, carbohydrate antigen 242 (CA242), carbohydrate antigen 199 (CA199), carbohydrate antigen 125 (CA125), carcinoembryonic antigen (CEA), tumor-supplied group of factors (TSGF) and tumor necrosis factor-α (TNF-α), is closely associated with invasion and metastasis of many malignancies. The expression of these markers were measured in serum taken from 37 pancreatic cancer patients prior to treatment. Levels of CA242, CA199, CA125, CEA and TNF-α expression correlated with tumor size, clinical stage, tumor differentiation, lymph node and liver metastasis (P markers were significantly reduced compared with levels prior to cryosurgery (P 0.05). Thus, cryosurgery is more effective than chemotherapy for decreasing CA242, CA199, CA125, CEA, TSGF and TNF-α serum levels in these patients.

242Pu: Preliminary evaluation with consideration of 240Pu, and some sensitivity results

International Nuclear Information System (INIS)

Jary, J.; Lagrange, C.; Philis, C.

1978-01-01

A preliminary evaluation of 242 Pu nuclear data is presented for the neutron energy range from 10 keV to 20 MeV. The fission cross section is based upon recent experimental measurements on 242 Pu. The remaining cross sections have been calculated using various nuclear models with parameters obtained mainly by both fits on 240 Pu experimental data and general reflexions on the actinides. Particular care has been taken of the direct interactions. The laws of secondary neutron energy spectra and the average number of neutrons produced per fission have been evaluated. The results have been placed in ENDF/BIV format and combined with the low energy region of ENDF/BIV MAT = 1161 data to make complete the evaluation over the whole energy range 10 -5 eV - 20 MeV. Finally, the sensitivities of some of these nuclear data available for reactor calculations are given in terms of the variation of the calculated critical masses

Restart oversight assessment of Hanford 242-A evaporator: Technical report

International Nuclear Information System (INIS)

Lagdon, R.; Lasky, R.

1994-08-01

An assessment team from the Office of Environment, Safety and Health (EH), US Department of Energy (DOE), conducted an independent assessment of the 242-A Evaporator at the Hanford Site during January 17--28, 1994. An EH team member remained on-site following the assessment to track corrective actions and resolve prestart findings. The primary objective of this assessment was independent assurance that the DOE Office of Environmental Management (EM), the DOE Richland Operations Office (DOE-RL), and Westinghouse Hanford Company (WHC) can safely restart the evaporator. Another objective of the EH team was to assess EM's Operational Readiness Evaluation (ORE) to determine if the programs, procedures, and management systems implemented for operation of the 241-A Evaporator ensure the protection of worker safety and health. The following section of this report provides background information on the 242-A Evaporator and Operational Readiness Review (ORR) activities conducted to date. The next chapter is divided into sections that address the results of discrete assessment activities. Each section includes a brief statement of conclusions for the functional area in question, descriptions of the review bases and methods, and a detailed discussion of the results. Concerns identified during the assessment are listed for the section to which they apply, and the specific findings upon which the concern is based can be found immediately thereafter

[Replication of Streptomyces plasmids: the DNA nucleotide sequence of plasmid pSB 24.2].

Science.gov (United States)

Bolotin, A P; Sorokin, A V; Aleksandrov, N N; Danilenko, V N; Kozlov, Iu I

1985-11-01

The nucleotide sequence of DNA in plasmid pSB 24.2, a natural deletion derivative of plasmid pSB 24.1 isolated from S. cyanogenus was studied. The plasmid amounted by its size to 3706 nucleotide pairs. The G-C composition was equal to 73 per cent. The analysis of the DNA structure in plasmid pSB 24.2 revealed the protein-encoding sequence of DNA, the continuity of which was significant for replication of the plasmid containing more than 1300 nucleotide pairs. The analysis also revealed two A-T-rich areas of DNA, the G-C composition of which was less than 55 per cent and a DNA area with a branched pin structure. The results may be of value in investigation of plasmid replication in actinomycetes and experimental cloning of DNA with this plasmid as a vector.

Use of 236Pu and 242Pu as a radiochemical tracer for estimation of Pu in bioassay samples by fission track analysis

International Nuclear Information System (INIS)

Sawant, Pramilla D.; Prabhu, Supreetha P.; Kalsi, P.C.

2008-01-01

236 Pu and 242 Pu are routinely used as radiochemical yield monitors in India for bioassay monitoring of occupational workers by alpha spectrometry. Fission Track Analysis (FTA) is also being standardized for trace level determination of Pu in bioassay samples. The present study, reports the utility of 236 Pu and 242 Pu as radiochemical tracers in estimation of Pu in bioassay samples by FTA technique. The advantages of using 236 Pu tracer in FTA over 242 Pu as well as the interference caused due to presence of 241 Pu in the bioassay samples of occupational workers handling power reactor grade Pu is discussed. (author)

Measurement of the $^{242}$Pu(n,f) reaction cross-section at the CERN n_TOF facility

CERN Document Server

AUTHOR|(CDS)2080481; Kokkoris, Michael; Vlachoudis, Vasilis

The accurate knowledge of relevant nuclear data, such as the neutron-induced fission cross sections of various plutonium isotopes and other minor actinides, is crucial for the design of advanced nuclear systems as well as the development of comprehensive theoretical models of the fission process. The $^{242}$Pu(n,f) cross section was measured at the CERN n_TOF facility taking advantage of the wide energy range and the high instantaneous flux of the neutron beam. In this work, results for the $^{242}$Pu(n,f) measurement are presented along with a detailed description of the experimental setup, Monte-Carlo simulations and the analysis procedure, and a theoretical cross section calculation performed with the EMPIRE code.

242-A Control System device logic software documentation. Revision 2

International Nuclear Information System (INIS)

Berger, J.F.

1995-01-01

A Distributive Process Control system was purchased by Project B-534. This computer-based control system, called the Monitor and Control System (MCS), was installed in the 242-A Evaporator located in the 200 East Area. The purpose of the MCS is to monitor and control the Evaporator and Monitor a number of alarms and other signals from various Tank Farm facilities. Applications software for the MCS was developed by the Waste Treatment System Engineering Group of Westinghouse. This document describes the Device Logic for this system

Applicative Value of Serum CA19-9, CEA, CA125 and CA242 in Diagnosis and Prognosis for Patients with Pancreatic Cancer Treated by Concurrent Chemoradiotherapy.

Science.gov (United States)

Gu, Yu-Lei; Lan, Chao; Pei, Hui; Yang, Shuang-Ning; Liu, Yan-Fen; Xiao, Li-Li

2015-01-01

To evaluate the application value of serum CA19-9, CEA, CA125 and CA242 in diagnosis and prognosis of pancreatic cancer cases treated with concurrent chemotherapy. 52 patients with pancreatic cancer, 40 with benign pancreatic diseases and 40 healthy people were selected. The electrochemiluminescence immunoassay method was used for detecting levels of CA19-9, CEA and CA125, and a CanAg CA242 enzyme linked immunoassay kit for assessing the level of CA242. The Kaplan-Meier method was used for analyzing the prognostic factors of patients with pancreatic cancer. The Cox proportional hazard model was applied for analyzing the hazard ratio (HR) and 95% confidential interval (CI) for survival time of patients with pancreatic cancer. The levels of serum CA19-9, CEA, CA125 and CA242 in patients with pancreatic cancer were significantly higher than those in patients with benign pancreatic diseases and healthy people (PCEA. The specificity of CA242 is the highest, followed by CA125, CEA and CA19-9. The sensitivity and specificity of joint detection of serum CA19-9, CEA, CA125and CA242 were 90.4% and 93.8%, obviously higher than single detection of those markers in diagnosis of pancreatic cancer. The median survival time of 52 patients with pancreatic cancer was 10 months (95% CI7.389~12.611).. Patients with the increasing level of serum CA19-9, CEA, CA125, CA242 had shorter survival times (P=0.047. 0.043, 0.0041, 0.029). COX regression analysis showed that CA19-9 was an independent prognostic factor for patients with pancreatic cancer (P=0.001, 95%CI 2.591~38.243). The detection of serum tumor markers (CA19.9, CEA, CA125 and CA242) is conducive to the early diagnosis of pancreatic cancer and joint detection of tumor markers helps improve the diagnostic efficiency. Moreover, CA19-9 is an independent prognostic factor for patients with pancreatic cancer.

miR-24-2 controls H2AFX expression regardless of gene copy number alteration and induces apoptosis by targeting antiapoptotic gene BCL-2: a potential for therapeutic intervention.

Science.gov (United States)

Srivastava, Niloo; Manvati, Siddharth; Srivastava, Archita; Pal, Ranjana; Kalaiarasan, Ponnusamy; Chattopadhyay, Shilpi; Gochhait, Sailesh; Dua, Raina; Bamezai, Rameshwar N K

2011-04-04

New levels of gene regulation with microRNA (miR) and gene copy number alterations (CNAs) have been identified as playing a role in various cancers. We have previously reported that sporadic breast cancer tissues exhibit significant alteration in H2AX gene copy number. However, how CNA affects gene expression and what is the role of miR, miR-24-2, known to regulate H2AX expression, in the background of the change in copy number, are not known. Further, many miRs, including miR-24-2, are implicated as playing a role in cell proliferation and apoptosis, but their specific target genes and the pathways contributing to them remain unexplored. Changes in gene copy number and mRNA/miR expression were estimated using real-time polymerase chain reaction assays in two mammalian cell lines, MCF-7 and HeLa, and in a set of sporadic breast cancer tissues. In silico analysis was performed to find the putative target for miR-24-2. MCF-7 cells were transfected with precursor miR-24-2 oligonucleotides, and the gene expression levels of BRCA1, BRCA2, ATM, MDM2, TP53, CHEK2, CYT-C, BCL-2, H2AFX and P21 were examined using TaqMan gene expression assays. Apoptosis was measured by flow cytometric detection using annexin V dye. A luciferase assay was performed to confirm BCL-2 as a valid cellular target of miR-24-2. It was observed that H2AX gene expression was negatively correlated with miR-24-2 expression and not in accordance with the gene copy number status, both in cell lines and in sporadic breast tumor tissues. Further, the cells overexpressing miR-24-2 were observed to be hypersensitive to DNA damaging drugs, undergoing apoptotic cell death, suggesting the potentiating effect of mir-24-2-mediated apoptotic induction in human cancer cell lines treated with anticancer drugs. BCL-2 was identified as a novel cellular target of miR-24-2. mir-24-2 is capable of inducing apoptosis by modulating different apoptotic pathways and targeting BCL-2, an antiapoptotic gene. The study suggests

Management of nuclear materials in an R ampersand D environment at the Los Alamos National Laboratory

International Nuclear Information System (INIS)

Behrens, R.G.; Roth, S.B.; Jones, S.R.

1991-01-01

Los Alamos National Laboratory is a multidisciplinary R ampersand D organization and, as such, its nuclear materials inventory is diverse. Accordingly, major inventories of isotopes such as Pu-238, Pu-239, Pu-242, U-235, Th, tritium, and deuterium, and lesser amounts of isotopes of Am, Cm, Np and exotic isotopes such as berkelium must be managed in accordance with Department of Energy Orders and Laboratory policies. Los Alamos also acts as a national resource for many one-of-a-kind materials which are supplied to universities, industry, and other government agencies within the US and throughout the world. Management of these materials requires effective interaction and communication with many nuclear materials custodians residing in over forty technical groups as well as effective interaction with numerous outside organizations. This paper discusses the role, philosophy, and organizational structure of Nuclear Materials Management at Los Alamos and also briefly presents results of two special nuclear materials management projects: 1- Revision of Item Description Codes for use in the Los Alamos nuclear material data base and 2- The recommendation of new economic discard limits for Pu-239. 2 refs., 1 fig

Measurement of Am-242 fission yields at the Lohengrin spectrometer; improvement and Benchmarking of the semi-empirical code GEF

International Nuclear Information System (INIS)

Amouroux, Charlotte

2014-01-01

The study of fission yields has a major impact on the characterization and understanding of the fission process and is mandatory for reactor applications. While the yields are known for the major actinides (U-235, Pu-239) in the thermal neutron-induced fission, only few measurements were performed on Am-242. Moreover, the two main data libraries do not agree among each other on the light peak. Am-241 and Am-242 are nuclei of interest for the MOX-fuel reactors and for the reduction of nuclear waste radiotoxicity using transmutation reactions. Thus, a campaign of precise measurement of the fission mass yields from the reaction Am-241(2n,f) was performed at the Lohengrin mass spectrometer (ILL, France) for both the light and the heavy peak. Forty-one masses were measured. Moreover, the measurement of the isotopic fission yields on the heavy peak by gamma-ray spectrometry led to the extraction of 20 independent isotopic yields. Our measurement was also meant to determine whether there is a difference in fission yields between the Am-242 isomeric state and its ground state as it exists in fission cross sections. The experimental method used to answer this question is based on the measurement a set of fission mass yields as a function of the ratio of Am-242gs to Am-242m fission rate. Results show that the mass yields are independent of the fission rate ratio. A future experimental campaign is proposed to observe a possible influence on the isomeric yields. The theoretical models are nowadays unable to predict the fission yields with enough accuracy and therefore we have to rely on experimental data and phenomenological models. The accuracy of the predictions of the semi empirical GEF fission model predictions makes it a useful tool for evaluation. This thesis also presents the physical content and part of the development of this model. Validation of the kinetic energy distributions, isomeric yields and fission yields predictions was performed. The extension of the GEF

High-level waste storage tank farms/242-A evaporator Standards/Requirements Identification Document (S/RID)

Energy Technology Data Exchange (ETDEWEB)

1994-04-01

The High-Level Waste Storage Tank Farms/242-A Evaporator Standards/Requirements Identification Document (S/RID) is contained in multiple volumes. This document (Volume 3) presents the standards and requirements for the following sections: Safeguards and Security, Engineering Design, and Maintenance.

High-level waste storage tank farms/242-A evaporator Standards/Requirements Identification Document (S/RID)

International Nuclear Information System (INIS)

1994-04-01

The High-Level Waste Storage Tank Farms/242-A Evaporator Standards/Requirements Identification Document (S/RID) is contained in multiple volumes. This document (Volume 3) presents the standards and requirements for the following sections: Safeguards and Security, Engineering Design, and Maintenance

Application value of combined measurement of serum sTn, CA242, CA19-9 and CEA in the diagnosis of gastroenterological neoplasm

International Nuclear Information System (INIS)

Zhang Wanzhong; Chen Zhizhou; Fan Zhenfu

2007-01-01

To determine the application value of four serum tumor markers sTn, CA242, CA 19-9 and CEA in the diagnosis of gastroenterological neoplasm, the serum sTn, CA242, CA19-9 and CEA in 30 normal adult controls and 60 patients with gastroenterological neoplasm were measured by IRMA. The results showed that the serum sTn, CA242, CA19-9 and CEA levels in patients with gastric carcinoma or colorectal carcinoma were much higher than those in control group (P<0.01). The serum CEA, CA19-9 and CA242 levels in patients with colorectal carcinoma were significantly higher than those in patients with gastric carcinoma (P<0.01), but the serum sTn level in the former was markedly lower (P<0.01) than that in the latter. The sensitivity of tumor marker increased with the progress of clinical stages, with a considerably higher sensitivity for stage IV compared with stage I-II (P<0.01). The combined test of four tumor markers could be more sensitive than single test in detecting gastric carcinoma and colorectal carcinoma (P<0.05). Four tumor markers are useful for diagnosing gastroenterological neoplasm, and the combined measurement of 4 tumor markers could increase the sensitivity of detecting gastric carcinoma. (authors)

Temperature thresholds for surface blistering of platinum and stainless steel exposed to curium-242 alpha radiations

International Nuclear Information System (INIS)

McDonell, W.R.; Dillich, S.

1981-01-01

Implantation of helium in materials exposed to alpha-emitting radionuclides such as 242 Cm causes surface blistering at elevated temperatures. The temperature thresholds for such blistering are of practical importance to the selection of suitable container materials for radionuclides, and are of fundamental interest with regard to the mechanisms of helium blistering of materials in radiation environments. The purpose of this investigation was to establish temperature thresholds for surface blistering of platinum and stainless-steel container materials by post-irradiation heating of specimens exposed at room temperature to alpha particles from an external 242 Cm source. These thresholds were compared with (1) the analogous temperature thresholds for surface blistering of materials exposed to external beams of accelerator helium ions, and (2) thresholds for swelling and grain-boundary cracking of materials in which helium is generated internally by (n,α) reactions during reactor exposures

Optical and statistical model calculation of the americium 242m capture cross section

International Nuclear Information System (INIS)

Tellier, Henry.

1981-04-01

The capture cross sections of Am 242m can be deduced from resonances analysis at low energy and computed with theoretical models at high energy. In this work, a coherent set of cross sections which reproduced the experimental values of the fission cross sections is computed. These calculations were performed for an energy of the incoming neutron between 1 keV and 1 MeV

1998 interim 242-A Evaporator tank system integrity assessment report

Energy Technology Data Exchange (ETDEWEB)

Jensen, C.E.

1998-07-02

This Integrity Assessment Report (IAR) is prepared by Fluor Daniel Northwest (FDNW) under contract to Lockheed-Martin Hanford Company (LMHC) for Waste Management Hanford (WMH), the 242-A Evaporator (facility) operations contractor for Fluor Daniel Hanford, and the US Department of Energy, the system owner. The contract specifies that FDNW perform an interim (5 year) integrity assessment of the facility and prepare a written IAR in accordance with Washington Administrative Code (WAC) 173-303-640. The WAC 173-303 defines a treatment, storage, or disposal (TSD) facility tank system as the ``dangerous waste storage or treatment tank and its ancillary equipment and containment.`` This integrity assessment evaluates the two tank systems at the facility: the evaporator vessel, C-A-1 (also called the vapor-liquid separator), and the condensate collection tank, TK-C-100. This IAR evaluates the 242-A facility tank systems up to, but not including, the last valve or flanged connection inside the facility perimeter. The initial integrity assessment performed on the facility evaluated certain subsystems not directly in contact with dangerous waste, such as the steam condensate and used raw water subsystems, to provide technical information. These subsystems were not evaluated in this IAR. The last major upgrade to the facility was project B-534. The facility modifications, as a result of project B-534, were evaluated in the 1993 facility interim integrity assessment. Since that time, the following upgrades have occurred in the facility: installation of a process condensate recycle system, and installation of a package steam boiler to provide steam for the facility. The package boiler is not within the scope of the facility TSD.

1998 interim 242-A Evaporator tank system integrity assessment report

International Nuclear Information System (INIS)

Jensen, C.E.

1998-01-01

This Integrity Assessment Report (IAR) is prepared by Fluor Daniel Northwest (FDNW) under contract to Lockheed-Martin Hanford Company (LMHC) for Waste Management Hanford (WMH), the 242-A Evaporator (facility) operations contractor for Fluor Daniel Hanford, and the US Department of Energy, the system owner. The contract specifies that FDNW perform an interim (5 year) integrity assessment of the facility and prepare a written IAR in accordance with Washington Administrative Code (WAC) 173-303-640. The WAC 173-303 defines a treatment, storage, or disposal (TSD) facility tank system as the ''dangerous waste storage or treatment tank and its ancillary equipment and containment.'' This integrity assessment evaluates the two tank systems at the facility: the evaporator vessel, C-A-1 (also called the vapor-liquid separator), and the condensate collection tank, TK-C-100. This IAR evaluates the 242-A facility tank systems up to, but not including, the last valve or flanged connection inside the facility perimeter. The initial integrity assessment performed on the facility evaluated certain subsystems not directly in contact with dangerous waste, such as the steam condensate and used raw water subsystems, to provide technical information. These subsystems were not evaluated in this IAR. The last major upgrade to the facility was project B-534. The facility modifications, as a result of project B-534, were evaluated in the 1993 facility interim integrity assessment. Since that time, the following upgrades have occurred in the facility: installation of a process condensate recycle system, and installation of a package steam boiler to provide steam for the facility. The package boiler is not within the scope of the facility TSD

242-A Evaporator/Liquid Effluent Retention Facility data quality objectives

International Nuclear Information System (INIS)

Von Bargen, B.H.

1994-01-01

The purpose of data quality objectives (DQO) is to determine the most cost effective methods of gathering the essential data necessary to make decisions to support successful operation of the facility. The essential data is defined by such information as sample amount, sample location, required analyses, and how sampling and analyses are performed. Successful operation is defined as meeting the campaign objectives while operating within established requirements. This DQO document addresses that portion of the system from 242-A Evaporator candidate feed tanks through discharge of process condensate to the Liquid Effluent Retention of Facility (LERF). Later revisions will incorporate and integrate the entire system, including the Effluent Treatment Facility (ETF)

242-A Evaporator/Liquid Effluent Retention Facility data quality objectives

Energy Technology Data Exchange (ETDEWEB)

Von Bargen, B.H.

1994-09-29

The purpose of data quality objectives (DQO) is to determine the most cost effective methods of gathering the essential data necessary to make decisions to support successful operation of the facility. The essential data is defined by such information as sample amount, sample location, required analyses, and how sampling and analyses are performed. Successful operation is defined as meeting the campaign objectives while operating within established requirements. This DQO document addresses that portion of the system from 242-A Evaporator candidate feed tanks through discharge of process condensate to the Liquid Effluent Retention of Facility (LERF). Later revisions will incorporate and integrate the entire system, including the Effluent Treatment Facility (ETF).

High-level waste storage tank farms/242-A evaporator Standards/Requirements Identification Document (S/RID), Volume 4

Energy Technology Data Exchange (ETDEWEB)

1994-04-01

The High-Level Waste Storage Tank Farms/242-A Evaporator Standards/Requirements Identification Document (S/RID) is contained in multiple volumes. This document (Volume 4) presents the standards and requirements for the following sections: Radiation Protection and Operations.

High-level waste storage tank farms/242-A evaporator Standards/Requirements Identification Document (S/RID), Volume 4

International Nuclear Information System (INIS)

1994-04-01

The High-Level Waste Storage Tank Farms/242-A Evaporator Standards/Requirements Identification Document (S/RID) is contained in multiple volumes. This document (Volume 4) presents the standards and requirements for the following sections: Radiation Protection and Operations

High-level waste storage tank farms/242-A evaporator Standards/Requirements Identification Document (S/RID), Volume 5

International Nuclear Information System (INIS)

1994-04-01

The High-Level Waste Storage Tank Farms/242-A Evaporator Standards/Requirements Identification Document (S/RID) is contained in multiple volumes. This document (Volume 5) outlines the standards and requirements for the Fire Protection and Packaging and Transportation sections

Possibility of obtaining enriched americium-242g by the elution of recoil atoms from zeolite

Energy Technology Data Exchange (ETDEWEB)

Shafiev, A I; Vityutnev, V M; Ivanov, V M; Yakovlev, G N

1974-12-31

On the example of production the possibility of obtaining enriched actinide isotopes by the elution of recotl atoms with the use of a zeolite- americium-241 target was shown. The enrichment factor and the recoil atoms of / sup 242g/Am yield depend on preliminary target treatment and solution composition used for elution. (auth)

Diagnostic value of combined determination of serum tumor markers (NSE, CA-242, TPA, CEA) levels in patients with lung cancer

International Nuclear Information System (INIS)

Liu Juzhen; Cai Tietie; Qin Shana

2007-01-01

Objective: To investigate the diagnostic value of combined determination of serum NSE, CA242, tissue polypeptide antigen (TPA) and CEA levels in patients with primary lung cancer. Methods: Serum NSE, CA242, TPA and CEA levels were determined with ELISA in (1) 102 patients with various types of primary lung carcinoma (adenocarcinoma 38, squamous cell carcinoma 32, small cell lung carcinoma 32) (2) 33 patients with open lung T. B. and (3) 30 controls. Results: (1) In patients with lung cancer, serum levels of all the four markers were increased and significantly higher than their respective values in patients with open lung T.B. and controls. (2) Positive rate of combined any two markers were 75% for adenocarcinoma, 50% for squamous cell carcinoma and 65% for small cell lung carcinoma, while false positive rate was only 9% for T.B patients and none for the controls. (3) The most appropriate single marker for each specific type of lung cancer was: NSE for SCLC (sensitivity 72%, specificity 97%, CA242 for adenocarcinoma sensitivity 62%, specificity 90%). Conclusion: Combined determination of these tumor markers would improve the sensitivity and specificity for diagnosis of primary lung carcinoma. (authors)

TAK-242, a small-molecule inhibitor of Toll-like receptor 4 signalling, unveils similarities and differences in lipopolysaccharide- and lipidinduced inflammation and insulin resistance in muscle cells

Science.gov (United States)

Hussey, Sophie E.; Liang, Hanyu; Costford, Sheila R.; Klip, Amira; DeFronzo, Ralph A.; Sanchez-Avila, Alicia; Ely, Brian; Musi, Nicolas

2012-01-01

Emerging evidence suggests that TLR (Toll-like receptor) 4 and downstream pathways [MAPKs (mitogen-activated protein kinases) and NF-κB (nuclear factor κB)] play an important role in the pathogenesis of insulin resistance. LPS (lipopolysaccharide) and saturated NEFA (non-esterified fatty acids) activate TLR4, and plasma concentrations of these TLR4 ligands are elevated in obesity and Type 2 diabetes. Our goals were to define the role of TLR4 on the insulin resistance caused by LPS and saturated NEFA, and to dissect the independent contribution of LPS and NEFA to the activation of TLR4-driven pathways by employing TAK-242, a specific inhibitor of TLR4. LPS caused robust activation of the MAPK and NF-κB pathways in L6 myotubes, along with impaired insulin signalling and glucose transport. TAK-242 completely prevented the inflammatory response (MAPK and NF-κB activation) caused by LPS, and, in turn, improved LPS-induced insulin resistance. Similar to LPS, stearate strongly activated MAPKs, although stimulation of the NF-κB axis was modest. As seen with LPS, the inflammatory response caused by stearate was accompanied by impaired insulin action. TAK-242 also blunted stearate-induced inflammation; yet, the protective effect conferred by TAK-242 was partial and observed only on MAPKs. Consequently, the insulin resistance caused by stearate was only partially improved by TAK-242. In summary, TAK-242 provides complete and partial protection against LPS- and NEFA-induced inflammation and insulin resistance, respectively. Thus, LPS-induced insulin resistance depends entirely on TLR4, whereas NEFA works through TLR4-dependent and -independent mechanisms to impair insulin action. PMID:23050932

17 CFR 242.603 - Distribution, consolidation, and display of information with respect to quotations for and...

Science.gov (United States)

2010-04-01

..., and display of information with respect to quotations for and transactions in NMS stocks. 242.603... with respect to quotations for and transactions in NMS stocks. (a) Distribution of information. (1) Any... source, that distributes information with respect to quotations for or transactions in an NMS stock to a...

Yields of correlated fragment pairs and neutron multiplicity in spontaneous fission of {sup 242}Pu

Energy Technology Data Exchange (ETDEWEB)

Veselsky, M.; Kliman, J.; Morhaccaron, M. [Institute of Physics of Slovak Academy of Sciences, Dubravska 9, 84228 Bratislava (Slovakia); Ramayya, A.V.; Kormicki, J.; Daniel, A.V. [Physics Department, Vanderbilt University, Nashville (United States)] Rasmussen, J.O. [Lawrence Berkeley National Laboratory, Berkeley (United States)] Stoyer, M.A. [Lawrence Livermore National Laboratory, Livermore (United States); Daniel, A.V.; Popeko, G.S.; Oganessian, Yu. Ts. [Joint Institute for Nuclear Research, Dubna (Russia)] Greiner, W. [Institut fur Theoretische Physik, J. W. Goethe Universitaet, Frankfurt a. M. (Germany); Aryaeinejad, R. [Idaho National Engineering Laboratory, Idaho Falls (United States)

1998-10-01

Yields of correlated fragment pairs were obtained in spontaneous fission of {sup 242}Pu. Charge, mass and neutron multiplicity distributions of fragment pairs were determined and compared to available data. The yield of cold fission without neutron emission was determined to about 10{percent} for the set of observed correlated fragment pairs. {copyright} {ital 1998 American Institute of Physics.}

TAK-242, a small-molecule inhibitor of Toll-like receptor 4 signalling, unveils similarities and differences in lipopolysaccharide- and lipid-induced inflammation and insulin resistance in muscle cells.

Science.gov (United States)

Hussey, Sophie E; Liang, Hanyu; Costford, Sheila R; Klip, Amira; DeFronzo, Ralph A; Sanchez-Avila, Alicia; Ely, Brian; Musi, Nicolas

2012-11-30

Emerging evidence suggests that TLR (Toll-like receptor) 4 and downstream pathways [MAPKs (mitogen-activated protein kinases) and NF-κB (nuclear factor κB)] play an important role in the pathogenesis of insulin resistance. LPS (lipopolysaccharide) and saturated NEFA (non-esterified fatty acids) activate TLR4, and plasma concentrations of these TLR4 ligands are elevated in obesity and Type 2 diabetes. Our goals were to define the role of TLR4 on the insulin resistance caused by LPS and saturated NEFA, and to dissect the independent contribution of LPS and NEFA to the activation of TLR4-driven pathways by employing TAK-242, a specific inhibitor of TLR4. LPS caused robust activation of the MAPK and NF-κB pathways in L6 myotubes, along with impaired insulin signalling and glucose transport. TAK-242 completely prevented the inflammatory response (MAPK and NF-κB activation) caused by LPS, and, in turn, improved LPS-induced insulin resistance. Similar to LPS, stearate strongly activated MAPKs, although stimulation of the NF-κB axis was modest. As seen with LPS, the inflammatory response caused by stearate was accompanied by impaired insulin action. TAK-242 also blunted stearate-induced inflammation; yet, the protective effect conferred by TAK-242 was partial and observed only on MAPKs. Consequently, the insulin resistance caused by stearate was only partially improved by TAK-242. In summary, TAK-242 provides complete and partial protection against LPS- and NEFA-induced inflammation and insulin resistance, respectively. Thus, LPS-induced insulin resistance depends entirely on TLR4, whereas NEFA works through TLR4-dependent and -independent mechanisms to impair insulin action.

High-level waste storage tank farms/242-A evaporator Standards/Requirements Identification Document (S/RID), Volume 2

International Nuclear Information System (INIS)

1994-04-01

The High-Level Waste Storage Tank Farms/242-A Evaporator Standards/Requirements Document (S/RID) is contained in multiple volumes. This document (Volume 2) presents the standards and requirements for the following sections: Quality Assurance, Training and Qualification, Emergency Planning and Preparedness, and Construction

High-level waste storage tank farms/242-A evaporator Standards/Requirements Identification Document (S/RID), Volume 2

Energy Technology Data Exchange (ETDEWEB)

1994-04-01

The High-Level Waste Storage Tank Farms/242-A Evaporator Standards/Requirements Document (S/RID) is contained in multiple volumes. This document (Volume 2) presents the standards and requirements for the following sections: Quality Assurance, Training and Qualification, Emergency Planning and Preparedness, and Construction.

Extractability of plutonium-238 and curium-242 from a contaminated soil as a function of pH and certain soil components. CH3COOH-NH4OH system

International Nuclear Information System (INIS)

Nishita, H.

1978-01-01

Extractability of 238 Pu and 242 Cm from an artificially contaminated soil as a function of pH and certain soil components was examined with an equilibrium batch technique by the use of a CH 3 COOH--NH 4 OH extracting system. The influence of various soil components on 238 Pu and 242 Cm extractability was determined indirectly by selective removal of the components from the soil. The soil organic matter appeared to have a major influence on the extractability of these radionuclides. Though to a lesser extent, free iron oxides exerted an influence also. Before removal of soil organic matter, the extractability curves for these radionuclides were qualitatively similar in general form. The nature of this form is discussed. Within the contaminated, untreated soil, the 238 Pu and 242 Cm extractability ranged from 0.60 to 30.8% and 0.11 to 14.83% of dose, respectively, depending on the pH of the extracting solution. The liquid-to soild-phase ratio (K'/sub d/) values ranged from 3.5 x 10 -4 to 2.7 x 10 -2 for 238 Pu and 0.9 x 10 -4 to 1.4 x 10 -2 for 242 Cm. Very low extractability occurred in the pH range from approx. 8.6 to approx. 9.7 for 238 Pu and from 7.6 to approx. 9.7 for 242 Cm

25 CFR 1000.242 - What provisions relating to a construction program may be included in an AFA?

Science.gov (United States)

2010-04-01

..., DEPARTMENT OF THE INTERIOR ANNUAL FUNDING AGREEMENTS UNDER THE TRIBAL SELF-GOVERNMENT ACT AMENDMENTS TO THE INDIAN SELF-DETERMINATION AND EDUCATION ACT Construction § 1000.242 What provisions relating to a... specific provisions of the Office of Federal Procurement and Policy Act and Federal Acquisition Regulations...

242Pu as tracer for simultaneous determination of 237Np and 239,240Pu in environmental samples

DEFF Research Database (Denmark)

Chen, Q.J.; Dahlgaard, H.; Nielsen, S.P.

2002-01-01

A procedure has been developed using Pu-242 as tracer for simultaneous determination of Np-237 and Pu-239,Pu-240 in environmental samples. The validity of the method has been demonstrated by ICPMS and alpha-spectroscopy for up to 10 gram soil and sediment, seawater up to 200 litres. The paper...... from Np and Pu) R-before/R-after = 1.004 +/- 3.3% (S.D n = 20) and 1 litre seawater R-before/R-after = 1.019+/-1.9% (S.D., n = 12). Results from the intercomparison samples LAEA-135, LAEA-381 and from environmental samples are presented....... describes a suitable chemical procedure for Np and Pu including a quantitative pre-concentration of neptunium and plutonium, preparation of Np4+ and Pu4+, NP(NO3)(6)(2-) and Pu(NO3)(6)(2-), The ratio of Np-237/Pu-242 (or Np-237/Pu-239) before and after the procedure has been determined using 10 g soil (free...

High level waste storage tank farms/242-A evaporator Standards/Requirements Identification Document (S/RID), Volume 6

Energy Technology Data Exchange (ETDEWEB)

1994-04-01

The High-Level Waste Storage Tank Farms/242-A Evaporator Standards/Requirements Identification Document (S/RID) is contained in multiple volumes. This document (Volume 6) outlines the standards and requirements for the sections on: Environmental Restoration and Waste Management, Research and Development and Experimental Activities, and Nuclear Safety.

High level waste storage tank farms/242-A evaporator Standards/Requirements Identification Document (S/RID), Volume 6

International Nuclear Information System (INIS)

1994-04-01

The High-Level Waste Storage Tank Farms/242-A Evaporator Standards/Requirements Identification Document (S/RID) is contained in multiple volumes. This document (Volume 6) outlines the standards and requirements for the sections on: Environmental Restoration and Waste Management, Research and Development and Experimental Activities, and Nuclear Safety

High-level waste storage tank farms/242-A evaporator Standards/Requirements Identification Document (S/RID), Volume 7. Revision 1

Energy Technology Data Exchange (ETDEWEB)

Burt, D.L.

1994-04-01

The High-Level Waste Storage Tank Farms/242-A Evaporator Standards/Requirements Identification Document (S/RID) is contained in multiple volumes. This document (Volume 7) presents the standards and requirements for the following sections: Occupational Safety and Health, and Environmental Protection.

High-level waste storage tank farms/242-A evaporator Standards/Requirements Identification Document (S/RID), Volume 7. Revision 1

International Nuclear Information System (INIS)

Burt, D.L.

1994-04-01

The High-Level Waste Storage Tank Farms/242-A Evaporator Standards/Requirements Identification Document (S/RID) is contained in multiple volumes. This document (Volume 7) presents the standards and requirements for the following sections: Occupational Safety and Health, and Environmental Protection

High-level waste storage tank farms/242-A evaporator standards/requirements identification document (S/RID), Vol. 4

Energy Technology Data Exchange (ETDEWEB)

1994-04-01

Radiation protection of personnel and the public is accomplished by establishing a well defined Radiation Protection Organization to ensure that appropriate controls on radioactive materials and radiation sources are implemented and documented. This Requirements Identification Document (RID) applies to the activities, personnel, structures, systems, components, and programs involved in executing the mission of the Tank Farms. The physical boundaries within which the requirements of this RID apply are the Single Shell Tank Farms, Double Shell Tank Farms, 242-A Evaporator-Crystallizer, 242-S, T Evaporators, Liquid Effluent Retention Facility (LERF), Purgewater Storage Facility (PWSF), and all interconnecting piping, valves, instrumentation, and controls. Also included is all piping, valves, instrumentation, and controls up to and including the most remote valve under Tank Farms control at any other Hanford Facility having an interconnection with Tank Farms. The boundary of the structures, systems, components, and programs to which this RID applies, is defined by those that are dedicated to and/or under the control of the Tank Farms Operations Department and are specifically implemented at the Tank Farms.

High-level waste storage tank farms/242-A evaporator standards/requirements identification document (S/RID), Vol. 4

International Nuclear Information System (INIS)

1994-04-01

Radiation protection of personnel and the public is accomplished by establishing a well defined Radiation Protection Organization to ensure that appropriate controls on radioactive materials and radiation sources are implemented and documented. This Requirements Identification Document (RID) applies to the activities, personnel, structures, systems, components, and programs involved in executing the mission of the Tank Farms. The physical boundaries within which the requirements of this RID apply are the Single Shell Tank Farms, Double Shell Tank Farms, 242-A Evaporator-Crystallizer, 242-S, T Evaporators, Liquid Effluent Retention Facility (LERF), Purgewater Storage Facility (PWSF), and all interconnecting piping, valves, instrumentation, and controls. Also included is all piping, valves, instrumentation, and controls up to and including the most remote valve under Tank Farms control at any other Hanford Facility having an interconnection with Tank Farms. The boundary of the structures, systems, components, and programs to which this RID applies, is defined by those that are dedicated to and/or under the control of the Tank Farms Operations Department and are specifically implemented at the Tank Farms

A 233U/236U/242Pu/244Pu spike for isotopic and isotope dilution analysis by mass spectrometry with internal calibration

International Nuclear Information System (INIS)

Stepanov, A.; Belyaev, B.; Buljanitsa, L.

1989-11-01

The Khlopin Radium Institute prepared on behalf of the IAEA a synthetic mixture of 233 U, 236 U, 242 Pu and 244 Pu isotopes. The isotopic composition and elemental concentration of uranium and plutonium were certified on the basis of analyses done by four laboratories of the IAEA Network, using mass spectrometry with internal standardization. The certified values for 233 U/ 236 U ratio and the 236 U chemical concentration have a coefficient of variation of 0.05%. The latter is fixed by the uncertainty in the 235 U/ 238 U ratio of NBS500 used as internal standard. The coefficients of variation of the 244 Pu/ 242 Pu ratio and the 242 Pu chemical concentration are respectively 0.10% and 0.16% and limited by the uncertainty in the 240 Pu/ 239 Pu ratio of NBS947. This four isotope mixture was used as an internal standard as well as a spike, to analyze 30 batches of LWR spent fuel solutions. The repeatability of the mass spectrometric measurements have a coefficient of variation of 0.025% for the uranium concentration, and of 0.039% for the plutonium concentration. The spiking and treatment errors had a coefficient of variation of 0.048%. (author). Refs, figs and tabs

Determination of isotope fractionation effect using a double spike (242Pu+240Pu) during the mass spectrometric analysis of plutonium

International Nuclear Information System (INIS)

Chitambar, S.A.; Parab, A.R.; Khodade, P.S.; Jain, H.C.

1986-01-01

Isotope fractionation effect during the mass spectrometric analysis of plutonium has been investigated using a double spike ( 242 Pu+ 240 Pu) and the determination of concentration of plutonium in dissolver solution of irradiated fuel is reported. (author). 6 refs., 2 tables

Radiative neutron capture on 242Pu in the resonance region at the CERN n_TOF-EAR1 facility

Science.gov (United States)

Lerendegui-Marco, J.; Guerrero, C.; Mendoza, E.; Quesada, J. M.; Eberhardt, K.; Junghans, A. R.; Krtička, M.; Aberle, O.; Andrzejewski, J.; Audouin, L.; Bécares, V.; Bacak, M.; Balibrea, J.; Barbagallo, M.; Barros, S.; Bečvář, F.; Beinrucker, C.; Berthoumieux, E.; Billowes, J.; Bosnar, D.; Brugger, M.; Caamaño, M.; Calviño, F.; Calviani, M.; Cano-Ott, D.; Cardella, R.; Casanovas, A.; Castelluccio, D. M.; Cerutti, F.; Chen, Y. H.; Chiaveri, E.; Colonna, N.; Cortés, G.; Cortés-Giraldo, M. A.; Cosentino, L.; Damone, L. A.; Diakaki, M.; Dietz, M.; Domingo-Pardo, C.; Dressler, R.; Dupont, E.; Durán, I.; Fernández-Domínguez, B.; Ferrari, A.; Ferreira, P.; Finocchiaro, P.; Furman, V.; Göbel, K.; García, A. R.; Gawlik, A.; Glodariu, T.; Gonçalves, I. F.; González-Romero, E.; Goverdovski, A.; Griesmayer, E.; Gunsing, F.; Harada, H.; Heftrich, T.; Heinitz, S.; Heyse, J.; Jenkins, D. G.; Jericha, E.; Käppeler, F.; Kadi, Y.; Katabuchi, T.; Kavrigin, P.; Ketlerov, V.; Khryachkov, V.; Kimura, A.; Kivel, N.; Kokkoris, M.; Leal-Cidoncha, E.; Lederer, C.; Leeb, H.; Lo Meo, S.; Lonsdale, S. J.; Losito, R.; Macina, D.; Marganiec, J.; Martínez, T.; Massimi, C.; Mastinu, P.; Mastromarco, M.; Matteucci, F.; Maugeri, E. A.; Mengoni, A.; Milazzo, P. M.; Mingrone, F.; Mirea, M.; Montesano, S.; Musumarra, A.; Nolte, R.; Oprea, A.; Patronis, N.; Pavlik, A.; Perkowski, J.; Porras, J. I.; Praena, J.; Rajeev, K.; Rauscher, T.; Reifarth, R.; Riego-Perez, A.; Rout, P. C.; Rubbia, C.; Ryan, J. A.; Sabaté-Gilarte, M.; Saxena, A.; Schillebeeckx, P.; Schmidt, S.; Schumann, D.; Sedyshev, P.; Smith, A. G.; Stamatopoulos, A.; Tagliente, G.; Tain, J. L.; Tarifeño-Saldivia, A.; Tassan-Got, L.; Tsinganis, A.; Valenta, S.; Vannini, G.; Variale, V.; Vaz, P.; Ventura, A.; Vlachoudis, V.; Vlastou, R.; Wallner, A.; Warren, S.; Weigand, M.; Weiss, C.; Wolf, C.; Woods, P. J.; Wright, T.; Žugec, P.; n TOF Collaboration

2018-02-01

The spent fuel of current nuclear reactors contains fissile plutonium isotopes that can be combined with uranium to make mixed oxide (MOX) fuel. In this way the Pu from spent fuel is used in a new reactor cycle, contributing to the long-term sustainability of nuclear energy. However, an extensive use of MOX fuels, in particular in fast reactors, requires more accurate capture and fission cross sections for some Pu isotopes. In the case of 242Pu there are sizable discrepancies among the existing capture cross-section measurements included in the evaluations (all from the 1970s) resulting in an uncertainty as high as 35% in the fast energy region. Moreover, postirradiation experiments evaluated with JEFF-3.1 indicate an overestimation of 14% in the capture cross section in the fast neutron energy region. In this context, the Nuclear Energy Agency (NEA) requested an accuracy of 8% in this cross section in the energy region between 500 meV and 500 keV. This paper presents a new time-of-flight capture measurement on 242Pu carried out at n_TOF-EAR1 (CERN), focusing on the analysis and statistical properties of the resonance region, below 4 keV. The 242Pu(n ,γ ) reaction on a sample containing 95(4) mg enriched to 99.959% was measured with an array of four C6D6 detectors and applying the total energy detection technique. The high neutron energy resolution of n_TOF-EAR1 and the good statistics accumulated have allowed us to extend the resonance analysis up to 4 keV, obtaining new individual and average resonance parameters from a capture cross section featuring a systematic uncertainty of 5%, fulfilling the request of the NEA.

