WorldWideScience

Sample records for berkelium 242

  1. New berkelium isotope: 242Bk

    International Nuclear Information System (INIS)

    A new isotope of berkelium, 242Bk, was produced with a cross section of approx. 10 μb in reactions of boron on uranium and nitrogen on thorium. It decays by electron capture with a half-life of 7 +- 1.3 minutes. The branching ratio for this isotope for alpha decay is less than 1% and that for spontaneous fission is less than 0.03%. 2 figures, 2 tables

  2. Characterization of berkelium(III) dipicolinate and borate compounds in solution and the solid state.

    Science.gov (United States)

    Silver, Mark A; Cary, Samantha K; Johnson, Jason A; Baumbach, Ryan E; Arico, Alexandra A; Luckey, Morgan; Urban, Matthew; Wang, Jamie C; Polinski, Matthew J; Chemey, Alexander; Liu, Guokui; Chen, Kuan-Wen; Van Cleve, Shelley M; Marsh, Matthew L; Eaton, Teresa M; van de Burgt, Lambertus J; Gray, Ashley L; Hobart, David E; Hanson, Kenneth; Maron, Laurent; Gendron, Frédéric; Autschbach, Jochen; Speldrich, Manfred; Kögerler, Paul; Yang, Ping; Braley, Jenifer; Albrecht-Schmitt, Thomas E

    2016-08-26

    Berkelium is positioned at a crucial location in the actinide series between the inherently stable half-filled 5f(7) configuration of curium and the abrupt transition in chemical behavior created by the onset of a metastable divalent state that starts at californium. However, the mere 320-day half-life of berkelium's only available isotope, (249)Bk, has hindered in-depth studies of the element's coordination chemistry. Herein, we report the synthesis and detailed solid-state and solution-phase characterization of a berkelium coordination complex, Bk(III)tris(dipicolinate), as