Measurement of the neutron-induced fission cross-section of 240,242Pu

International Nuclear Information System (INIS)

Salvador-Castineira, P.; Hambsch, F.J.; Brys, T.; Oberstedt, S.; Vidali, M.; Pretel, C.

2014-01-01

Fast spectrum neutron-induced fission cross-section data for transuranic isotopes are in high demand in the nuclear data community. In particular, highly accurate data are needed for the new Generation-IV nuclear applications. The aim is to obtain precise neutron-induced fission cross-sections for 240 Pu and 242 Pu. In this context accurate data on spontaneous fission half-lives have also been measured. To minimise the total uncertainty on the fission cross-sections the detector efficiency has been studied in detail. Both isotopes have been measured using a twin Frisch-grid ionisation chamber (TFGIC) due to its superiority compared to other detector systems in view of radiation hardness, 2 x 2π solid angle coverage and very good energy resolution. (authors)

Prenatal Diagnosis of a 2.5 Mb De Novo 17q24.1q24.2 Deletion Encompassing KPNA2 and PSMD12 Genes in a Fetus with Craniofacial Dysmorphism, Equinovarus Feet, and Syndactyly

Directory of Open Access Journals (Sweden)

Marie-Emmanuelle Naud

2017-01-01

Full Text Available Interstitial 17q24.1 or 17q24.2 deletions were reported after conventional cytogenetic analysis or chromosomal microarray analysis in patients presenting intellectual disability, facial dysmorphism, and/or malformations. We report on a fetus with craniofacial dysmorphism, talipes equinovarus, and syndactyly associated with a de novo 2.5 Mb 17q24.1q24.2 deletion. Among the deleted genes, KPNA2 and PSMD12 are discussed for the correlation with the fetal phenotype. This is the first case of prenatal diagnosis of 17q24.1q24.2 deletion.

Investigation of association between donors' and recipients' NADPH oxidase p22(phox) C242T polymorphism and acute rejection, delayed graft function and blood pressure in renal allograft recipients.

Science.gov (United States)

Mandegary, Ali; Rahmanian-Koshkaki, Sara; Mohammadifar, Mohammad-Amir; Pourgholi, Leila; Mehdipour, Mohammad; Etminan, Abbas; Ebadzadeh, Mohammad-Reza; Fazeli, Faramarz; Azmandian, Jalal

2015-01-01

Production of reactive oxygen species (ROS) and thereby induction of oxidative stress seem to be one of the major mediators of inflammatory adverse outcomes after renal transplantation. p22(phox) is a polymorphic subunit of NAD(P)H-oxidase that is critical for activation and stabilization of the enzyme. This enzyme is involved in the production of superoxide that triggers inflammatory injuries to the kidney. So in this study, the association between donors and recipients' C242T polymorphism of p22(phox) and acute rejection (AR), delayed graft function (DGF), creatinine clearance (CrCl), and blood pressure in renal-allograft recipients was studied. One hundred ninety six donor-recipient pairs were studied. The C242T polymorphism of p22(phox) was determined using polymerase chain reaction-restriction fragment length polymorphism (PCR-RFLP). According to p22 genotype, the subjects were divided in wild-type (CC) and T allele carriers (CT+TT). Transplantation outcomes were determined using acute rejection and delayed graft function criteria. The mean arterial pressure was also measured monthly after transplantation. There was a significant association between the recipients' p22(phox) polymorphism and DGF occurrence (OR=2.5, CI: 1.2-4.9, p=0.0009). No significant association was detected between donors' p22(phox) polymorphism and AR and DGF events. CrCl during the six months follow-up after transplantation was lower in the patients who received allograft from donors carrying 242T allele (B=-12.8, CI: -22.9-12.8 (-22.9 to -2.6)). Changes in the blood pressure were not different among the patients having different genotypes of p22(phox). These results suggest that the recipients' p22(phox) C242T polymorphism may be a major risk factor for DGF in renal transplantation. Moreover, the donors' 242T allele seems to affect the rate of CrCl in the renal allograft recipients. Copyright © 2014. Published by Elsevier B.V.

Operational test report for LERF Basin 242AL-44 integrity test

International Nuclear Information System (INIS)

Galioto, T.M.

1994-01-01

This operational test report documents the results of LERF operational testing per operational test procedure (OTP) TFPE-WP-0231, ''LERF Basin Integrity Testing.'' The primary purpose of the OTP was to resolve test exceptions generated as a result of TFPE-WP-0184. The TOP was prepared and performed in accordance with WHC-SD-534-OTP-002, ''Operational Test Plan for the 242-A Evaporator Upgrades and the Liquid Effluent Retention Facility.'' WHC-S-086, ''Specification for Operational Testing of the Liquid Effluent Retention Facility, Basin Integrity Testing,'' identified the test requirements and acceptance criteria. The completed, signed-off test procedure is contained in Appendix A. The test log is contained in Appendix B. Section 2.1 describes all the test exceptions written during performance of the Operational Test Procedure. The test revisions generated during the testing are discussed in Section 2.2. The dispositioned test exception forms are contained in Appendix C

Sequence and batch language programs and alarm-related ``C`` programs for the 242-A MCS. Revision 2

Energy Technology Data Exchange (ETDEWEB)

Berger, J.F.

1995-03-01

A Distributive Process Control system was purchased by Project B-534, ``242-A Evaporator/Crystallizer Upgrades``. This control system, called the Monitor and Control System (MCS), was installed in the 242-A Evaporator located in the 200 East Area. The purpose of the MCS is to monitor and control the Evaporator and monitor a number of alarms and other signals from various Tank Farm facilities. Applications software for the MCS was developed by the Waste Treatment Systems Engineering (WTSE) group of Westinghouse. The standard displays and alarm scheme provide for control and monitoring, but do not directly indicate the signal location or depict the overall process. To do this, WTSE developed a second alarm scheme which uses special programs, annunciator keys, and process graphics. The special programs are written in two languages; Sequence and Batch Language (SABL), and ``C`` language. The WTSE-developed alarm scheme works as described below: SABL relates signals and alarms to the annunciator keys, called SKID keys. When an alarm occurs, a SABL program causes a SKID key to flash, and if the alarm is of yellow or white priority then a ``C`` program turns on an audible horn (the D/3 system uses a different audible horn for the red priority alarms). The horn and flashing key draws the attention of the operator.

The synthesis and complex anion-vacancy ordered structure of La0.33Sr0.67MnO2.42

International Nuclear Information System (INIS)

Dixon, Edward; Hadermann, Joke; Hayward, Michael A.

2011-01-01

The low-temperature topotactic reduction of La 0.33 Sr 0.67 MnO 3 with NaH results in the formation of La 0.33 Sr 0.67 MnO 2.42 . A combination of neutron powder and electron diffraction data show that La 0.33 Sr 0.67 MnO 2.42 adopts a novel anion-vacancy ordered structure with a 6-layer OOTOOT' stacking sequence of the 'octahedral' and tetrahedral layers (Pcmb, a=5.5804(1) A, b=23.4104(7) A, c=11.2441(3) A). A significant concentration of anion vacancies at the anion site, which links neighbouring 'octahedral' layers means that only 25% of the 'octahedral' manganese coordination sites actually have 6-fold MnO 6 coordination, the remainder being MnO 5 square-based pyramidal sites. The chains of cooperatively twisted apex-linked MnO 4 tetrahedra adopt an ordered -L-R-L-R- arrangement within each tetrahedral layer. This is the first published example of a fully refined structure of this type which exhibits such intralayer ordering of the twisted tetrahedral chains. The rationale behind the contrasting structures of La 0.33 Sr 0.67 MnO 2.42 and other previously reported reduced La 1-x Sr x MnO 3-y phases is discussed. - Graphical Abstract: The topotactic reduction of the perovskite phase La 0.33 Sr 0.67 MnO 3 with NaH yields La 0.33 Sr 0.67 MnO 2.42(3) , which adopts a novel anion vacancy ordered structure with a 6-layer OOTOOT' stacking sequence of the 'octahedral' and tetrahedral layers. The anion site that links the neighbouring octahedral layers is partially occupied so only 25% of the 'octahedral' manganese sites actually have 6-fold MnO 6 coordination. Highlights: → Topotactic reduction with NaH to form a mixed valent Mn 2+ /Mn 3+ phase. → Novel layered anion-vacancy ordered structure. → Comparison to related brownmillerite structure types.

Association between NADPH oxidase p22(phox C242T polymorphism and ischemic cerebrovascular disease: a meta-analysis.

Directory of Open Access Journals (Sweden)

Bing-Hu Li

Full Text Available BACKGROUND: Epidemiological studies have evaluated the association between nicotinamide adenine dinucleotide phosphate (NADPH oxidase p22(phox C242T polymorphism and risk of ischemic cerebrovascular disease (ICVD, but the results remain inconclusive. This meta-analysis was therefore designed to clarify these controversies. METHODOLOGY/PRINCIPAL FINDINGS: Systematic searches of electronic databases Embase, PubMed and Web of Science, as well as hand searching of the references of identified articles and the meeting abstracts were performed. Statistical analyses were performed using software Review Manager (Version 5.1.7 and Stata (Version 11.0. The pooled odds ratios (ORs with 95% confidence intervals (95%CIs were performed. Fixed or random effects model was separately used depending on the heterogeneity between studies. Publication bias was tested by Begg's funnel plot and Egger's regression test. A total of 6 studies including 1,948 cases and 2,357 controls were combined showing no statistical evidence of association between NADPH oxidase p22(phox C242T polymorphism and overall ICVD (allelic model: OR = 1.08, 95%CI = 0.93-1.26; additive model: OR = 1.33, 95%CI = 0.81-2.17; dominant model: OR = 1.00, 95%CI = 0.86-1.15; recessive model: OR = 1.06, 95%CI = 0.77-1.45. Significant association was found in large-artery atherosclerotic stroke subgroup (allelic model: OR = 1.12, 95%CI = 0.88-1.41; additive model: OR = 1.36, 95%CI = 0.60-3.09; dominant model: OR = 1.25, 95%CI = 0.74-2.11; recessive model: OR = 2.17, 95%CI = 1.11-4.23. No statistical evidence of significant association was observed for small-vessel occlusive stroke, as well as Asian subgroup and Caucasian subgroup. Statistical powers on the combined sample size (total and subgroup were all lower than 80%. CONCLUSIONS/SIGNIFICANCE: This meta-analysis indicates that NADPH oxidase p22(phox C242T polymorphism is more associated

C242T Polymorphism in CYBA Gene (p22phox and Risk of Coronary Artery Disease in a Population of Caucasian Italians

Directory of Open Access Journals (Sweden)

Sabina Nasti

2006-01-01

Full Text Available Background: specific polymorphisms of genes regulating intracellular redox balance and oxidative stress are related to atherogenesis. Some studies have identified a relationship between progression of atherosclerosis and C242T mutation in CYBA gene coding for p22phox, a subunit of the NADH/NADPH oxidase system.

The evaluation of the mass distribution data for 238U, 239Pu and 242Pu fission

International Nuclear Information System (INIS)

Liu Tingjin

2002-01-01

The mass distribution data for 238 U at E n =1.5, 5.5, 8.3, 11.3, 14.9, 22.0, 27.5, 50.0, 99.5, 160.0 MeV, E p =20.0, 60.0 MeV 239 Pu at E n =0.17, 7.9, 14.5 MeV and 242 Pu at E n =15.1 MeV were evaluated and recommended based on the main available experimental data up to now. The experimental data were make necessary corrections and their errors were also made necessary adjustments. The problems concerned were discussed

Radiochemical studies of neutron deficient actinide isotopes

International Nuclear Information System (INIS)

Williams, K.E.

1978-04-01

The production of neutron deficient actinide isotopes in heavy ion reactions was studied using alpha, gamma, x-ray, and spontaneous fission detection systems. A new isotope of berkelium, 242 Bk, was produced with a cross-section of approximately 10 μb in reactions of boron on uranium and nitrogen on thorium. It decays by electron capture with a half-life of 7.0 +- 1.3 minutes. The alpha-branching ratio for this isotope is less than 1% and the spontaneous fission ratio is less than 0.03%. Studies of (Heavy Ion, pxn) and (Heavy Ion, αxn) transfer reactions in comparison with (Heavy ion, xn) compound nucleus reactions revealed transfer reaction cross-sections equal to or greater than the compound nucleus yields. The data show that in some cases the yield of an isotope produced via a (H.I.,pxn) or (H.I.,αxn) reaction may be higher than its production via an xn compound nucleus reaction. These results have dire consequences for proponents of the ''Z 1 + Z 2 = Z/sub 1+2/'' philosophy. It is no longer acceptable to assume that (H.I.,pxn) and (H.I.,αxn) product yields are of no consequence when studying compound nucleus reactions. No evidence for spontaneous fission decay of 228 Pu, 230 Pu, 232 Cm, or 238 Cf was observed indicating that strictly empirical extrapolations of spontaneous fission half-life data is inadequate for predictions of half-lives for unknown neutron deficient actinide isotopes

Comparison of size modulation and conventional standard automated perimetry with the 24-2 test protocol in glaucoma patients

Science.gov (United States)

Hirasawa, Kazunori; Shoji, Nobuyuki; Kasahara, Masayuki; Matsumura, Kazuhiro; Shimizu, Kimiya

2016-05-01

This prospective randomized study compared test results of size modulation standard automated perimetry (SM-SAP) performed with the Octopus 600 and conventional SAP (C-SAP) performed with the Humphrey Field Analyzer (HFA) in glaucoma patients. Eighty-eight eyes of 88 glaucoma patients underwent SM-SAP and C-SAP tests with the Octopus 600 24-2 Dynamic and HFA 24-2 SITA-Standard, respectively. Fovea threshold, mean defect, and square loss variance of SM-SAP were significantly correlated with the corresponding C-SAP indices (P < 0.001). The false-positive rate was slightly lower, and false-negative rate slightly higher, with SM-SAP than C-SAP (P = 0.002). Point-wise threshold values obtained with SM-SAP were moderately to strongly correlated with those obtained with C-SAP (P < 0.001). The correlation coefficients of the central zone were significantly lower than those of the middle to peripheral zone (P = 0.031). The size and depth of the visual field (VF) defect were smaller (P = 0.039) and greater (P = 0.043), respectively, on SM-SAP than on C-SAP. Although small differences were observed in VF sensitivity in the central zone, the defect size and depth and the reliability indices between SM-SAP and C-SAP, global indices of the two testing modalities were well correlated.

Measurements of the neutron-induced fission cross sections of 240Pu and 242Pu relative to 235U

International Nuclear Information System (INIS)

Behrens, J.W.; Browne, J.C.; Carlson, G.W.

1976-01-01

A continuation is given of the fission-cross-section ratio measurements in progress at the Lawrence Livermore Laboratory. Preliminary results are provided for the 240 Pu/ 235 U and 242 Pu/ 235 U ratios from 0.02 to 30 MeV and 0.1 to 30 MeV, respectively. Using the threshold-cross-section method, the ratios were normalized to the values 1.368 +- 0.030 and 1.116 +- 0.025, respectively, from 1.75 to 4.00 MeV

Neutron and gamma-ray emission in the proton induced fission of {sup 238}U and {sup 242}Pu

Energy Technology Data Exchange (ETDEWEB)

Kniajeva, G.N.; Krupa, L.; Bogachev, A.A.; Chubarian, G.G.; Dorvaux, O.; Itkis, I.M.; Itkis, M.G.; Kliman, J.; Khlebnikov, S.; Kondratiev, N.A.; Kozulin, E.M.; Lyapin, V.; Materna, T.; Pokrovsky, I.V.; Rubchenya, V.A.; Trzaska, W.H.; Vakhtin, D.; Voskressenski, V.M

2004-04-05

Average prescission M{sup pre}{sub n} and postscission M{sup post}{sub n} neutron multiplicities as well as average {gamma}-ray multiplicity , average energy emitted by {gamma}-rays as a function of mass and total kinetic energy (TKE) of fission fragments were measured in proton induced reactions p+{sup 242}Pu{yields}{sup 243}Am, p+{sup 238}U{yields}{sup 239}Np at proton energy E{sub p}=13, 20 and 55 MeV.

Fission cross section measurement of Am-242m using lead slowing-down spectrometer

Energy Technology Data Exchange (ETDEWEB)

Kai, Tetsuya; Kobayashi, Katsuhei; Yamamoto, Shuji; Fujita, Yoshiaki [Kyoto Univ., Kumatori, Osaka (Japan). Research Reactor Inst.; Kimura, Itsuro; Ohkawachi, Yasushi; Wakabayashi, Toshio

1998-03-01

By making use of double fission chamber and lead slowing-down spectrometer coupled to an electron linear accelerator, fission cross section for the {sup 242m}Am(n,f) reaction has been measured relative to that for the {sup 235}U(n,f) reaction in the energy range from 0.1 eV to 10 keV. The measured result was compared with the evaluated nuclear data appeared in ENDF/B-VI and JENDL-3.2, of which evaluated data were broadened by the energy resolution function of the spectrometer. Although the JENDL-3.2 data seem to be a little smaller than the present measurement, good agreement can be seen in the general shape and the absolute values. The ENDF/B-VI data are larger more than 50 % than the present values above 3 eV. (author)

The C242T polymorphism of the p22-phox gene (CYBA is associated with higher left ventricular mass in Brazilian hypertensive patients

Directory of Open Access Journals (Sweden)

Krieger José E

2011-08-01

Full Text Available Abstract Background Reactive oxygen species have been implicated in the physiopathogenesis of hypertensive end-organ damage. This study investigated the impact of the C242T polymorphism of the p22-phox gene (CYBA on left ventricular structure in Brazilian hypertensive subjects. Methods We cross-sectionally evaluated 561 patients from 2 independent centers [Campinas (n = 441 and Vitória (n = 120] by clinical history, physical examination, anthropometry, analysis of metabolic and echocardiography parameters as well as p22-phox C242T polymorphism genotyping. In addition, NADPH-oxidase activity was quantified in peripheral mononuclear cells from a subgroup of Campinas sample. Results Genotype frequencies in both samples were consistent with the Hardy- Weinberg equilibrium. Subjects with the T allele presented higher left ventricular mass/height2.7 than those carrying the CC genotype in Campinas (76.8 ± 1.6 vs 70.9 ± 1.4 g/m2.7; p = 0.009, and in Vitória (45.6 ± 1.9 vs 39.9 ± 1.4 g/m2.7; p = 0.023 samples. These results were confirmed by stepwise regression analyses adjusted for age, gender, blood pressure, metabolic variables and use of anti-hypertensive medications. In addition, increased NADPH-oxidase activity was detected in peripheral mononuclear cells from T allele carriers compared with CC genotype carriers (p = 0.03. Conclusions The T allele of the p22-phox C242T polymorphism is associated with higher left ventricular mass/height2.7 and increased NADPH-oxidase activity in Brazilian hypertensive patients. These data suggest that genetic variation within NADPH-oxidase components may modulate left ventricular remodeling in subjects with systemic hypertension.

242-A Campaign 94-1 post run document

International Nuclear Information System (INIS)

Guthrie, M.D.

1994-01-01

The purpose of this post-run document is to summarize the results of 242-A Evaporator Campaign 94-1 as required. Campaign 94-1 represents the first Evaporator operation since 1989, following completion of the B-534 upgrades and Liquid Effluent Retention Facility (LERF) construction. The purpose of Campaign 94-1 was to concentrate dilute waste from TK-102-AW, TK-106-AW, and TK-103-AP. From an available 2.87 million gallon feedstock of dilute waste contained in 102-AW, 106-AW and 103-AP, an overall Waste Volume Reduction (WVR) of 2.39 million gallons (83% WVRF) was achieved. At the completion of the campaign, approximately 477,000 gallons of dilute double-shell slurry feed (DDSSF) was produced with a SpG. of 1.25--1.30. Total process condensate discharged to LERF was 3.09 million gallons, achieving a condensate/WVR ratio of 1.29. Throughput for Campaign 94-1 was 5.27 million gallons. Total steam condensate and cooling water discharge to B-pond was 4.7 and 216 million gallons respectively. The evaporator operated approximately 43 days of the 60 day campaign for a total operating efficiency of 73%. Campaign 94-1 was completed without any discharge limit, Operating Specification Document, or Operational Safety Requirement violations. Major problems encountered during the run included the following: (1) high CA1 deentrainment pad dP's caused by foaming, (2) condensate pump P-C100 failure, and (3) ion exchange column dP's and efficiency

Thermal neutron capture cross-section measurements of 243Am and 242Pu using the new mini-INCA α- and γ-spectroscopy station

International Nuclear Information System (INIS)

Marie, F.; Letourneau, A.; Fioni, G.; Deruelle, O.; Veyssiere, Ch.; Faust, H.; Mutti, P.; AlMahamid, I.; Muhammad, B.

2006-01-01

In the framework of the Mini-INCA project, dedicated to the study of Minor Actinide transmutation process in high neutron fluxes, an α- and γ-spectroscopy station has been developed and installed at the High Flux Reactor of the Laue-Langevin Institut. This set-up allows short irradiations as well as long irradiations in a high quasi-thermal neutron flux and post-irradiation spectroscopy analysis. It is well suited to measure precisely, in reference to 59 Co cross-section, neutron capture cross-sections, for all the actinides, in the thermal energy region. The first measurements using this set-up were done on 243 Am and 242 Pu isotopes. Cross-section values, at E n =0.025eV, were found to be (81.8+/-3.6)b for 243 Am and (22.5+/-1.1)b for 242 Pu. These values differ from evaluated data libraries by a factor of 9% and 17%, respectively, but are compatible with the most recent measurements, validating by the way the experimental apparatus

Method for Determination of Neptunium in Large-Sized Urine Samples Using Manganese Dioxide Coprecipitation and ²⁴²Pu as Yield Tracer

DEFF Research Database (Denmark)

Qiao, Jixin; Hou, Xiaolin; Roos, Per

2013-01-01

A novel method for bioassay of large volumes of human urine samples using manganese dioxide coprecipitation for preconcentration was developed for rapid determination of 237Np. 242Pu was utilized as a nonisotopic tracer to monitor the chemical yield of 237Np. A sequential injection extraction chr...... and rapid analysis of neptunium contamination level for emergency preparedness....

Waste volume reduction factors for potential 242-A evaporator feed

International Nuclear Information System (INIS)

Sederburg, J.P.

1995-01-01

Double-shell tank (DST) storage space requirements have been shown to be highly dependent on the end point of 242-A operations. Consequences to the DST of various waste volumes, and concentrations, are evaluated. Only waste streams that are currently planned to be stored in the DST system before the year 2004 are discussed. As of January 1, 1995, approximately 27-million L (7.2-million gal) of dilute wastes are stored in the DSTs available for evaporator processing. Waste streams planned to be transferred to the DSTs before December 31, 2004, are identified. The DST volume for storing slurry from these wastes is presented in this document. At a final slurry specific gravity of -1.35, 22.5-million L (5.93-million gal) of DST space would be needed on December 31, 2004, to store the product from evaporator processing of these feedstocks. The expected volume needed if the resultant slurry were concentrated to the traditional double-shell slurry feed (DSSF) phase boundary (a specific gravity of ∼1.5) would be 17.7-million L (4.67-million gal). An additional 4.8-million L (1.26-million gal) is therefore needed if these wastes are concentrated to a specific gravity of 1.35 instead of the DSSF limit

Directed evolution of the periodic table: probing the electronic structure of late actinides.

Science.gov (United States)

Marsh, M L; Albrecht-Schmitt, T E

2017-07-25

Recent investigations of the coordination chemistry and physical properties of berkelium (Z = 97) and californium (Z = 98) have revealed fundamental differences between post-curium elements and lighter members of the actinide series. This review highlights these developments and chronicles key findings and concepts from the last half-century that have helped usher in a new understanding of the evolution of electronic structure in the periodic table.

Fission cross sections of plutonium-239 and plutonium-242 relative to uranium-285 from 0. 1 to 10 MeV

Energy Technology Data Exchange (ETDEWEB)

Meadows, J.W.

1978-12-01

Measurement of the ratio of the fission cross sections of /sup 239/Pu and /sup 242/Pu to that of /sup 235/U is reported. The sources of neutrons were the /sup 7/Li(p,n)/sup 7/Be and D(d,n)/sup 3/He reactions. The ratio of the masses of the samples was determined by low geometry alpha counting and from relative thermal fission rates. The results are compared with other measurements. 19 references.

The emission of heavy clusters described in the mean-field HFB theory: the case of 242Cm

International Nuclear Information System (INIS)

Robledo, L.M.; Warda, M.

2008-01-01

The emission of a nucleus of 34 Si by the parent 96 242 Cm is a process in the diffuse borderline between cluster emission and standard mass asymmetric fission. In this paper we analyze in a microscopic framework such process using the standard mean field techniques used to describe cluster emission. They include Hartree-Fock-Bogoliubov constrained calculations with the Gogny D1S interaction and the octupole moment operator as the collective coordinate to describe the process. Collective masses and all kind of zero point energy corrections are considered which allows for a parameter free estimation of the process' half-life. The agreement with experiment is quite satisfactory. (author)

pH responsive label-assisted click chemistry triggered sensitivity amplification for ultrasensitive electrochemical detection of carbohydrate antigen 24-2.

Science.gov (United States)

Zheng, Yun; Zhao, Lihua; Ma, Zhanfang

2018-05-15

Sensitivity amplification strategy by implementing click chemistry in the construction of biosensing interface can efficiently improve the performance of immunosensor. Herein, we developed a sandwich-type amperometric immunosensor for ultrasensitive detection of carbohydrate antigen 24-2 (CA 242) based on pH responsive label-assisted click chemistry triggered sensitivity amplification strategy. The sensitivity of amperometric immunosensor relies on the current response differences (ΔI) caused by per unit concentration target analyte. The pH responsive Cu 2+ -loaded polydopamine (CuPDA) particles conjugated with detection antibodies were employed as labels, which can release Cu(II) ions by regulating pH. In the presence of ascorbic acid (reductant), Cu(II) ions were reduced to Cu(I) ions. Azide-functionalized double-stranded DNA (dsDNA) as signal enhancer was immobilized on the substrate through Cu + -catalyzed azide/alkyne cycloaddition reaction. With the help of the click reaction, the ΔI caused by target was elevated prominently, resulting in sensitivity amplification of the immunosensor. Under optimal condition, the proposed immunosensor exhibited excellent performance with linear range from 0.0001 to 100 U mL -1 and ultralow detection limit of 20.74 μU mL -1 . This work successfully combines click chemistry with pH-responsive labels in sandwich-type amperometric immunosensor, providing a promising sensitivity amplification strategy to construct immunosensing platform for analysis of other tumor marker. Copyright © 2018 Elsevier B.V. All rights reserved.

Restart oversight assessment of Hanford 242-A evaporator: Summary report

International Nuclear Information System (INIS)

1994-08-01

This report summarizes a January 17--28, 1994, oversight assessment of restart activities for the 242-A Evaporator at the US Department of Energy's (DOE's) Hanford Site about 25 miles northeast of Hanford, Washington. The assessment was conducted by qualified staff and consultants from the DOE Office of Environment, Safety and Health (EH). Its focus was the readiness of the facility for the resumption of safe operations, in particular those operations involved in the treatment and disposal of condensate from the evaporation of liquid radioactive waste, a key element of the tank waste remediation project administered by the DOE Richland Operations Office (DOE-RL). Overall, the assessment yielded eight programmatic concerns, supported by 38 individual findings. Of the concerns, four have already been closed, and the other four have been resolved. Results pointed up strengths in management and engineering design, as well as effective support of facility training programs by the management and operating contractor, Westinghouse Hanford Company (WHC). Weaknesses were evident, however, in conduct of operations, maintenance, and radiological practices. Furthermore, problems in the submittal and approval of Compliance Schedule Approvals--that is, WHC documentation of the status of compliance with DOE orders--were indicative of a programmatic breakdown in the DOE Order compliance process. According to the results of this assessment, there are no safety and health issues that would preclude or delay restart of the evaporator

Radiochemical studies of neutron deficient actinide isotopes

Energy Technology Data Exchange (ETDEWEB)

Williams, K.E.

1978-04-01

The production of neutron deficient actinide isotopes in heavy ion reactions was studied using alpha, gamma, x-ray, and spontaneous fission detection systems. A new isotope of berkelium, /sup 242/Bk, was produced with a cross-section of approximately 10 ..mu..b in reactions of boron on uranium and nitrogen on thorium. It decays by electron capture with a half-life of 7.0 +- 1.3 minutes. The alpha-branching ratio for this isotope is less than 1% and the spontaneous fission ratio is less than 0.03%. Studies of (Heavy Ion, pxn) and (Heavy Ion, ..cap alpha..xn) transfer reactions in comparison with (Heavy ion, xn) compound nucleus reactions revealed transfer reaction cross-sections equal to or greater than the compound nucleus yields. The data show that in some cases the yield of an isotope produced via a (H.I.,pxn) or (H.I.,..cap alpha..xn) reaction may be higher than its production via an xn compound nucleus reaction. These results have dire consequences for proponents of the ''Z/sub 1/ + Z/sub 2/ = Z/sub 1+2/'' philosophy. It is no longer acceptable to assume that (H.I.,pxn) and (H.I.,..cap alpha..xn) product yields are of no consequence when studying compound nucleus reactions. No evidence for spontaneous fission decay of /sup 228/Pu, /sup 230/Pu, /sup 232/Cm, or /sup 238/Cf was observed indicating that strictly empirical extrapolations of spontaneous fission half-life data is inadequate for predictions of half-lives for unknown neutron deficient actinide isotopes.

Neutron diffraction study of δ-alloy Pu{sup 242}–Ga aging

Energy Technology Data Exchange (ETDEWEB)

Somenkov, V.A. [National Research Center “Kurchatov Institute”, Moscow (Russian Federation); Blanter, M.S., E-mail: mike.blanter@gmail.com [Moscow State University of Instrumental Engineering and Information Science, Moscow (Russian Federation); Glazkov, V.P. [National Research Center “Kurchatov Institute”, Moscow (Russian Federation); Laushkin, A.V.; Orlov, V.K. [JSC VNIINM n.a. A.A. Bochvar, Moscow (Russian Federation)

2014-09-15

In this paper, we report on a continuing neutron diffraction study of the mean-square atom displacements occurring during the long-term self-irradiation of a Pu–Ga alloy. The measurements were performed at room temperature using the sample based on the isotope Pu{sup 242} with low neutron absorption cross-section to which the short-lived isotope Pu{sup 238} (1.4 wt.%) was added to accelerate self-irradiation. We obtain the maximum self-irradiation equivalent time of 35.5 years, 12 years longer than in our previous papers. In the entire range of self-irradiation time a single fcc phase is preserved. It was found that after the two stages of change in the mean-square displacements we observed earlier (rapid growth up to ∼5–6 equivalent years and a slow decline in the range of ∼6–25 years), comes a stage of stabilization (after ∼25 years). The stabilization can be explained by the emergence of a balance between the formation of point defects and their absorption by helium bubbles and dislocation loops which accumulated over time.

Measurement of the fission cross-section of $^{240}$Pu and $^{242}$Pu at CERN's n_TOF Facility

CERN Multimedia

Pavlik, A F; Gonzalez romero, E M

The n_TOF Collaboration proposes to continue the fission program, already started in 2002-2004, taking advantage of the newly constructed Work Sector Type A, with the measurement of the two isotopes : $^{240}$ Pu and $^{242}$ Pu. They are both of major importance for reactor physics applications and are included in the Nuclear Energy Agency (NEA) High Priority List [1], in the NEA WPEC Subgroup 26 Report on the accuracy of nuclear data for advanced reactor designe [2] and in the EU 6$^{th}$ Framework Programme IP-EUROTRANS/NUDATRA reports [3]. Based on those requests, the measurement of the fission cross-section of the two Pu isotopes is one of the objectives of the project ANDES of the FP7 EURATOM program [4].

FAST, LOW-IONIZATION EMISSION REGIONS OF THE PLANETARY NEBULA M2-42

Energy Technology Data Exchange (ETDEWEB)

Danehkar, A.; Parker, Q. A. [Department of Physics and Astronomy, Macquarie University, Sydney, NSW 2109 (Australia); Steffen, W., E-mail: ashkbiz.danehkar@cfa.harvard.edu [Instituto de Astronomía, Universidad Nacional Autónoma de México, C.P.22860, Ensenada (Mexico)

2016-02-15

Spatially resolved observations of the planetary nebula M2-42 (PN G008.2−04.8) obtained with the Wide Field Spectrograph on the Australian National University 2.3 m telescope have revealed the remarkable features of bipolar collimated jets emerging from its main structure. Velocity-resolved channel maps derived from the [N ii] λ6584 emission line disentangle different morphological components of the nebula. This information is used to develop a three-dimensional morpho-kinematic model, which consists of an equatorial dense torus and a pair of asymmetric bipolar outflows. The expansion velocity of about 20 km s{sup −1} is measured from the spectrum integrated over the main shell. However, the deprojected velocities of the jets are found to be in the range of 80–160 km s{sup −1} with respect to the nebular center. It is found that the mean density of the collimated outflows, 595 ± 125 cm{sup −3}, is five times lower than that of the main shell, 3150 cm{sup −3}, whereas their singly ionized nitrogen and sulfur abundances are about three times higher than those determined from the dense shell. The results indicate that the features of the collimated jets are typical of fast, low-ionization emission regions.

De novo 14q24.2q24.3 microdeletion including IFT43 is associated with intellectual disability, skeletal anomalies, cardiac anomalies, and myopia.

Science.gov (United States)

Stokman, Marijn F; Oud, Machteld M; van Binsbergen, Ellen; Slaats, Gisela G; Nicolaou, Nayia; Renkema, Kirsten Y; Nijman, Isaac J; Roepman, Ronald; Giles, Rachel H; Arts, Heleen H; Knoers, Nine V A M; van Haelst, Mieke M

2016-06-01

We report an 11-year-old girl with mild intellectual disability, skeletal anomalies, congenital heart defect, myopia, and facial dysmorphisms including an extra incisor, cup-shaped ears, and a preauricular skin tag. Array comparative genomic hybridization analysis identified a de novo 4.5-Mb microdeletion on chromosome 14q24.2q24.3. The deleted region and phenotype partially overlap with previously reported patients. Here, we provide an overview of the literature on 14q24 microdeletions and further delineate the associated phenotype. We performed exome sequencing to examine other causes for the phenotype and queried genes present in the 14q24.2q24.3 microdeletion that are associated with recessive disease for variants in the non-deleted allele. The deleted region contains 65 protein-coding genes, including the ciliary gene IFT43. Although Sanger and exome sequencing did not identify variants in the second IFT43 allele or in other IFT complex A-protein-encoding genes, immunocytochemistry showed increased accumulation of IFT-B proteins at the ciliary tip in patient-derived fibroblasts compared to control cells, demonstrating defective retrograde ciliary transport. This could suggest a ciliary defect in the pathogenesis of this disorder. © 2016 Wiley Periodicals, Inc. © 2016 Wiley Periodicals, Inc.

Safety analysis report for packaging: neutron shipping cask, model 0.5T

International Nuclear Information System (INIS)

Peterson, R.T.

1976-01-01

The Safety Analysis Report for Packaging demonstrates that the neutron shipping cask can safely transport, in solid or powder form, all isotopes of uranium, plutonium, americium, curium, berkelium, californium, einsteinium, and fermium. The shipping cask and its contents are described. It also evaluates transport conditions, structural parameters (e.g., load resistance, pressure and impact effects, lifting and tiedown devices), and shielding. Finally, it discusses compliance with Chapter 0529 of the Energy Research and Development Administration Manual

Engineering work plan for implementing the Process Condensate Recycle Project at the 242-A evaporator

International Nuclear Information System (INIS)

Haring, D.S.

1995-01-01

The 242-A Evaporator facility is used to reduce the volume of waste stored in the Hanford double shell tanks. This facility uses filtered raw water for cooling, de-entrainment pad sprays, pump seal water, and chemical tank make-up. Some of these uses result in the introduction of filtered raw water into the process, thus increasing the volume of waste requiring evaporation and subsequent treatment by the 200 East Effluent Treatment Facility. The pump seal water and the de-entrainment pad spray systems were identified as candidates for a waste minimization upgrade. This work plan describes the activities associated with the design, installation, testing and initial operation of the process condensate recycle system. Implementation of the process condensate recycle system will permit the use of process condensate in place of raw water for the de-entrainment pad sprays and pump seals. This will reduce the amount of low-level liquid waste and generated during facility operation through source reduction and recycling

Common variants on 8p12 and 1q24.2 confer risk of schizophrenia

DEFF Research Database (Denmark)

Shi, Yongyong; Li, Zhiqiang; Xu, Qi

2011-01-01

Schizophrenia is a severe mental disorder affecting ~1% of the world population, with heritability of up to 80%. To identify new common genetic risk factors, we performed a genome-wide association study (GWAS) in the Han Chinese population. The discovery sample set consisted of 3,750 individuals...... with schizophrenia and 6,468 healthy controls (1,578 cases and 1,592 controls from northern Han Chinese, 1,238 cases and 2,856 controls from central Han Chinese, and 934 cases and 2,020 controls from the southern Han Chinese). We further analyzed the strongest association signals in an additional independent cohort...... of 4,383 cases and 4,539 controls from the Han Chinese population. Meta-analysis identified common SNPs that associated with schizophrenia with genome-wide significance on 8p12 (rs16887244, P = 1.27 × 10(-10)) and 1q24.2 (rs10489202, P = 9.50 × 10(-9)). Our findings provide new insights...

Reasons why Plutonium 242 is the best fission chamber deposit to monitor the fast component of a high neutron flux

International Nuclear Information System (INIS)

Filliatre, P.; Oriol, L.; Jammes, C.; Vermeeren, L.

2008-01-01

The FNDS project aims at developing fission chambers to measure on-line the fast component of a high neutron flux (∼10 14 ncm -2 s -1 or more) with a significant thermal component. We identify with simulations the deposits of fission chambers that are best suited to this goal. We address the question of the evolution of the deposit by radiative capture and decay. A deposit of 242 Pu appears as the best choice, with a high initial sensitivity to fast neutrons only slowly degrading under irradiation. The effect of unavoidable impurities was assessed: small concentrations of 241 Pu and 239 Pu can be tolerated

Multi-isotopic determination of plutonium (239Pu, 240Pu, 241Pu and 242Pu) in marine sediments using sector-field inductively coupled plasma mass spectrometry.

Science.gov (United States)

Donard, O F X; Bruneau, F; Moldovan, M; Garraud, H; Epov, V N; Boust, D

2007-03-28

Among the transuranic elements present in the environment, plutonium isotopes are mainly attached to particles, and therefore they present a great interest for the study and modelling of particle transport in the marine environment. Except in the close vicinity of industrial sources, plutonium concentration in marine sediments is very low (from 10(-4) ng kg(-1) for (241)Pu to 10 ng kg(-1) for (239)Pu), and therefore the measurement of (238)Pu, (239)Pu, (240)Pu, (241)Pu and (242)Pu in sediments at such concentration level requires the use of very sensitive techniques. Moreover, sediment matrix contains huge amounts of mineral species, uranium and organic substances that must be removed before the determination of plutonium isotopes. Hence, an efficient sample preparation step is necessary prior to analysis. Within this work, a chemical procedure for the extraction, purification and pre-concentration of plutonium from marine sediments prior to sector-field inductively coupled plasma mass spectrometry (SF-ICP-MS) analysis has been optimized. The analytical method developed yields a pre-concentrated solution of plutonium from which (238)U and (241)Am have been removed, and which is suitable for the direct and simultaneous measurement of (239)Pu, (240)Pu, (241)Pu and (242)Pu by SF-ICP-MS.

Evaluation of 242Pu data for the incident neutron energy range 0.1 - 6 MeV

International Nuclear Information System (INIS)

Vladuca, G.; Sin, M.; Tudora, A.

1996-11-01

This report presents the models and the procedures used for the calculation of the quantities required by Files 3, 4 and 5 of ENDF-6 for 242 Pu. These quantities are the integrated cross sections for the total, fission, scattering and gamma-capture reactions and the angular and energy distributions of the scattered neutrons for the incident neutron energies 0.01/6 MeV. The direct mechanism was treated with the coupled-channel method using a deformed optical potential defined by a set of actinide region parameters established by the authors. For the compound nucleus calculations, a new HRTW version of the statistical model extended to describe the fission at subbarrier energies was used. To describe the continuous part of the transition states spectrum, analytical expressions have been established. The energy distributions of the scattered neutrons have been calculated with an author's version of the Los Alamos model. The agreement of the calculations with the existing experimental data is good. (author)

Measurement of the Neutron Capture Cross Sections of $^{233}$U, $^{237}$Np, $^{240,242}$Pu, $^{241,243}$Am and $^{245}$Cm with a Total Absorption Calorimeter at n_TOF

CERN Multimedia

Beer, H; Wiescher, M; Cox, J; Rapp, W; Embid, M; Dababneh, S

2002-01-01

Accurate and reliable neutron capture cross section data for actinides are necessary for the poper design, safety regulation and precise performance assessment of transmutation devices such as Fast Critical Reactors or Accelerator Driven Systems (ADS). The goal of this proposal is the measurement of the neutron capture cross sections of $^{233}$U, $^{237}$Np, $^{240,242}$Pu, $^{241,243}$Am and $^{245}$Cm at n_TOF with an accuracy of 5~\\%. $^{233}$U plays an essential role in the Th fuel cycle, which has been proposed as a safer and cleaner alternative to the U fuel cycle. The capture cross sections of $^{237}$Np,$^{240,242}$Pu, $^{241,243}$Am and $^{245}$Cm play a key role in the design and optimization of a strategy for the Nuclear Waste Transmutation. A high accuracy can be achieved at n_TOF in such measurements due to a combination of features unique in the world: high instantaneous neutron fluence and excellent energy resolution of the facility, innovative Data Acquisition System based on flash ADCs and t...

Effect Of Cooling Rate On Thermal And Mechanical Properties Of Cu-%24.2Mn Alloy

International Nuclear Information System (INIS)

Celik, H.

2010-01-01

In this research, different heat and mechanical treatments have been applied to the Cu-%24.2Mn and some samples have been obtained from this alloy. On these samples, phase transformations have been formed by thermal and mechanical effect. Morphological, mechanical and crystallographic properties of the phase transformations have been examined by using different physical methods. Austenite phase has been obtained in the samples which have been applied slow and rapid cooling according to the SEM analysis. It has been observed that the grain size obtained by the rapid cooling is smaller than the grain size obtained by the slow cooling. Therefore, it has been concluded that the cooling process differences, changes the grain size of the alloy. Compression stress has been applied to the alloy in order to search the deformation effect on the austenite phase transformation. The structural features of the phase transformations have been examined. Slip lines and martensite structural were observed on the surface of the alloys after the deformation. Changes in phase structure of the alloy are also examined by means of XRD technique.

Separation and activity determination of 239+240Pu, 241Am and Curium (242and244Cm) in evaporator concentrate by Alpha Spectrometry

International Nuclear Information System (INIS)

Reis Junior, Aluisio S.; Temba, Eliane S.C.; Kastner, Geraldo F.; Monteiro, Roberto P.G.

2013-01-01

Alpha spectrometry analysis was used for activity determinations of Pu, Am and Cm isotopes in evaporator concentrate samples from nuclear power plants. Using a sequential procedure the first step was Pu isolation by an anion exchange column followed by an Am and Cm separation of U and Fe by a co-precipitation with oxalic acid. The precipitate was used for americium and curium separation of strontium by using a TRU resin extraction chromatography column. Due to their chemical similarities and energy difference it was seen that the simultaneous determination of 241 Am, 242 Cm and 24 3 ,244 Cm isotopes is possible using the 243 Am as tracer, once they have peaks in different region of interest (ROI) in the alpha spectrum. In this work it was used tracers, 238 Pu, 243 Am, 244 Cm and 232 U, for determination and quantification of theirs isotopes, respectively. The standard deviations for replicate analysis were calculated and for 241 Am it was (1,040 ± 160 mBqKg -1 ), relative standard deviation 15.38%, and for 239+240 Pu it was (551 +- 44 mBqKg -1 ), relative standard deviation 7.98%. In addition, for the 242 Cm isotope the standard deviation for determinations was(75 ± 23 mBqKg -1 ), with the relative standard deviation 30.67% higher than for 241 Am and 239+240 Pu. The radiometric yields ranged from 90% to 105% and the lower limit of detection was estimated as being 2.05 mBqKg -1 . (author)

Reasons why Plutonium 242 is the best fission chamber deposit to monitor the fast component of a high neutron flux

Energy Technology Data Exchange (ETDEWEB)

Filliatre, P. [CEA, DEN, SPEx/LDCI, F-13108 Saint-Paul-lez-Durance (France); Laboratoire Commun d' Instrumentation CEA-SCK-CEN (France)], E-mail: philippe.filliatre@cea.fr; Oriol, L.; Jammes, C. [CEA, DEN, SPEx/LDCI, F-13108 Saint-Paul-lez-Durance (France); Laboratoire Commun d' Instrumentation CEA-SCK-CEN (France); Vermeeren, L. [SCK-CEN, Boeretang 200, B-2400 Mol (Belgium); Laboratoire Commun d' Instrumentation CEA-SCK-CEN (France)

2008-08-11

The FNDS project aims at developing fission chambers to measure on-line the fast component of a high neutron flux ({approx}10{sup 14}ncm{sup -2}s{sup -1} or more) with a significant thermal component. We identify with simulations the deposits of fission chambers that are best suited to this goal. We address the question of the evolution of the deposit by radiative capture and decay. A deposit of {sup 242}Pu appears as the best choice, with a high initial sensitivity to fast neutrons only slowly degrading under irradiation. The effect of unavoidable impurities was assessed: small concentrations of {sup 241}Pu and {sup 239}Pu can be tolerated.

Safety analysis report for packaging: neutron shipping cask, model 4T

International Nuclear Information System (INIS)

Peterson, R.T.

1977-01-01

This Safety Analysis Report for Packaging demonstrates that the neutron shipping cask can safely transport, in solid or powder form, all isotopes of uranium, plutonium, americium, curium, berkelium, californium, einsteinium, and fermium. The cask and its contents are described. It also evaluates transport conditions, structural parameters (e.g., load resistance, pressure and impact effects, lifting and tiedown devices), and shielding. Finally, it discusses compliance with Chapter 0529 of the Energy Research and Development Administration Manual, Safety Standards for the Packaging of Fissile and Other Radioactive Materials

Chelation and stabilization of berkelium in oxidation state +IV

Czech Academy of Sciences Publication Activity Database

Deblonde, G. J.-P.; Sturzbecher-Hoehne, M.; Rupert, P. B.; An, D. D.; Illy, M.-C.; Ralston, C. Y.; Brabec, Jiří; de Jong, W. A.; Strong, R. K.; Abergel, R. J.

2017-01-01

Roč. 9, č. 9 (2017), s. 843-849 ISSN 1755-4330 Institutional support: RVO:61388955 Keywords : bioorganic chemistry * chemical bonding * mass spectrometry Subject RIV: CF - Physical ; Theoretical Chemistry OBOR OECD: Physical chemistry Impact factor: 25.870, year: 2016

Actinides

International Nuclear Information System (INIS)

Martinot, L.; Fuger, J.

1985-01-01

The oxidation behavior of the actinides is explained on the basis of their electronic structure. The actinide elements, actinium, thorium, protactinium, uranium, neptunium, plutonium, americium, curium, berkelium, californium, einsteinium, fermium, mendelevium, nobelium, and laurencium are included. For all except the last three elements, the points of discussion are oxidation states, Gibbs energies and potentials, and potential diagram for the element in acid solution; and thermodynamic properties of these same elements are tabulated. References are cited following discussion of each element with a total of 97 references being cited. 13 tables

Process Control Plan for 242-A Evaporator Campaign January 2001

International Nuclear Information System (INIS)

LE, E.Q.

2001-01-01

Wastewater stored in 104-AW that was generated during the terminal cleanout of the PUREX facility is the primary feed to be processed during the 242-A Evaporator Campaign 01-01, Approximately 801,600 gallons of 104-AW waste was transferred to feed tank 102-AW at the end of January 2001, in preparation for the campaign. The total feed volume that will be processed during Campaign 01-01 is 8 15,200 gallons, which includes the waste from 104-AW and residual waste from the previous evaporator campaign, 00-01, Additional feed will be generated during the pre-campaign cold run and processed during campaign 01-01. Based on characterization data from 104-AW feed waste 'and the evaluation of waste processability presented in Section 5 of this PCP, Campaign 01-01 does not pose any unacceptable risks to the facility, safety, environmental, human health offsite, or onsite personnel. Evaporator Campaign 01-01 is essential in supporting the River Protection Project (RPP) to maintaining its critical mission schedule and regulator commitments for tank waste systems. Several of RPP critical activities requiring completion of Campaign 01-01 by April 1, 2001 are highlighted below. Availability of DST space: Additional tank space that will be made available by this campaign is needed to support the continued interim stabilization of Single-Shell Tanks (SSTs). This additional space will also be used to move waste among Double-Shell Tanks (DSTs) to support the demonstrations of SST waste retrieval. DST life extension: An electrical outage in the AW Tank Farm is scheduled to begin following completion of the Campaign 01-01. This outage is a critical step in identifying and completing life extension upgrades to the DST systems. DST upgrades: Project W-314 plans significant upgrades to the AW Tank Farm to retrieve and supply waste feed to the Waste Treatment (Vitrification) Plant using a system that complies with current environmental requirements. These upgrades will commence on

Estimation of Ni63, Pu241, Pu242 and Am243 from Co60, Pu239, and Cm244 activities in groundwater samples

International Nuclear Information System (INIS)

Holcomb, H.P.

1993-01-01

The Part B Permit for F ampersand H Seepage Basins calls for analysis of several constituents of concern in groundwater monitoring wells. Four of these analytes are the radionuclides Ni 63 , Pu 241 , Pu 242 , and Am 243 . These are currently not being analyzed due to their very difficult, tedious analytical schemes coupled with their relatively low activity values. This report demonstrates how the activity value for Ni 63 , a week beta emitter, can be estimated from that of Co 60 , an easily detectable, high-energy gamma emitter. Similarly, estimates of Pu 241 , a beta emitter, and the alpha-emitting Pu 242 can be made from the activity value of the more easily detected Pu 239 . Am 243 can be estimated from the activity of Cm 244 , which is easier to detect because of a shorter half-life (higher specific activity) and the emission of higher energy alpha particles. These correlations are made under very specific parameters in order to ensure the validity of this approach. Therefore, assumptions must be established setting ground rules for establishing these activity relationships. Bases for these assumptions are explained and/or referenced. Their degree of uncertainty limits the accuracy of the data so that the term ''estimate'' is used. Such soundly-based, conservative estimates for these four rads can provide a tool for evaluating any hazards from their presence over the next several years. Hopefully, during this time, sufficient advances will be made in their radiochemical analyses and in counting techniques so that in the future, their activities may be quantitatively determined more easily and also more cost effectively

Configuration management plan for waste tank farms and the 242-A evaporator of tank waste remediation system

International Nuclear Information System (INIS)

Laney, T.

1994-01-01

The configuration management architecture presented in this Configuration Management Plan is based on the functional model established by DOE-STD-1073-93, ''Guide for Operational Configuration Management Program.'' The DOE Standard defines the configuration management program by the five basic program elements of ''program management,'' ''design requirements,'' ''document control,'' ''change control,'' and ''assessments,'' and the two adjunct recovery programs of ''design reconstitution,'' and ''material condition and aging management.'' The CM model of five elements and two adjunct programs strengthen the necessary technical and administrative control to establish and maintain a consistent technical relationship among the requirements, physical configuration, and documentation. Although the DOE Standard was originally developed for the operational phase of nuclear facilities, this plan has the flexibility to be adapted and applied to all life-cycle phases of both nuclear and non-nuclear facilities. The configuration management criteria presented in this plan endorses the DOE Standard and has been tailored specifically to address the technical relationship of requirements, physical configuration, and documentation during the full life cycle of the Waste Tank Farms and 242-A Evaporator of Tank Waste Remediation System

? Tranzitornyy? neonatal'nyy diabet vsledstvie duplikatsii v 6-y khromosome [dup(6(q24.2q24.2 de novo

Directory of Open Access Journals (Sweden)

Ivan Ivanovich Dedov

2002-06-01

�оксикозом во II половине, беременности. Роды на 41-42-й нед. Масса тела при рождении 2100 г, длина 49 см. На 19-м дне жизни в связи беспокойством, непрерывным плачем, отсутствием аппетита, белым налетом на языке ребенок был госпитализирован. При обследовании выявлена гипергликемия натощак (17- 25 ммоль/л, глюкозурия ? 1,5 %. Реакция на ацетон отрицательная. Диагностирован СД 1 типа, назначен инсулин 0,5 Ед 2 раза в сутки. В возрасте 1,5 мес. у девочки появились гипогликемии, доза инсулина была снижена до 0,5 Ед/сут. В связи с повторением гипогликемических состояний в возрасте 2 мес. мать самосто-ятельно отменила инсулин. При повторном поступлении в клинику в возрасте 14 лет: рост 157,9 см (25-50 перц., вес 36 кг (25 перц.. Гликированный гемоглобин А1с 12,6 % (норма до 6,4 %, HbAl 15,3 % (норма до 7,8 %. На глазном дне без отрицательной динамики. С-пептид 0,45 нг/мл (норма 1,1-3,2 нг/мл. Антитела к островковым клеткам и глютаматдекарбоксилазе не обнаружены. Результаты: Кариотип: 46,XX,dup(6(q24.2q24.2. У пациентки женский кариотип с дополнительным G-материалом в локусе 6q24.2 длинного плеча 6 хромосомы ? дупликация локуса 6q24.2, специфичная для ?транзиторного? �

Joint Institute for Nuclear Research Data Analysis Guide - Berkelium Edition

International Nuclear Information System (INIS)

Henderson, R.A.

2009-01-01

This is a data analysis guide to the JINR system developed by Roger Henderson. It is intended as a complete guide to the data format and the calibration parameters utilized for the analysis of the data. This guide will provide the basic structure of the data files, the description of the individual data items, and the basic equations developed for the calculation of the results. Currently (7/17/2009), calculation of the calibration parameters is not a covered topic. It is intended that this will be covered in a future update

Monitoring the fast neutrons in a high flux: The case for 242Pu fission chambers

International Nuclear Information System (INIS)

Filliatre, P.; Jammes, C.; Oriol, L.; Geslot, B.; Vermeeren, L.

2009-01-01

Fission chambers are widely used for on-line monitoring of neutron fluxes in irradiation reactors. A selective measurement of a component of interest of the neutron flux is possible in principle thanks to a careful choice of the deposit material. However, measuring the fast component is challenging when the flux is high (up to 10 15 n/cm 2 /s) with a significant thermal component. The main problem is that the isotopic content of a material selected for its good response to fast neutrons evolves with irradiation, so that the material is more and more sensitive to thermal neutrons. Within the framework of the FNDS (Fast Neutron Detector System) project, we design tools that simulate the evolution of the isotopic composition and fission rate for several deposits under any given flux. In the case of a high flux with a significant thermal component, 242 Pu is shown after a comprehensive study of all possibilities to be the best choice for measuring the fast component, as long as its purity is sufficient. If an estimate of the thermal flux is independently available, one can correct the signal for that component. This suggests a system of two detectors, one of which being used for such a correction. It is of very high interest when the detectors must be operated up to a high neutron fluence. (authors)

P-glycoprotein binds to ezrin at amino acid residues 149-242 in the FERM domain and plays a key role in the multidrug resistance of human osteosarcoma.

Science.gov (United States)

Brambilla, Daria; Zamboni, Silvia; Federici, Cristina; Lugini, Luana; Lozupone, Francesco; De Milito, Angelo; Cecchetti, Serena; Cianfriglia, Maurizio; Fais, Stefano

2012-06-15

Overexpression of the mdr1 gene encoding P-glycoprotein (Pgp) exerts a major role in reducing the effectiveness of cytotoxic therapy in osteosarcoma. The interaction between actin and Pgp has been shown to be instrumental in the establishment of multidrug resistance (MDR) in human tumor cells. The cytoskeleton linker ezrin exerts a pivotal role in maintaining the functional connection between actin and Pgp. We investigated the role of ezrin in a human multidrug-resistant osteosarcoma cell line overexpressing Pgp and compared it to its counterpart that overexpresses an ezrin deletion mutant. The results showed that Pgp binds at amino acid residues 149-242 of the N-terminal domain of ezrin. The interaction between ezrin and Pgp occurs in the plasma membrane of MDR cells, where they also co-localize with the ganglioside G(M1) located in lipid rafts. The overexpression of the ezrin deletion mutant entirely restored drug susceptibility of osteosarcoma cells, consistent with Pgp dislocation to cytoplasmic compartments and abrogation of G(M1) /Pgp co-localization at the plasma membrane. Our study provides evidence that ezrin exerts a key role in MDR of human osteosarcoma cells through a Pgp-ezrin-actin connection that is instrumental for the permanence of Pgp into plasma membrane lipid rafts. We also show for the first time that Pgp-binding site is localized to amino acid residues 149-242 of the ezrin Band 4.1, Ezrin/Radixin/Moesin (FERM) domain, thus proposing a specific target for future molecular therapy aimed at counteracting MDR in osteosarcoma patients. Copyright © 2011 UICC.

Monitoring the fast neutrons in a high flux: The case for {sup 242}Pu fission chambers

Energy Technology Data Exchange (ETDEWEB)

Filliatre, P.; Jammes, C.; Oriol, L.; Geslot, B. [Commissariat a l' Energie Atomique, DEN/SPEX/LDCI, Centre de Cadarache, F-13108 Saint-Paul-lez-Durance (France); Vermeeren, L. [SCK-CEN, Boeretang 200, B-2400 Mol (Belgium)

2009-07-01

Fission chambers are widely used for on-line monitoring of neutron fluxes in irradiation reactors. A selective measurement of a component of interest of the neutron flux is possible in principle thanks to a careful choice of the deposit material. However, measuring the fast component is challenging when the flux is high (up to 10{sup 15} n/cm{sup 2}/s) with a significant thermal component. The main problem is that the isotopic content of a material selected for its good response to fast neutrons evolves with irradiation, so that the material is more and more sensitive to thermal neutrons. Within the framework of the FNDS (Fast Neutron Detector System) project, we design tools that simulate the evolution of the isotopic composition and fission rate for several deposits under any given flux. In the case of a high flux with a significant thermal component, {sup 242}Pu is shown after a comprehensive study of all possibilities to be the best choice for measuring the fast component, as long as its purity is sufficient. If an estimate of the thermal flux is independently available, one can correct the signal for that component. This suggests a system of two detectors, one of which being used for such a correction. It is of very high interest when the detectors must be operated up to a high neutron fluence. (authors)

Radiological safety considerations in the design and operation of the ORNL Transuranium Research Laboratory (TRL)

International Nuclear Information System (INIS)

Haynes, C.E.

1976-01-01

The Transuranium Research Laboratory (TRL) is the central facility at Oak Ridge National Laboratory (ORNL) for chemical and physical research involving transuranium elements. Transuranium Research Laboratory investigations are about equally divided between studies of inorganic and structural chemistry of the heavy elements and nuclear structure and properties of their isotopes. Elements studied include neptunium, plutonium, americium, curium, berkelium, californium, and einsteinium, each in microgram-to-gram quantities depending upon availability and experimental requirements. This paper describes an eight-step safety procedure followed in planning and approving individual research projects. This procedure should provide an optimum margin of safety and should permit the accomplishment of successful research

Composition containing transuranic elements for use in the homeopathic treatment of aids

International Nuclear Information System (INIS)

Lustig, D.

1996-01-01

A homeopathic remedy consisting of a composition containing one or more transuranic elements, particularly plutonium, for preventing and treating acquired immunodeficiency syndrome (AIDS) in humans, as well as seropositivity for human immunodeficiency virus (HIV). Said composition is characterized in that it uses any chemical or isotopic form of one or more transuranic elements (neptunium, plutonium, americium, curium, berkelium, californium or einsteinium), particularly plutonium, said form being diluted and dynamized according to conventional homeopathic methods, particularly the so-called Hahnemann and Korsakov methods, and provided preferably but not exclusively in the form of lactose and/or saccharose globules or granules impregnated with the active principle of said composition. (author)

PROCEEDINGS OF THE SYMPOSIUM COMMEMORATING THE 25th ANNIVERSARY OF ELEMENTS 97 and 98 HELD ON JAN. 20, 1975

Energy Technology Data Exchange (ETDEWEB)

Seaborg, Glenn T.; Street Jr., Kenneth; Thompson, Stanley G.; Ghiorso, Albert

1976-07-01

This volume includes the talks given on January 20, 1975, at a symposium in Berkeley on the occasion of the celebration of the 25th anniversary of the discovery of berkelium and californium. Talks were given at this symposium by the four people involved in the discovery of these elements and by a number of people who have made significant contributions in the intervening years to the investigation of their nuclear and chemical properties. The papers are being published here, without editing, in the form in which they were submitted by the authors in the months following the anniversary symposium, and they reflect rather faithfully the remarks made on that occasion.

TOWARD AN IMPROVED UNDERSTANDING OF STRUCTURE AND MAGNETISM IN NEPTUNIUM AND PLUTONIUM PHOSPHONATES AND SULFONATES

Energy Technology Data Exchange (ETDEWEB)

Albrecht-Schmitt, Thomas

2012-03-01

This grant supported the exploratory synthesis of new actinide materials with all of the actinides from thorium to californium with the exceptions of protactinium and berkelium. We developed detailed structure-property relationships that allowed for the identification of novel materials with selective ion-exchange, selective oxidation, and long-range magnetic ordering. We found novel bonding motifs and identified periodic trends across the actinide series. We identified structural building units that would lead to desired structural features and novel topologies. We also characterized many different spectroscopic trends across the actinide series. The grant support the preparation of approximately 1200 new compounds all of which were structurally characterized.

Investigation of the chemical explosion of an ion exchange resin column and resulting americium contamination of personnel in the 242-Z building, August 30, 1976

Energy Technology Data Exchange (ETDEWEB)

1976-10-19

As a result of an explosion in the Waste Treatment Facility, 242-Z Building, 200 West Area of the Hanford Reservation on August 30, 1976, the Manager of the Richland Operations Office (RL), Energy Research and Development Administration (ERDA), appointed an ERDA Committee to conduct a formal investigation and to prepare a report on their findings of this occurrence. The Committee was instructed to conduct the investigation in accordance with ERDAMC 0502, insofar as circumstances would permit, to cover and explain technical elements of the casual sequence(s) of the occurrence, and to describe management systems which should have or could have prevented the occurrence. This report is the result of the investigation and presents the conclusions of the review.

Performance Characterization of Loctite (Registered Trademark) 242 and 271 Liquid Locking Compounds (LLCs) as a Secondary Locking Feature for International Space Station (ISS) Fasteners

Science.gov (United States)

Dube, Michael J.; Gamwell, Wayne R.

2011-01-01

Several International Space Station (ISS) hardware components use Loctite (and other polymer based liquid locking compounds (LLCs)) as a means of meeting the secondary (redundant) locking feature requirement for fasteners. The primary locking method is the fastener preload, with the application of the Loctite compound which when cured is intended to resist preload reduction. The reliability of these compounds has been questioned due to a number of failures during ground testing. The ISS Program Manager requested the NASA Engineering and Safety Center (NESC) to characterize and quantify sensitivities of Loctite being used as a secondary locking feature. The findings and recommendations provided in this investigation apply to the anaerobic LLCs Loctite 242 and 271. No other anaerobic LLCs were evaluated for this investigation. This document contains the findings and recommendations of the NESC investigation

A severe connatal form of Pelizaeus Merzbacher disease in a Czech boy caused by a novel mutation (725C>A, Ala242Glu) at the 'jimpy(msd) codon' in the PLP gene.

Science.gov (United States)

Seeman, Pavel; Paderova, Katerina; Benes, Vladimir; Sistermans, Erik A

2002-02-01

Pelizaeus Merzbacher disease (PMD) is an X-linked recessive disorder of the central nervous system myelination caused by mutations involving the proteolipid protein gene (PLP). Early nystagmus and developmental delay, progressive pyramidal, cerebellar and dystonic signs as well as white matter changes in brain MRI are typical for PMD. The PLP gene can be affected by two major types of mutations. A duplication of the whole PLP gene is the most common mutation and results usually in the milder classical phenotype, whereas point mutations in PLP gene often result in the rarer and more severe connatal form of PMD. The PLP protein is a higly conserved across species and is identical in human, mouse and rat. We describe a 13-year-old Czech boy with an early and severe developmental delay. His maternal uncle died at the age of one year and was also early and severely psychomotoricly retarded. The patient was the first child of healthy unrelated parents born after an uneventful pregnancy and delivery in 1988. Hyperbilirubinemia and bronchopneumonia and early stridor complicated his neonatal period. Diffuse hypotonia, nystagmus, psychomotor retardation, visual and hearing impairment have been observed in the patient since the age of 6 weeks. White matter abnormalities, cortical and periventricular atrophy were detected by MRI at the age of 6 and 11 years, respectively. Despite these signs and results an accurate clinical diagnosis was unclear until the age of 11 years. Last neurological examination in 1999 showed no nystagmus anymore, but extremely dystrophic limbs, truncal deformation, due to severe scoliosis, tetraplegia with hyperreflexia in C5C7 and areflexia L2S2 and positive pyramidal signs. The boy had no visual or speech contact. DNA tests followed the clinical suspicion for PMD. At first, duplication of PLP gene was excluded by quantitative comparative PCR. Direct sequencing of PLP gene detected a novel mutation in exon 6, a missense mutation 725C-->A (Ala242Glu

Measurements of ice nucleating particle concentrations at 242 K in the free troposphere

Science.gov (United States)

Lacher, L.; Lohmann, U.; Boose, Y.; Zipori, A.; Herrmann, E.; Bukowiecki, N.; Steinbacher, M.; Gute, E.; Kanji, Z. A.

2017-12-01

Clouds containing ice play an important role in the Earth's system, but some fundamental knowledge on their formation and further development is still missing. The phase change from vapor or liquid to ice in the atmosphere can occur heterogeneously in the presence of ice nucleating particles (INPs) at temperatures warmer, and supersaturations lower than required for homogeneous freezing. Only a small fraction of particles in an environment relevant for the occurrence of ice- and mixed-phase clouds are INPs, and their identification and quantification remains challenging. We measure INP concentrations with the ETH Horizontal Ice Nucleation Chamber (HINC) at the High Altitude Research Station Jungfraujoch (JFJ) during several field campaigns in different seasons and years. The measurements are performed at 242 K and above water saturation, representing ice- and mixed-phase clouds conditions. Due to its elevation of 3580 m a.s.l. the site encounters mostly free tropospheric conditions, and is influenced by boundary layer injections up to 80% of the time in summer. JFJ regularly encounters Saharan dust events and receives air masses of marine origin, which can both occur within the free troposphere. Our measurements show that INP concentrations in the free troposphere do not follow a seasonal cycle. They are remarkably constant, with concentrations from 0.5 - 8 L-1 (interquartile range), which compares well to measurements performed under the same conditions at another location within the free troposphere, the Izaña Atmospheric Research Station in Tenerife. At JFJ, correlations with parameters of physical properties of ambient particles, meteorology and air mass characteristics do not show a single best estimator to predict INP concentrations, emphasizing the complexity of ice nucleation in the free troposphere. Increases in INP concentrations of a temporary nature were observed in the free troposphere during Saharan dust events and marine air mass influence, which

Complex chromosomal rearrangement in a girl with psychomotor-retardation and a de novo inversion: inv(2)(p15;q24.2).

Science.gov (United States)

Granot-Hershkovitz, Einat; Raas-Rothschild, Annick; Frumkin, Ayala; Granot, David; Silverstein, Shira; Abeliovich, Dvorah

2011-08-01

Cytogenetic analysis of DNA from a girl with severe psychomotor retardation revealed a de novo pericentric inversion of chromosome 2: 46,XX,inv(2)(p15q24.2). In order to elucidate the possible role of the inversion in the girl's abnormal phenotype, we analyzed the inversion breakpoints. FISH analysis revealed BAC clones spanning the breakpoints at 2p and 2q of the inversion. Southern blot hybridization with DNA probes from the BAC regions was used to refine the localization of the breakpoints, followed by inverse-PCR which enabled us to sequence the inversion breakpoints. We found a complex chromosomal rearrangement, including five breakpoints, four at 2q and one at 2p joined with minor insertions/deletions of a few bases. The breakpoint at 2p was within the NRXN1 gene that has previously been associated with autism, intellectual disabilities, and psychiatric disorders. In 2q, the breakpoints disrupted two genes, TANC1 and RBMS1; the phenotypic effect of these genes is not currently known. Copyright © 2011 Wiley-Liss, Inc.

The Impact of Forced Migration on Mortality: A Cohort Study of 242,075 Finns from 1939-2010.

Science.gov (United States)

Haukka, Jari; Suvisaari, Jaana; Sarvimäki, Matti; Martikainen, Pekka

2017-07-01

The stresses and life changes associated with migration may have harmful long-term health effects, especially for mental health. These effects are exceedingly difficult to establish, because migrants are typically a highly selected group. We examined the impact of migration on health using "naturally occurring" historical events. In this article, we use the forced migration of 11% of the Finnish population after WWII as such a natural experiment. We observed the date and cause of death starting from 1 January 1971 and ending in 31 December 2010 for the cohort of 242,075 people. Data were obtained by linking individual-level data from the 1950 and 1970 population censuses and the register of death certificates from 1971 to 2010 (10% random sample). All-cause and cause-specific mortalities were modeled using Poisson regression. Models with full adjustment for background variables showed that both all-cause mortality (RR 1.03, 95% CI 1.01, 1.05), and ischemic heart disease mortality (RR 1.11, 95% CI 1.08, 1.15) were higher in the displaced population than in the nondisplaced population. Suicide mortality was lower (RR 0.77, 95% CI 0.64, 0.92) in displaced than in the general population. In our long-term follow-up study, forced migration was associated with increased risk of death due to ischemic heart diseases. In contrast, lower suicide mortality was observed in association with forced migration 25 years or more.

A 242-year seasonal-resolved speleothem record from Hainan Island: A window into variability of the precipitation δ18O in East Asia

Science.gov (United States)

Cai, Y.; An, Z.; Cheng, H.; Edwards, R. L.; Fung, I. Y.; Zhang, H.; Tan, L.; Bi, H.

2016-12-01

Hainan Island is located at the gateway of East Asian summer monsoon to the continent. The typical tropical monsoon climate at Hainan island is characterized by wet season during the summer and autumn and dry season during the winter and spring. Here, we present a seasonal resolved speleothem record spanning 242 years ( 50-292 AD) from Xianren Cave (E109°25`, N18°34`), which is situated in the Baoting County, Hainan Province. The monitoring inside the cave shows that the relative humidity kept saturated during the observed periods (one and half years) while the temperature varied seasonally following the temperature changes outside the cave, but with much smaller amplitude. Monthly observation of drip water inside the cave indicates that the isotope composition of drip water mainly responds to the changes in the precipitation isotope composition with less than two months' resident time. The visible annual lamination and distinct fluctuations of calcite Mg, Sr and Ba concentrations corroborate that the high-frequency oscillations of calcite δ18O largely capture the seasonal variation of the isotope composition of precipitation, although the temperature effect cannot be excluded. By setting the heaviest value of annual variation of calcite δ18O as the beginning of each annual cycle, we transferred the δ18O record of 11.2 cm in depth to a δ18O record of 242-year in age. The δ18O record of stalagmite XR-3 demonstrate clearly the annual, decadal and multi-decadal variations of amplitude from 2 to 4‰, in addition to the seasonal oscillation of amplitude varied from 1.5 to 2.5‰. The ensemble empirical mode decomposition results show that the dominant variability (54.6% of the total variance) is captured by the components at the timescale of 3-7 year, while the components on timescales of 22-24 -year, 80-year and 120-year capture 35.0%, 7.0% and 3.4% of the variance, respectively. We contribute the variability of speleothem δ18O at the timescale of 3-7 -year to

The production of {sup 238-242}Pu(n,γ){sup 239-243}Pu fissionable fluids in a fusion-fission hybrid reactor

Energy Technology Data Exchange (ETDEWEB)

Guenay, Mehtap [Inoenue Univ., Malatya (Turkey). Physics Dept.

2014-03-15

In this study, the effect of spent fuel grade plutonium content on {sup 239-243}Pu was investigated in a designed hybrid reactor system. In this system, the fluids were composed of a molten salt, heavy metal mixture with increased mole fractions 99-95 % Li{sub 20}Sn{sub 80}-1-5 % SFG-Pu, 99-95 % Li{sub 20}Sn{sub 80}-1-5 % SFG-PuF{sub 4}, 99-95 % Li{sub 20}Sn{sub 80}-1-5 % SFG-PuO{sub 2}. Beryllium (Be) is a neutron multiplier by (n,2n) reactions. Thence, a Be zone of 3 cm thickness was used in order to contribute to fissile fuel breeding between the liquid first wall and a 9Cr2WVTa ferritic steel blanket which is used as structural material. The production of {sup 238-242}Pu(n,γ){sup 239-243}Pu was calculated in liquid first wall, blanket and shielding zones. Three-dimensional nucleonic calculations were performed by using the most recent version MCNPX-2.7.0 Monte Carlo code and nuclear data library ENDF/B-VII.0. (orig.)

A Diagnostic and Therapeutic Algorithm for Impacted Teeth for Plastic Surgeons: Outcomes of 242 Extracted Teeth

Directory of Open Access Journals (Sweden)

Nebil Yeşiloğlu

2016-09-01

Full Text Available Objective: Impacted teeth are important for plastic surgeons that frequently perform maxillofacial operations because of their tendency to affect dental occlusion, and thus, cephalometric results. Moreover, severe complications are also caused by the tooth and its surgical removal. In this study, retrospective analysis of 242 extracted teeth and 24 extracted roots was performed and an algorithmic approach to different types and the localizations of impacted teeth was presented. Possible complications and salvage procedures were also discussed. Material and Methods: A retrospective analysis of 128 patients who underwent impacted teeth removal surgery between 2013 and 2015 was performed. Mean age was 26 years (Range: 18–42 years, and the female to male ratio was 39/89. Sixteen of the patients were operated under regional nerve block, whereas the remaining were operated under general anesthesia. In 107 patients, the whole tooth was removed, whereas the residual root of the tooth was removed in 21 patients. In 89 patients, bone interventions like the creation of bone window or peridental milling to loosen the tooth were needed, whereas only oral mucosal incisions were performed in the remaining patients. Results: The most common onset symptom was localized pain, and the most common complications were swelling and edema. The most common extracted tooth was the mandibular 3rd molar. Lower lip hypoesthesia, which was continued up to eight months, was encountered in six patients who underwent mandibular 3rd molar extraction. Conclusion: In our opinion, a wide range of possible complications secondary to impacted teeth surgery makes them important for plastic surgeons who are more experienced than other disciplines, and learning teeth extraction is essential to learn in plastic surgery specialty training.

Simultaneous measurement of 239Pu, 240Pu, 241Pu, and 242Pu by high resolution inductively coupled plasma mass spectrometer (HR ICP-MS) in marine sediments

International Nuclear Information System (INIS)

Bruneau, F.

1999-01-01

Transuranics elements are of particular interest in radioecological studies because of their radiotoxicity and their potential use to decipher source fingerprints and transport processes. The simultaneous measurement of 239 Pu, 240 Pu, 241 Pu, and 242 Pu in environmental samples requires a specific chemical procedure. This work deals with an analytical procedure which yields a very high grade of purification of Pu suitable for ultra low level detection by HR ICP-MS, from marine sediments. After the elimination of major elements (Fe, Al, Mg...) by a first chromatographic separation, a new device of purification by solvent extraction and concentration by a second chromatographic separation is used to obtain a concentrated and high purified solution of plutonium. The chemical procedure have been validated on IAEA certified sediment samples and on sediment samples collected in the roads of Cherbourg which had been previously analysed by other techniques (a spectrometry and thermo-ionisation mass spectrometer). (author)

Chemical consequences of radioactive decay. 1. Study of 249Cf ingrowth into crystalline 249BkBr3: a new crystalline phase of CfBr3

International Nuclear Information System (INIS)

Young, J.P.; Haire, R.G.; Peterson, J.R.; Ensor, D.D.; Fellows, R.L.

1980-01-01

Spectrophotometric and x-ray powder diffraction methods have been applied to a study of the ingrowth of californium-249 by β - decay of berkelium-249 in crystalline 249 BkBr 3 . It was found that the Cf daughter grows in with the same oxidation state and crystal structure as the parent. Thus, six-coordinate BkBr 3 (AlCl 3 -type monoclinic structure) generates six-coordinate CfBr 3 , and eight-coordinate BkBr 3 (PuBr 3 -type orthorhombic structure) generates eight-coordinate CfBr 3 , a previously unknown form of CfBr 3 . It was also found that the daughter Cf(III) in the BkBr 3 parent compound can be reduced to Cf(II) by treatment with H 2 , as it can in pure CfBr 3 . 5 figures

Nuclear fission and the transuranium elements

International Nuclear Information System (INIS)

Seaborg, G.T.

1989-02-01

Many of the transuranium elements are produced and isolated in large quantities through the use of neutrons furnished by nuclear fission reactions: plutonium (atomic number 94) in ton quantities; neptunium (93), americium (95), and curium (96) in kilogram quantities; berkelium (97) in 100 milligram quantities; californium (98) in gram quantities; and einsteinium (99) in milligram quantities. Transuranium isotopes have found many practical applications---as nuclear fuel for the large-scale generation of electricity, as compact, long-lived power sources for use in space exploration, as means for diagnosis and treatment in the medical area, and as tools in numerous industrial processes. Of particular interest is the unusual chemistry and impact of these heaviest elements on the periodic table. This account will feature these aspects. 9 refs., 5 figs

Nuclear fission and the transuranium elements

Energy Technology Data Exchange (ETDEWEB)

Seaborg, G.T.

1989-02-01

Many of the transuranium elements are produced and isolated in large quantities through the use of neutrons furnished by nuclear fission reactions: plutonium (atomic number 94) in ton quantities; neptunium (93), americium (95), and curium (96) in kilogram quantities; berkelium (97) in 100 milligram quantities; californium (98) in gram quantities; and einsteinium (99) in milligram quantities. Transuranium isotopes have found many practical applications---as nuclear fuel for the large-scale generation of electricity, as compact, long-lived power sources for use in space exploration, as means for diagnosis and treatment in the medical area, and as tools in numerous industrial processes. Of particular interest is the unusual chemistry and impact of these heaviest elements on the periodic table. This account will feature these aspects. 9 refs., 5 figs.

Effect of (3,5,6-trimethylpyrazin-2-yl)methyl 2-[4-(2-methylpropyl)phenyl]propanoate (ITE), a newly developed anti-inflammatory drug, on type II collagen-induced arthritis in mice.

Science.gov (United States)

Ma, Tao; Cao, Ying-Lin; Xu, Bei-Bei; Zhou, Xiao-Mian

2004-06-01

The effect of (3,5,6-trimethylpyrazin-2-yl)methyl 2-[4-(2-methylpropyl)phenyl]propanoate (ITE) on type II collagen (CII)-induced arthritis in mice was studied. Mice were immunized twice with CII, ITE being given orally once a day for 40 d after the 1st immunization. Clinical assessment showed that ITE had no effect on the day of onset of arthritis but did lowered the incidence rate of arthritis and the arthritis score. And ITE had a marked suppressive effect on the mouse hind paw edema induced by CII. ITE suppressed the delayed-type mouse ear skin reaction to CII but had no effect on the level of serum anti-CII antibodies. These results suggest that ITE inhibits the development of CII-induced arthritis in mice by suppressing delayed-type hypersensitivity to CII.

Unraveling the reaction mechanism on nitrile hydration catalyzed by [Pd(OH2)4]2+: insights from theory.

Science.gov (United States)

Tílvez, Elkin; Menéndez, María I; López, Ramón

2013-07-01

Density functional theory methodologies combined with continuum and discrete-continuum descriptions of solvent effects were used to investigate the [Pd(OH2)4](2+)-catalyzed acrylonitrile hydration to yield acrylamide. According to our results, the intramolecular hydroxide attack mechanism and the external addition mechanism of a water molecule with rate-determining Gibbs energy barriers in water solution of 27.6 and 28.3 kcal/mol, respectively, are the most favored. The experimental kinetic constants of the hydration started by hydroxide, k(OH), and water, k(H2O), attacks for the cis-[Pd(en)(OH2)2](2+)-catalyzed dichloroacetonitrile hydration rendered Gibbs energy barriers whose energy difference, 0.7 kcal/mol, is the same as that obtained in the present study. Our investigation reveals the nonexistence of the internal attack of a water ligand for Pd-catalyzed nitrile hydration. At the low pHs used experimentally, the equilibrium between [Pd(OH2)3(nitrile)](2+) and [Pd(OH2)2(OH)(nitrile)](+) is completely displaced to [Pd(OH2)3(nitrile)](2+). Experimental studies in these conditions stated that water acts as a nucleophile, but they could not distinguish whether it was a water ligand, an external water molecule, or a combination of both possibilities. Our theoretical explorations clearly indicate that the external water mechanism becomes the only operative one at low pHs. On the basis of this mechanistic proposal it is also possible to ascribe an (1)H NMR signal experimentally detected to the presence of a unidentate iminol intermediate and to explain the influence of nitrile concentration reported experimentally for nitriles other than acrylonitrile in the presence of aqua-Pd(II) complexes. Therefore, our theoretical point of view on the mechanism of nitrile hydration catalyzed by aqua-Pd(II) complexes can shed light on these relevant processes at a molecular level as well as afford valuable information that can help in designing new catalysts in milder and more

Total neutron cross sections of berkelium-249 and californium-249 below 100 eV

International Nuclear Information System (INIS)

Benjamin, R.W.; Harvey, J.A.; Hill, N.W.; Pandey, M.S.; Carlton, R.F.

1979-01-01

The neutron total cross sections of 249 Bk and 249 Cf have been measured from 0.03 to 100 eV using the Oak Ridge Electron Linear Accelerator (ORELA) as a source of pulsed neutrons. The 1.6 mm dia. cylindrical transmission samples contained initially up to 5.3 mg of 98% 249 Bk and 2% 249 Cf: 4.5 years later, when the final measurements were made, the composition of the samples had become 2.5% 249 Bk, 96.9% 249 Cf, and 0.6% 245 Cm. Samples were cooled with liquid nitrogen to reduce Doppler broadening. Thirty-nine resonances were identified in 249 Bk and analyzed using a single-level Breit-Wigner formalism. Fifty-five resonances were identified in 249 Cf and analyzed using an R-matrix multilevel formalism. Fifty-five resonances were identified in 249 Cf and analyzed using an R-matrix multilevel formalism. The resonance parameters obtained have been used to determine the average level spacings and the s-wave neutron and fission strength functions. Where possible, bound-level parameters were derived to fit the thermal neutron total cross section data

The fission cross sections of 230Th, 232Th, 233U, 234U, 236U, 238U, 237Np, 239Pu and 242Pu relative 235U at 14.74 MeV neutron energy

International Nuclear Information System (INIS)

Meadows, J.W.

1986-12-01

The measurement of the fission cross section ratios of nine isotopes relative to 235 U at an average neutron energy of 14.74 MeV is described with particular attention to the determination of corrections and to sources of error. The results are compared to ENDF/B-V and to other measurements of the past decade. The ratio of the neutron induced fission cross section for these isotopes to the fission cross section for 235 U are: 230 Th - 0.290 +- 1.9%; 232 Th - 0.191 +- 1.9%; 233 U - 1.132 +- 0.7%; 234 U - 0.998 +- 1.0%; 236 U - 0.791 +- 1.1%; 238 U - 0.587 +- 1.1%; 237 Np - 1.060 +- 1.4%; 239 Pu - 1.152 +- 1.1%; 242 Pu - 0.967 +- 1.0%. 40 refs., 11 tabs., 9 figs

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFC242 (Link to dictyBase) - - - Contig-U16280-1 VFC242F (Link... to Original site) VFC242F 431 - - - - - - Show VFC242 Library VF (Link to library) Clone ID VFC242 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16280-1 Original site URL http://dict...3( S18663 ) coronin - slime mold (Dictyostelium discoideum) ... 270 1e-71 AY52578...asmic 4.0 %: cytoskeletal 4.0 %: vesicles of secretory system >> prediction for VFC242 is nuc 5' end seq. ID

Identification of the new isotope sup 2 sup 4 sup 1 Bk

CERN Document Server

Asai, M; Ichikawa, S; Nagame, Y; Nishinaka, I; Akiyama, K; Toyoshima, A; Kaneko, T; Sakama, M; Haba, H; Oura, Y; Kojima, Y; Shibata, M

2003-01-01

A new neutron-deficient berkelium isotope sup 2 sup 4 sup 1 Bk produced in the sup 2 sup 3 sup 9 Pu( sup 6 Li, 4n) reaction has been identified using a gas-jet coupled on-line isotope separator. Cm K and L X-rays associated with the EC decay of sup 2 sup 4 sup 1 Bk were observed in the mass-241 fraction, and three gamma transitions were attributed to the EC decay of sup 2 sup 4 sup 1 Bk through X-gamma coincidences. The half-life of sup 2 sup 4 sup 1 Bk was determined to be 4.6+-0.4 min which is 1/2-1/4 of that of theoretical predictions. The half-life value and the observed gamma transitions can be consistently explained as a consequence of the allowed EC transition of pi 7/2 sup + [633] -> nu 7/2 sup + [624]. (orig.)

Reactor production of 252Cf and transcurium isotopes

International Nuclear Information System (INIS)

Alexander, C.W.; Halperin, J.; Walker, R.L.; Bigelow, J.E.

1990-01-01

Berkelium, californium, einsteinium, and fermium are currently produced in the High Flux Isotope Reactor (HFIR) and recovered in the Radiochemical Engineering Development Center (REDC) at the Oak Ridge National Laboratory (ORNL). All the isotopes are used for research. In addition, 252 Cf, 253 Es, and 255 Fm have been considered or are used for industrial or medical applications. ORNL is the sole producer of these transcurium isotopes in the western world. A wide range of actinide samples were irradiated in special test assemblies at the Fast Flux Test Facility (FFTF) at Hanford, Washington. The purpose of the experiments was to evaluate the usefulness of the two-group flux model for transmutations in the special assemblies with an eventual goal of determining the feasibility of producing macro amounts of transcurium isotopes in the FFTF. Preliminary results from the production of 254g Es from 252 Cf will be discussed. 14 refs., 5 tabs

Actinide metals

Energy Technology Data Exchange (ETDEWEB)

Brown, Paul L. [Geochem Australia, Kiama, NSW (Australia); Ekberg, Christian [Chalmers Univ. of Technology, Goeteborg (Sweden). Nuclear Chemistry/Industrial Materials Recycling

2016-07-01

All isotopes of actinium are radioactive and exist in aqueous solution only in the trivalent state. There have been very few studies on the hydrolytic reactions of actinium(III). The hydrolysis reactions for uranium would only be important in alkaline pH conditions. Thermodynamic parameters for the hydrolysis species of uranium(VI) and its oxide and hydroxide phases can be determined from the stability and solubility constants. The hydrolytic behaviour of neptunium(VI) is quite similar to that of uranium(VI). The solubility constant of NpO{sub 2}OH(am) has been reported a number of times for both zero ionic strength and in fixed ionic strength media. Americium can form four oxidation states in aqueous solution, namely trivalent, tetravalent, pentavalent and hexavalent. Desire, Hussonnois and Guillaumont determined stability constants for the species AmOH{sup 2+} for the actinides, plutonium(III), americium(III), curium(III), berkelium(III) and californium(III) using a solvent extraction technique.

Actinide metals

International Nuclear Information System (INIS)

Brown, Paul L.; Ekberg, Christian

2016-01-01

All isotopes of actinium are radioactive and exist in aqueous solution only in the trivalent state. There have been very few studies on the hydrolytic reactions of actinium(III). The hydrolysis reactions for uranium would only be important in alkaline pH conditions. Thermodynamic parameters for the hydrolysis species of uranium(VI) and its oxide and hydroxide phases can be determined from the stability and solubility constants. The hydrolytic behaviour of neptunium(VI) is quite similar to that of uranium(VI). The solubility constant of NpO 2 OH(am) has been reported a number of times for both zero ionic strength and in fixed ionic strength media. Americium can form four oxidation states in aqueous solution, namely trivalent, tetravalent, pentavalent and hexavalent. Desire, Hussonnois and Guillaumont determined stability constants for the species AmOH 2+ for the actinides, plutonium(III), americium(III), curium(III), berkelium(III) and californium(III) using a solvent extraction technique.

Nuclear Chemistry Institute, Mainz University. Annual Report 1995

International Nuclear Information System (INIS)

Denschlag, H.O.

1996-03-01

The annual report of the Institut fuer Kernchemie addresses inter alia three main research activities. The first belongs to the area of basic research, covering studies in the fields of nuclear fission, chemistry of the super-heavy elements and of heavy-ion reactions extending from the Coulomb barrier to relativistic energies, and nuclear astrophysics in connection with the ''r process''. By means of laser technology, high-precision data could be measured of the ionization energies of berkelium and californium. Studies of atomic clusters in the vacuum of an ionization trap revealed interesting aspects. The second major activity was devoted to the analysis of environmental media, applying inter alia neutron activation analysis and resonance ionization mass spectroscopy (RIMS). The third activity resulted in the development of novel processes, or the enhancement of existing processes or methods, for applications in basic research work and in environmental analytics. Another item of interest is the summarizing report on the operation of the TRIGA research reactor. (orig./SR) [de

Remarkably High Stability of Late Actinide Dioxide Cations: Extending Chemistry to Pentavalent Berkelium and Californium.

Science.gov (United States)

Dau, Phuong D; Vasiliu, Monica; Peterson, Kirk A; Dixon, David A; Gibson, John K

2017-12-06

Actinyl chemistry is extended beyond Cm to BkO 2 + and CfO 2 + through transfer of an O atom from NO 2 to BkO + or CfO + , establishing a surprisingly high lower limit of 73 kcal mol -1 for the dissociation energies, D[O-(BkO + )] and D[O-(CfO + )]. CCSD(T) computations are in accord with the observed reactions, and characterize the newly observed dioxide ions as linear pentavalent actinyls; these being the first Bk and Cf species with oxidation states above IV. Computations of actinide dioxide cations AnO 2 + for An=Pa to Lr reveal an unexpected minimum for D[O-(CmO + )]. For CmO 2 + , and AnO 2 + beyond EsO 2 + , the most stable structure has side-on bonded η 2 -(O 2 ), as An III peroxides for An=Cm and Lr, and as An II superoxides for An=Fm, Md, and No. It is predicted that the most stable structure of EsO 2 + is linear [O=Es V =O] + , einsteinyl, and that FmO 2 + and MdO 2 + , like CmO 2 + , also have actinyl(V) structures as local energy minima. The results expand actinide oxidation state chemistry, the realm of the distinctive actinyl moiety, and the non-periodic character towards the end of the periodic table. © 2017 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

A model for the Lin-Shu type density-wave structure of our Galaxy: Line-of-sight and transverse-longitudinal velocities of 242 optically visible open clusters

Science.gov (United States)

Griv, E.; Jiang, I.-G.

2015-02-01

In this paper, the fourth in a series, we examine again one of the implications of the Lin-Shu density-wave theory, specifically, the noncircular systematic motion of the Galactic objects. Our previous investigation is extended by analyzing simultaneously both the line-of-sight and transversal velocities of a sample of open clusters for which velocities, distances and ages are available. The ordinary equations of the Oort-Lindblad theory of galactic differential rotation are used. The minor effects caused by the two-dimensional tightly-wound density waves are also taken into account. The published data of 242 currently known optically visible clusters having distances rsight and transversal along the Galactic longitude velocities are nearly equal. We argue that the resemblance of these Galactic wave structures is so remarkable that no doubt is felt as to the theory's truth with respect to these data. The results obtained allow us to conclude that several low-m trailing density-wave patterns with different number of spiral arms m (say, m=1, 2, 3, and 4), pitch angles (about 5o, 8o, 11o, and 14o, respectively) and amplitudes of the perturbed gravitational potential may coexist in the Galaxy. The latter suggests the asymmetric multiarm, not well-organized (``flocculent'') spiral structure of the system. In memory of Professors Alexei M. Fridman (1940-2010) and Chi Yuan (1937-2008)

Prevalência e padrão de distribuição das doenças cerebrovasculares em 242 idosos, procedentes de um hospital geral, necropsiados em Belo Horizonte, Minas Gerais, no período de 1976 a 1997 Prevalence and types of cerebrovascular diseases in 242 hospitalized elderly patients, autopsied in Belo Horizonte, Minas Gerais, Brazil, from 1976 to 1997

Directory of Open Access Journals (Sweden)

José Eymard H. Pittella

2002-03-01

Full Text Available OBJETIVO: Descrever a prevalência e os tipos das doenças cerebrovasculares (DCVs em indivíduos idosos necropsiados. MÉTODO: Foram consultados os laudos neuropatológicos de 242 pacientes com idade igual ou superior a 61 anos, procedentes em sua maioria do Hospital das Clínicas da Universidade Federal de Minas Gerais, em Belo Horizonte, Minas Gerais, e necropsiados consecutivamente no período 1976 a 1997. RESULTADO: Os principais grupos de doenças do sistema nervoso central (SNC foram representados por DCVs (71,9%, infecções (12,4%, neoplasias (7,1%, traumatismos crânio-encefálicos (3,7%, doenças nutricionais (2,5% e doenças degenerativas (1,7%. As DCVs mais frequentes foram: aterosclerose (61,2%, doença cerebrovascular hipertensiva (25,6% e infarto cerebral (14,9%. Observou-se aumento da frequência e da gravidade da aterosclerose e da frequência da doença cerebrovascular hipertensiva com o avançar da idade. Houve associação significativa entre doença cerebrovascular hipertensiva e aterosclerose. As DCVs foram clinicamente sintomáticas e as responsáveis diretas pelo óbito em 42,7% e 17,3% dos pacientes, respectivamente. CONCLUSÃO: As DCVs constituíram o principal grupo de doenças do SNC no idoso. A aterosclerose e a doença cerebrovascular hipertensiva foram as principais doenças deste grupo, notando-se aumento de sua frequência com o avançar da idade e associação significativa entre ambas.OBJECTIVE: To describe the prevalence and the types of cerebrovascular diseases (CVDs in autopsied elderly individuals. METHOD: Consecutive clinical charts and neuropathological reports of 242 patients aged 61 years or older were reviewed. The patients died in Hospital das Clínicas, Federal University of Minas Gerais, in Belo Horizonte, Minas Gerais, Brazil, from 1976 to 1997. RESULTS: The prevalent diseases of the central nervous system (CNS found in decreasing order were: CVDs (71.9%, infections (12.4%, neoplasms (7.1%, head

Pages 242 - 248.pmd

African Journals Online (AJOL)

Administrator

Department of Paediatrics and Child Health Makerere University, Kampala, Uganda. 2. Department of ... several times each day, often during meals, and in ..... Figure 2: The smaller patient has Nodding syndrome and is the same age as the taller adolescent who is of the ... Onchocerca volvulus in the CSF confirms our lack.

Zebrafish model of tuberous sclerosis complex reveals cell-autonomous and non-cell-autonomous functions of mutant tuberin

Directory of Open Access Journals (Sweden)

Seok-Hyung Kim

2011-03-01

Tuberous sclerosis complex (TSC is an autosomal dominant disease caused by mutations in either the TSC1 (encodes hamartin or TSC2 (encodes tuberin genes. Patients with TSC have hamartomas in various organs throughout the whole body, most notably in the brain, skin, eye, heart, kidney and lung. To study the development of hamartomas, we generated a zebrafish model of TSC featuring a nonsense mutation (vu242 in the tsc2 gene. This tsc2vu242 allele encodes a truncated Tuberin protein lacking the GAP domain, which is required for inhibition of Rheb and of the TOR kinase within TORC1. We show that tsc2vu242 is a recessive larval-lethal mutation that causes increased cell size in the brain and liver. Greatly elevated TORC1 signaling is observed in tsc2vu242/vu242 homozygous zebrafish, and is moderately increased in tsc2vu242/+ heterozygotes. Forebrain neurons are poorly organized in tsc2vu242/vu242 homozygous mutants, which have extensive gray and white matter disorganization and ectopically positioned cells. Genetic mosaic analyses demonstrate that tsc2 limits TORC1 signaling in a cell-autonomous manner. However, in chimeric animals, tsc2vu242/vu242 mutant cells also mislocalize wild-type host cells in the forebrain in a non-cell-autonomous manner. These results demonstrate a highly conserved role of tsc2 in zebrafish and establish a new animal model for studies of TSC. The finding of a non-cell-autonomous function of mutant cells might help explain the formation of brain hamartomas and cortical malformations in human TSC.

Tumor markers for diagnosis, monitoring of recurrence and prognosis in patients with upper gastrointestinal tract cancer.

Science.gov (United States)

Jing, Jie-Xian; Wang, Yan; Xu, Xiao-Qin; Sun, Ting; Tian, Bao-Guo; Du, Li-Li; Zhao, Xian-Wen; Han, Cun-Zhi

2014-01-01

To evaluate the value of combined detection of serum CEA, CA19-9, CA24-2, AFP, CA72-4, SCC, TPA and TPS for the clinical diagnosis of upper gastrointestinal tract (GIT) cancer and to analyze the efficacy of these tumor markers (TMs) in evaluating curative effects and prognosis. A total of 573 patients with upper GIT cancer between January 2004 and December 2007 were enrolled in this study. Serum levels of CEA, CA19-9, CA24-2, AFP, CA72-4, SCC, TPA and TPS were examined preoperatively and every 3 months postoperatively by ELISA. The sensitivity of CEA, CA19-9, CA24-2, AFP, CA72-4, SCC, TPA and TPS were 26.8%, 36.2%, 42.9%, 2.84%, 25.4%, 34.6%, 34.2% and 30.9%, respectively. The combined detection of CEA+CA199+CA242+CA724 had higher sensitivity and specificity in gastric cancer (GC) and cardiac cancer, while CEA+CA199+CA242+SCC was the best combination of diagnosis for esophageal cancer (EC). Elevation of preoperative CEA, CA19-9 and CA24-2, SCC and CA72-4 was significantly associated with pathological types (pCEA, CA19-9, CA24-2, CA72-4 and SCC decreased obviously 3 months after operations. When metastasis and recurrence occurred, the levels of TMs significantly increased. On multivariate analysis, high preoperative CA72-4, CA24-2 and SCC served as prognostic factors for cardiac carcinoma, GC and EC, respectively. combined detection of CEA+CA199+CA242+SCC proved to be the most economic and practical strategy in diagnosis of EC; CEA+CA199+CA242+CA724 proved to be a better evaluation indicator for cardiac cancer and GC. CEA and CA19-9, CA24-2, CA72-4 and SCC, examined postoperatively during follow-up, were useful to find early tumor recurrence and metastasis, and evaluate prognosis. AFP, TPA and TPS have no significant value in diagnosis of patients with upper GIT cancer.

Evaluation of thermal neutron cross-sections and resonance integrals of protactinium, americium, curium, and berkelium isotopes

International Nuclear Information System (INIS)

Belanova, T.S.

1994-12-01

Data on the thermal neutron fission and capture cross-sections as well as their corresponding resonance integrals are reviewed and analysed. The data are classified according to the form of neutron spectra under investigation. The weighted mean values of the cross-sections and resonance integrals for every type of neutron spectra were adopted as evaluated data. (author). 87 refs, 2 tabs

Extraction of transplutonium elements from carbonate solutions by alkylpyrocatechol

International Nuclear Information System (INIS)

Karalova, Z.K.; Myasoedov, B.F.; Rodionova, L.M.; Kuznetsova, V.S.

1983-01-01

Extraction of americium, berkelium as well as Ce, Eu, Th, U, Zr, Cs, Fe with solution of 4(α, α-dioctylethyl)pyrocatechol (DOP) in toluene from carbonate solutions to determine conditions of their separation has been studied. It is established that americium extraction is quite sensitive to the changes of potassium carbonate concentration. The maximum extraction of americium (R >90%) is observed in the case of 0.1-0.5 mol/l of K 2 CO 3 solutions and the minimum one (R=2.5%) - in the case of 8 mol/l K 2 CO 3 . Americium extraction increases sharply when sodium hydroxide is introduced in carbonate solutions. It is shown that varying sodium hydroxide concentration it is possible to achieve qualitative extraction of americium even from saturated solution of potassium carbonate. Reextraction of TPE is easily realized with 3 mol/l HCl solution. The system K 2 CO 3 (KOH)-DOP proved to be perspective for Am separation from Bk, Ce, Cs, actinoid elements as well as from Fe

Radiochemical determination of the neutron capture cross sections of {sup 241}Am irradiated in the JMTR reactor

Energy Technology Data Exchange (ETDEWEB)

Shinohara, N.; Hatsukawa, Y.; Hata, K.; Kohno, N. [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment

1997-03-01

The thermal neutron capture cross section {sigma}{sub 0} and Resonance integral I{sub 0} of {sup 241}Am leading to the production of {sup 242m}Am and {sup 242g}Am were measured by radiochemical method. The cross sections obtained in this study are {sigma}{sub 0}=60.9 {+-} 2.6 barn, I{sub 0}=213 {+-} 13 barn for {sup 241}Am(n,{gamma}){sup 242m}Am and {sigma}{sub 0}=736 {+-} 31 barn, I{sub 0}=1684 {+-} 92 barn for {sup 241}Am(n,{gamma}){sup 242g}Am. (author)

Comparison of fission and capture cross sections of minor actinides

International Nuclear Information System (INIS)

Nakagawa, Tsuneo; Iwamoto, Osamu

2003-01-01

The fission and capture cross sections of minor actinides given in JENDL-3.3 are compared with other evaluated data and experimental data. The comparison was made for 32 nuclides of Th-227, 228, 229, 230, 233, 234, Pa-231, 232, 233, U-232, 234, 236, 237, Np-236, 237, 238, Pu-236, 237, 238, 242, 244, Am-241, 242, 242m, 243, Cm-242, 243, 244, 245, 246, 247 and 248. Given in the present report are figures of these cross sections and tables of cross sections at 0.0253 eV and resonance integrals. (author)

Effects of a superantigen-antibody recombinant fusion protein (r-C242 Fab-SEA) on toxicological responses in the anaesthetised rabbit

International Nuclear Information System (INIS)

Ilbaeck, Nils-Gunnar; Gunnarsson, Kjell; Persson, Robert; Lindh, Ulf; Staaalhandske, Torbjoern

2003-01-01

The objective was to study toxin-induced effects on physiological parameters in the rabbit and whether these parameters show dose-response and co-variation after administration of a recombinant fusion protein between staphylococcal enterotoxin (SE) and the Fab fragment of an antibody. Rabbits are very sensitive to SE toxins and the cardiovascular and immune effects are similar to those observed in septic shock in man. The test compound, r-C242 Fab-SEA, was administered intravenously to anaesthetised New Zealand white rabbits at doses in the range of 0.00005-50 μg/kg. All rabbits were checked for titres of anti-SEA antibodies before entering the experiment, since they could neutralise the effect of the test compound. Heart rate, blood pressure and body temperature were continuously monitored before and during 6 h after dosing. Immediately before the start of administration and 3 and 6 h during the experiment, blood gases (pO 2 and pCO 2 ), pH, haematology, clinical chemistry, cytokine response (TNF-α) and trace elements (Mn, Cu, Zn, Se, Ag, Cd, Hg and Pb) were measured. No mortality occurred, but at 50 μg/kg severe adverse clinical signs developed. The decrease in blood pressure was weakly dose-related. Heart rate, ECG, body temperature, pCO 2 and pH were not affected by the treatment. pO 2 tended to increase as a function of time, but not in relation to dose. WBC and PLT decreased dose dependently. TNF-α was not affected by the treatment. The major effects on clinical chemistry were a dose-dependent increase in AST and creatinine. Potassium and urea showed dose dependent increases, mainly at higher doses, though these changes were of less value for drug selection purposes. Trace element changes were observed, including an increase in Mn and a decrease of Zn at all doses. The Cu/Zn ratio decreased below normal at low doses, whereas at high doses in which adverse effects developed, it increased above normal. Post mortem examination revealed minimal to moderate

Energy Magazine. V. 24(2)

International Nuclear Information System (INIS)

1999-01-01

In this issue, there are two articles related to the thematic of the Conference on energy efficiency and renewable resources, Eurolac 2000. Some examples of actions for energy conservation and for improvement of the regional energetic efficiency are described

17 CFR 242.500 - Definitions.

Science.gov (United States)

2010-04-01

.... market is not the principal trading market. Public appearance means any participation by a research... activities of research analysts or the content of research reports; and (ii) If the broker or dealer... broker or dealer from influencing the activities of research analysts and the content of research reports...

32 CFR 242.3 - Definitions.

Science.gov (United States)

2010-07-01

... ADMISSION POLICIES AND PROCEDURES FOR THE SCHOOL OF MEDICINE, UNIFORMED SERVICES UNIVERSITY OF THE HEALTH... Health Service. (b) Military Personnel. For purposes of this Directive, “Military Personnel” shall... or more in any of the three Military Departments. (2) Reserve component personnel enrolled in the...

24 CFR 242.16 - Applications.

Science.gov (United States)

2010-04-01

... evaluate any other factors, including but not limited to risk to the Insurance Fund, that should be... relationships that help optimize financial, clinical, and operational performance; (vii) Management's demonstrated ability to operate effectively and efficiently, and to develop effective strategies for addressing...

19 CFR 10.242 - Definitions.

Science.gov (United States)

2010-04-01

... “beneficiary country” as defined in § 10.202(a) for purposes of the ATPA which the President also has... articles under 19 U.S.C. 3203(b)(3) and which has been the subject of a determination by the President or... entered into by the United States, Canada, and Mexico on December 17, 1992. Preferential treatment...

36 CFR 242.4 - Definitions.

Science.gov (United States)

2010-07-01

... Administrative Code. Barter means the exchange of fish or wildlife or their parts taken for subsistence uses; for... boundaries of any unit of the National Park System, National Wildlife Refuge System, National Wild and Scenic Rivers Systems, National Forest Monument, National Recreation Area, National Conservation Area, new...

32 CFR 242.4 - Policies.

Science.gov (United States)

2010-07-01

... section on obligated service requirements.) (b) In making admissions decisions, the School will adhere to... entrance shall be judged strictly on merit, in terms of demonstrated aptitude, motivation, and potential... the extent possible in making Service assignments. However, to insure that the makeup of each entering...

24 CFR 242.77 - Liens.

Science.gov (United States)

2010-04-01

... liens other than the insured mortgage, except that the property may be subject to a lien as provided by... superior lien on accounts receivable as approved by HUD as collateral for a line of credit or other...

24 CFR 242.54 - Nondiscrimination.

Science.gov (United States)

2010-04-01

... and sex discrimination do not affect the eligibility of hospitals for women and children. ... financed with mortgages insured under this part must be made available without discrimination as to race...

24 CFR 242.1 - Definitions.

Science.gov (United States)

2010-04-01

... premiums (MIPs), taxes, ground rents, property insurance premiums, and assessments, when funds available... revenues over expenses (not-for-profit) or net income (for-profit) plus interest expense plus depreciation.... Mortgage Reserve Fund means a trust account, or an account held by the mortgagee, for and on behalf of the...

12 CFR 24.2 - Definitions.

Science.gov (United States)

2010-01-01

... targeted by a governmental entity for redevelopment, or would receive consideration as “qualified... nonbank community development corporations; (3) CDFI Fund-certified Community Development Financial... trusts; (7) Business development companies; (8) Community development closed-end mutual funds; (9) Non...

48 CFR 242.7502 - Procedures.

Science.gov (United States)

2010-10-01

... OF DEFENSE CONTRACT MANAGEMENT CONTRACT ADMINISTRATION AND AUDIT SERVICES Contractor Accounting... significant accounting system or related internal control deficiencies, the ACO will— (1) Provide a copy of... percentage of progress payments or reimbursement of costs proportionate to the estimated cost risk to the...

17 CFR 242.401 - Definitions.

Science.gov (United States)

2010-04-01

... security other than a security future, the most recent closing sale price of the security, as shown by any regularly published reporting or quotation service. If there is no recent closing sale price, the security...: (A) If the instrument underlying such security future is a stock, theproduct of the daily settlement...

48 CFR 242.7501 - Policy.

Science.gov (United States)

2010-10-01

... DEFENSE CONTRACT MANAGEMENT CONTRACT ADMINISTRATION AND AUDIT SERVICES Contractor Accounting Systems and... provide reasonable assurance that— (a) Applicable laws and regulations are complied with; (b) The...

Therapeutic potential of a dual mTORC1/2 inhibitor for the prevention of posterior capsule opacification: An in vitro study.

Science.gov (United States)

Feng, Hao; Yang, Zhibo; Bai, Xue; Yang, Meirong; Fang, Yuan; Zhang, Xiaonan; Guo, Qiqiang; Ning, Hong

2018-04-01

Mammalian target of rapamycin (mTOR) serves a central role in regulating cell growth and survival, and has been demonstrated to be involved in the pathological progression of posterior capsule opacification (PCO). In the present study, the potency of PP242, a novel dual inhibitor of mTOR complex 1/2 (mTORC1/2), in the suppression of the growth of human lens epithelial cells (HLECs) was investigated. Using a Cell Counting Kit‑8 and a wound healing assay, it was demonstrated that PP242 inhibited the proliferation and migration of HLECs. In addition, western blot analysis indicated that PP242 completely inhibited mTORC1 and mTORC2 downstream signaling activities, whereas rapamycin only partially inhibited mTORC1 activity within LECs. Furthermore, PP242 treatment led to an upregulation of the expression levels of p53 and B cell lymphoma‑2 (Bcl‑2)‑associated X and downregulation of Bcl‑2. In addition, flow cytometric analysis demonstrated that PP242 induced the cell cycle arrest at the G0/G1 phase, which may have caused apoptosis and induced autophagy within the LECs. The results of the present study suggested that administration of PP242 may potentially offer a novel therapeutic approach for the prevention of PCO.

The fission cross sections of /sup 230/Th, /sup 232/Th, /sup 233/U, /sup 234/U, /sup 236/U, /sup 238/U, /sup 237/Np, /sup 239/Pu and /sup 242/Pu relative /sup 235/U at 14. 74 MeV neutron energy

Energy Technology Data Exchange (ETDEWEB)

Meadows, J.W.

1986-12-01

The measurement of the fission cross section ratios of nine isotopes relative to /sup 235/U at an average neutron energy of 14.74 MeV is described with particular attention to the determination of corrections and to sources of error. The results are compared to ENDF/B-V and to other measurements of the past decade. The ratio of the neutron induced fission cross section for these isotopes to the fission cross section for /sup 235/U are: /sup 230/Th - 0.290 +- 1.9%; /sup 232/Th - 0.191 +- 1.9%; /sup 233/U - 1.132 +- 0.7%; /sup 234/U - 0.998 +- 1.0%; /sup 236/U - 0.791 +- 1.1%; /sup 238/U - 0.587 +- 1.1%; /sup 237/Np - 1.060 +- 1.4%; /sup 239/Pu - 1.152 +- 1.1%; /sup 242/Pu - 0.967 +- 1.0%. 40 refs., 11 tabs., 9 figs.

Pharmacological TLR4 Inhibition Protects against Acute and Chronic Fat-Induced Insulin Resistance in Rats.

Science.gov (United States)

Zhang, Ning; Liang, Hanyu; Farese, Robert V; Li, Ji; Musi, Nicolas; Hussey, Sophie E

2015-01-01

To evaluate whether pharmacological TLR4 inhibition protects against acute and chronic fat-induced insulin resistance in rats. For the acute experiment, rats received a TLR4 inhibitor [TAK-242 or E5564 (2x5 mg/kg i.v. bolus)] or vehicle, and an 8-h Intralipid (20%, 8.5 mg/kg/min) or saline infusion, followed by a two-step hyperinsulinemic-euglycemic clamp. For the chronic experiment, rats were subcutaneously implanted with a slow-release pellet of TAK-242 (1.5 mg/d) or placebo. Rats then received a high fat diet (HFD) or a low fat control diet (LFD) for 10 weeks, followed by a two-step insulin clamp. Acute experiment; the lipid-induced reduction (18%) in insulin-stimulated glucose disposal (Rd) was attenuated by TAK-242 and E5564 (the effect of E5564 was more robust), suggesting improved peripheral insulin action. Insulin was able to suppress hepatic glucose production (HGP) in saline- but not lipid-treated rats. TAK-242, but not E5564, partially restored this effect, suggesting improved HGP. Chronic experiment; insulin-stimulated Rd was reduced ~30% by the HFD, but completely restored by TAK-242. Insulin could not suppress HGP in rats fed a HFD and TAK-242 had no effect on HGP. Pharmacological TLR4 inhibition provides partial protection against acute and chronic fat-induced insulin resistance in vivo.

Anti-inflammatory and anti-amyloidogenic effects of a small molecule, 2,4-bis(p-hydroxyphenyl-2-butenal in Tg2576 Alzheimer’s disease mice model

Directory of Open Access Journals (Sweden)

Jin Peng

2013-01-01

Full Text Available Abstract Background Alzheimer’s disease (AD is pathologically characterized by excessive accumulation of amyloid-beta (Aβ fibrils within the brain and activation of astrocytes and microglial cells. In this study, we examined anti-inflammatory and anti-amyloidogenic effects of 2,4-bis(p-hydroxyphenyl-2-butenal (HPB242, an anti-inflammatory compound produced by the tyrosine-fructose Maillard reaction. Methods 12-month-old Tg2576 mice were treated with HPB242 (5 mg/kg for 1 month and then cognitive function was assessed by the Morris water maze test and passive avoidance test. In addition, western blot analysis, Gel electromobility shift assay, immunostaining, immunofluorescence staining, ELISA and enzyme activity assays were used to examine the degree of Aβ deposition in the brains of Tg2576 mice. The Morris water maze task was analyzed using two-way ANOVA with repeated measures. Otherwise were analyzed by one-way ANOVA followed by Dunnett’s post hoc test. Results Treatment of HPB242 (5 mg/kg for 1 month significantly attenuated cognitive impairments in Tg2576 transgenic mice. HPB242 also prevented amyloidogenesis in Tg2576 transgenic mice brains. This can be evidenced by Aβ accumulation, BACE1, APP and C99 expression and β-secretase activity. In addition, HPB242 suppresses the expression of inducible nitric oxide synthase (iNOS and cyclooxygenase-2 (COX-2 as well as activation of astrocytes and microglial cells. Furthermore, activation of nuclear factor-kappaB (NF-κB and signal transducer and activator of transcription 1/3 (STAT1/3 in the brain was potently inhibited by HPB242. Conclusions Thus, these results suggest that HPB242 might be useful to intervene in development or progression of neurodegeneration in AD through its anti-inflammatory and anti-amyloidogenic effects.

An incident leading to contamination of the beaches near to the British Nuclear Fuels Limited Windscale and Calder Works, Sellafield November 1983

International Nuclear Information System (INIS)

1984-01-01

The report falls into the sections: executive summary; the inquiry; background to Sellafield operations (history; statutory control); the incident in the reprocessing plant (B205) (plant description; plant procedure; lead up to the incident; detection of the incident; conclusions concerning the incident); the effect on operations in the effluent treatment plant and sea discharge plant (B242/B241) (plant description; plant procedure; events in B242/B241 following the incident in B205; conclusions concerning operations in B242/B241); the effect on operations in the medium active liquid storage plant (B211) (plant description; events in B211 following transfer of waste from B242/B241; conclusions concerning the transfer of waste to B211); environmental aspects (description of events; conclusions concerning environmental aspects); compliance with the liquid waste disposal authorisation; conclusions and recommendations. (U.K.)

48 CFR 242.002 - Interagency agreements.

Science.gov (United States)

2010-10-01

... administration services on their direct purchases from U.S. producers. Direct purchase is the purchase of defense... organizations send their requests for contract administration services to the DoD Central Control Point (CCP) at...

32 CFR 242.5 - Admission procedures.

Science.gov (United States)

2010-07-01

... qualified applicants, based on aptitude, intelligence, maturity, personality, emotional stability, diligence, stamina, enthusiasm, motivation, and other relevant factors, consistent with the practices followed by...

Publications | Page 242 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

Simple human vulnerability index to climate change hazards for Pakistan (open access) ... Understanding remittances in Ghana : analysing poverty reducing effect of ... Risk communication guide for climate change practitioners in Africa ...

24 CFR 242.66 - Affiliate transactions.

Science.gov (United States)

2010-04-01

... URBAN DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES MORTGAGE INSURANCE FOR HOSPITALS Regulatory Agreement, Accounting and Reporting, and Financial Requirements...

Publications | Page 242 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

IDRC works with developing-country researchers and institutions to build local capacity through funding, knowledge sharing, and training. Through books, articles, research publications, and studies, we aim to widen the impact of our investment and advance development research. We share the results of our funded ...

17 CFR 242.402 - General provisions.

Science.gov (United States)

2010-04-01

... conduct all financial relations with respect to such security future and related positions in accordance... customer in a futures account shall record and conduct all financial relations with respect to such... authorities of which the security futures intermediary is a member. (b) Separation and consolidation of...

48 CFR 5252.242-9000 - Refunds.

Science.gov (United States)

2010-10-01

..., accuracy and completeness of, cost or pricing data applicable to the item. (End of clause) ... on price was reached and the contract price. Refunds will not be made to recoup the amount of cost... established catalog or market price, plus the value of any unique requirements, including delivery terms...

48 CFR 242.771-3 - Responsibilities.

Science.gov (United States)

2010-10-01

....771-3 Responsibilities. (a) The cognizant administrative contracting officer (ACO) or corporate ACO... (OUSD(AT&L)DDR&E), is responsible for establishing a regular method for communication— (1) From DoD to...

24 CFR 242.10 - Eligible mortgagors.

Science.gov (United States)

2010-04-01

... or profit-motivated mortgagors may include for-profit corporations, limited partnerships, and limited liability corporations and companies, but may not include natural persons, joint ventures, and general partnerships. Any proposed mortgagor must demonstrate that it has a continuity of organization commensurate...

Toward Reanalysis of the Tight-Pitch HCLWR-PROTEUS Phase II Experiments

Directory of Open Access Journals (Sweden)

Perret Grégory

2016-01-01

Spectral index predictions using the three nuclear data libraries agreed within two standard deviations with the measured values. The only exception is the Pu-242-capture-to-Pu-239-fission ratio, which was overestimated with all libraries by more than four standard deviations, i.e. 13%, in the non-moderated configuration. In this configuration, Pu-242 captures are few since the flux spectrum in the Pu-242 capture resonance region (between 1eV and 1keV is small making this spectral index hard to measure. Sensitivity coefficient predictions with both MCNP6 and SERPENT2 were in good agreement.

Measurement of mass yields from the 241Am(2nth,f reaction at the Lohengrin Spectrometer

Directory of Open Access Journals (Sweden)

Köster U.

2013-03-01

Full Text Available The study of fission yields has a major impact on the characterization and understanding of the fission process and is mandatory for reactor applications. While the yields are known for the major actinides (235U, 239Pu in the thermal neutron-induced fission, only few measurements have been performed on 242Am. The interest of 242Am concerns the reduction of radiotoxicity of 241Am in nuclear wastes using transmutation reactions. This paper presents the measurement of the fission mass yields from the reaction 241Am(2nth,f performed at the Lohengrin mass spectrometer (ILL, France for both the light and the heavy peaks: a total of 41 mass yields have been measured. The experiment was also meant to determine whether there is a difference in mass yields between the isomeric state and the ground state as it exists in fission and capture cross sections. The method used to address this question is based on a repeated measurement of a set of fission mass yields as a function of the ratio between the 242gAm and the 242mAm fission rates. The presented experiment is also a first step towards the measurement of the isotopic fission yields of 242Am.

76 FR 54711 - Endangered and Threatened Wildlife and Plants; Bald Eagles Nesting in Sonoran Desert Area of...

Science.gov (United States)

2011-09-02

... Royal Palm Road, Suite 103, Phoenix, AZ 85021; telephone, 602-242-0210; facsimile, 602- 242-2513...)). ``Take'' includes ``pursue, shoot, shoot at, poison, wound, kill, capture, trap, collect, destroy, molest... or in any manner, pursue, hunt, take, capture, kill, attempt to take, capture, or kill, possess...

A Tiered Approach to Retinopathy of Prematurity Screening (TARP) Using a Weight Gain Predictive Model and a Telemedicine System.

Science.gov (United States)

Gurwin, Jaclyn; Tomlinson, Lauren A; Quinn, Graham E; Ying, Gui-Shuang; Baumritter, Agnieshka; Binenbaum, Gil

2017-01-05

The Telemedicine Approaches to Evaluating Acute-Phase Retinopathy of Prematurity (e-ROP) Study telemedicine system of remote fundus image grading and The Children's Hospital of Philadelphia Retinopathy of Prematurity (CHOP-ROP) postnatal weight gain predictive model are 2 approaches for improving ROP screening efficiency. Current screening has low specificity for severe ROP. To describe a tiered approach to ROP screening (TARP) for identifying children who develop severe ROP using telemedicine and a predictive model synergistically. This investigation was a post hoc analysis of a cohort in the e-ROP Study (a multicenter prospective telemedicine study) and the Postnatal Growth and Retinopathy of Prematurity (G-ROP) Study (a multicenter retrospective cohort study). The setting was neonatal intensive care units at The Children's Hospital of Philadelphia and the Hospital of the University of Pennsylvania. Participants in the e-ROP Study were premature infants with a birth weight less than 1251 g and a known ROP outcome enrolled between May 25, 2011, and October 31, 2013. The G-ROP Study enrolled all infants undergoing ROP examinations with a known ROP outcome who were born between January 1, 2006, and December 31, 2011. The mean outcomes were the sensitivity for type 1 ROP, reductions in infants requiring imaging or examinations, numbers of imaging sessions and examinations, and total clinical encounters (imaging sessions and examinations combined). The following 4 screening approaches were evaluated: ROUTINE (only diagnostic examinations by an ophthalmologist), CHOP-ROP (birth weight and gestational age, with weekly weight gain initiating examinations when the risk cut point is surpassed), e-ROP IMAGING (trained reader grading of type 1 or 2 ROP initiates diagnostic examinations), and TARP (CHOP-ROP alarm initiates imaging, and imaging finding of severe ROP initiates diagnostic examinations). A total of 242 infants were included in the study, with a median birth

Male Hypogonadism and Germ Cell Loss Caused by a Mutation in Polo-Like Kinase 4

Science.gov (United States)

Harris, Rebecca M.; Weiss, Jeffrey

2011-01-01

The genetic etiologies of male infertility remain largely unknown. To identify genes potentially involved in spermatogenesis and male infertility, we performed genome-wide mutagenesis in mice with N-ethyl-N-nitrosourea and identified a line with dominant hypogonadism and patchy germ cell loss. Genomic mapping and DNA sequence analysis identified a novel heterozygous missense mutation in the kinase domain of Polo-like kinase 4 (Plk4), altering an isoleucine to asparagine at residue 242 (I242N). Genetic complementation studies using a gene trap line with disruption in the Plk4 locus confirmed that the putative Plk4 missense mutation was causative. Plk4 is known to be involved in centriole formation and cell cycle progression. However, a specific role in mammalian spermatogenesis has not been examined. PLK4 was highly expressed in the testes both pre- and postnatally. In the adult, PLK4 expression was first detected in stage VIII pachytene spermatocytes and was present through step 16 elongated spermatids. Because the homozygous Plk4I242N/I242N mutation was embryonic lethal, all analyses were performed using the heterozygous Plk4+/I242N mice. Testis size was reduced by 17%, and histology revealed discrete regions of germ cell loss, leaving only Sertoli cells in these defective tubules. Testis cord formation (embryonic day 13.5) was normal. Testis histology was also normal at postnatal day (P)1, but germ cell loss was detected at P10 and subsequent ages. We conclude that the I242N heterozygous mutation in PLK4 is causative for patchy germ cell loss beginning at P10, suggesting a role for PLK4 during the initiation of spermatogenesis. PMID:21791561

The creation of new nuclei

International Nuclear Information System (INIS)

Armbruster, P.; Hessberger, F.P.

1998-01-01

In the last 60 years physicists have created 20 artificial elements beyond uranium. In 1934 Enrico Fermi predicted the creation of new elements by bombarding atoms with neutrons. This method led to the discovery of neptunium (Z=93), plutonium, americium, curium, berkelium, californium, einsteinium and fermium (Z=100). In fact the capture of a neutron is followed by a beta-decay which increases the atomic number (Z) by one unit. Beyond Z=100 beta-decay no more occurs so a new approach was necessary. Between the American Lawrence Berkeley Laboratory and the Russian Dubna Institute a fierce competition broke out to produce new elements by bombarding transuranium nuclei with light elements such as helium, carbon, nitrogen. This new method required heavy equipment: ion accelerator and detectors but led to the creation of all the elements from Z=101 to Z=106. A new idea was to provoke the fusion of heavy nuclei such as lead and bismuth with colliding argon, nickel or zinc ion beams. This method called 'cold fusion' opened the way to reach the nuclei beyond Z=107. In 1996 the element Z=112 was the last discovered. The next step could be the element Z=114 for which a particular stability is expected. (A.C.)

Characterization of a Viking Blade Fabricated by Traditional Forging Techniques

Science.gov (United States)

Vo, H.; Frazer, D.; Bailey, N.; Traylor, R.; Austin, J.; Pringle, J.; Bickel, J.; Connick, R.; Connick, W.; Hosemann, P.

2016-12-01

A team of students from the University of California, Berkeley, participated in a blade-smithing competition hosted by the Minerals, Metals, and Materials Society at the TMS 2015 144th annual meeting and exhibition. Motivated by ancient forging methods, the UC Berkeley team chose to fabricate our blade from historical smithing techniques utilizing naturally-occurring deposits of iron ore. This approach resulted in receiving the "Best Example of a Traditional Blade Process/Ore Smelting Technique" award for our blade named "Berkelium." First, iron-enriched sand was collected from local beaches. Magnetite (Fe3O4) was then extracted from the sand and smelted into individual high- and low-carbon steel ingots. Layers of high- and low-carbon steels were forge-welded together, predominantly by hand, to form a composite material. Optical microscopy, energy dispersive spectroscopy, and Vickers hardness mechanical testing were conducted at different stages throughout the blade-making process to evaluate the microstructure and hardness evolution during formation. It was found that the pre-heat-treated blade microstructure was composed of ferrite and pearlite, and contained many nonmetallic inclusions. A final heat treatment was performed, which caused the average hardness of the blade edge to increase by more than a factor of two, indicating a martensitic transformation.

Fluorescence and excitation spectra of Bk3+, Cf3+, and Es3+ ions in single crystals of LaCl3

International Nuclear Information System (INIS)

Hessler, J.P.; Caird, J.A.; Carnall, W.T.; Crosswhite, H.M.; Sjoblom, R.K.; Wagner, F. Jr.

1978-01-01

Dye laser techniques have been used to study the energy level structure of the heavier actinides in single crystals of lanthanum chloride. In the case of einsteinium, fluorescence was detected and measured from the following manifolds: J = 5 at 0.984 μm -1 , J = 4 at 1.572 μm -1 , J = 6 at 2.930 μm -1 . This fluorescence was observed to the five lowest manifolds: J = 8, 5, 7, 2, 6. For californium, fluorescence has been detected from the manifolds: J = 11/2 at 1.190 μm -1 , J = 7/2 at 1.389 μm -1 , J = 5/2 at 1.977 μm -1 . This fluorescence was observed to the three lowest manifolds: J = 15/2, 9/2, 11/2. The fluorescence manifolds of berkelium are J = 6 at 1.540 μm -1 , and J = 4 at 1.953 μm -1 . The three lowest manifolds, J = 6, 5, and 4, have been observed in fluorescence. Absorption spectra data have yielded crystal-field splitting measurements in the higher manifolds of Es + . The location of the manifolds in general confirmed earlier approximate free-ion level structure calculations based on assumed regularities in the energy level parameters derived from spectra of the actinide ions through Cf + . 2 figures

Oxidation-reduction properties of americium, curium, berkelium, californium, einsteinium and fermium, and thermodynamic consequences for the 5f series

International Nuclear Information System (INIS)

Samhoun, K.

1976-01-01

The amalgamation of 5f elements from Am to Fm has been studied by using 241 Am, 244 Cm, 249 Bk, 249 Cf, 252 Cf, 253 Es, 254 Es, 252 Fm and 255 Fm with two electrochemical methods, radiocoulometry and radiopolarography, perfectly adapted to investigate extremely diluted solutions when the concentration of electroactive species is as low as 10 -16 M. The theory of radiocoulometry has been developed in the general cases of reversible and irreversible electrode process. It has been used to interpret the experimental data on the kinetic curves of amalgamation, and to estimate the standard rate constant of the electrode process in complexing medium (citric). On the other hand the radiopolarographic method has been applied to study the mechanism of reduction at the dropping mercury electrode of cations M 3+ in aqueous medium to the metal M with formation of amalgam. The results are exploited into two directions: 1- Acquisition of some data concerning the oxidation-reduction properties of elements from Am to Fm. Therefore the standard electrode E 0 [M(III-0)] potentials for Bk, Cf and Es, and the standard electrode E 0 [M(II-0)] potential for Fm are estimated and the relative stability of each oxidation state (from II to VII) of 5f elements is discussed; 2- Acquisition of unknown thermodynamic data on transcalifornium elements. Correlations between 4f and 5f elements are precised and some divergences appear for the second half of 4f and 5f series (i.e. for 65 [fr

76 FR 67397 - Radio Broadcasting Services; Llano, Texas

Science.gov (United States)

2011-11-01

...] Radio Broadcasting Services; Llano, Texas AGENCY: Federal Communications Commission. ACTION: Proposed... substituting Channel 242C3 for vacant Channel 293C3, at Llano, Texas. The proposal is part of a contingently... required for the allotment of Channel 242C3 at Llano, Texas, because the proposed allotment is located...

Simultaneous measurement of {sup 239}Pu, {sup 240}Pu, {sup 241}Pu, and {sup 242}Pu by high resolution inductively coupled plasma mass spectrometer (HR ICP-MS) in marine sediments; Mesure des isotopes du plutonium des sediments marins par spectrometrie de masse a plasma couple inductivement haute resolution (HR ICP-MS)

Energy Technology Data Exchange (ETDEWEB)

Bruneau, F

1999-07-01

Transuranics elements are of particular interest in radioecological studies because of their radiotoxicity and their potential use to decipher source fingerprints and transport processes. The simultaneous measurement of {sup 239}Pu, {sup 240}Pu, {sup 241}Pu, and {sup 242}Pu in environmental samples requires a specific chemical procedure. This work deals with an analytical procedure which yields a very high grade of purification of Pu suitable for ultra low level detection by HR ICP-MS, from marine sediments. After the elimination of major elements (Fe, Al, Mg...) by a first chromatographic separation, a new device of purification by solvent extraction and concentration by a second chromatographic separation is used to obtain a concentrated and high purified solution of plutonium. The chemical procedure have been validated on IAEA certified sediment samples and on sediment samples collected in the roads of Cherbourg which had been previously analysed by other techniques (a spectrometry and thermo-ionisation mass spectrometer). (author)

JMBR - SEPTEMBER 2013.cdr

African Journals Online (AJOL)

FinePrint

Clostridium sp (2.42%), Serratia sp (2.42%). Bacterial isolates from the waste workers were essentially similar to those isolated from the dumpsites although the latter were more heavily colonized. The highest bacterial burden was recorded from the top soil samples at Benin Bye-pass dumpsite with a mean viable count of.

77 FR 4637 - Defense Federal Acquisition Regulation Supplement: Shipping Instructions (DFARS Case 2011-D052)

Science.gov (United States)

2012-01-30

.... origin contracts, Export Traffic Release regardless of f.o.b. terms, or foreign military sales shipments... use the DD Form 1659 when using the clauses at FAR 52.242-10, F.o.b. Origin--Government Bills of Lading or Prepaid Postage, or 52.242-11, F.o.b. Origin-- Government Bills of Lading or Indicia Mail...

The Role of Hypoxia in the Tumor Microenvironment: Implications for Ovarian Cancer Therapy

Science.gov (United States)

2017-07-01

Association for Cancer Research Publications ( Peer Reviewed) 1. Sinha S, Thomas D, Chan S, Gao Y, Brunen D, Torabi D, Reinisch A, Hernandez D, Chan A...Symposia, Keystone, CO Teaching 2017 Guest lecturer CBIO 242: Hypoxia and Angiogenesis (Stanford University) 2016 Guest lecturer CBIO 242: Hypoxia...Cancer Biology Journal Club (Stanford University) 2006 Teaching Assistant BIOM 555: Gene Expression (University of Pennsylvania)

36 CFR 242.9 - Information collection requirements.

Science.gov (United States)

2010-07-01

... the Paperwork Reduction Act. The burden in this situation is negligible, and information gained from... estimate to: Information Collection Officer, U.S. Fish and Wildlife Service, 1849 C Street, N.W., MS 222...

24 CFR 242.65 - Distribution of assets.

Science.gov (United States)

2010-04-01

... URBAN DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES MORTGAGE INSURANCE FOR HOSPITALS Regulatory Agreement, Accounting and Reporting, and Financial Requirements...

17 CFR 242.611 - Order protection rule.

Science.gov (United States)

2010-04-01

... transaction that constituted the trade-through was not a “regular way” contract. (3) The transaction that... traded through had displayed, within one second prior to execution of the transaction that constituted the trade-through, a best bid or best offer, as applicable, for the NMS stock with a price that was...

48 CFR 652.242-72 - Shipping Instructions.

Science.gov (United States)

2010-10-01

...) Each packing box shall be of solid construction in accordance with best commercial practices and.../3 of the width of the piece of lumber. Box shall be constructed with three-way corners and diagonal... Contractor shall place the fourth copy of the packing list in packing case number one, which shall be marked...

40 CFR 61.242-2 - Standards: Pumps.

Science.gov (United States)

2010-07-01

... pressure that is at all times greater than the pump stuffing box pressure; or (ii) Equipped with a barrier... system that purges the barrier fluid into a process stream with zero VHAP emissions to atmosphere. (2...

40 CFR 61.242-3 - Standards: Compressors.

Science.gov (United States)

2010-07-01

... at a pressure that is greater than the compressor stuffing box pressure; or (2) Equipped with a...) Equipped with a system that purges the barrier fluid into a process stream with zero VHAP emissions to...

48 CFR 1852.242-70 - Technical direction.

Science.gov (United States)

2010-10-01

... Direction (SEP 1993) (a) Performance of the work under this contract is subject to the written technical... the Contracting Officer in writing in accordance with NASA FAR Supplement 1842.270. “Technical... in writing by the COTR. (d) The Contractor shall proceed promptly with the performance of technical...

48 CFR 242.302 - Contract administration functions.

Science.gov (United States)

2010-10-01

...) Contractor estimating systems (see FAR 15.407-5); and (B) Contractor material management and accounting... report identifying significant accounting system or related internal control deficiencies. (9) For... SYSTEM, DEPARTMENT OF DEFENSE CONTRACT MANAGEMENT CONTRACT ADMINISTRATION AND AUDIT SERVICES Contract...

36 CFR 242.10 - Federal Subsistence Board.

Science.gov (United States)

2010-07-01

... consultants to the Board. (d) Powers and duties. (1) The Board shall meet at least twice per year and at such... for the decision, in writing, in a timely fashion. (2) The Board shall provide available and...

2.4.2. Water processing of cake

International Nuclear Information System (INIS)

Nazarov, Sh.B.; Safiev, Kh.S.; Mirsaidov, U.

2008-01-01

The cake water processing carried out with the purpose of extraction ofalkali components, in particular calcium chlorides and sodium, formed atbaking of raw materials with calcium chloride and by acid processingextracted the aluminium and iron compounds

48 CFR 1252.242-71 - Contractor testimony.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Contractor testimony. 1252... Contractor testimony. As prescribed in (TAR) 48 CFR 1242.7000(b), insert the following clause: Contractor Testimony (OCT 1994) All requests for the testimony of the Contractor or its employees, and any intention to...

36 CFR 242.20 - Request for reconsideration.

Science.gov (United States)

2010-07-01

... statement of the facts of the dispute, the issues raised by the request, and specific references to any law... implement a final decision on a request for reconsideration after compliance with 5 U.S.C. 551-559 (APA). (g...

36 CFR 242.3 - Applicability and scope.

Science.gov (United States)

2010-07-01

... and the Yukon Territory; Canada, and extending westerly, along the line of extreme low water across... the western bank of the Colville River following the highest highwater mark westerly, extending across... together with the adjacent waters of the Bering Sea extending, for Federal Subsistence Management purposes...

49 CFR 24.2 - Definitions and acronyms.

Science.gov (United States)

2010-10-01

... development with normal site improvements, including customary landscaping. The site need not include special... displacing Agency shall follow the requirements for separate bedrooms for children of the opposite gender... assistance provided under the American Dream Downpayment Initiative (ADDI) authorized by section 102 of the...

17 CFR 242.100 - Preliminary note; definitions.

Science.gov (United States)

2010-04-01

... with the distribution participant, issuer, or selling security holder that direct, effect, or recommend... course of its business. Distribution means an offering of securities, whether or not subject to... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Preliminary note; definitions...

Experimental Verification of the Fission Chamber Gamma Signal Suppression by the Campbelling Mode

International Nuclear Information System (INIS)

Vermeeren, L.; Weber, M.; Oriol, L.; Breaud, S.; Filliatre, P.; Geslot, B.; Jammes, C.; Normand, S.; Lescop, B.

2011-01-01

For the on-line monitoring of high fast neutron fluxes in the presence of a strong thermal neutron component, SCK-CEN and CEA are jointly developing a Fast Neutron Detector System, based on 242 Pu fission chambers as sensors and including dedicated electronics and data processing systems. Irradiation tests in the BR2 reactor of 242 Pu fission chambers operating in current mode showed that in typical MTR conditions the fission chamber currents are dominated by the gamma contribution. In order to reduce the gamma contribution to the signal, it was proposed to use the fission chambers in Campbelling mode. An irradiation experiment in the BR2 reactor with a 242 Pu and a 235 U fission chamber, both equipped with a suitable cable for measurements in Campbelling mode, proved the effectiveness of the suppression of the gamma-induced signal component by the Campbelling mode: gamma contribution reduction factors of 26 for the 235 U fission chamber and more than 80 for the 242 Pu fission chamber were obtained. The experimental data also prove that photofission contributions are negligibly small. Consequently, in typical MTR conditions the gamma contribution to the fission chamber Campbelling signal can be neglected. (authors)

Mercaptobenzothiazole on gold biosensor systems for organophosphate and carbamate pesticide compounds

CSIR Research Space (South Africa)

Somerset, VS

2010-05-01

Full Text Available .............................................. 179 2.5.2.1.3 Poly(2,5-dimethoxy aniline), PDMA........................................ 182 2.5.3 Conducting mechanism of PANI .......................................................... 184 2.5.4 Synthesis of polyaniline, PANI... of mercaptobenzothiazole self-assembled monolayer on gold electrode 242 3.4.2 Characterisation of Au/MBT SAM-modified electrode ....................... 242 3.5 Synthesis of polyaniline films onto gold disk (Au), MBT SAM modified electrode...

Total and spontaneous fission half-lives of the americium and curium nuclides

International Nuclear Information System (INIS)

Holden, N.E.

1984-01-01

The total half-life and the half-life for spontaneous fission are evaluated for the various long-lived nuclides of interest. Recommended values are presented for 241 Am, /sup 242m/Am, 243 Am, 242 Cm, 243 Cm, 244 Cm, 245 Cm, 246 Cm, 247 Cm, 248 Cm, and 250 Cm. The uncertainties are provided at the 95% confidence limit for each of the recommended values

A leucine repeat motif in AbiA is required for resistance of Lactococcus lactis to phages representing three species.

Science.gov (United States)

Dinsmore, P K; O'Sullivan, D J; Klaenhammer, T R

1998-05-28

The abiA gene encodes an abortive bacteriophage infection mechanism that can protect Lactococcus species from infection by a variety of bacteriophages including three unrelated phage species. Five heptad leucine repeats suggestive of a leucine zipper motif were identified between residues 232 and 266 in the predicted amino acid sequence of the AbiA protein. The biological role of residues in the repeats was investigated by incorporating amino acid substitutions via site-directed mutagenesis. Each mutant was tested for phage resistance against three phages, phi 31, sk1, and c2, belonging to species P335, 936, and c2, respectively. The five residues that comprise the heptad repeats were designated L234, L242, A249, L256, and L263. Three single conservative mutations of leucine to valine in positions L235, L242, and L263 and a double mutation of two leucines (L235 and L242) to valines did not affect AbiA activity on any phages tested. Non-conservative single substitutions of charged amino acids for three of the leucines (L235, L242, and L256) virtually eliminated AbiA activity on all phages tested. Substitution of the alanine residue in the third repeat (A249) with a charged residue did not affect AbiA activity. Replacement of L242 with an alanine elimination phage resistance against phi 31, but partial resistance to sk1 and c2 remained. Two single proline substitutions for leucines L242 and L263 virtually eliminated AbiA activity against all phages, indicating that the predicted alpha-helical structure of this region is important. Mutations in an adjacent region of basic amino acids had various effects on phage resistance, suggesting that these basic residues are also important for AbiA activity. This directed mutagenesis analysis of AbiA indicated that the leucine repeat structure is essential for conferring phage resistance against three species of lactococcal bacteriophages.

The Transplutonium. The superheavy nuclei found in the micas of Madagascar and their interests

International Nuclear Information System (INIS)

Raoelina Andriambololona

1976-01-01

Since June 1976, evidence for the existence of superheavy elements is discussed about. After having recalled artificial elements with atomic numbers Z of wich go from Z=95 (Americium) to Z=107 (built in 1976), superheavy elements having Z greater than 110 are considered. They have been discovered by american searchers in giant halos seen in Madagascar micas. The samples have been recoked in the Fort-Dauphin region (Haut Mandrare). The corresponding numbers Z are 114, 115, 116, 124, 125, 125, 126, 127. It seems that the existence of Z=126 element should be accepted with a greater degree of confidence. But different experiences done by other groups seem to show the evidence of superheavy elements in micas looks weaker. Nevertheless, it is interesting to investigate the evidence or the non-evidence of those elements. We estimate the mass numbers A of those superheavy elements in the liquid drop model if we assume that they are stable versus β. The results thus obtained agree with the shell-model ones within 4 % approximation. We propose if the evidence of superheavies is confirmed to give the name of madagascarium to one of them (Z=126) by similitude with francium, lutetium, polonium, berkelium, americium, europium, ...Their evidence was first conjectured in Madagascar micas in 1976. Superheavy nuclei are to be distinguished from hypernuclei. [fr

Effect of local burn-up variation on computed mean nuclide concentrations

International Nuclear Information System (INIS)

Moeller, W.

1982-01-01

Mean concentrations of U-235, U-236, U-238, Pu-239, Pu-240, Pu-241 and Pu-242 in some volume areas of WWER-440 fuel assemblies have been calculated from corresponding burn-up microdistribution data and compared with those calculated from burn-up mean values. Differences occurring were below 3% for the uranium nuclides but, at low burn-ups, considerable for Pu-241 and Pu-242. (author)

The correlation between pre-operative serum tumor markers and lymph node metastasis in gastric cancer patients undergoing curative treatment.

Science.gov (United States)

Li, Fangxuan; Li, Shixia; Wei, Lijuan; Liang, Xiaofeng; Zhang, Huan; Liu, Juntian

2013-11-01

There was few study concentrated on the correlation between the evaluated tumor markers and lymph node metastasis. In this study, we aimed to evaluate the correlation between the CA724, CA242, CA199, CEA and the lymph node metastasis of gastric cancer and assess the prognostic value of them in different N stage patients. We analyzed the correlation between serum level of CA724, CA242, CA199, CEA and lymph node metastasis in 1501 gastric cancer patients. Lymph node metastasis of gastric cancer was related with tumor location, Bormann type, tumor size, histological type, depth of invasion and TNM stage (p CEA were positively correlated with the metastatic lymph node counts and the N stage (p tumor markers were higher (p tumor markers, the positive rates of tumor markers combination were higher. The combination of CA724 + CA242 + CA199 + CEA had highest positive rate. The higher CEA level related to N1 stage patients while higher CA199 was related with poor prognosis for N1 stage patients. For N0 and N2 stage patients, evaluation of CA724 indicated poorer prognosis. For N1 and N2 stage gastric patients, the patients with increased CA242 inclined to have shorter survival time. The tumor makers CA724, CA242, CA199 and CEA were evaluated significantly in the gastric patients with later N stage. The combination of these four tumor markers maybe prefer diagnostic index of gastric cancer and its lymph node metastasis. These tumor markers can be a possible indicator of poorer prognosis in different N stage patients.

Experimental verification of the fission chamber gamma signal suppression by the Campbelling mode

Energy Technology Data Exchange (ETDEWEB)

Vermeeren, L.; Weber, M. [SCK-CEN, Boeretang 200, B-2400 Mol (Belgium); Oriol, L.; Breaud, S.; Filliatre, P.; Geslot, B.; Jammes, C. [CEA, Centre de Cadarache, F-13109 Saint-Paul-lez-Durance (France); Normand, S.; Lescop, B. [CEA, Centre de Saclay, F-91191 Gif sur Yvette Cedex (France)

2009-07-01

For the on-line monitoring of high fast neutron fluxes in the presence of a strong thermal neutron component, SCK-CEN and CEA are jointly developing a Fast Neutron Detector System, based on {sup 242}Pu fission chambers as sensors and including dedicated electronics and data processing systems. Irradiation tests in the BR2 reactor of {sup 242}Pu fission chambers operating in current mode showed that in typical MTR (Materials Test Reactors) conditions the fission chamber currents are dominated by the gamma contribution. In order to reduce the gamma contribution to the signal, it was proposed to use the fission chambers in Campbelling mode. An irradiation experiment in the BR2 reactor with a {sup 242}Pu and a {sup 235}U fission chamber, both equipped with a suitable cable for measurements in Campbelling mode, proved the effectiveness of the suppression of the gamma-induced signal component by the Campbelling mode: gamma contribution reduction factors of 26 for the {sup 235}U fission chamber and more than 80 for the {sup 242}Pu fission chamber were obtained. The experimental data also prove that photofission contributions are negligibly small. Consequently, in typical MTR conditions the gamma contribution to the fission chamber Campbelling signal can be neglected. (authors)

Determination of americium and plutonium in autopsy tissue: methods and problems

International Nuclear Information System (INIS)

Boyd, H.A.; Eutsler, B.C.; McInroy, J.F.

1979-01-01

The current methods used by the tissue analysis program at LASL for the determination of americium and plutonium in autopsy tissue are described. Problems affecting radiochemical yield are discussed. Included are problems associated with sample preparation, separation of plutonium from large amounts of bone ash, and reagent contamination. The average 242 Pu tracer yield for 1800 Pu determinations is 78 +- 12%. The average 242 Am tracer yield is 85 +- 7% for 40 determinations

Proposal for experiments with actinide elements

International Nuclear Information System (INIS)

Sanchez, R.G.

1994-01-01

An analytical study was conducted in which critical masses for some actinide isotopes were calculated with the Monte Carlo Neutron Photon (MCNP) Transport computer code. Different spherical computer models were used for even- and odd-neutron nuclides. Critical masses obtained are tabulated for Np-237, Pu-242, Am-241, Am-243, Pu-241, and Am-242m, together with indirect experimental data. Experimental data are needed for actinides with odd number of neutrons

EST Table: FS904516 [KAIKOcDNA[Archive

Lifescience Database Archive (English)

Full Text Available 1461 10/09/10 48 %/243 aa gnl|Amel|GB18846-PA 10/09/10 46 %/242 aa gi|91086187|ref|XP_971225.1| PREDICTED: similar to medulloblastoma...oblastoma antigen MU-MB-50.4 [Tribolium castaneum] gb|EFA06682.1| hypothetical prot...FS904516 E_FL_fufe_02D20_F_0 11/12/09 n.h 10/09/28 46 %/242 aa ref|XP_971225.1| PREDICTED: similar to medull

Clinical assessment and prognostic evaluation of tumor markers in patients with gastric cancer.

Science.gov (United States)

Jiexian, Jing; Xiaoqin, Xu; Lili, Du; Baoguo, Tian; Ting, Sun; Xianwen, Zhao; Cunzhi, Han

2013-06-28

To investigate the relationship between the serum levels of CEA, CA19-9, CA24-2, CA72-4, and AFP in patients with gastric cancer (GC) and their clinicopathological characteristics; to analyze the efficacy of these tumor markers in evaluating the prognosis of GC. Overall, 389 patients with GC either located in the gastric cardia (132), the pyloric antrum (112) or the body of the stomach (145) were included in the study. Serum levels of CEA, CA19-9, CA72-4, and AFP were detected with the ECLIA method, while CA24-2 was measured with ELISA. First, the serum level of CEA in GC patients with a cardia-located cancer was significantly higher than in patients with pyloric antrum-located cancer (p=0.050). CA72-4 level in patients with GC located in the gastric body was significantly higher than in patients with cardia and pyloric antrum-located cancers (p=0.042 and p=0.039, respectively). Secondly, serum CA19-9 and CA24-2 levels in females with cardia-located GC were significantly higher than those in males with the same type of tumor (p=0.037 and p=0.033, respectively). Additionally, for females with gastric body-located GC the levels of CEA and CA72-4 were significantly higher than those in male patients with the same type of tumor (p=0.047 and p=0.048, respectively). Conversely, in female GC patients with pyloric antrum-located cancer the serum levels of CA19-9 and CA24-2 were significantly lower than those in male patients with the same type of cancer (p=0.013 and p=0.007, respectively). Moreover, CEA, CA19-9, CA24-2, and CA72-4 levels were strongly related to TNM grade and histological anatomy stage, whereas CEA and CA72-4 levels were strongly related to lymph node stage (p=0.000 and p=0.042, respectively). Patients with vascular embolism had higher serum levels of CEA, CA19-9, CA24-2, and CA72-4 compared with patients without vascular embolism (p=0.005, p=0.031, p=0.007, and p=0.014, respectively). In patients with distant metastases and ascites the levels of CEA, CA19

Calculations of neutron and proton induced reaction cross sections for actinides in the energy region from 10 MeV to 1 GeV

International Nuclear Information System (INIS)

Konshin, V.A.

1995-01-01

Several nuclear model codes were applied to calculations of nuclear data in the energy region from 10 MeV to 1 GeV. At energies up to 100 MeV the nuclear theory code GNASH was used for nuclear data calculation for incident neutrons for 238 U, 233-236 U, 238-242 Pu, 237 Np, 232 Th, 241-243 Am and 242-247 Cm. At energies from 100 MeV to 1 GeV the intranuclear cascade exciton model including the fission process was applied to calculations of protons and neutrons with 233 U, 235 U, 238 U, 232 Th, 232 Pa, 237 Np, 238 Np, 239 Pu, 241 Am, 242 Am and 242-248 Cm. Determination of parameter systematics was a major effort in the present work that was aimed at improving the predictive capability of the models used. An emphasis was made on a simultaneous analysis of data for a variety of reaction channels for the nucleus considered, as well as of data that are available for nearby nuclei or other incident particles. Comparison with experimental data available on multiple reaction cross sections, isotope yields, fission cross sections, particle multiplicities, secondary particle spectra, and double differential cross sections indicates that the calculations reproduce the trends, and often the details, of the experimental data. (author)

Calculations of neutron and proton induced reaction cross sections for actinides in the energy region from 10MeV to 1GeV

International Nuclear Information System (INIS)

Konshin, V.A.

1995-06-01

Several nuclear model codes were applied to calculations of nuclear data in the energy region from 10MeV to 1GeV. At energies up to 100MeV the nuclear theory code GNASH was used for nuclear data calculation for neutrons incident for on 238 U, 233-236 U, 238-242 Pu, 237 Np, 232 Th, 241-243 Am and 242-247 Cm. At energies from 100MeV to 1GeV the intranuclear cascade exciton model including the fission process was applied to calculations of protons and neutrons with 233 U, 235 U, 238 U, 232 Th, 232 Pa, 237 Np, 238 Np, 239 Pu, 241 Am, 242 Am and 242-248 Cm. Determination of parameter systematics was a major effort in the present work that was aimed at improving the predictive capability of the models used. An emphasis was placed upon a simultaneous analysis of data for a variety of reaction channels for the nuclei considered, as well as of data that are available for nearby nuclei or for other incident particles. Comparisons with experimental data available on multiple reaction cross sections, isotope yields, fission cross sections, particle multiplicities, secondary particle spectra, and double differential cross sections indicate that the calculations reproduce the trends, and often the details, of the measurements data. (author) 82 refs

Taxonomically Different Co-Microsymbionts of a Relict Legume, Oxytropis popoviana, Have Complementary Sets of Symbiotic Genes and Together Increase the Efficiency of Plant Nodulation.

Science.gov (United States)

Safronova, Vera I; Belimov, Andrey A; Sazanova, Anna L; Chirak, Elizaveta R; Verkhozina, Alla V; Kuznetsova, Irina G; Andronov, Evgeny E; Puhalsky, Jan V; Tikhonovich, Igor A

2018-06-20

Ten rhizobial strains were isolated from root nodules of a relict legume Oxytropis popoviana Peschkova. For identification of the isolates, sequencing of rrs, the internal transcribed spacer region, and housekeeping genes recA, glnII, and rpoB was used. Nine fast-growing isolates were Mesorhizobium-related; eight strains were identified as M. japonicum and one isolate belonged to M. kowhaii. The only slow-growing isolate was identified as a Bradyrhizobium sp. Two strains, M. japonicum Opo-242 and Bradyrhizobium sp. strain Opo-243, were isolated from the same nodule. Symbiotic genes of these isolates were searched throughout the whole-genome sequences. The common nodABC genes and other symbiotic genes required for plant nodulation and nitrogen fixation were present in the isolate Opo-242. Strain Opo-243 did not contain the principal nod, nif, and fix genes; however, five genes (nodP, nodQ, nifL, nolK, and noeL) affecting the specificity of plant-rhizobia interactions but absent in isolate Opo-242 were detected. Strain Opo-243 could not induce nodules but significantly accelerated the root nodule formation after coinoculation with isolate Opo-242. Thus, we demonstrated that taxonomically different strains of the archaic symbiotic system can be co-microsymbionts infecting the same nodule and promoting the nodulation process due to complementary sets of symbiotic genes.

48 CFR 242.202 - Assignment of contract administration.

Science.gov (United States)

2010-10-01

..., charting, and geodesy services; (F) Base, post, camp, and station purchases; (G) Operation or maintenance of, or installation of equipment at, radar or communication network sites; (H) Communications..., post, camp, and station contracts on a military installation are normally the responsibility of the...

36 CFR 242.26 - Subsistence taking of wildlife.

Science.gov (United States)

2010-07-01

...-driven boat when the boat's progress from the motor's power has not ceased; (5) Using a motorized vehicle... collars. If you take an animal that has been marked or tagged for scientific studies, you must, within a... Unit 1B—that portion on the Cleveland Peninsula south of the divide between Yes Bay and Santa Anna...

7 CFR 2.42 - Administrator, Farm Service Agency.

Science.gov (United States)

2010-01-01

... release of a hazardous substance, pollutant, or contaminant into the environment; (ii) Sections 104(e)-(h... Water Pollution Prevention and Control Act, as amended (33 U.S.C. 1251 et seq.); (iii) Safe Drinking... coordinate land retirement and agricultural working land conservation programs under section 2005 (16 U.S.C...

Dicty_cDB: AFH242 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available CA sequence update 2001. 6. 2 Translated Amino Acid sequence claywvyntvysytsl*rii...r*snsynirslnykwss*nwc*sleelktslpisnklqs Frame C: claywvyntvysytsl*riikknkkkek*vmfmill*ldqvfqv*cvvin*krmdikf*

24 CFR 242.64 - Current and future property.

Science.gov (United States)

2010-04-01

... URBAN DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES MORTGAGE INSURANCE FOR HOSPITALS Regulatory Agreement, Accounting and Reporting, and Financial Requirements...

24 CFR 242.57 - Maintenance of hospital facility.

Science.gov (United States)

2010-04-01

... HOUSING AND URBAN DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES MORTGAGE INSURANCE FOR HOSPITALS Regulatory Agreement, Accounting and Reporting, and Financial...

50 CFR 216.242 - Permissible methods of taking.

Science.gov (United States)

2010-10-01

... percent of the number of takes indicated below): (i) Mysticetes: (A) North Atlantic right whale (Eubalaena...) Sperm whales (Physeter macrocephalus)—48790 (an average of 9758 annually). (B) Pygmy or dwarf sperm...

24 CFR 242.63 - Additional indebtedness and leasing.

Science.gov (United States)

2010-04-01

... AUTHORITIES MORTGAGE INSURANCE FOR HOSPITALS Regulatory Agreement, Accounting and Reporting, and Financial... Development (Continued) OFFICE OF ASSISTANT SECRETARY FOR HOUSING-FEDERAL HOUSING COMMISSIONER, DEPARTMENT OF... derivative-type transactions, except in conformance with policies and procedures established by HUD. ...

40 CFR 180.242 - Thiabendazole; tolerances for residues.

Science.gov (United States)

2010-07-01

... Fruit, citrus, group 10, postharvest 10.0 None Fruit, pome, group 11, postharvest 5.0 None Mango 10.0... Strawberry1 5.0 None Sweet potato (postharvest to sweet potato intended only for use as seed) 0.05 None Wheat... connection with use of the pesticide under section 18 emergency exemptions granted by EPA. The tolerances are...

36 CFR 242.28 - Subsistence taking of shellfish.

Science.gov (United States)

2010-07-01

... from buying or selling subsistence-taken shellfish, their parts, or their eggs, unless otherwise... currently identified under Federal subsistence management jurisdiction. (3) Cook Inlet Area. (i) You may...

36 CFR 242.27 - Subsistence taking of fish.

Science.gov (United States)

2010-07-01

... not possess, transport, give, receive, or barter subsistence-taken fish or their parts which have been... Kitoi Creek; (F) All fresh water systems of Afognak Island. (iv) You must have a subsistence fishing...

17 CFR 242.103 - Nasdaq passive market making.

Science.gov (United States)

2010-04-01

... paragraph (b)(2) of this section. (4) Limitation on displayed size. At all times, the passive market maker's... may display a bid size of 100 shares. (5) Identification of a passive market making bid. The bid... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Nasdaq passive market making...

48 CFR 752.242-70 - Periodic progress reports.

Science.gov (United States)

2010-10-01

... interpreted as “task order” or “delivery order” when this clause is used in an indefinite-delivery contract... may be used by USAID personnel or their authorized representatives when evaluating the contractor's... contracting officer may withhold from payment an amount not to exceed US$25,000 (or local currency equivalent...

47 CFR 24.2 - Other applicable rule parts.

Science.gov (United States)

2010-10-01

... procedures concerning the marketing and importation of radio frequency devices, and for obtaining equipment... conditions relating to the marketing of part 15 devices. Unlicensed PCS devices operate under subpart D of... towers. (g) Part 20 of this chapter governs commercial mobile radio services. (h) Part 21. This part...

Dicty_cDB: VHM242 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Homo sapiens full open reading fra... 74 3e-12 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecolic aci...( BC114006 |pid:none) Bos taurus L-pipecolic acid oxidas... 74 4e-12 protein upda

48 CFR 352.242-71 - Tobacco-free facilities.

Science.gov (United States)

2010-10-01

... personal or company vehicles operated by Contractor employees while on an HHS property. This policy also... HHS policy will apply to the maximum area permitted by both law and current lease agreements. The Contractor shall ensure that each of its employees, and any subcontractor staff, is made aware of, understand...

48 CFR 3452.242-70 - Litigation and claims.

Science.gov (United States)

2010-10-01

... proceed with the defense of the action in good faith. (e) To the extent not in conflict with any... compensated by insurance that was required by law, regulation, contract clause, or other written direction of... ACQUISITION REGULATION CLAUSES AND FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Texts of Provisions and...

24 CFR 242.45 - Early commencement of work.

Science.gov (United States)

2010-04-01

... insurance and is to be accomplished at the sole risk of the mortgagor. (b) Construction completed prior to... to the issuance of a commitment or denial by HUD, the hospital and lender may request for good cause... hospital and the lender to be approved. Such work may be eligible to be financed with insured mortgage...

17 CFR 242.101 - Activities by distribution participants.

Science.gov (United States)

2010-04-01

... (CONTINUED) REGULATIONS M, SHO, ATS, AC, AND NMS AND CUSTOMER MARGIN REQUIREMENTS FOR SECURITY FUTURES... quotation system or electronic communications network; or (6) Basket transactions. (i) Bids or purchases, in... to such a basket in the ordinary course of business as a result of a change in the composition of a...

1935 15' Quad #242 Aerial Photo Mosaic Index

Data.gov (United States)

Earth Data Analysis Center, University of New Mexico — Aerial Photo Reference Mosaics contain aerial photographs that are retrievable on a frame by frame basis. The inventory contains imagery from various sources that...

Cooperative Control of Unmanned Surface Vessels and Unmanned Underwater Vessels for Asset Protection

Science.gov (United States)

2015-05-18

are met as well. APPENDIX A –CODE FOR SIMPLE SURFACE PRIMARY SIMULATION % Input Variables cap desired 0.95; xd 2000; yd 2000...50 for t 1:1:50 % Capability Calculations if ((640/(2*sqrt((yd y1)^2 + ( xd x1)^2)*tand(24/2))) > 3) & ((640/(2*sqrt((yd...y2)^2 + ( xd x2)^2)*tand(24/2))) > 3) c1 1 0.0000000000000001*sqrt((yd y1)^2 + ( xd x1)^2); c2 (1 0.0000000000000001

ORF Alignment: NC_003074 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available : 242 FTYALLRFSTLLKESYQSDVFSIGGRSMYLQVFPNGRNLSKGKAMSLYLNINDKFKPFEM 301 ... FTYALLRFSTLLKESYQSDVFSIGGR...SMYLQVFPNGRNLSKGKAMSLYLNINDKFKPFEM Sbjct: 1 ... FTYALLRFSTLLKESYQSDVFSIGGRSMYLQVFPNGRNLSKGKAMSLYLNINDKFKPFEM

Extended N-Arylsulfonylindoles as 5-HT6 Receptor Antagonists: Design, Synthesis & Biological Evaluation

Directory of Open Access Journals (Sweden)

Gonzalo Vera

2016-08-01

Full Text Available Based on a known pharmacophore model for 5-HT6 receptor antagonists, a series of novel extended derivatives of the N-arylsulfonyindole scaffold were designed and identified as a new class of 5-HT6 receptor modulators. Eight of the compounds exhibited moderate to high binding affinities and displayed antagonist profile in 5-HT6 receptor functional assays. Compounds 2-(4-(2-methoxyphenylpiperazin-1-yl-1-(1-tosyl-1H-indol-3-ylethanol (4b, 1-(1-(4-iodophenylsulfonyl-1H-indol-3-yl-2-(4-(2-methoxyphenylpiperazin-1-ylethanol (4g and 2-(4-(2-methoxyphenylpiperazin-1-yl-1-(1-(naphthalen-1-ylsulfonyl-1H-indol-3-ylethanol (4j showed the best binding affinity (4b pKi = 7.87; 4g pKi = 7.73; 4j pKi = 7.83. Additionally, compound 4j was identified as a highly potent antagonist (IC50 = 32 nM in calcium mobilisation functional assay.

Measurement of the ${240}$Pu(n,f) reaction cross-section

CERN Multimedia

Following proposal CERN-INTC-2010-042 / INTC-P-280 (“Measurement of the fission cross-section of $^{240}$Pu and $^{242}$Pu at CERN’s n_TOF Facility”), the parallel measurement of the $^{240}$Pu(n,f) and $^{242}$Pu(n,f) reaction cross-sections was carried out at n_TOF EAR-1. While the $^{242}$Pu measurement was successful, unexpected sample-induced damage to the detectors caused by the high α-activity of the 240Pu samples resulted in a deterioration of the detector performance over the data taking period of several months, which compromised the measurement. This obstacle can be eliminated by performing the measurement in EAR-2, where the higher neutron flux will allow collecting data in a much shorter time, thus preventing the degradation of the detectors. In addition to this obvious advantage, the measurement would also benefit from the stronger suppression of the sample-induced α-background, due to the shorter times-of-flight involved.

Electron-capture delayed fission properties of neutron-deficient einsteinium nuclei

International Nuclear Information System (INIS)

Shaughnessy, Dawn A.

2000-01-01

Electron-capture delayed fission (ECDF) properties of neutron-deficient einsteinium isotopes were investigated using a combination of chemical separations and on-line radiation detection methods. 242 Es was produced via the 233 U( 14 N,5n) 242 Es reaction at a beam energy of 87 MeV (on target) in the lab system, and was found to decay with a half-life of 11 ± 3 seconds. The ECDF of 242 Es showed a highly asymmetric mass distribution with an average pre-neutron emission total kinetic energy (TKE) of 183 ± 18 MeV. The probability of delayed fission (P DF ) was measured to be 0.006 ± 0.002. In conjunction with this experiment, the excitation functions of the 233 U( 14 N,xn) 247-x Es and 233 U( 15 N,xn) 248-x Es reactions were measured for 243 Es, 244 Es and 245 Es at projectile energies between 80 MeV and 100 MeV

Investigations for the influence of geochemical parameters on the sorption and desorption of lanthanides and uranium onto opalinus clay as potential host rock for a repository

International Nuclear Information System (INIS)

Moeser, Christina

2010-01-01

The development of a disposal in deep geological formations for radioactive waste is a very important task for the future. The safety assessment for more than a hundred thousand years needs a full understanding of all processes of interaction between the radioactive waste and the surrounded formations. This work contributes to this understanding. The interaction between lanthanides (homologues of the actinides americium, curium and berkelium) / uranium and the host rock opalinus clay under influence of organic substances (NOM) have been analyzed and discussed. The complex system was split into 3 binary basic systems with the following interactions - Interactions between lanthanides / uranium and NOM - Interactions between lanthanides / uranium and the opalinus clay - Interactions between NOM and opalinus clay All binary systems can be influenced by geological parameters like pH, ion strength and competing cations. The sorption / desorption of the lanthanides onto the opalinus clay is analyzed via inductively coupled plasma mass spectrometry. For the investigation of the complexation behavior of metals with NOM we used capillary electrophoresis coupled with inductively coupled plasma mass spectrometry. Under these conditions the chosen model organic humic acid affected the sorption of the lanthanides onto opalinus clay favorably. The smaller organic compounds, which dominate in the composition of the clay organics, remobilized the metals after sorption onto clay and the sorption can be inhibited by NOM. Due to the reduced metal sorption onto Opalinus clay by NOM, a migration through the clay may be possible.

Effects of cadmium exposure on growth and metabolic profile of bermudagrass [Cynodon dactylon (L. Pers].

Directory of Open Access Journals (Sweden)

Yan Xie

Full Text Available Metabolic responses to cadmium (Cd may be associated with variations in Cd tolerance in plants. The objectives of this study were to examine changes in metabolic profiles in bermudagrass in response to Cd stress and to identify predominant metabolites associated with differential Cd tolerance using gas chromatography-mass spectrometry. Two genotypes of bermudagrass with contrasting Cd tolerance were exposed to 0 and 1.5 mM CdSO4 for 14 days in hydroponics. Physiological responses to Cd were evaluated by determining turf quality, growth rate, chlorophyll content and normalized relative transpiration. All these parameters exhibited higher tolerance in WB242 than in WB144. Cd treated WB144 transported more Cd to the shoot than in WB242. The metabolite analysis of leaf polar extracts revealed 39 Cd responsive metabolites in both genotypes, mainly consisting of amino acids, organic acids, sugars, fatty acids and others. A difference in the metabolic profiles was observed between the two bermudagrass genotypes exposed to Cd stress. Seven amino acids (norvaline, glycine, proline, serine, threonine, glutamic acid and gulonic acid, four organic acids (glyceric acid, oxoglutaric acid, citric acid and malic acid, and three sugars (xylulose, galactose and talose accumulated more in WB242 than WB144. However, compared to the control, WB144 accumulated higher quantities of sugars than WB242 in the Cd regime. The differential accumulation of these metabolites could be associated with the differential Cd tolerance in bermudagrass.

DNA Binding and Phosphorylation Regulate the Core Structure of the NF-κB p50 Transcription Factor.

Science.gov (United States)

Vonderach, Matthias; Byrne, Dominic P; Barran, Perdita E; Eyers, Patrick A; Eyers, Claire E

2018-06-05

The NF-κB transcription factors are known to be extensively phosphorylated, with dynamic site-specific modification regulating their ability to dimerize and interact with DNA. p50, the proteolytic product of p105 (NF-κB1), forms homodimers that bind DNA but lack intrinsic transactivation function, functioning as repressors of transcription from κB promoters. Here, we examine the roles of specific phosphorylation events catalysed by either protein kinase A (PKA c ) or Chk1, in regulating the functions of p50 homodimers. LC-MS/MS analysis of proteolysed p50 following in vitro phosphorylation allows us to define Ser328 and Ser337 as PKA c - and Chk1-mediated modifications, and pinpoint an additional four Chk1 phosphosites: Ser65, Thr152, Ser242 and Ser248. Native mass spectrometry (MS) reveals Chk1- and PKA c -regulated disruption of p50 homodimer formation through Ser337. Additionally, we characterise the Chk1-mediated phosphosite, Ser242, as a regulator of DNA binding, with a S242D p50 phosphomimetic exhibiting a > 10-fold reduction in DNA binding affinity. Conformational dynamics of phosphomimetic p50 variants, including S242D, are further explored using ion-mobility MS (IM-MS). Finally, comparative theoretical modelling with experimentally observed p50 conformers, in the absence and presence of DNA, reveals that the p50 homodimer undergoes conformational contraction during electrospray ionisation that is stabilised by complex formation with κB DNA. Graphical Abstract ᅟ.

Effects of cadmium exposure on growth and metabolic profile of bermudagrass [Cynodon dactylon (L.) Pers].

Science.gov (United States)

Xie, Yan; Hu, Longxing; Du, Zhimin; Sun, Xiaoyan; Amombo, Erick; Fan, Jibiao; Fu, Jinmin

2014-01-01

Metabolic responses to cadmium (Cd) may be associated with variations in Cd tolerance in plants. The objectives of this study were to examine changes in metabolic profiles in bermudagrass in response to Cd stress and to identify predominant metabolites associated with differential Cd tolerance using gas chromatography-mass spectrometry. Two genotypes of bermudagrass with contrasting Cd tolerance were exposed to 0 and 1.5 mM CdSO4 for 14 days in hydroponics. Physiological responses to Cd were evaluated by determining turf quality, growth rate, chlorophyll content and normalized relative transpiration. All these parameters exhibited higher tolerance in WB242 than in WB144. Cd treated WB144 transported more Cd to the shoot than in WB242. The metabolite analysis of leaf polar extracts revealed 39 Cd responsive metabolites in both genotypes, mainly consisting of amino acids, organic acids, sugars, fatty acids and others. A difference in the metabolic profiles was observed between the two bermudagrass genotypes exposed to Cd stress. Seven amino acids (norvaline, glycine, proline, serine, threonine, glutamic acid and gulonic acid), four organic acids (glyceric acid, oxoglutaric acid, citric acid and malic acid,) and three sugars (xylulose, galactose and talose) accumulated more in WB242 than WB144. However, compared to the control, WB144 accumulated higher quantities of sugars than WB242 in the Cd regime. The differential accumulation of these metabolites could be associated with the differential Cd tolerance in bermudagrass.

ORF Alignment: NC_003070 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available LLSAKRTRRTTRTEYIISMDA 60 ... Query: 242 GSYNIAQITYELNVLGTRGPRRMHCIMNSIPISSLEPGGSVPNQ...PEKLVPAPYSLDDXXX 301 ... GSYNIAQITYELNVLGTRGPRRMHCIMNSIPISSLEPGGSVPNQPEKLVPAPYSLDD ... Sbjct: 121 GSYNIAQITYELNVLGTRGPRRMHC

Non-Linear Dynamic Analysis of Geared Systems

Science.gov (United States)

1990-11-01

bearings are compliant. To overcome this deficiency , a three degree of freedom (3-DOF) transverse-torsional model as shown in Figure 1.1 Ia is developed...1.16x10 9 1.16x10 9 1.16x10 9 1.16x10 9 kh (N/m) 3.44x10 8 3.22x10 8 3.01x10 8 2.72x10 8 Kl1 , K22 0.950 0.966 0.983 1.007 K13 , tK2 3 0.242 0.242

Microscopic structure of superdeformed states in Th, U, Pu and Cm isotopes with Gogny force

International Nuclear Information System (INIS)

Girod, M.; Delaroche, J.P.; Romain, P.; Libert, J.

2002-01-01

The structure properties of the even-even nuclei 226, 228, 230, 232, 234 Th, 230, 232, 234, 236, 238, 240 U, 240, 242, 244, 246 Pu, and 242, 244, 246, 248 Cm have been investigated at normal and superdeformed shapes in microscopic mean-field calculations based on Gogny force. Collective levels are predicted from constrained Hartree-Fock-Bogoliubov and configuration mixing calculations. Two quasiparticle states are also predicted from blocking calculations for neutron and proton configurations. Predictions are shown and compared with experimental data at superdeformed shapes. (orig.)

Measurement of 241Am Ground State Radiative Neutron Capture Cross Section with Cold Neutron Beam. Progress Report on Research Contract HUN14318 for the CRP on Minor Actinide Neutron Reaction Data (MANREAD)

International Nuclear Information System (INIS)

Belgya, T.; Szentmiklosi, L.; Kis, Z.; Nagy, N.M.; Konya, J.

2012-01-01

The ground state cross section of 242 Am has been measured with beams of cold neutrons at the Budapest Research Reactor using the X-ray emission of the decay product of 242 Pu. This methodology avoids the uncertainty caused by resonance neutrons in the pile activations. The target was characterized with gamma and X-ray spectrometry. The obtained ground state cross section is 540 ± 32 b, which is at the low end of the most recent literature values, but agrees with most of them within their uncertainty. (author)

Evaluation and compilation of fission product yields 1993

International Nuclear Information System (INIS)

England, T.R.; Rider, B.F.

1995-01-01

This document is the latest in a series of compilations of fission yield data. Fission yield measurements reported in the open literature and calculated charge distributions have been used to produce a recommended set of yields for the fission products. The original data with reference sources, and the recommended yields axe presented in tabular form. These include many nuclides which fission by neutrons at several energies. These energies include thermal energies (T), fission spectrum energies (F), 14 meV High Energy (H or HE), and spontaneous fission (S), in six sets of ten each. Set A includes U235T, U235F, U235HE, U238F, U238HE, Pu239T, Pu239F, Pu241T, U233T, Th232F. Set B includes U233F, U233HE, U236F, Pu239H, Pu240F, Pu241F, Pu242F, Th232H, Np237F, Cf252S. Set C includes U234F, U237F, Pu240H, U234HE, U236HE, Pu238F, Am241F, Am243F, Np238F, Cm242F. Set D includes Th227T, Th229T, Pa231F, Am241T, Am241H, Am242MT, Cm245T, Cf249T, Cf251T, Es254T. Set E includes Cf250S, Cm244S, Cm248S, Es253S, Fm254S, Fm255T, Fm256S, Np237H, U232T, U238S. Set F includes Cm243T, Cm246S, Cm243F, Cm244F, Cm246F, Cm248F, Pu242H, Np237T, Pu240T, and Pu242T to complete fission product yield evaluations for 60 fissioning systems in all. This report also serves as the primary documentation for the second evaluation of yields in ENDF/B-VI released in 1993

Evaluation and compilation of fission product yields 1993

Energy Technology Data Exchange (ETDEWEB)

England, T.R.; Rider, B.F.

1995-12-31

This document is the latest in a series of compilations of fission yield data. Fission yield measurements reported in the open literature and calculated charge distributions have been used to produce a recommended set of yields for the fission products. The original data with reference sources, and the recommended yields axe presented in tabular form. These include many nuclides which fission by neutrons at several energies. These energies include thermal energies (T), fission spectrum energies (F), 14 meV High Energy (H or HE), and spontaneous fission (S), in six sets of ten each. Set A includes U235T, U235F, U235HE, U238F, U238HE, Pu239T, Pu239F, Pu241T, U233T, Th232F. Set B includes U233F, U233HE, U236F, Pu239H, Pu240F, Pu241F, Pu242F, Th232H, Np237F, Cf252S. Set C includes U234F, U237F, Pu240H, U234HE, U236HE, Pu238F, Am241F, Am243F, Np238F, Cm242F. Set D includes Th227T, Th229T, Pa231F, Am241T, Am241H, Am242MT, Cm245T, Cf249T, Cf251T, Es254T. Set E includes Cf250S, Cm244S, Cm248S, Es253S, Fm254S, Fm255T, Fm256S, Np237H, U232T, U238S. Set F includes Cm243T, Cm246S, Cm243F, Cm244F, Cm246F, Cm248F, Pu242H, Np237T, Pu240T, and Pu242T to complete fission product yield evaluations for 60 fissioning systems in all. This report also serves as the primary documentation for the second evaluation of yields in ENDF/B-VI released in 1993.

Current pain education within undergraduate medical studies across Europe: Advancing the Provision of Pain Education and Learning (APPEAL) study

Science.gov (United States)

Briggs, Emma V; Battelli, Daniele; Gordon, David; Kopf, Andreas; Ribeiro, Sofia; Puig, Margarita M; Kress, Hans G

2015-01-01

Objectives Unrelieved pain is a substantial public health concern necessitating improvements in medical education. The Advancing the Provision of Pain Education and Learning (APPEAL) study aimed to determine current levels and methods of undergraduate pain medicine education in Europe. Design and methods Using a cross-sectional design, publicly available curriculum information was sought from all medical schools in 15 representative European countries in 2012–2013. Descriptive analyses were performed on: the provision of pain teaching in dedicated pain modules, other modules or within the broader curriculum; whether pain teaching was compulsory or elective; the number of hours/credits spent teaching pain; pain topics; and teaching and assessment methods. Results Curriculum elements were publicly available from 242 of 249 identified schools (97%). In 55% (133/242) of schools, pain was taught only within compulsory non-pain-specific modules. The next most common approaches were for pain teaching to be provided wholly or in part via a dedicated pain module (74/242; 31%) or via a vertical or integrated approach to teaching through the broader curriculum, rather than within any specific module (17/242; 7%). The curricula of 17/242 schools (7%) showed no evidence of any pain teaching. Dedicated pain modules were most common in France (27/31 schools; 87%). Excluding France, only 22% (47/211 schools) provided a dedicated pain module and in only 9% (18/211) was this compulsory. Overall, the median number of hours spent teaching pain was 12.0 (range 4–56.0 h; IQR: 12.0) for compulsory dedicated pain modules and 9.0 (range 1.0–60.0 h; IQR: 10.5) for other compulsory (non-pain specific) modules. Pain medicine was principally taught in classrooms and assessed by conventional examinations. There was substantial international variation throughout. Conclusions Documented pain teaching in many European medical schools falls far short of what might be expected given the

Double-shell tank system dangerous waste permit application

International Nuclear Information System (INIS)

1991-06-01

This Double-Shell Tank System Dangerous Waste Permit Application should be read in conjunction with the 242-A Evaporator Dangerous Waste Permit Application and the Liquid Effluent Retention Facility Dangerous Waste Permit Application, also submitted on June 28, 1991. Information contained in the Double-Shell Tank System permit application is referenced in the other two permit applications. The Double-Shell Tank System stores and treats mixed waste received from a variety of sources on the Hanford Site. The 242-A Evaporator treats liquid mixed waste received from the double-shell tanks. The 242-A Evaporator returns a mixed-waste slurry to the double-shell tanks and generates the dilute mixed-waste stream stored in the Liquid Effluent Retention Facility. This report contains information on the following topics: Facility Description and General Provisions; Waste Characteristics; Process Information; Groundwater Monitoring; Procedures to Prevent Hazards; Contingency Plan; Personnel Training; Exposure Information Report; Waste Minimization Plan; Closure and Postclosure Requirements; Reporting and Recordkeeping; other Relevant Laws; and Certification. 150 refs., 141 figs., 118 tabs

ORF Alignment: NC_003075 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available in [Arabidopsis thaliana] ... Length = 242 ... Query: 66 ... PCVIYCHGNSGCRADASEAAIVLLPSNITIFTLDFSGSGLSGGEHV...TLGWNEKDDLKAVV 125 ... PCVIYCHGNSGCRADASEAAIVLLPSNITIFTLDFSGSGLSGGEHVTLGWNEKDDLKAVV Sbjct: 1 ... PCVIYCHGNSGCRADA

Contribution to the experimental study of transuranian element (Pu, Am, Cm) transfers between the various phases (particles, water, organisms) of the sedimentary system

International Nuclear Information System (INIS)

Grillo, M.C.

1982-06-01

The methodology of this work is first given. Transfer kinetics of 237 Pu, 241 Am and 242 Cm between seawater and macrofauna of loose substrates are studied. The effect of temperature and salinity over the transfers of 237 Pu, 241 Am and 242 Cm between water and bivalve mollusk Tapes decussatus is then studied. This work deals also with transfer kinetics of these elements between carnivorous organisms of the loose substrates and their preys. A preliminary study of 241 Am transfers between two phases, particles and interstitial water is finally presented: role of benthic burrowing organisms [fr

Purification, crystallization and preliminary X-ray diffraction analysis of the C-terminal fragment of the MvfR protein from Pseudomonas aeruginosa

International Nuclear Information System (INIS)

Kefala, Katerina; Kotsifaki, Dina; Providaki, Mary; Kapetaniou, Evangelia G.; Rahme, Lawrence; Kokkinidis, Michael

2012-01-01

MvfRC87, a 242-residue C-terminal segment of the LysR-type transcriptional regulator MvfR, was produced in Escherichia coli, purified and crystallized. The LysR-type transcriptional regulator MvfR plays a critical role in Pseudomonas aeruginosa pathogenicity via the transcriptional regulation of multiple quorum-sensing-regulated virulence factors. The protein also controls pathogenic type VI secretion loci. MvfRC87, a 242-residue C-terminal segment of MvfR, was produced in Escherichia coli, purified and crystallized. X-ray diffraction data were collected using synchrotron radiation and crystallographic parameters were determined

Minutes of the 28th annual plutonium sample exchange meeting. Part I: isotopic sample exchange

International Nuclear Information System (INIS)

1984-01-01

Contents of this publication include the following: list of participating laboratories; agenda; attendees; minutes of October 24 meeting; and handout materials supplied by speakers. The handout materials cover the following: interlaboratory comparisons of plutonium isotope ratios. The plutonium ratios considered are 240/239, 241/239, 242/239, 238/239, 239/240, 241/240, 242/240, and 238/240; carbon, uranium, iron, and nickel data; mass spectroscopy data; determination of plutonium 241 half-life; review of plutonium overplating sample loading technique; on-line measurement evaluation system for isotopic analysis; and description of a new thermal ionization mass spectrometer

Basic criticality relations for gas core design

International Nuclear Information System (INIS)

Tanner, J.E.

1992-01-01

Minimum critical fissile concentrations are calculated for U-233, U-235, Pu-239, and Am-242m mixed homogeneously with hydrogen at temperatures to 15,000K. Minimum critical masses of the same mixtures in a 1000 liter sphere are also calculated. It is shown that propellent efficiencies of a gas core fizzler engine using Am-242m as fuel would exceed those in a solid core engine as small as 1000L operating at 100 atmospheres pressure. The same would be true for Pu-239 and possibly U-233 at pressures of 1000 atm. or at larger volumes

Synthesis of carbon-13 labeled ibuprofen

International Nuclear Information System (INIS)

Hsi, R.S.P.; Stelzer, L.S.; Stolle, W.T.

1989-01-01

This report describes the synthesis of 2-[4-(2-methyl)propyl-phenyl]propionic acid (ibuprofen) labeled with carbon-13 either at the terminal methyl carbons, or at the methine carbon of the isobutyl side chain. The synthetic route involves the removal of the isopropyl group in the isobutyl side-chain of ibuprofen via 2-[4-(2-methyl-1-propenyl)phenyl]propionic acid, followed by restoration of the isopropyl group with a Wittig reaction, using appropriate carbon-13 labeled acetone as the precursor of the isopropyl group. Interesting NMR coupling data attributable to phosphorous and carbon-13 are presented in the experimental section. (author)

ORF Alignment: NC_006368 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available LRERTGAGMMECKKFLIATNGDIEQAIIEMRKAGQAKADKKADRVAAEGI 60 ... Query: 122 TTVEQARQELVAKIGENIKLRRLERMHCDGVIGYYLHGSRIG...VMVALKNGSEALAKDIAM 181 ... TTVEQARQELVAKIGENIKLRRLERMHCDGVIGYYLHGSRIGVMVAL...KNGSEALAKDIAM Sbjct: 121 TTVEQARQELVAKIGENIKLRRLERMHCDGVIGYYLHGSRIGVMVALKNGSEALAKDIAM 180 ... Query: 242 QPYVKD

ORF Alignment: NC_003106 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available PAENLHDCASFIKDYLSSQGFSSQVIEFEKGWPVVISENGNKN 60 ... Query: 122 VNYNLIFTAVPDEESGGDKGSKYLADRYKPDLVLISEPSGSDSINIGEK...GLLQVKLIAKG 181 ... VNYNLIFTAVPDEESGGDKGSKYLADRYKPDLVLISEPSGSDSINIGEKGLLQV...KLIAKG Sbjct: 121 VNYNLIFTAVPDEESGGDKGSKYLADRYKPDLVLISEPSGSDSINIGEKGLLQVKLIAKG 180 ... Query: 242 FXXXXXXXXXXXX

ORF Alignment: NC_005042 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available VEKAKALRIPPGPIYSQL Sbjct: 121 ESAENKIIFEDNDFLVTCTPLIHRVPAFAYRVDEKAKPGRFDVEKAKALRIPPGPIYSQL 180 ... Query: 242 DSDLAYQRQHSTSTMAAQIASEAN...VGQLVLTHLSPRYAPGNRISPNDLLSEAKSIFPNTL 301 ... DSDLAYQRQHSTSTMAAQIASEAN...VGQLVLTHLSPRYAPGNRISPNDLLSEAKSIFPNTL Sbjct: 241 DSDLAYQRQHSTSTMAAQIASEANVGQLVLTHLSPRYAPGNRISPNDLLSEAKSIFPNTL 300 ...

ORF Alignment: NC_002967 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ... Length = 242 ... Query: 188 GSSRAWTTVLDSIKLVAASDVPVLISGETGTGKEQAARTIHRLSNRAEKPFVPV...NCSALV 247 ... GSSRAWTTVLDSIKLVAASDVPVLISGETGTGKEQAARTIHRLSNRAEKPFVPVNCSALV Sbjct: 1 ... GSSRAWTTVLDS...IKLVAASDVPVLISGETGTGKEQAARTIHRLSNRAEKPFVPVNCSALV 60 ... Query: 308 ERVGGEKPVSVDVRIIAATNVDLAEAVSMGRFREDLLYRLDVFP

Synthesis of novel 2-(4-(2-morpholinoethoxy)phenyl)-N ...

Indian Academy of Sciences (India)

gefitinib4 and the analgesic dextromoramide.5 Certain morpholino acetimidamide derivatives were found to suppress hepatitis C virus replication.6 Paracetamol, a simple acetamide is a widely used analgesic and antipyretic agent. Acetamide derivatives show potential biological functions. They possess excellent antimicro-.

17 CFR 242.600 - NMS security designation and definitions.

Science.gov (United States)

2010-04-01

... quotation has been superseded or supplemented by the display of a new transaction report, last sale data, or... association. (36) Make publicly available means posting on an Internet Web site that is free and readily... contracts in an options class that have the same unit of trade, expiration date, and exercise price, and...

All projects related to | Page 242 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

Topic: ENTREPRENEURSHIP, SOCIAL ASPECTS, BUSINESS SERVICES, INNOVATIONS, Capacity building, BUSINESS CREATION. Region: Middle East, North of Sahara, South of Sahara, ... Raising Tobacco Taxes in Selected Countries of Central America. Project. Expert advice and evidence-based research will guide ...

24 CFR 242.59 - Inspection of facilities by Commissioner.

Science.gov (United States)

2010-04-01

... HOUSING AND URBAN DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES MORTGAGE INSURANCE FOR HOSPITALS Regulatory Agreement, Accounting and Reporting, and Financial...

Facility effluent monitoring plan for 242-A Evaporator facility

International Nuclear Information System (INIS)

Crummel, G.M.; Gustavson, R.D.

1993-03-01

A facility effluent monitoring plan is required by the US Department of Energy in DOE Order 5400.1* for any operations that involve hazardous materials and radioactive substances that could affect employee or public safety or the environment. A facility effluent monitoring plan determination was performed during Calendar Year 1991 and the evaluation showed the need for a facility effluent monitoring plan. This document is prepared using the specific guidelines identified in A Guide for Preparing Hanford Site Facility effluent Monitoring Plans, WHC-EP-0438-1**. This facility effluent monitoring plan assesses effluent monitoring systems and evaluates whether they are adequate to ensure the public health and safety as specified in applicable federal, state, and local requirements

48 CFR 1552.242-72 - Financial administrative contracting officer.

Science.gov (United States)

2010-10-01

... Administrative Contracting Officer (FACO) is responsible for performing certain post-award functions related to the financial aspects of this contract when the EPA is the cognizant federal agency. These functions...) Negotiate advance agreements applicable to treatment of costs and to Independent Research & Development/Bid...

Tris{2-[4-(2-pyridylpyrimidin-2-ylsulfanyl]ethyl}amine

Directory of Open Access Journals (Sweden)

Jian-Quan Wang

2009-08-01

Full Text Available The tripodal character of the title compound, C33H30N10S3, arises from the three thioether arms surrounding a central amine N atom. The three arms have approximately the same conformation but distinct geometries in a trans–trans–cis conformation, resulting in a short pyridine–sulfanyl N...S distance of 4.320 (7 Å. The distances of the central N atom to the N atoms of three pyridine rings in the arms are 8.305 (7, 8.032 (7 and 5.076 (9Å. In the crystal, molecules are joined into a three-dimensional supramolecular network via effective π–π stacking between adjacent heterocycles [centroid–centroid distances of 3.700 (3–4.118 (4 Å between adjacent interlayer pyrimidine rings and 3.676 (4 Å between the pyridine rings].

Radiative capture on $^{242}$Pu for MOX fuel reactors

CERN Multimedia

The use of MOX fuel (mixed-oxide fuel made of UO$_{2}$ and PuO$_{2}$) in nuclear reactors allows substituting a large fraction of the enriched Uranium by Plutonium reprocessed from spent fuel. Indeed around 66% of the plutonium from spent fuel is made of $^{239}$Pu and $^{241}$Pu, which are fissile in thermal reactors. A typical reactor of this type uses a fuel with 7% reprocessed Pu and 93% depleted U, thus profiting from both the spent fuel and the remaining $^{238}$U following the $^{235}$U enrichment. With the use of such new fuel compositions rich in Pu the better knowledge of the capture and fission cross sections of the Pu isotopes becomes very important. This is clearly stated in the recent OECD NEA’s “High Priority Request List” and in the WPEC-26 “Uncertainty and target accuracy assessment for innovative systems using recent covariance data evaluations” report. In particular, a new series of cross section evaluations have been recently carried out jointly by the European (JEFF) and United ...

48 CFR 3452.242-72 - Withholding of contract payments.

Science.gov (United States)

2010-10-01

... clause in all solicitations and contacts other than purchase orders: Withholding of Contract Payments... shall promptly notify the contractor of its intention to withhold payment of any invoice or voucher...

Facility effluent monitoring plan for 242-A evaporator facility

International Nuclear Information System (INIS)

Crummel, G.M.; Gustavson, R.D.

1995-02-01

A facility effluent monitoring plan is required by the U.S. Department of Energy in DOE Order 5400.1 for any operations that involve hazardous materials and radioactive substances that could affect employee or public safety or the environment. A facility effluent monitoring plan determination was performed during Calendar Year 1991 and the evaluation showed the need for a facility effluent monitoring plan. This document is prepared using the specific guidelines identified in A Guide for Preparing Hanford Site Facility Effluent Monitoring Plans, WHC-EP-0438-1. This facility effluent monitoring plan assesses effluent monitoring systems and evaluates whether they are adequate to ensure the public health and safety as specified in applicable federal, state, and local requirements. This facility effluent monitoring plan shall ensure long-range integrity of the effluent monitoring systems by requiring an update whenever a new process or operation introduces new hazardous materials or significant radioactive materials. This document must be reviewed annually even if there are no operational changes, and it must be updated, as a minimum, every three years

36 CFR 242.24 - Customary and traditional use determinations.

Science.gov (United States)

2010-07-01

... (mileposts 25-46), Slana, Tazlina, Tok Cutoff Road (mileposts 79-110), Tonsina, and Units 11. Unit 11, north..., Mentasta Lake, Nabesna Road (mileposts 25-46), Slana, Tazlina, Tok Cutoff Road (mileposts 79-110), Tonsina... the Tok Cutoff—Milepost 79-110 (Mentasta Pass), residents along the Nabesna Road—Milepost 0-46...

ORF Alignment: NC_003295 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available RLPSPTVMRILFFSSHRYDEDAFRAAQARGGHGFELVFQRAHLDVHTAPLAAGFEVV 60 ... Query: 122 AVGMILTLNRRLHRACNRTREXXXXXXXXXXXXXXXKXXXXXXXXXXXXXFARIMA...GFGC 181 ... AVGMILTLNRRLHRACNRTRE ... K ... FARIMA...GFGC Sbjct: 121 AVGMILTLNRRLHRACNRTREGDFSLDGLLGFDLAGKTVGVVGTGQIGQVFARIMAGFGC 180 ... Query: 242

ORF Alignment: NC_005861 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available LPLLNAEGSLF 180 ... Query: 242 QQKAEITIKCTEKHEPQEKVGILVKENHRVKVIEYSELPDQHKNASEANGRLQ...YCCANLS 301 ... QQKAEITIKCTEKHEPQEKVGILVKENHRVKVIEYSELPDQHKNASEANGRLQYCCANLS Sbjct: 241 QQKAEITIKCTEK...HEPQEKVGILVKENHRVKVIEYSELPDQHKNASEANGRLQYCCANLS 300 ... Query: 362 KVFALLYPRHHCFAPLKNFQGNDSLESVQKALIYREK 398 ...

ORF Alignment: ch_oct10_gene_aa_db [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available 122 GLKIVLCIGESLSERETGKTNDVIQKQLTEALKDVSDLSNLVIAYEPIWAIGTGVVATPE 181 ... GLKIVLCIGESLSERETGKTNDVIQKQ...LTEALKDVSDLSNLVIAYEPIWAIGTGVVATPE Sbjct: 121 GLKIVLCIGESLSERETGKTNDVIQKQLTEALKDVSDLSNLVIAYEPIWAIGTGVVATPE 180 ... Query: 242 FAKIIESAQ 250 ... FAKIIESAQ Sbjct: 241 FAKIIESAQ 249

ORF Alignment: ch_oct10_gene_aa_db [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available 2 PPVLEKSDPRWPGNELIYKGICPSCLPTTECLKDTVERVKPYFEDVIAPSIMSGKSVLVS 181 ... PPVLEKSDPRWPGNELIYKGICPSCLPTTECLKDTVERVKPYFEDVIAPSIM...SGKSVLVS Sbjct: 121 PPVLEKSDPRWPGNELIYKGICPSCLPTTECLKDTVERVKPYFEDVIAPSIMSGKSVLVS 180 ... Query: 242 VANQGK 247 ... VANQGK Sbjct: 241 VANQGK 246

Paul Scherrer Institute Scientific Report 1999. Volume I: Particles and Matter

International Nuclear Information System (INIS)

Gobrecht, J.; Gaeggeler, H.; Herlach, D.; Junker, K.; Kettle, P.-R.; Kubik, P.; Zehnder, A.

2000-01-01

Although originally planned for fundamental research in nuclear physics, the particle beams of pions, muons, protons and neutrons are now used in a large variety of disciplines in both natural science and medicine. The beams at PSI have the world's highest intensities and therefore allow certain experiments to be performed, which would not be possible elsewhere. The highlight of research this year was the first-ever determination of the chemical properties of the superheavy element 107 Bohrium. This was undertaken, by an international team led by H. Gaeggeler of PSI's Laboratory for Radiochemistry. Bohrium was produced by bombarding a Berkelium target with Neon ions from the Injector I cyclotron and six atoms were detected after having passed through an online gas chromatography device. At the Laboratory for Particle Physics the focus has shifted from nuclear physics to elementary particle physics with about a fifty-fifty split between investigations of rare processes or particle decays using the high intensity muon, pion and recently also polarized neutron beams of PSI, and research at the highest energy frontier at CERN (Geneva) and DESY (Hamburg). Important space instrumentation has been contributed by the Laboratory for Astrophysics to the European Space Agency and NASA satellite programmes. The Laboratory for Micro and Nanotechnology continued to focus on research into molecular nanotechnology and SiGeC nanostructures, the latter with the aim of producing silicon based optoelectronics. Progress in 1999 in these topical areas is described in this report. A list of scientific publications in 1999 is also provided

Paul Scherrer Institute Scientific Report 1999. Volume I: Particles and Matter

Energy Technology Data Exchange (ETDEWEB)

Gobrecht, J.; Gaeggeler, H.; Herlach, D.; Junker, K.; Kettle, P.-R.; Kubik, P.; Zehnder, A. [eds.

2000-07-01

lthough originally planned for fundamental research in nuclear physics, the particle beams of pions, muons, protons and neutrons are now used in a large variety of disciplines in both natural science and medicine. The beams at PSI have the world's highest intensities and therefore allow certain experiments to be performed, which would not be possible elsewhere. The highlight of research this year was the first-ever determination of the chemical properties of the superheavy element {sup 107} Bohrium. This was undertaken, by an international team led by H. Gaeggeler of PSI's Laboratory for Radiochemistry. Bohrium was produced by bombarding a Berkelium target with Neon ions from the Injector I cyclotron and six atoms were detected after having passed through an online gas chromatography device. At the Laboratory for Particle Physics the focus has shifted from nuclear physics to elementary particle physics with about a fifty-fifty split between investigations of rare processes or particle decays using the high intensity muon, pion and recently also polarized neutron beams of PSI, and research at the highest energy frontier at CERN (Geneva) and DESY (Hamburg). Important space instrumentation has been contributed by the Laboratory for Astrophysics to the European Space Agency and NASA satellite programmes. The Laboratory for Micro and Nanotechnology continued to focus on research into molecular nanotechnology and SiGeC nanostructures, the latter with the aim of producing silicon based optoelectronics. Progress in 1999 in these topical areas is described in this report. A list of scientific publications in 1999 is also provided.

Paul Scherrer Institute Scientific Report 1999. Volume I: Particles and Matter

Energy Technology Data Exchange (ETDEWEB)

Gobrecht, J; Gaeggeler, H; Herlach, D; Junker, K; Kettle, P -R; Kubik, P; Zehnder, A [eds.

2000-07-01

lthough originally planned for fundamental research in nuclear physics, the particle beams of pions, muons, protons and neutrons are now used in a large variety of disciplines in both natural science and medicine. The beams at PSI have the world's highest intensities and therefore allow certain experiments to be performed, which would not be possible elsewhere. The highlight of research this year was the first-ever determination of the chemical properties of the superheavy element {sup 107} Bohrium. This was undertaken, by an international team led by H. Gaeggeler of PSI's Laboratory for Radiochemistry. Bohrium was produced by bombarding a Berkelium target with Neon ions from the Injector I cyclotron and six atoms were detected after having passed through an online gas chromatography device. At the Laboratory for Particle Physics the focus has shifted from nuclear physics to elementary particle physics with about a fifty-fifty split between investigations of rare processes or particle decays using the high intensity muon, pion and recently also polarized neutron beams of PSI, and research at the highest energy frontier at CERN (Geneva) and DESY (Hamburg). Important space instrumentation has been contributed by the Laboratory for Astrophysics to the European Space Agency and NASA satellite programmes. The Laboratory for Micro and Nanotechnology continued to focus on research into molecular nanotechnology and SiGeC nanostructures, the latter with the aim of producing silicon based optoelectronics. Progress in 1999 in these topical areas is described in this report. A list of scientific publications in 1999 is also provided.

Role of blood tumor markers in predicting metastasis and local recurrence after curative resection of colon cancer

Science.gov (United States)

Peng, Yifan; Zhai, Zhiwei; Li, Zhongmin; Wang, Lin; Gu, Jin

2015-01-01

Aim: To investigate the prognostic value of carcinoembryonic antigen (CEA), CA199, CA724 and CA242 in peripheral blood and local draining venous blood in colon cancer patients after curative resection. Methods: 92 colon cancer patients who received curative resection were retrospectively analyzed. The CEA, CA199, CA724 and CA242 were detected in peripheral blood and local draining venous blood. Results: Metastasis or local recurrence was found in 29 (29/92, 31.5%) patients during follow-up period. 92 patients were divided into two groups: metastasis/local recurrence group (n = 29) and non-metastasis/local recurrence group (n = 63). Peripheral venous CEA, CA199, CA724 and CA242 (p-CEA, p-CA199, p-CA724 and p-CA242) were comparable between two groups (P > 0.05). The median draining venous CEA (d-CEA) in metastases/local recurrence group (23.7 ± 6.9 ng/ml) was significantly higher than that in non-metastases/local recurrence group (18.1 ± 6.3 ng/ml; P 0.05). The optimal cut-off value of d-CEA was 2.76 ng/ml, with the sensitivity and specificity of 90% and 40% in the prediction of metastasis or local recurrence, respectively. d-CEA correlated with tumor differentiation, T stage, TNM stage, metastasis and local recurrence. Subgroup analysis showed that, of 41 patients with stage II colon cancer, the optimal cut-off value of d-CEA was 8.78 ng/mL, and the sensitivity and specificity were 87.5% and 69.7% in the prediction of metastasis or local recurrence, respectively. Conclusion: d-CEA may be a prognostic factor for stage II colon cancer patients. PMID:25785084

Comparison of visual field test results obtained through Humphrey matrix frequency doubling technology perimetry versus standard automated perimetry in healthy children.

Science.gov (United States)

Kocabeyoglu, Sibel; Uzun, Salih; Mocan, Mehmet Cem; Bozkurt, Banu; Irkec, Murat; Orhan, Mehmet

2013-10-01

The aim of this study was to compare the visual field test results in healthy children obtained via the Humphrey matrix 24-2 threshold program and standard automated perimetry (SAP) using the Swedish interactive threshold algorithm (SITA)-Standard 24-2 test. This prospective study included 55 healthy children without ocular or systemic disorders who underwent both SAP and frequency doubling technology (FDT) perimetry visual field testing. Visual field test reliability indices, test duration, global indices (mean deviation [MD], and pattern standard deviation [PSD]) were compared between the 2 tests using the Wilcoxon signed-rank test and paired t-test. The performance of the Humphrey field analyzer (HFA) 24-2 SITA-standard and frequency-doubling technology Matrix 24-2 tests between genders were compared with Mann-Whitney U-test. Fifty-five healthy children with a mean age of 12.2 ± 1.9 years (range from 8 years to 16 years) were included in this prospective study. The test durations of SAP and FDT were similar (5.2 ± 0.5 and 5.1 ± 0.2 min, respectively, P = 0.651). MD and the PSD values obtained via FDT Matrix were significantly higher than those obtained via SAP (P tests in terms of MD (r = 0.352, P = 0.008) and PSD (r = 0.329, P = 0.014) was observed. Children were able to complete both the visual test algorithms successfully within 6 min. However, SAP testing appears to be associated with less depression of the visual field indices of healthy children. FDT Matrix and SAP should not be used interchangeably in the follow-up of children.

Results of Am isotopic ratio analysis in irradiated MOX fuels

Energy Technology Data Exchange (ETDEWEB)

Koyama, Shin-ichi; Osaka, Masahiko; Mitsugashira, Toshiaki; Konno, Koichi [Power Reactor and Nuclear Fuel Development Corp., Oarai, Ibaraki (Japan). Oarai Engineering Center; Kajitani, Mikio

1997-04-01

For analysis of a small quantity of americium, it is necessary to separate from curium which has similar chemical property. As a chemical separation method for americium and curium, the oxidation of americium with pentavalent bismuth and subsequent co-precipitation of trivalent curium with BIP O{sub 4} were applied to analyze americium in irradiated MOX fuels which contained about 30wt% plutonium and 0.9wt% {sup 241}Am before irradiation and were irradiated up to 26.2GWd/t in the experimental fast reactor Joyo. The purpose of this study is to measure isotopic ratio of americium and to evaluate the change of isotopic ratio with irradiation. Following results are obtained in this study. (1) The isotopic ratio of americium ({sup 241}Am, {sup 242m}Am and {sup 243}Am) can be analyzed in the MOX fuels by isolating americium. The isotopic ratio of {sup 242m}Am and {sup 243}Am increases up to 0.62at% and 0.82at% at maximum burnup, respectively, (2) The results of isotopic analysis indicates that the contents of {sup 241}Am decreases, whereas {sup 242m}Am, {sup 243}Am increase linearly with increasing burnup. (author)

Electron-capture delayed fission properties of neutron-deficient einsteinium nuclei

Energy Technology Data Exchange (ETDEWEB)

Shaughnessy, Dawn A. [Univ. of California, Berkeley, CA (United States)

2000-01-01

Electron-capture delayed fission (ECDF) properties of neutron-deficient einsteinium isotopes were investigated using a combination of chemical separations and on-line radiation detection methods. ²⁴²Es was produced via the ²³³U(¹⁴N,5n)²⁴²Es reaction at a beam energy of 87 MeV (on target) in the lab system, and was found to decay with a half-life of 11 ± 3 seconds. The ECDF of ²⁴²Es showed a highly asymmetric mass distribution with an average pre-neutron emission total kinetic energy (TKE) of 183 ± 18 MeV. The probability of delayed fission (P_DF) was measured to be 0.006 ± 0.002. In conjunction with this experiment, the excitation functions of the ²³³U(¹⁴N,xn)^247-xEs and ²³³U^{(15N,xn)248-x}Es reactions were measured for ²⁴³Es, ²⁴⁴Es and ²⁴⁵Es at projectile energies between 80 MeV and 100 MeV.

Description of two new plasmids isolated from Francisella philomiragia strains and construction of shuttle vectors for the study of Francisella tularensis.

Science.gov (United States)

Le Pihive, E; Blaha, D; Chenavas, S; Thibault, F; Vidal, D; Valade, E

2009-11-01

Francisella tularensis is the causative agent of tularemia, a zoonotic disease often transmitted to humans by infected animals. The lack of useful specific genetic tools has long hampered the study of F. tularensis subspecies. We identified and characterized two new plasmids, pF242 and pF243, isolated from Francisella philomiragia strains ATCC 25016 and ATCC 25017, respectively. Sequence analysis revealed that pF242 and pF243 are closely related to pC194 and pFNL10 plasmids, respectively. Two generations of pF242- and pF243-based shuttle vectors, harboring several antibiotic resistance markers, were developed. We used the first generation to compare transformation efficiencies in two virulent F. tularensis subspecies. We found that electroporation was more efficient than cryotransformation: almost all vectors tested were successfully introduced by electroporation into Francisella strains with a high level of efficiency. The second generation of shuttle vectors, containing a multiple cloning site and/or gfp gene downstream of Francisella groES promotor, was used for GFP production in F. tularensis. The development of new shuttle vectors offers new perspectives in the genetic manipulation of F. tularensis, helping to elucidate the mechanisms underlying its virulence.

ORF Alignment: NC_002947 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available C family ... [Pseudomonas putida KT2440] ... Length = 101 ... Query: 242 ERAIMHRVSEWAADCPEETLNLLE...LADVAGVSLRQLQQAFKAFTGMPPAHWLRLRRLNGA 301 ... ERAIMHRVSEWAADCPEETLNLLELADVA...GVSLRQLQQAFKAFTGMPPAHWLRLRRLNGA Sbjct: 1 ... ERAIMHRVSEWAADCPEETLNLLELADVAGVSLRQLQQAFKAFTGMPPAHWLRLRRLNGA 60 ...

40 CFR Appendix E to Part 61 - Compliance Procedures Methods for Determining Compliance With Subpart I

Science.gov (United States)

2010-07-01

... Part 61, Subpart I”. The compliance model is the highest level in the COMPLY computer code and provides... Ag-106 1.6E+00 1.6E+03 1.6E+06 Ag-106m 2.6E−03 2.6E+00 2.6E+03 Ag-108m 6.5E−06 6.5E−03 6.5E+00 Ag...−06 2.3E−03 2.3E+00 Am-242 1.8E−02 1.8E+01 1.8E+04 Am-242m 2.5E−06 2.5E−03 2.5E+00 Am-243 2.3E−06 2.3E...

Microscopic structure of superdeformed states in Th, U, Pu and Cm isotopes with Gogny force

Energy Technology Data Exchange (ETDEWEB)

Girod, M.; Delaroche, J.P.; Romain, P. [CEA/DIF, DPTA/SPN, Boite Postale 12, 91680 Bruyeres-le-Chatel (France); Libert, J. [Institut de Physique Nucleaire Centre National de la Recherche Scientifique-IN2P3, F-91406 Orsay (France)

2002-10-01

The structure properties of the even-even nuclei {sup 226,} {sup 228,} {sup 230,} {sup 232,} {sup 234}Th, {sup 230,} {sup 232,} {sup 234,} {sup 236,} {sup 238,} {sup 240}U, {sup 240,} {sup 242,} {sup 244,} {sup 246}Pu, and {sup 242,} {sup 244,} {sup 246,} {sup 248}Cm have been investigated at normal and superdeformed shapes in microscopic mean-field calculations based on Gogny force. Collective levels are predicted from constrained Hartree-Fock-Bogoliubov and configuration mixing calculations. Two quasiparticle states are also predicted from blocking calculations for neutron and proton configurations. Predictions are shown and compared with experimental data at superdeformed shapes. (orig.)

Radiochemical methodologies applied to analytical characterization of low and intermediate level wastes from nuclear power plants

International Nuclear Information System (INIS)

Monteiro, Roberto Pellacani G.; Júnior, Aluísio Souza R.; Kastner, Geraldo F.; Temba, Eliane S.C.; Oliveira, Thiago C. de; Amaral, Ângela M.; Franco, Milton B.

2017-01-01

The aim of this work is to present radiochemical methodologies developed at CDTN/CNEN in order to answer a program for isotopic inventory of radioactive wastes from Brazilian Nuclear Power Plants. In this program some radionuclides, 3 H, 14 C, 55 Fe, 59 Ni, 63 Ni, 90 Sr, 93 Zr, 94 Nb, 99 Tc, 129 I, 235 U, 238 U, 238 Pu, 239 + 240 Pu, 241 Pu, 242 Pu, 241 Am, 242 Cm e 243 + 244 Cm, were determined in Low Level Wastes (LLW) and Intermediate Level Wastes (ILW) and a protocol of analytical methodologies based on radiochemical separation steps and spectrometric and nuclear techniques was established. (author)

ORF Alignment: Ca19AnnotatedDec2004aaSeq [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available 9.2041 [Candida ... albicans SC5314] ... Length = 135 ... Query: 183 GSLVKVRKEEPLITFGRLAEFCINILNDVI...NHKFPNQGVLSGPFLEEVDTEVYTDYLDYV 242 ... GSLVKVRKEEPLITFGRLAEFCINILNDVINHK...FPNQGVLSGPFLEEVDTEVYTDYLDYV Sbjct: 1 ... GSLVKVRKEEPLITFGRLAEFCINILNDVINHKFPNQGVLSGPFLEEVDTEVYTDYLDYV 60 ... Quer

Frequência de disfunção sexual em mulheres com doenças reumáticas Frequency of sexual dysfunction in women with rheumatic diseases

Directory of Open Access Journals (Sweden)

Clarissa de Castro Ferreira

2013-02-01

Full Text Available OBJETIVO: Pesquisar a prevalência de disfunção sexual em mulheres com as seguintes doenças reumáticas: lúpus eritematoso sistêmico, artrite reumatoide, esclerose sistêmica, síndrome antifosfolípide e fibromialgia acompanhados no Ambulatório de Reumatologia do Hospital Universitário de Brasília e do Hospital das Clínicas da Universidade de São Paulo. MÉTODOS: Utilizou-se o índice de função sexual feminina (Female Sexual Function Index - FSfi, questionário que contém 19 itens que avaliam 6 domínios: desejo sexual, excitação sexual, lubrificação vaginal, orgasmo, satisfação sexual e dor. RESULTADOS: Foram avaliadas 163 pacientes. A média de idade foi de 40,4 anos. A prevalência de disfunção sexual foi de 18,4%, porém 24,2% das pacientes não apresentaram atividade sexual nas últimas 4 semanas. Entre os subgrupos, as pacientes com fibromialgia e esclerose sistêmica foram as com maior índice de disfunção sexual (33%. Se excluirmos as pacientes sem atividade sexual, a taxa de disfunção sobe para 24,2%. CONCLUSÃO: A prevalência de disfunção sexual encontrada neste estudo foi menor em relação à literatura. Entretanto, 24,2% das pacientes entrevistadas negaram atividade sexual nas últimas 4 semanas, o que pode ter contribuído para o baixo índice de disfunção sexual.OBJECTIVE: To assess the prevalence of sexual dysfunction in women followed up at the Rheumatology Outpatient Clinic of the Hospital Universitário de Brasília and of the Hospital das Clínicas da Universidade de São Paulo with the following rheumatic diseases: systemic lupus erythematosus; rheumatoid arthritis; systemic sclerosis; antiphospholipid antibody syndrome; and fibromyalgia. METHODS: The Female Sexual Function Index (FSfi, obtained by applying a 19-item questionnaire that assesses six domains (sexual desire, arousal, vaginal lubrication, orgasm, sexual satisfaction and pain, was used. RESULTS: This study assessed 163 patients. The

State waste discharge permit application for the 200 Area Effluent Treatment Facility and the State-Approved Land Disposal Site

International Nuclear Information System (INIS)

1993-08-01

Application is being made for a permit pursuant to Chapter 173--216 of the Washington Administrative Code (WAC), to discharge treated waste water and cooling tower blowdown from the 200 Area Effluent Treatment Facility (ETF) to land at the State-Approved Land Disposal Site (SALDS). The ETF is located in the 200 East Area and the SALDS is located north of the 200 West Area. The ETF is an industrial waste water treatment plant that will initially receive waste water from the following two sources, both located in the 200 Area on the Hanford Site: (1) the Liquid Effluent Retention Facility (LERF) and (2) the 242-A Evaporator. The waste water discharged from these two facilities is process condensate (PC), a by-product of the concentration of waste from DSTs that is performed in the 242-A Evaporator. Because the ETF is designed as a flexible treatment system, other aqueous waste streams generated at the Hanford Site may be considered for treatment at the ETF. The origin of the waste currently contained in the DSTs is explained in Section 2.0. An overview of the concentration of these waste in the 242-A Evaporator is provided in Section 3.0. Section 4.0 describes the LERF, a storage facility for process condensate. Attachment A responds to Section B of the permit application and provides an overview of the processes that generated the wastes, storage of the wastes in double-shell tanks (DST), preliminary treatment in the 242-A Evaporator, and storage at the LERF. Attachment B addresses waste water treatment at the ETF (under construction) and the addition of cooling tower blowdown to the treated waste water prior to disposal at SALDS. Attachment C describes treated waste water disposal at the proposed SALDS

Comparison of visual field test results obtained through Humphrey matrix frequency doubling technology perimetry versus standard automated perimetry in healthy children

Directory of Open Access Journals (Sweden)

Sibel Kocabeyoglu

2013-01-01

Full Text Available Aims : The aim of this study was to compare the visual field test results in healthy children obtained via the Humphrey matrix 24-2 threshold program and standard automated perimetry (SAP using the Swedish interactive threshold algorithm (SITA-Standard 24-2 test. Materials and Methods: This prospective study included 55 healthy children without ocular or systemic disorders who underwent both SAP and frequency doubling technology (FDT perimetry visual field testing. Visual field test reliability indices, test duration, global indices (mean deviation [MD], and pattern standard deviation [PSD] were compared between the 2 tests using the Wilcoxon signed-rank test and paired t-test. The performance of the Humphrey field analyzer (HFA 24-2 SITA-standard and frequency-doubling technology Matrix 24-2 tests between genders were compared with Mann-Whitney U-test. Results: Fifty-five healthy children with a mean age of 12.2 ± 1.9 years (range from 8 years to 16 years were included in this prospective study. The test durations of SAP and FDT were similar (5.2 ± 0.5 and 5.1 ± 0.2 min, respectively, P = 0.651. MD and the PSD values obtained via FDT Matrix were significantly higher than those obtained via SAP (P < 0.001, and fixation losses and false negative errors were significantly less with SAP (P < 0.05. A weak positive correlation between the two tests in terms of MD (r = 0.352, P = 0.008 and PSD (r = 0.329, P = 0.014 was observed. Conclusion: Children were able to complete both the visual test algorithms successfully within 6 min. However, SAP testing appears to be associated with less depression of the visual field indices of healthy children. FDT Matrix and SAP should not be used interchangeably in the follow-up of children.

Comparación de diferentes sondas de DNA para la detección de Plasmodium falciparum

Directory of Open Access Journals (Sweden)

L. Eugenio Andrade

1989-12-01

Full Text Available Las sondas pRepHind, Rep20, p242B1-1, pPF-14, clon 26 y clon 34 se compararon a fin de examinar su capacidad para detectar P. falciparum en estudios de campo. Noventa y cuatro muestras de pacientes procedentes de Tumaco, región endémica de malaria situada en la Costa Pacífica Colombiana y 78 muestras provenientes de Villavicencio (Llanos Orientales, se estudiaron en experimentos de hibridación en "dot-blot". Las sondas Rep 20, p242B1-1, pRepHind y pPF-14 detectaron hasta 17 pg de DNA purificado de P. falciparum, mientras que los clones 26 y 34 detectaron 425 pg de DNA. Las sondas pPF-14, p242B1-1, pRepHind y Rep 20 mostraron niveles comparables de detección en muestras de sangre infectada. La sensibilidad mostró variaciones desde 75-94% en sujetos con parasitemias mayores de 10.000 par. a 15-42% en sujetos con parasitemias menores de 100 par. .Las sondas pPF-14 y p242B1-1 mostraron la mayor sensibilidad, mientras que los clones 26 y 34 presentaron niveles de detección significativamente menores. Todas las sondas demostraron ser altamente específicas. Los niveles de detección fueron dependientes del tratamiento de la muestra. El tratamiento consiste en eliminación del suero, lisis con Triton X-100, digestión con Proteinasa K, extracción con Fenol y Cloroformo, y precipitación con etanol condujo a niveles de detección del 100% cuando se realizó en muestras con parasitemias igual y/o mayores de 1.000 par.

Sampling and Analysis for Tank 241-AW-104 Waste in Support of Evaporator Campaign 2001-1

International Nuclear Information System (INIS)

MCKINNEY, S.G.

2000-01-01

This Tank Sampling and Analysis Plan (TSAP) identifies sample collection, laboratory analysis, quality assurance/quality control (QA/QC), and reporting objectives for the characterization of tank 241-AW-104 waste. Technical bases for these objectives are specified in the 242-A Evaporator Data Quality Objectives (Bowman 2000a and Von Bargen 1998), 242-A Evaporator Quality Assurance Project Plan (Bowman 1998 and Bowman 2000b), Tank 241-AW-104 Sampling Requirements in Support of Evaporator Campaign 2000-1 (Le 2000). Characterization results will be used to support the evaporator campaign currently planned for early fiscal year 2001. No other needs (or issues) requiring data for this tank waste apply to this sampling event

Radiometric determination of uranium and its decay products found in uranium ores

International Nuclear Information System (INIS)

Alencar, D.M. de.

1982-01-01

Uranium is analysed by three different methods based on gamma spectroscopy. The first method evaluates the 205 KeV photopeak emitted in the U-235 decay. It consits of a direct way of measuring 235 U, is applicable to the fuel element control and its inherent uncertainty is 13%. The second method assumes that uranium is in secular equilibrium in the sample and thus, uses the 242 KeV peak of Ra-226 and also the ratio between the 186 and 242 KeV peak areas. The third method analyses the contributions of U-235 and Ra-226 for the 186 KeV peak area; its error is negligible and its uncertainty is of 3%. (C.L.B.) [pt

Joint estimation of the fast and thermal components of a high neutron flux with a two on-line detector system

International Nuclear Information System (INIS)

Filliatre, P.; Oriol, L.; Jammes, C.; Vermeeren, L.

2009-01-01

A fission chamber with a 242 Pu deposit is the best suited detector for on-line measurements of the fast component of a high neutron flux (∼10 14 ncm -2 s -1 or more) with a significant thermal component. To get the fast flux, it is, however, necessary to subtract the contribution of the thermal neutrons, which increases with fluence because of the evolution of the isotopic content of the deposit. This paper presents an algorithm that permits, thanks to measurements provided by a 242 Pu fission chamber and a detector for thermal neutrons, to estimate the thermal and the fast flux at any time. An implementation allows to test it with simulated data.

Contribution to the study of molybdic medium and of rare earth molybdates in solution

International Nuclear Information System (INIS)

Bouih, A.

1989-01-01

On one hand,a potentiometric study of molybdic medium is done, and on the other hand, trivalent Europium behaviour in this medium is investigated The using of potentiometric data resulting from the molybdic medium study has permited to determine, with the help of a calculation program based on the electroneutrality equations and on the mass conservation, the equilibrium constants corresponding to the polymerization of molybdic acid. The behaviour of trivalent Europium in molybdic medium has been investigated using solvent extraction and potentiometry methods. Both methods have permited to identify two complexes: EuHMo7O24(2-); EuHMo7O24(2-) and to calculate their equilibrium constants. 11 figs., 12 tabs., 29 refs.(author)

Review of Livermore-Led Neutron Capture Studies Using DANCE

International Nuclear Information System (INIS)

Parker, W; Sheets, S; Agvaanluvsan, U; Becker, J; Becvar, F; Bredeweg, T; Clement, R; Couture, A; Esch, E; Haight, R; Jandel, M; Krticka, M; Mitchell, G; Macri, R; O'Donnell, J; Reifarth, R; Rundberg, R; Schwantes, J; Ullmann, J; Vieira, D; Wouters, J; Wilk, P

2007-01-01

We have made neutron capture cross-section measurements using the white neutron source at the Los Alamos Science Center, the DANCE detector array (Detector for Advanced Neutron Capture Experiments) and targets important for basic science and stockpile stewardship. In this paper, we review results from (n,γ) reactions on 94,95 Mo, 152,154,157,160,nat Gd, 151,153 Eu and 242m Am for neutron energies from 94,95 Mo, we focused on the spin and parity assignments of the resonances and the determination of the photon strength functions for the compound nuclei 95,96 Mo. Future plans include measurements on actinide targets; our immediate interest is in 242m Am

BOOK REVIEW FOOD AND AGRICULTURAL LAW: READINGS ON ...

African Journals Online (AJOL)

242 AFE BABALOLA UNIVERSITY: JOURNAL OF SUSTAINABLE DEVELOPMENT LAW ... The book, Food and Agricultural Law is Nigeria's first authoritative book ... professions including law, economics, environmental science, development,.

Hepatobiliary gammagraphy and its importance for differential diagnosis of mechanic and hepatocellular jaundice

International Nuclear Information System (INIS)

Takacs, J.

1983-01-01

The reliability of hepatobiliary gammagraphy following sup(99m)Tc-EHIDA administration and its variations with the concentration of the total plasma bilirubin were assessed in 155 hepatitis patients in whom differential diagnosis was performed for mechanical or hepatocellular jaundice. In mechanical jaundice (28 patients), sensitivity of the method was 75.8%, specificity 95.9%, diagnostic accuracy 90.9%. In hepatocellular jaundice (127 patients) the respective values were 95.9%, 90.3%, 94.8%. The differential diagnosis reliability was found to decrease with the increasing level of total bilirubin. For a level of up to 21.5 μmol/l, diagnostic accuracy was 93.6%, for a level between 21.6 and 85.5 μmol/l it was 91.0%, from 85.6 to 171.0 μmol/l it was 66.6%, from 171.1 to 242.0 μmol/l it was 50.0%, and above 242.0 μmol/l, diagnostic accuracy was 28.5%. At the same time, the sensitivity and specificity of examination decreased with increasing bilirubin level. In respect of differential diagnosis of jaundice, a concentration of the total plasma bilirubin of 242.O μmol/l is considered to be the limit concentration. (author)

The determination of Plutonium content in urine using anion exchange resin method

International Nuclear Information System (INIS)

Mukh-Syaifudin

1996-01-01

The possibility of internal contamination by plutonium is usually determined through urine analysis. The technique involved the co-precipitation of plutonium with rhodizonic acid by the addition of sodium hydroxide, the re-extraction of Pu into concentrated HCl, dissolution of Pu in 8 N HCI + Cl 2 solution, and the purification of plutonium through AGI-X8 anion exchange resin in columns with a diameter of 4 and 7 mm. The eluent was evaporated and the residu was dissolved in 8 N HCI and then deposited directly onto a Lexan slide or electrodeposited onto a stainless steel disc and the alpha emission of Pu was counted by using alpha spectrometry. The results showed that the recoveries of Pu-242 tracer by using column 7 mm and direct deposition and electrodeposition methods were 28.783% and 16.444%, respectively. The recoveries of Pu-242 by using column 4 mm and direct deposition and electrodeposition methods were 64.834% and 55.661%, respectively. From the percentage of recovery, it can be concluded that the direct deposition method was relatively better than the electrodeposition method. The recovery of Pu-242 by using column of 4 mm in diameter was higher than that of column 7 mm

Effect of multizone refractive multifocal contact lenses on standard automated perimetry.

Science.gov (United States)

Madrid-Costa, David; Ruiz-Alcocer, Javier; García-Lázaro, Santiago; Albarrán-Diego, César; Ferrer-Blasco, Teresa

2012-09-01

The aim of this study was to evaluate whether the creation of 2 foci (distance and near) provided by multizone refractive multifocal contact lenses (CLs) for presbyopia correction affects the measurements on Humphreys 24-2 Swedish interactive threshold algorithm (SITA) standard automated perimetry (SAP). In this crossover study, 30 subjects were fitted in random order with either a multifocal CL or a monofocal CL. After 1 month, a Humphrey 24-2 SITA standard strategy was performed. The visual field global indices (the mean deviation [MD] and pattern standard deviation [PSD]), reliability indices, test duration, and number of depressed points deviating at P0.5% on pattern deviation probability plots were determined and compared between multifocal and monofocal CLs. Thirty eyes of 30 subjects were included in this study. There were no statistically significant differences in reliability indices or test duration. There was a statistically significant reduction in the MD with the multifocal CL compared with monfocal CL (P=0.001). Differences were not found in PSD nor in the number of depressed points deviating at P0.5% in the pattern deviation probability maps studied. The results of this study suggest that the multizone refractive lens produces a generalized depression in threshold sensitivity as measured by the Humphreys 24-2 SITA SAP.

Half-lives for selected actinides and long-lived radionuclides

International Nuclear Information System (INIS)

Holden, N.E.

1988-01-01

Long-lived actinide nuclides are of interest for their use in nuclear reactors, for nuclear reactor burnup studies in waste management, and for safeguard applications, e.g., α counting is used to determine the amount of material present. Some long-lived radionuclides are of interest for their use in determining geological ages using various dating methods, and in calculating the cosmic-ray exposure ages of meteorites. Recommended values are presented for both the total half-life and for the spontaneous fission half-life of /sup 232-236,238/U, of /sup 236,238-242,244/Pu, of /sup 241,242m,243/Am, and of /sup 242-248,250/Cm. Problems with the presentation of uncertainties are discussed. The impact of the revised 14 C half-life on the carbon dating technique and various 14 C ages is discussed. The possible primordial occurrence of 92 Nb is now definitely ruled out. Based on examination of the 26 Al half-life, the calculated value for the cosmic-ray exposure age of meteorites remains too high compared to the age calculated using other radionuclide half-life values. 204 Pb, which was once thought to be radioactive, is shown to be stable. 37 refs., 5 tabs

People and things. CERN Courier, Mar 1984, v. 24(2)

Energy Technology Data Exchange (ETDEWEB)

Anon.

1984-03-15

The article reports on achievements of various people, staff changes and position opportunities within the CERN organization and contains news updates on upcoming or past events. Some time ago, Wolfgang ('Pief') Panofsky, Director of SLAC since 1961 and one of the prime movers behind both the famous two-mile electron linac and the Laboratory itself, announced his intention to step down in 1984. Immediately a search began for a worthy successor. Carlo Rubbia, leader of the UA 1 experiment at CERN which last year discovered the W and Z particles, was named by the US science magazine 'Discover' as its 1983 'Scientist of the Year'. A CERN-ECFA Workshop to study the feasibility of hadron colliders which it might at some time in the future be possible to install in the LEP tunnel, is to be held at the University of Lausanne from 21-24 March. Fermilab will host the 1984 US Summer School on High Energy Particle Accelerators from 13-24 August - the fourth in this series of summer schools.The 1984 CERN School of Computing, the eighth in the biennial series, is being organized in collaboration with the Instituto Estudios Energeticos (Junta de Energia Nuclear, Madrid) and the Facultad de Informatica, Barcelona, and will be held from 9-22 September at Aiguablava, Spain. The 1984 Users' Meeting of the High Energy Discussion Group (HEDG) at Brookhaven on 29-31 March will include a Workshop on the possible physics from an improved Alternating Gradient Synchrotron.

17 CFR 242.404 - Type, form and use of margin.

Science.gov (United States)

2010-04-01

... accordingly; (ii) The security futures intermediary (or clearing agency or derivatives clearing organization... value; (ii) Each net long or short position in a listed option on a contract for future delivery shall... (CONTINUED) REGULATIONS M, SHO, ATS, AC, AND NMS AND CUSTOMER MARGIN REQUIREMENTS FOR SECURITY FUTURES...

36 CFR 242.16 - Customary and traditional use determination process.

Science.gov (United States)

2010-07-01

... characterized by efficiency and economy of effort and cost, conditioned by local characteristics; (4) The... generation to generation; (7) A pattern of use in which the harvest is shared or distributed within a...

People and things. CERN Courier, Mar 1984, v. 24(2)

International Nuclear Information System (INIS)

Anon.

1984-01-01

The article reports on achievements of various people, staff changes and position opportunities within the CERN organization and contains news updates on upcoming or past events. Some time ago, Wolfgang ('Pief') Panofsky, Director of SLAC since 1961 and one of the prime movers behind both the famous two-mile electron linac and the Laboratory itself, announced his intention to step down in 1984. Immediately a search began for a worthy successor. Carlo Rubbia, leader of the UA 1 experiment at CERN which last year discovered the W and Z particles, was named by the US science magazine 'Discover' as its 1983 'Scientist of the Year'. A CERN-ECFA Workshop to study the feasibility of hadron colliders which it might at some time in the future be possible to install in the LEP tunnel, is to be held at the University of Lausanne from 21-24 March. Fermilab will host the 1984 US Summer School on High Energy Particle Accelerators from 13-24 August - the fourth in this series of summer schools.The 1984 CERN School of Computing, the eighth in the biennial series, is being organized in collaboration with the Instituto Estudios Energeticos (Junta de Energia Nuclear, Madrid) and the Facultad de Informatica, Barcelona, and will be held from 9-22 September at Aiguablava, Spain. The 1984 Users' Meeting of the High Energy Discussion Group (HEDG) at Brookhaven on 29-31 March will include a Workshop on the possible physics from an improved Alternating Gradient Synchrotron

242 The Status of Material Resources for Effective Teaching of ...

African Journals Online (AJOL)

User

2011-07-21

Jul 21, 2011 ... Stephen, Utib-Abasi Scepter - Department of Science Education, University of Uyo, Uyo, Akwa Ibom ... (primary, secondary and tertiary). At the ... effective teaching and learning of physics, in our secondary schools therefore ...

Transuranium Processing Plant semiannual report of production, status, and plans for period ending December 31, 1975

International Nuclear Information System (INIS)

King, L.J.; Bigelow, J.E.; Collins, E.D.

1976-10-01

Between July 1, 1975, and December 31, 1975, maintenance was conducted at TRU for a period of three months, 295 g of curium oxide (enough for approximately 26 HFIR targets) were prepared, 100 mg of high-purity 248 Cm, were separated from 252 Cf that had been purified during earlier periods, 11 HFIR targets were fabricated, and 28 product shipments were made. No changes were made in the chemical processing flowsheets normally used at TRU during this report period. However, three equipment racks were replaced (with two new racks) during this time. In Cubicle 6, the equipment replaced was that used to decontaminate the transplutonium elements from rare earth fission products and to separate curium from the heavier elements by means of the LiCl-based anion-exchange process. In Cubicle 5, the equipment used to separate the transcurium elements by high-pressure ion exchange and to purify berkelium by batch solvent extraction was replaced. Two neutron sources were fabricated, bringing the total fabricated to 79. One source that had been used in a completed project was returned to the TRU inventory and is available for reissue. Three sources, for which no further use was foreseen, were processed to isolate and recover the ingrown 248 Cm and the residual 252 Cf. Eight pellets, each containing 100 μg of high-purity 248 Cm were prepared for irradiation in HFIR to study the production of 250 Cm. The values currently being used for transuranium element decay data and for cross-section data in planning irradiation-processing cycles, calculating production forecasts, and assaying products are tabulated

Standard guide for estimating the atmospheric corrosion resistance of low-alloy steels

CERN Document Server

American Society for Testing and Materials. Philadelphia

2004-01-01

1.1 This guide presents two methods for estimating the atmospheric corrosion resistance of low-alloy weathering steels, such as those described in Specifications A242/A242M, A588/A588M, A606 Type 4, A709/A709M grades 50W, HPS 70W, and 100W, A852/A852M, and A871/A871M. One method gives an estimate of the long-term thickness loss of a steel at a specific site based on results of short-term tests. The other gives an estimate of relative corrosion resistance based on chemical composition. 1.2 The values stated in SI units are to be regarded as standard. No other units of measurement are included in this standard.

Joint estimation of the fast and thermal components of a high neutron flux with a two on-line detector system

Energy Technology Data Exchange (ETDEWEB)

Filliatre, P. [CEA, DEN, SPEx/LDCI, F-13108 Saint-Paul-lez-Durance (France); Laboratoire Commun d' Instrumentation CEA-SCK-CEN (France)], E-mail: philippe.filliatre@cea.fr; Oriol, L.; Jammes, C. [CEA, DEN, SPEx/LDCI, F-13108 Saint-Paul-lez-Durance (France); Laboratoire Commun d' Instrumentation CEA-SCK-CEN (France); Vermeeren, L. [SCK-CEN, Boeretang 200, B-2400 Mol (Belgium); Laboratoire Commun d' Instrumentation CEA-SCK-CEN (France)

2009-05-21

A fission chamber with a {sup 242}Pu deposit is the best suited detector for on-line measurements of the fast component of a high neutron flux ({approx}10{sup 14}ncm{sup -2}s{sup -1} or more) with a significant thermal component. To get the fast flux, it is, however, necessary to subtract the contribution of the thermal neutrons, which increases with fluence because of the evolution of the isotopic content of the deposit. This paper presents an algorithm that permits, thanks to measurements provided by a {sup 242}Pu fission chamber and a detector for thermal neutrons, to estimate the thermal and the fast flux at any time. An implementation allows to test it with simulated data.

Plány Vyšehradu v Národní knihovně v Paříži

Czech Academy of Sciences Publication Activity Database

Nechvátal, Bořivoj

2016-01-01

Roč. 41, č. 2 (2016), s. 229-242 ISSN 0231-5823 Institutional support: RVO:67985912 Keywords : defence system * palisades * bastion * ravelin * Vyšehrad Subject RIV: AC - Archeology, Anthropology, Ethnology

Moderna mimo centra

Czech Academy of Sciences Publication Activity Database

Hnídková, Vendula

2017-01-01

Roč. 96, č. 4 (2017), s. 242-244 ISSN 0042-4544 Institutional support: RVO:68378033 Keywords : modern architecture * Josep Lluis Sert * Fondation Maeght Subject RIV: AL - Art, Architecture , Cultural Heritage

Focused directed evolution of beta-glucosidases: theoretical versus real effectiveness of a minimal working setup and simple robust screening

Czech Academy of Sciences Publication Activity Database

Mazura, P.; Filipi, T.; Souček, P.; Brzobohatý, Břetislav

2011-01-01

Roč. 346, č. 2 (2011), s. 238-242 ISSN 0008-6215 Institutional support: RVO:68081707 Keywords : Directed evolution * beta-Glucosidase * Mutagenesis Subject RIV: BO - Biophysics Impact factor: 2.332, year: 2011

Inorganic nanoprobes for biological sensing and imaging

National Research Council Canada - National Science Library

Mattoussi, Hedi; Cheon, Jinwoo

2009-01-01

... and Nickel Nanoparticles Metal Alloy Nanoparticles 2.3.1 FePt Nanoparticles 2.3.2 Other Metal Alloy Nanoparticles Metal Oxide Nanoparticles 2.4.1 Monometallic Oxide Nanoparticles 2.4.2 Bimetall...

75 FR 28252 - Notice of a Computer Matching Program

Science.gov (United States)

2010-05-20

... 1.F, GSA Information Technology (IT) Security Policy, and CIO 2104.1, GSA Information Technology (IT...: Director, Office of Forensic Auditing, Office of Inspector General, 1800 F Street, NW., Room G-242...

Almost twenty years' search of transuranium isotopes in effluents discharged to air from nuclear power plants with VVER reactors.

Science.gov (United States)

Hölgye, Z; Filgas, R

2006-04-01

Airborne effluents of 5 stacks (stacks 1-5) of three nuclear power plants, with 9 pressurized water reactors VVER of 4,520 MWe total power, were searched for transuranium isotopes in different time periods. The search started in 1985. The subject of this work is a presentation of discharge data for the period of 1998-2003 and a final evaluation. It was found that 238Pu, 239,240Pu, 241Am, 242Cm, and 244Cm can be present in airborne effluents. Transuranium isotope contents in most of the quarterly effluent samples from stacks 2, 4 and 5 were not measurable. Transuranium isotopes were present in the effluents from stack l during all 9 years of the study and from stack 3 since the 3rd quarter of 1996 as a result of a defect in the fuel cladding. A relatively high increase of transuranium isotopes in effluents from stack 3 occurred in the 3rd quarter of 1999, and a smaller increase occurred in the 3rd quarter of 2003. In each instance 242Cm prevailed in the transuranium isotope mixtures. 238Pu/239,240Pu, 241Am/239,240Pu, 242Cm/239,240Pu, and 244Cm/239,240Pu ratios in fuel for different burn-up were calculated, and comparison of these ratios in fuel and effluents was performed.

Operational test procedure for pumping and instrumentation control skid SALW-6001B monitor and control system

International Nuclear Information System (INIS)

Garcia, M.F.

1995-11-01

This OTP shall verify and document that the monitor and control system comprised of PICS SALW-6001B PLC, 242S PLC, Operator Control Station, and communication network is functioning per operational requirements

Ale nám Písmo ukazuje tajemství. Biblické aluze v cyklu Truchlivý Jana Amose Komenského

Czech Academy of Sciences Publication Activity Database

Havelka, Tomáš

2013-01-01

Roč. 5, č. 2 (2013), s. 225-242 ISSN 1804-1132 Institutional support: RVO:67985955 Keywords : Bible * Johan Amos Comenius * quotations * Czech consolatory writings * Truchlivý * Mournful Subject RIV: AA - Philosophy ; Religion

A numerical study of two different specimen fixtures for the modified compact tension test – their influence on concrete fracture parameters

Czech Academy of Sciences Publication Activity Database

Holušová, Táňa; Seitl, Stanislav; Cifuentes, H.; Canteli, A.

2016-01-01

Roč. 10, č. 35 (2016), s. 242-249 ISSN 1971-8993 Institutional support: RVO:68081723 Keywords : Modified Compact Tension Test * Fracture Parameters * Cementitious Composites * FEM Subject RIV: JL - Materials Fatigue, Friction Mechanics

Circulating CD8+CD28- suppressor T cells tied to poorer prognosis among metastatic breast cancer patients receiving adoptive T-cell therapy: A cohort study.

Science.gov (United States)

Song, Qingkun; Ren, Jun; Zhou, Xinna; Wang, Xiaoli; Song, Guohong; Hobeika, Amy; Yuan, Yanhua; Lyerly, Herbert Kim

2018-01-01

This study aimed to determine the prognostic value of circulating CD8 + CD28 - T lymphocytes among breast cancer patients treated with adoptive T-lymphocyte immunotherapy after chemotherapy. Two hundred and thirty-two breast cancer patients underwent adoptive T-cell immunotherapy. Circulating CD8 + CD28 - proportion was measured by flow cytometry. Median proportion of CD8 + CD28 - was 24.2% and set as the categorical cutoff value for further analysis. The median survival was estimated by Kaplan-Meier curve, with difference detection and hazard ratio estimation by log-rank test and Cox hazard proportion regression model. With adoptive T-cell therapy, patients with higher CD8 + CD28 - levels experienced median progression-free and overall survival of 7.1 months and 26.9 months, respectively-significantly shorter than patients with lower levels (11.8 and 36.2 months). CD8 + CD28 - proportion >24.2% demonstrated a hazard ratio (HR) of 2.06 (95% confidence interval [CI] 1.31-3.12) for progression and an HR of 1.97 (95% CI 1.06-3.67) for death. Among patients who had received previous first-line chemotherapy, CD8 + CD28 - proportion >24.2% demonstrated an HR of 2.66 (95% CI 1.45-4.88) for progression. Among patients exposed to previous second-line or higher chemotherapy, CD8 + CD28 - proportion >24.2% demonstrated a 486% higher risk for death (HR = 5.86, 95% CI 1.77-19.39). A 1% increase in suppressive T cells was associated with a 5% increased risk of death. Elevated peripheral blood CD8 + CD28 - was associated with poorer prognosis for metastatic breast cancer, especially for higher risk of progression among patients with first-line chemotherapy and higher risk of death among patients with more than second-line chemotherapy. Copyright © 2017 International Society for Cellular Therapy. Published by Elsevier Inc. All rights reserved.

Genetic inferences in common bean differential cultivars to Colletotrichum lindemuthianum race 69/ Inferências genéticas em cultivares diferenciadoras de feijoeiro comum ao Colletotrichum lindemuthianum raça 69

Directory of Open Access Journals (Sweden)

Adilson R. Schuelter

2006-06-01

Full Text Available Anthracnose caused by the Colletotrichum lindemuthianum Sacc. et Magn fungus, is one of the most important diseases and can result in heavy yield losses to the common bean (Phaseolus vulgaris L.. Genetic inferences about resistance of cultivars: Michelite, Michigan Dark Red Kidney, Perry Marrow, Cornell 49-242, PI 207262, AB 136, G 2333 and their 21 diallel hybrids were obtained in relation to the reaction to 69 race by using Hayman’s method. The results showed that dominance effects were higher than additive effects to resistance of the related race. The order of parents in relation to dominant genes concentration obtained was: G 2333, AB 136, PI 207262, Cornell 49-242, Michigan Dark Red Kidney, Perry Marrow and Michelite. G 2333, AB 136 and PI 707262 parents are the most indicated for breeding programs to obtain anthracnose resistant cultivars.A antracnose, causada pelo fungo Colletotrichum lindemuthianum Sacc cet Magn, é uma das mais importantes doenças e pode causar severas perdas ao cultivo do feijão comum (Phaseolus vulgaris L.. Inferências genéticas sobre a resistência de sete cultivares diferenciais de feijão comum (Michelite, Michigan Dark Red Kidney, Perry Marrow, Cornell 49-242, PI 207262, AB 136, G 2333 e seus 21 híbridos dialélicos foram obtidas em relação à raça 69, por meio da metodologia de Hayman. Os resultados mostraram que os efeitos dominantes foram superiores aos aditivos para resistência à referida raça. A ordem dos parentais em relação à concentração de genes dominantes obtida foi: G 2333, AB 136, PI 207262, Cornell 49-242, Michigan Dark Red Kidney, Perry Marrow e Michelite. Os parentais G 2333, AB 136 e PI 707262 são os mais indicados para programas de melhoramento visando à obtenção de cultivares resistentes à antracnose.

Incidence vrozených srdečních vad v České republice - aktuální data

Czech Academy of Sciences Publication Activity Database

Šípek, A.; Gregor, V.; Šípek jr., A.; Hudáková, J.; Horáček, J.; Klaschka, Jan; Skibová, J.; Langhammer, P.; Petržílková, L.; Klímová, B.; Peřinová, B.; Wiesnerová, J.

2010-01-01

Roč. 75, č. 3 (2010), s. 221-242 ISSN 1210-7832 Institutional research plan: CEZ:AV0Z10300504 Keywords : congenital heart defect * incidence * prenatal diagnostics * Czech Republic Subject RIV: FK - Gynaecology, Childbirth

Developmental silencing of the AtTERT gene is associated with increased H3K27me3 loading and maintenance of its euchromatic environment

Czech Academy of Sciences Publication Activity Database

Ogrocká, A.; Sýkorová, Eva; Fajkus, Jiří; Fojtová, M.

2012-01-01

Roč. 63, č. 11 (2012), s. 4233-4241 ISSN 0022-0957 Institutional support: RVO:68081707 Keywords : TELOMERASE REVERSE-TRANSCRIPTASE * ARABIDOPSIS-THALIANA * DNA METHYLATION Subject RIV: BO - Biophysics Impact factor: 5.242, year: 2012

Markovian equilibria in dynamic spatial legislative bargaining: existence with three players

Czech Academy of Sciences Publication Activity Database

Zápal, Jan

2016-01-01

Roč. 98, July (2016), s. 235-242 ISSN 0899-8256 Institutional support: RVO:67985998 Keywords : dynamic decision-making * endogenous status-quo * spatial bargaining Subject RIV: AH - Economics Impact factor: 0.904, year: 2016

the pattern of cardiac diseases at the cardiac clinic of jimma

African Journals Online (AJOL)

user

24.2%) and ... 1 Department of Internal Medicine, Jimma University, P.O. Box : 1274, E-mail: ... The data quality control measures undertaken ... enrolled cardiac patients' record information was ..... Fong W. Infections and cardiovascular system:.

Wild chimpanzees are infected by Trypanosoma brucei

Czech Academy of Sciences Publication Activity Database

Jirků, M.; Votýpka, J.; Petrželková, Klára Judita; Jirků-Pomajbíková, K.; Kriegová, E.; Vodička, R.; Lankester, F.; Leendertz, S. A. J.; Wittig, R. M.; Boesch, C.; Modrý, D.; Ayala, F. J.; Leendertz, F. H.; Lukeš, J.

2015-01-01

Roč. 4, č. 3 (2015), s. 277-282 ISSN 0020-7519 Institutional support: RVO:68081766 Keywords : Trypanosomes * Chimpanzee * Non-human primates * Transmission * Diagnostics Subject RIV: EG - Zoology Impact factor: 4.242, year: 2015

Calculation of Plutonium content in RSG-GAS spent fuel using IAFUEL computer code

International Nuclear Information System (INIS)

Mochamad-Imron

2003-01-01

It has been calculated the contain of isotopes Pu-239, Pu-240, Pu-241, and isotope Pu-242 in MTR reactor fuel types which have U-235 contain about 250 gram. The calculation was performed in three steps. The first step is to determine the library of calculation output of BOC (Beginning of Cycle). The second step is to determine the core isotope density, the weight of plutonium for one core, and one fuel isotope density. The third step is to calculate weight of plutonium in gram. All calculation is performed by IAFUEL computer code. The calculation was produced content of each Pu isotopes were Pu-239 is 6.7666 gr, Pu-240 is 1.4628 gr, Pu-241 is 0.52951 gr, and Pu-242 is 0.068952 gr

Radiochemical methodologies applied to analytical characterization of low and intermediate level wastes from nuclear power plants

Energy Technology Data Exchange (ETDEWEB)

Monteiro, Roberto Pellacani G.; Júnior, Aluísio Souza R.; Kastner, Geraldo F.; Temba, Eliane S.C.; Oliveira, Thiago C. de; Amaral, Ângela M.; Franco, Milton B., E-mail: rpgm@cdtn.br, E-mail: reisas@cdtn.br, E-mail: gfk@cdtn.br, E-mail: esct@cdtn.br, E-mail: tco@cdtn.br, E-mail: ama@cdtn.br, E-mail: francom@cdtn.br [Centro de Desenvolvimento da Tecnologia Nuclear (CDTN/CNEN-MG), Belo Horizonte, MG (Brazil)

2017-07-01

The aim of this work is to present radiochemical methodologies developed at CDTN/CNEN in order to answer a program for isotopic inventory of radioactive wastes from Brazilian Nuclear Power Plants. In this program some radionuclides, {sup 3}H, {sup 14}C, {sup 55}Fe, {sup 59}Ni, {sup 63}Ni, {sup 90}Sr, {sup 93}Zr, {sup 94}Nb, {sup 99}Tc, {sup 129}I, {sup 235}U, {sup 238}U, {sup 238}Pu, {sup 239}+{sup 240}Pu, {sup 241}Pu, {sup 242}Pu, {sup 241}Am, {sup 242}Cm e {sup 243}+{sup 244}Cm, were determined in Low Level Wastes (LLW) and Intermediate Level Wastes (ILW) and a protocol of analytical methodologies based on radiochemical separation steps and spectrometric and nuclear techniques was established. (author)

A 244Pu spike reference material CBNM IRM-042A

International Nuclear Information System (INIS)

Verbruggen, A.; Gallet, M.; Hendrickx, F.; Bievre, P. de

1991-01-01

An highly enriched 244 Pu isotopic reference material (CBNM IRM-042a) has been prepared and certified for 244 Pu isotope concentration. The certified value of (2.257 7 ± 0.004 4).10 18 atoms 242 Pu.kg -1 of solution has been established by isotope dilution mass spectrometry. The plutonium isotopic composition has been determined by thermal ionization mass spectrometry and calibration of these measurements by means of synthetic 242 Pu/ 239 Pu mixtures. The isotopic reference material is supplied in a sealed glass ampoule containing approximately 10 g of a 5M nitric acid solution at an approximate concentration of 1 μg Pu per g solution. This isotopic reference material is part of a systematic CBNM programme to supply spike isotopic reference materials of various isotopes at different concentrations

Unsafe Coulomb excitation of $^{240-244}Pu$

CERN Document Server

Wiedenhöver, I; Hackman, L; Ahmad, I; Greene, J P; Amro, H; Carpenter, M P; Nisius, D T; Reiter, P; Lauritsen, T; Lister, C J; Khoo, T L; Siem, S; Cizewski, J A; Seweryniak, D; Uusitalo, J; Macchiavelli, A O; Chowdhury, P; Seabury, E H; Cline, D; Wu, C Y

1999-01-01

The high spin states of /sup 240/Pu and /sup 244/Pu have been investigated with GAMMASPHERE at ATLAS, using Coulomb excitation with a /sup 208/Pb beam at energies above the Coulomb barrier. Data on a transfer channel leading to /sup 242/Pu were obtained as well. In the case of /sup 244/Pu, the yrast band was extended to 34h(cross), revealing the completed pi i/sub 13/2/ alignment, a "first" for actinide nuclei. The yrast sequence of /sup 242/Pu was also extended to higher spin and a similar backbend was delineated. In contrast, while the ground state band of /sup 240/Pu was measured up to the highest rotational frequencies ever reported in the actinide region (~300 keV), no sign of particle alignment was observed. (11 refs).

Prevalence of iodine- and thyroglobulin-negative findings in differentiated thyroid cancer. A retrospective analysis of patients treated from 1961 to 1998 in a university hospital; Haeufigkeit lod- und hTG-negativer Befunde beim differenzierten Schilddruesenkarzinom. Eine retrospektive Analyse der von 1961 bis 1998 in einer Universitaetsklinik behandelten Patienten

Energy Technology Data Exchange (ETDEWEB)

Klutmann, S.; Jenicke, L.; Geiss-Toenshoff, M.; Bohuslavizki, K.H.; Mester, J.; Clausen, M. [Universitaetskrankenhaus Eppendorf, Hamburg (Germany). Abt. fuer Nuklearmedizin

2001-10-01

Aim: The prevalence of iodine- and thyroglobulin-negative findings was evaluated in all patients with differentiated thyroid cancer (DTC) treated from 1961 until 1998 at the Department of Nuclear Medicine, University Hospital Hamburg-Eppendorf. Methods: A total of 490 patients with papillary thyroid cancer (PCA) and 242 patients with follicular thyroid cancer (FCA) were analyzed retrospectively. Patients were divided into four groups: 1: no recurrence, 2: recurrent disease, 3: primary metastatic/progressive disease and 4: inconclusive follow-up. Results of iodine scan, serum-TG, and additional imaging modalities as well as histology were compared in all patients. Results: 21/490 (4,3%) of patients with PCA and 16/242 (6,6%) with FCA suffered from recurrent disease. 62/490 (12,7%) of patients with PCA and 59/242 (24,4%) with FCA had primary metastatic/progressive disease. 12/21 patients with PCA and 12/16 with FCA showing up with recurrent disease had a negative iodinescan. 11/21 of patients with PCA and 4/16 with FCA and tumor recurrence had negative serum-TG levels. 14/62 patients with PCA and 14/59 with FCA presenting with primary metastatic/progressive disease had negative iodinescan. 14/62 patients with PCA and 6/59 with FCA had negative serum-TG. Conclusion: The prevalence of iodine-negative recurrent/metastatic disease is in accordance to the literature, whereas the prevalence of TG-negative recurrent/metastatic was noted higher than reported previously. Thus, the commonly used follow-up scheme of DTC is confirmed. However, iodine scan should be regularly performed in patients with high risk of recurrence. (orig.) [German] Ziel: Retrospektiv wurden alle von 1961 bis 1998 in der Abteilung fuer Nukleamedizin des Universitaetsklinikums Hamburg-Eppendorf behandelten Patienten mit einem differenzierten Schilddruesenkarzinom bezueglich des Anteils lod- und/oder hTG-negativer Rezidive analysiert. Methoden: Es wurden 490 Patienten mit einem papillaeren

Evidence for an Intermediate in the Methylation of CB11H12- with Methyl Triflate: Comparison of Electrophilic Substitution in Cage Boranes and in Arenes

Czech Academy of Sciences Publication Activity Database

Kaleta, Jiří; Akdag, Akin; Crespo, R.; Piqueras, M. C.; Michl, Josef

2013-01-01

Roč. 78, č. 9 (2013), s. 1174-1183 ISSN 2192-6506 Institutional support: RVO:61388963 Keywords : alkylation * boranes * carboranes * electrophilic substitution * hydrogen scrambling Subject RIV: CC - Organic Chemistry Impact factor: 3.242, year: 2013

Markovian equilibria in dynamic spatial legislative bargaining: existence with three players

Czech Academy of Sciences Publication Activity Database

Zápal, Jan

2016-01-01

Roč. 98, July (2016), s. 235-242 ISSN 0899-8256 Institutional support: PRVOUK-P23 Keywords : dynamic decision-making * endogenous status-quo * spatial bargaining Subject RIV: AH - Economics Impact factor: 0.904, year: 2016

Primary school mathematics teachers' ideas, beliefs, and practices ...

African Journals Online (AJOL)

kofi.mereku

African Journal of Educational Studies in Mathematics and Sciences Vol. 12, 2016. 45 ... The study explored Ghanaian primary school mathematics teachers' ideas, beliefs and ...... Journal of science and technology, 24(2), 106 -115. Palmer ...

Testing of models of stomatal ozone fluxes with field measurements in a mixed Mediterranean forest

Czech Academy of Sciences Publication Activity Database

Fares, S.; Matteucci, G.; Mugnozza, S.; Morani, A.; Calfapietra, Carlo; Salvatori, E.; Fusaro, L.; Manes, F.; Loreto, F.

2013-01-01

Roč. 67, MAR (2013), s. 242-251 ISSN 1352-2310 Institutional support: RVO:67179843 Keywords : Ozone fluxes * Stomatal conductance models * GPP * Mediterranean forest Subject RIV: EH - Ecology, Behaviour Impact factor: 3.062, year: 2013

Posthuman Metamorphosis: Narrative and Systems, New

Directory of Open Access Journals (Sweden)

Elke D'hoker

2009-10-01

Full Text Available Review of Bruce Clarke, Posthuman Metamorphosis: Narrative and Systems, New
York: Fordham University Press, 2008. 242 pages.
978-0-8232-2580-8 (hardback
978-0-8232-2581-5 (paperback

77 FR 58215 - Notice of Application for Special Permits

Science.gov (United States)

2012-09-19

... required labelling and placarding. (modes 1, 2, 4, 5) 15707-N Air Products and 49 CFR 173.240; To authorize the Chemicals, Inc., 173.242; 176.83. transportation in Allentown, PA. commerce of a gas purification...

Gravity Data for the State of New Mexico

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — The gravity station data (21,242 records) were compiled by the University of Texas at El Paso. This data base was received in October 1984. Principal gravity...

Download this PDF file

African Journals Online (AJOL)

FOBUR

WITH A METASTATIC MASS IN THE RIGHT ATRIUM - A CASE REPORT AND REVIEW OF. LITERATURE ... and swelling which was associated with anorexia and early satiety. On examination, she was pale, .... study of 242 cases. Interactive ...

Ecological turmoil in evolutionary dynamics of plant-insect interactions: defense to offence

Czech Academy of Sciences Publication Activity Database

Mishra, Manasi; Lomate, P. R.; Joshi, R. S.; Punekar, S. A.; Gupta, V. S.; Giri, A. P.

2015-01-01

Roč. 242, č. 4 (2015), s. 761-771 ISSN 0032-0935 Institutional support: RVO:61388963 Keywords : plant-insect interaction * co-evolution * human interference * ecosystem * climatic change Subject RIV: CE - Biochemistry Impact factor: 3.239, year: 2015

Využití akustické emise při vrypové zkoušce

Czech Academy of Sciences Publication Activity Database

Tomáštík, J.; Čtvrtlík, Radim; Dráb, M.; Boháč, P.; Koula, V.; Cvrk, K.; Hrabovský, M.; Jastrabík, L.; Veselský, M.

2016-01-01

Roč. 61, č. 10 (2016), s. 242-245 ISSN 0447-6441 R&D Projects: GA TA ČR TA03010743 Institutional support: RVO:68378271 Keywords : acoustic emission analysis * scratch test * thin films Subject RIV: BI - Acoustics

Depth-of-anaesthesia monitoring

African Journals Online (AJOL)

Correspondence to: John Sneyd, e-mail: robert.sneyd@pms.ac.uk. Abstract. All anaesthetists .... 2000;55(3):242-246. 5. Thornton C, Barrowcliffe MP, Konieczko KM, et al. ... Sandin RH, Enlund G, Samuelsson P, Lennmarken C. Awareness.

Optics for nano-satellite X-ray monitor

Czech Academy of Sciences Publication Activity Database

Tichý, V.; Burrows, D.N.; Prieskorn, Z.; Hudec, René

Roč. 24, č. 2 ( 2015 ), s. 242-250 ISSN 1392-0049 Institutional support: RVO:67985815 Keywords : X-ray optics * Schmidt lobster eye telescopes Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 0.346, year: 2015

ORF Alignment: NC_004311 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004311 gi|23500710 >1v7zA 10 254 1 242 2e-43 ... gb|AAN34155.1| creatinine amidohy...drolase, putative [Brucella suis 1330] ... ref|NP_700150.1| creatinine amidohydrolase, putative ...

Jak a proč sociologizovat pohled na jazykovou kulturu

Czech Academy of Sciences Publication Activity Database

Beneš, Martin

2016-01-01

Roč. 99, č. 3 (2016), s. 227-242 ISSN 0027-8203 Institutional support: RVO:68378092 Keywords : language cultivation * ontological socialism * intersubjectivity * common knowledge * language correctness * linguistic rule * usage * norm * codification * language change Subject RIV: AI - Linguistics

Consumption of Added Sugar among U.S. Children and Adolescents, 2005-2008

Science.gov (United States)

... foods such as breads, cakes, soft drinks, jams, chocolates, ice cream, and sugars eaten separately or added ... 242–9. 2010. Energy. In: Food, nutrition & diet therapy. 7th ed. Krause MV, Mahan LK (editors). 9– ...

Review and Assessment of Neutron Cross Section and Nubar Covariances for Advanced Reactor Systems

Energy Technology Data Exchange (ETDEWEB)

Maslov,V.M.; Oblozinsky, P.; Herman, M.

2008-12-01

In January 2007, the National Nuclear Data Center (NNDC) produced a set of preliminary neutron covariance data for the international project 'Nuclear Data Needs for Advanced Reactor Systems'. The project was sponsored by the OECD Nuclear Energy Agency (NEA), Paris, under the Subgroup 26 of the International Working Party on Evaluation Cooperation (WPEC). These preliminary covariances are described in two recent BNL reports. The NNDC used a simplified version of the method developed by BNL and LANL that combines the recent Atlas of Neutron Resonances, the nuclear reaction model code EMPIRE and the Bayesian code KALMAN with the experimental data used as guidance. There are numerous issues involved in these estimates of covariances and it was decided to perform an independent review and assessment of these results so that better covariances can be produced for the revised version in future. Reviewed and assessed are uncertainties for fission, capture, elastic scattering, inelastic scattering and (n,2n) cross sections as well as prompt nubars for 15 minor actinides ({sup 233,234,236}U, {sup 237}Np, {sup 238,240,241,242}Pu, {sup 241,242m,243}Am and {sup 242,243,244,245}Cm) and 4 major actinides ({sup 232}Th, {sup 235,238}U and {sup 239}Pu). We examined available evaluations, performed comparison with experimental data, taken into account uncertainties in model parameterization and made use state-of-the-art nuclear reaction theory to produce the uncertainty assessment.

Superior Effects of Antiretroviral Treatment among Men Who have Sex with Men Compared to Other HIV At-Risk Populations in a Large Cohort Study in Hunan, China

Directory of Open Access Journals (Sweden)

Shu Su

2016-03-01

Full Text Available This study assesses association between CD4 level at initiation of antiretroviral treatment (ART on subsequent treatment outcomes and mortality among people infected with HIV via various routes in Hunan province, China. Over a period of 10 years, a total of 7333 HIV-positive patients, including 553 (7.5% MSM, 5484 (74.8% heterosexuals, 1164 (15.9% injection drug users (IDU and 132 (1.8% former plasma donors (FPD, were recruited. MSM substantially demonstrated higher initial CD4 cell level (242, IQR 167–298 than other populations (Heterosexuals: 144 IQR 40–242, IDU: 134 IQR 38–224, FPD: 86 IQR 36–181. During subsequent long-term follow up, the median CD4 level in all participants increased significantly from 151 cells/mm3 (IQR 43–246 to 265 cells/mm3 (IQR 162–380, whereas CD4 level in MSM remained at a high level between 242 and 361 cells/mm3. Consistently, both cumulative immunological and virological failure rates (10.4% and 26.4% in 48 months, respectively were the lowest in MSM compared with other population groups. Survival analysis indicated that initial CD4 counts ≤200 cells/mm3 (AHR = 3.14; CI, 2.43–4.06 significantly contributed to HIV-related mortality during treatment. Timely diagnosis and treatment of HIV patients are vital for improving CD4 level and health outcomes.

Significance of serum and bile tumor markers in the diagnostic approach of patients with malignant pancreatobiliary disease.

Science.gov (United States)

Natsios, Athanasios; Vezakis, Antonios; Kaparos, Georgios; Fragulidis, Georgios; Karakostas, Nikolaos; Kouskouni, Evangelia; Logothetis, Emmanouil; Polydorou, Andreas

2015-01-01

Serum and bile tumor markers are under intense scrutiny for the diagnosis of malignant disease. The purpose of our study was to report the usefulness of serum and bile tumor markers for the discrimination between benign and malignant pancreatobiliary diseases. Between March 2010 and May 2013, 95 patients with obstructive jaundice or history of biliary obstruction, were included in the study. During ERCP, bile samples were obtained for measurement of tumor markers CEA, CA19- 9, CA125, CA72-4 and CA242. Serum samples were taken before ERCP for the same measurements. The patients were divided into two groups: patients with malignant disease and patients with benign disease. Serum tumor marker levels were significantly higher in patients with malignant disease. Serum CA242 and CA19-9 exhibited the highest diagnostic accuracy (76.8% and 73.7%, respectively). CA125 and CA72-4 levels in bile samples were significantly higher in patients with malignant disease. Bile CA125, CEA and CA72-4 achieved the best diagnostic accuracy (69, 65 and 65), respectively). The combined detection of CA19-9, CA242 in serum and CA125, CA72-4 in bile along with total bilirubin levels, showed the best diagnostic accuracy (81%). Serum and bile tumor markers, when studied alone, lack the diagnostic yield to discriminate benign from malignant pancreatobiliary diseases. In cases of diagnostic dilemmas the combination of serum and bile markers might be helpful.

Subcritical limits for special fissile actinides

International Nuclear Information System (INIS)

Clark, H.K.

1980-01-01

Critical masses and subcritical mass limits in oxide-water mixtures were calculated for actinide nuclides other than 233 U, 235 U, and 239 Pu that have an odd number of neutrons in the nucleus: S/sub n/ transport theory was used together with cross sections, drawn from the GLASS multigroup library, developed to provide accurate forecasts of actinide production at Savannah River. The subcritical limits are 201 g for 241 Pu, 13 g for 242 /sup m/Am, 90 g for 243 Cm, 30 g for 245 Cm, 900 g for 247 Cm, 10 g for 249 Cf, and 5 g for 251 Cf. Association of 241 Pu with an equal mass of 240 Pu increases the 241 Pu limit to a value greater than that for pure 239 Pu. Association of 242 /sup m/Am with 241 Am increases the limit for the mixture to that for dry, theoretical density AmO 2 at isotopic concentrations of 242 /sup m/Am less than approx. 6%. Association of 245 Cm with 244 Cm increases the limit according to the formula 30 + 0.3 244 Cm/ 245 Cm up to the limit for dry CmO 2 . A limiting mass of 8.15 kg for plutonium containing at least 67% 238 Pu as oxide was calculated that applies (provided 240 Pu exceeds 241 Pu) with no limit on moderation. 1 figure, 5 tables

Diagnostic value of tissue polypeptide specific antigen in serum for patients with pancreatic carcinoma

International Nuclear Information System (INIS)

Lu Yun; Liu Xingdang; Li Ding; Dei Shouzhen

2009-01-01

Objective: To compare the diagnostic value of tissue polypeptide specific antigen (TPS) in serum, with the carbohydrate antigens (CA) 19-9, CA50, CA125 and CA242 in pancreatic carcinoma. Methods: Serum TPS was measured with enzyme linked immunosorbent assay (ELISA). CA19-9 and CA125 were measured with chemiluminescent immunoassay. CAS0 and CA242 were measured with immunoradiometric assay in 33 patients with pancreatitis, 34 patients with pathologically proven pancreatic carcinoma, and 35 patients with non-pancreatic malignancies. Statistic analysis was carried out with SPSS 9.0 software. Results: Patients with pancreatic carcinoma had relatively higher levels of TPS [(386.5 ± 315. 1) U/L] and CA19-9 [(10 820.9 ± 389.7) kU/L] when compared with patients with pancreatitis [(86. 2 ± 28.1) U/L and (61.5 ± 24.7) kU/L, respectively; F = 936. 42, P < 0. 001 ; F = 2217. 09, P < 0. 001], with a sensitivity and a specificity of 70.6% (48/68) and 57.4% (39/68), respectively, for TPS, and 82.4% (28/34) and 77.9% (53/68), respectively, for CA19-9. Diagnostic performance was further improved when TPS was assayed in combination with CA19-9, CA50, CA125 and CA242. Conclusion: Serum TPS has an incremental value in complementing CA19-9 in the diagnosis of pancreatic carcinoma. (authors)

Crystal growth and applications of mercuric iodide. Report S-242-TP

International Nuclear Information System (INIS)

Schieber, M.; Roth, M.; Schnepple, W.F.

1983-01-01

A brief summary is given of a paper which discusses the crystal growth of mercuric iodide, a high-Z wide bandgap semiconductor suitable as a low noise, room temperature x-ray and gamma-ray detector. The paper summarized also reviews the state-of-the-art of the synthesis and purification of the starting material, mechanical properties and dislocation structure of HgI 2 , and recent success in the development of thick HgI 2 spectrometers

18 CFR 367.2420 - Account 242, Miscellaneous current and accrued liabilities.

Science.gov (United States)

2010-04-01

... HOLDING COMPANY ACT OF 2005, FEDERAL POWER ACT AND NATURAL GAS ACT UNIFORM SYSTEM OF ACCOUNTS FOR CENTRALIZED SERVICE COMPANIES SUBJECT TO THE PROVISIONS OF THE PUBLIC UTILITY HOLDING COMPANY ACT OF 2005... and supported so as to show the nature of each liability. ...

24 CFR 242.23 - Maximum mortgage amounts and cash equity requirements.

Science.gov (United States)

2010-04-01

... addition to the value of plant, property, and equipment and other values recognized as loan security in the commitment process. Exercise of this discretion shall never cause a loan to exceed 90 percent of estimated... COMMISSIONER, DEPARTMENT OF HOUSING AND URBAN DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL...

Atlas of atomic spectral lines of plutonium emitted by an inductively coupled plasma

Energy Technology Data Exchange (ETDEWEB)

Edelson, M.C.; DeKalb, E.L.; Winge, R.K.; Fassel, V.A.

1986-09-01

Optical emission spectra from high-purity Pu-242 were generated with a glovebox-enclosed inductively coupled plasma (ICP) source. Spectra covering the 2280 to 7008 Angstrom wavelength range are presented along with general commentary on ICP-Pu spectroscopy.

Integrated morphological and molecular identification of cat fleas (Ctenocephalides felis) and dog fleas (Ctenocephalides canis) vectoring Rickettsia felis in central Europe

Czech Academy of Sciences Publication Activity Database

Lawrence, A.L.; Hii, S.-F.; Jirsová, D.; Panáková, L.; Ionică, A.M.; Gilchrist, K.; Modrý, David; Mihalca, A. D.; Webb, C.E.; Traub, R.J.; Šlapeta, J.

2015-01-01

Roč. 210, 3-4 (2015), s. 215-223 ISSN 0304-4017 Institutional support: RVO:60077344 Keywords : Arthropod * Siphonaptera * Zoonosis * Bartonella * Taxonomy * cox1 Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.242, year: 2015

A Model of the Action of the Shockwave Generated by a Multichannel Discharge on the Union of Bone Tissue with Bone Cement

Czech Academy of Sciences Publication Activity Database

Zeman, J.; Hach, J.; Mikulaková, W.; Derňarová, Ľ.; Eliášová, A.; Lukeš, Petr; Balážová, L.; Beneš, J.

2016-01-01

Roč. 30, č. 3 (2016), s. 237-242 ISSN 0258-851X Institutional support: RVO:61389021 Keywords : Shockwave * bone cement extractions * surgical revision Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 0.953, year: 2016

Uplatnění PETL při řešení některých složitých kauz v oblasti příčinné souvislosti v medicínskoprávních sporech

Czech Academy of Sciences Publication Activity Database

Doležal, Adam; Doležal, Tomáš

2013-01-01

Roč. 19, 7-8 (2013), s. 242-248 ISSN 1211-4405 R&D Projects: GA ČR GAP408/12/2574 Institutional support: RVO:68378122 Keywords : medical law * causality * medico-legal disputes Subject RIV: AG - Legal Sciences

Some higher order Hardy inequalities

Czech Academy of Sciences Publication Activity Database

Kufner, Alois; Kuliev, K.; Persson, L. E.

2012-01-01

Roč. 2012, Mar 26 (2012), s. 69 ISSN 1029-242X Institutional support: RVO:67985840 Keywords : Hardy inequality Subject RIV: BA - General Mathematics Impact factor: 0.822, year: 2012 http://www.journalofinequalitiesandapplications.com/content/2012/1/69

Socialization Values and Parenting Practices as Predictors of Parental Involvement in Their Children's Educational Process

NARCIS (Netherlands)

Kikas, Eve; Tulviste, Tiia; Peets, Kätlin

2014-01-01

Research Findings: The purpose of this study was to examine associations between parental socialization values (including inconsistency in values), parenting practices, and parental involvement in their children's education. Altogether 242 Estonian mothers and fathers of first-grade children

Primary antibiotic resistance of Helicobacter pylori strains among adults and children in a tertiary referral centre in Lithuania

DEFF Research Database (Denmark)

Dargiene, Gintare; Kupcinskas, Juozas; Jonaitis, Laimas

2018-01-01

The study evaluated primary antibiotic resistance of Helicobacter pylori within the period 2013-2015 and trends of antibiotic consumption over the last decade in Lithuania; 242 adults and 55 children were included in the study. E-tests were performed for amoxicillin, metronidazole, clarithromycin......, ciprofloxacin, rifampicin and tetracycline. The presence of H. pylori and clarithromycin resistance was additionally tested by PCR. Helicobacter pylori culture was positive in 67 of 242 (28%) adult and in 12 of 55 (21.8%) children samples. Resistance rates among adults by E-tests were as follows: metronidazole......, while it has doubled from 1.10 to 2.22 DDD/1000/children/day in children within 2003-2015. There are no significant changes in the susceptibility of H. pylori to the most widely used antibiotics in adults over the last years in Lithuania; however, clarithromycin resistance among children exceeds 15...

The causes of genetic male sterility in 3 soybaen lines.

Science.gov (United States)

Rubaihayo, P R; Gumisiriza, G

1978-11-01

The cause of male sterility in 3 soybean lines, TGM 103-1, N-69-2774 and TGM 242-4 was studied. In TGM 103-1, which was both male and female sterile, two different abnormalities were associated with sterility. Precocious movement of a few chromosomes at the metaphase I stage resulted into the production of non-functional pollen while cells which underwent apparent normal meiotic division had disintergration of the tapetal cell wall immediately after the free microspore stage leading to the starvation and subsequent death of the developing microspores. In lines N-69-2774 and TGM 242-4, both of which were partially sterile, male sterility resulted from a failure of cytokinesis after the telophase II stage. Meiosis proceeded normally but the 4 microspores after telophase II failed to separate into pollen grains and degenerated thereafter.

Studies of neutron-deficient mendelevium isotopes at SHIP

Energy Technology Data Exchange (ETDEWEB)

Antalic, S.; Saro, S. [Comenius University, Department of Nuclear Physics and Biophysics, Bratislava (Slovakia); Hessberger, F.P.; Ackermann, D.; Heinz, S.; Kindler, B.; Kojouharov, I.; Lommel, B.; Mann, R. [GSI Helmholtzzentrum fuer Schwerionenforschung GmbH, Darmstadt (Germany); Hofmann, S. [GSI Helmholtzzentrum fuer Schwerionenforschung GmbH, Darmstadt (Germany); Goethe-Universitaet, Institut fuer Kernphysik, Frankfurt am Main (Germany); Kuusiniemi, P. [University of Oulu, Centre for Underground Physics in Pyhaesalmi (CUPP), Oulu (Finland); Leino, M. [University of Jyvaeskylae, Department of Physics, Jyvaeskylae (Finland)

2010-01-15

The radioactive decay of the isotopes {sup 247}Md, {sup 246}Md and their daughter products was investigated by means of {alpha}-{alpha} and {alpha}-{gamma} coincidence spectroscopy. The isotopes were produced using the fusion reaction {sup 40}Ar + {sup 209}Bi. Decay schemes are suggested for {sup 247}Md and {sup 243}Es. A new isomeric state in {sup 246}Md with a half-life of (4.4{+-}0.8) s was observed. Previous data of electron-capture delayed fission of {sup 246}Md and {sup 242}Es were confirmed. The probability for this decay branch in {sup 246}Md was measured to be P{sub ECDF}>0.10. The probability for electron-capture delayed fission in the case of {sup 242}Es was determined to be P{sub ECDF}=0.013{sup +0.012} {sub -0.007}. (orig.)

Small propulsion reactor design based on particle bed reactor concept

International Nuclear Information System (INIS)

Ludewig, H.; Lazareth, O.; Mughabghab, S.; Perkins, K.; Powell, J.R.

1989-01-01

In this paper Particle Bed Reactor (PBR) designs are discussed which use 233 U and /sup 242m/Am as fissile materials. A constant total power of 100MW is assumed for all reactors in this study. Three broad aspects of these reactors is discussed. First, possible reactor designs are developed, second physics calculations are outlined and discussed and third mass estimates of the various candidates reactors are made. It is concluded that reactors with a specific mass of 1 kg/MW can be envisioned of 233 U is used and approximately a quarter of this value can be achieved if /sup 242m/Am is used. If this power level is increased by increasing the power density lower specific mass values are achievable. The limit will be determined by uncertainties in the thermal-hydraulic analysis. 5 refs., 5 figs., 6 tabs

Experimental design and multiple response optimization. Using the desirability function in analytical methods development.

Science.gov (United States)

Candioti, Luciana Vera; De Zan, María M; Cámara, María S; Goicoechea, Héctor C

2014-06-01

A review about the application of response surface methodology (RSM) when several responses have to be simultaneously optimized in the field of analytical methods development is presented. Several critical issues like response transformation, multiple response optimization and modeling with least squares and artificial neural networks are discussed. Most recent analytical applications are presented in the context of analytLaboratorio de Control de Calidad de Medicamentos (LCCM), Facultad de Bioquímica y Ciencias Biológicas, Universidad Nacional del Litoral, C.C. 242, S3000ZAA Santa Fe, ArgentinaLaboratorio de Control de Calidad de Medicamentos (LCCM), Facultad de Bioquímica y Ciencias Biológicas, Universidad Nacional del Litoral, C.C. 242, S3000ZAA Santa Fe, Argentinaical methods development, especially in multiple response optimization procedures using the desirability function. Copyright © 2014 Elsevier B.V. All rights reserved.

Endothelial function is unaffected by changing between carvedilol and metoprolol in patients with heart failure--a randomized study

DEFF Research Database (Denmark)

Falskov, Britt; Hermann, Thomas Steffen; Raunsø, Jakob

2011-01-01

endothelial function, 24 hour ambulatory blood pressure and heart rate during treatment with carvedilol, metoprolol tartrate and metoprolol succinate in patients with HF. METHODS: Twenty-seven patients with mild HF, all initially treated with carvedilol, were randomized to a two-month treatment...... with carvedilol, metoprolol tartrate or metoprolol succinate. Venous occlusion plethysmography, 24-hour blood pressure and heart rate measurements were done before and after a two-month treatment period. RESULTS: Endothelium-dependent vasodilatation was not affected by changing from carvedilol to either...... metoprolol tartrate or metoprolol succinate. The relative forearm blood flow at the highest dose of serotonin was 2.42 ± 0.33 in the carvedilol group at baseline and 2.14 ± 0.24 after two months continuation of carvedilol (P = 0.34); 2.57 ± 0.33 before metoprolol tartrate treatment and 2.42 ± 0.55 after...

Neutron radiative capture by the 241Am nucleus in the energy range 1 keV-20 MeV

International Nuclear Information System (INIS)

Zolotarev, K.I.; Ignatyuk, A.V.; Tolstikov, V.A.; Tertychnyj, G.Ya.

1998-01-01

Production of high actinides leads to many technological problems in the nuclear power. The 241 Am(n,γ) 242 Am reaction is one of the sources of high actinide buildup. So a knowledge of the radiative capture cross-section of 241 Am for neutron energies up to 20 MeV is of considerable important for present day fission reactors and future advanced reactors. The main goal of this paper is the evaluation of the excitation function for the reaction 241 Am(n,γ) 242 Am in the energy range 1 keV-20 MeV. The evaluation was done on the basis of analysed experimental data, data from theoretical model calculations and systematic predictions for 14.5 MeV and 20 MeV. Data from the present evaluation are compared with the cross-section values given in the evaluations carried out earlier. (author)

Magnox fuel inventories. Experiment and calculation using a point source model

International Nuclear Information System (INIS)

Nair, S.

1978-08-01

The results of calculations of Magnox fuel inventories using the point source code RICE and associated Magnox reactor data set have been compared with experimental measurements for the actinide isotopes 234 , 235 , 236 , 238 U, 238 , 239 , 240 , 241 , 242 Pu, 241 , 243 Am and 242 , 244 Cm and the fission product isotopes 142 , 143 , 144 , 145 , 146 , 150 Nd, 95 Zr, 134 , 137 Cs, 144 Ce and daughter 144 Pr produced in four samples of spent Magnox fuel spanning the burnup range 3000 to 9000 MWd/Te. The neutron emissions from a further two samples were also measured and compared with RICE predictions. The results of the comparison were such as to justify the use of the code RICE for providing source terms for environmental impact studies, for the isotopes considered in the present work. (author)

Evaluation of refractive correction for standard automated perimetry in eyes wearing multifocal contact lenses.

Science.gov (United States)

Hirasawa, Kazunori; Ito, Hikaru; Ohori, Yukari; Takano, Yui; Shoji, Nobuyuki

2017-01-01

To evaluate the refractive correction for standard automated perimetry (SAP) in eyes with refractive multifocal contact lenses (CL) in healthy young participants. Twenty-nine eyes of 29 participants were included. Accommodation was paralyzed in all participants with 1% cyclopentolate hydrochloride. SAP was performed using the Humphrey SITA-standard 24-2 and 10-2 protocol under three refractive conditions: monofocal CL corrected for near distance (baseline); multifocal CL corrected for distance (mCL-D); and mCL-D corrected for near vision using a spectacle lens (mCL-N). Primary outcome measures were the foveal threshold, mean deviation (MD), and pattern standard deviation (PSD). The foveal threshold of mCL-N with both the 24-2 and 10-2 protocols significantly decreased by 2.2-2.5 dB ( P correction without additional near correction is to be recommended.

Actinide production in the reaction of heavy ions with curium-248

International Nuclear Information System (INIS)

Moody, K.J.

1983-07-01

Chemical experiments were performed to examine the usefulness of heavy ion transfer reactions in producing new, neutron-rich actinide nuclides. A general quasi-elastic to deep-inelastic mechanism is proposed, and the utility of this method as opposed to other methods (e.g. complete fusion) is discussed. The relative merits of various techniques of actinide target synthesis are discussed. A description is given of a target system designed to remove the large amounts of heat generated by the passage of a heavy ion beam through matter, thereby maximizing the beam intensity which can be safely used in an experiment. Also described is a general separation scheme for the actinide elements from protactinium (Z=91) to mendelevium (Z=101), and fast specific procedures for plutonium, americium and berkelium. The cross sections for the production of several nuclides from the bombardment of 248 Cm with 18 O, 86 Kr and 136 Xe projectiles at several energies near and below the Coulomb barrier were determined. The results are compared with yields from 48 Ca and 238 U bombardments of 248 Cm. Simple extrapolation of the product yields into unknown regions of charge and mass indicates that the use of heavy ion transfer reactions to produce new, neutron-rich above-target species is limited. The substantial production of neutron-rich below-target species, however, indicates that with very heavy ions like 136 Xe and 238 U the new species 248 Am, 249 Am and 247 Pu should be produced with large cross sections from a 248 Cm target. A preliminary, unsuccessful attempt to isolate 247 Pu is outlined. The failure is probably due to the half life of the decay, which is calculated to be less than 3 minutes. The absolute gamma ray intensities from 251 Bk decay, necessary for calculating the 251 Bk cross section, are also determined

Minor Actinides Recycling in PWRs

International Nuclear Information System (INIS)

Delpech, M.; Golfier, H.; Vasile, A.; Varaine, F.; Boucher, L.; Greneche, D.

2006-01-01

Recycling of minor actinides in current and near future PWR is considered as one of the options of the general waste management strategy. This paper presents the analysis of this option both from the core physics and fuel cycle point of view. A first indicator of the efficiency of different neutron spectra for transmutation purposes is the capture to fission cross sections ratio which is less favourable by a factor between 5 to 10 in PWRs compared to fast reactors. Another indicator presented is the production of high ranking isotopes like Curium, Berkelium or Californium in the thermal or epithermal spectrum conditions of PWR cores by successive neutron captures. The impact of the accumulation of this elements on the fabrication process of such PWR fuels strongly penalizes this option. The main constraint on minor actinides loadings in PWR (or fast reactors) fuels are related to their direct impact (or the impact of their transmutation products) on the reactivity coefficients, the reactivity control means and the core kinetics parameters. The main fuel cycle physical parameters like the neutron source, the alpha decay power, the gamma and neutrons dose rate and the criticality aspects are also affected. Recent neutronic calculations based on a reference core of the Evolutionary Pressurized Reactor (EPR), indicates typical maximum values of 1 % loadings. Different fuel design options for minor actinides transmutation purposes in PWRs are presented: UOX and MOX, homogeneous and heterogeneous assemblies. In this later case, Americium loading is concentrated in specific pins of a standard UOX assembly. Recycling of Neptunium in UOX and MOX fuels was also studied to improve the proliferation resistance of the fuel. The impact on the core physics and penalties on Uranium enrichment were underlined in this case. (authors)

ORF Alignment: NC_003232 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003232 gi|19173617 >1ltlE 7 224 22 242 3e-38 ... ref|NP_597420.1| DNA REPLICATION ...LICENSING FACTOR OF THE MCM FAMILY (MCM6) ... [Encephalitozoon cuniculi] emb|CAD26597.1| DNA ... REPLICATION

Dynamics of a vertical-flow windrow vermicomposting system

Czech Academy of Sciences Publication Activity Database

Hanč, A.; Částková, T.; Kužel, S.; Cajthaml, Tomáš

2017-01-01

Roč. 35, č. 11 (2017), s. 1121-1128 ISSN 0734-242X Institutional support: RVO:61388971 Keywords : Large-scale windrow vermicomposting * continuous feeding * biowaste Subject RIV: EE - Microbiology, Virology OBOR OECD: Microbiology Impact factor: 1.803, year: 2016

Effects of the polymerization temperature on the structure, morphology and conductivity of polyaniline prepared with ammonium peroxodisulfate

Czech Academy of Sciences Publication Activity Database

Bláha, Michal; Varga, M.; Prokeš, J.; Zhigunov, Alexander; Vohlídal, J.

2013-01-01

Roč. 49, č. 12 (2013), s. 3904-3911 ISSN 0014-3057 R&D Projects: GA TA ČR TE01020022 Institutional support: RVO:61389013 Keywords : polyaniline * conductivity * morphology Subject RIV: CG - Electrochemistry Impact factor: 3.242, year: 2013

Self-reported early trauma as a predictor of adult personality : A study in a military sample

NARCIS (Netherlands)

Rademaker, Arthur R.; Vermetten, Eric; Geuze, Elbert; Muilwilk, Anne; Kleber, Rolf J.

Exposure to early trauma has frequently been linked to adult psychopathology, including personality disorders. This cross-sectional study explored the relationship between personality and retrospectively rated levels of early trauma in 242 soldiers. Multiple regression analyses showed a significant

INDL/A - Suppl. 86/5. IAEA Nuclear Data Library for evaluated neutron reaction data of Actinides

International Nuclear Information System (INIS)

Goulo, V.G.; Lemmel, H.D.; McLaughlin, P.M.

1986-01-01

This supplement to INDL/A contains five evaluations by V.A. Konshin on U-235 and Pu-239, 240, 241, 242. They are available upon request on magnetic tape, free of charge, from the IAEA Nuclear Data Section. (author)

Altitudinal and seasonal differences of tick communities in dogs from pastoralist tribes of Northern Kenya

Czech Academy of Sciences Publication Activity Database

D'Amico, G.; Dumitrache, M.O.; Široký, P.; Albrechtová, K.; Sloboda, M.; Domsa, C.; Sándor, A.D.; Balázsi, R.; Kanyari, P. W. N.; Modrý, David; Mihalca, A. D.

2015-01-01

Roč. 212, 3-4 (2015), s. 318-323 ISSN 0304-4017 Institutional support: RVO:60077344 Keywords : Altitudinal distribution * Rhipicephalus sanguineus * Rhipicephalus pulchellus * Rhipicephalus armatus Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.242, year: 2015

Non-apoptotic programmed cell death with paraptotic-like features in bleomycin-treated plant cells is suppressed by inhibition of ATM/ATR pathways or NtE2F overexpression

Czech Academy of Sciences Publication Activity Database

Smetana, O.; Široký, Jiří; Houlné, G.; Opatrný, Z.; Chabouté, M.-E.

2012-01-01

Roč. 63, č. 7 (2012), s. 2631-2644 ISSN 0022-0957 Institutional research plan: CEZ:AV0Z50040702 Keywords : ATM /ATR pathways * cell cycle * double-strand break response Subject RIV: BO - Biophysics Impact factor: 5.242, year: 2012

Exclusion of acute myocardial infarction. The value of measuring creatine kinase slope

NARCIS (Netherlands)

Bakker, A. J.; Koelemay, M. J.; van Vlies, B.; Gorgels, J. P.; Smits, R.; Tijssen, J. G.; Haagen, F. D.

1995-01-01

For the exclusion (and diagnosis) of acute myocardial infarction, we studied timed sequential (slope) measurements of creatine kinase and creatine kinase-MB catalytic activity concentration, creatine kinase-MB mass concentration, troponin T and myoglobin, using data from 242 patients consecutively

Harmonic focus in thyroidectomy for substernal goiter

DEFF Research Database (Denmark)

Hahn, Christoffer Holst; Trolle, Waldemar; Sørensen, Christian Hjort

2015-01-01

, hospital stay and complications. MATERIALS AND METHODS: Prospective non-randomised study of 242 consecutive patients with substernal goiter out of 2258 patients (11%) who underwent thyroidectomy. A total of 121 patients had thyroidectomy performed with bipolar electrocoagulation and knot-tying techniques...

Determinants of long acting and permanent contraceptive methods ...

African Journals Online (AJOL)

Introduction: In Ethiopia information on the level of utilization of the long term and ... determinant factors of long acting and permanent contraceptive methods use ... number of live children (AOR = 2.42, 95% CI: 1.46- 4.02), joint fertility related ...

Complementarity of integral and differential experiments for reactor physics purposes

International Nuclear Information System (INIS)

Tellier, Henry.

1981-04-01

In this paper, the following topics are studied: uranium 238 effective integral; thermal range uranium 238 capture cross section; Americium 242 m capture cross section. The mentioned examples show that differential and integral experiments are both useful to the reactor physicists

78 FR 44909 - Regional Reliability Standard BAL-002-WECC-2-Contingency Reserve

Science.gov (United States)

2013-07-25

...\\ Mandatory Reliability Standards for the Bulk-Power System, Order No. 693, FERC Stats. & Regs. ] 31,242...-002-WECC-2 (Contingency Reserve). The North American Electric Reliability Corporation (NERC) and... (Technical Information), Office of Electric Reliability, Division of Reliability Standards, Federal Energy...

76 FR 66055 - North American Electric Reliability Corporation; Order Approving Interpretation of Reliability...

Science.gov (United States)

2011-10-25

...\\ Mandatory Reliability Standards for the Bulk-Power System, Order No. 693, FERC Stats. & Regs. ] 31,242... materially affected'' by Bulk-Power System reliability may request an interpretation of a Reliability... Electric Reliability Corporation; Order Approving Interpretation of Reliability Standard; Before...

78 FR 76443 - Safety and Effectiveness of Consumer Antiseptics; Topical Antimicrobial Drug Products for Over...

Science.gov (United States)

2013-12-17

... bacteria from washed hands to a ready- to-eat food item, melon balls. The observed reduction in bacterial... ready- to-eat food was contaminated... Vol. 78 Tuesday, No. 242 December 17, 2013 Part III Department of Health and Human Services Food...

PERFORMANCE EVALUATION AND PARAMETERS SENSITIVITY ...

Indian Academy of Sciences (India)

86

wetland (242.21 km2), Malaysia using MIKE SHE distributed model while coupling ..... the ponding water which may lead to rise in the water table level. ..... catchment; and Ds = 2.09 mm represents the amount of depression storages over the ...

Acetylcholinesterase and Butyrylcholinesterase Inhibitory Compounds from Corydalis cava (Fumariaceae)

Czech Academy of Sciences Publication Activity Database

Chlebek, J.; Macáková, K.; Cahlíková, L.; Kurfürst, Milan; Kuneš, J.; Opletal, J.

2011-01-01

Roč. 6, č. 5 (2011), s. 607-610 ISSN 1934-578X Institutional research plan: CEZ:AV0Z40720504 Keywords : corydalis cava * fumariaceae * alzheimer ´s disease Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.242, year: 2011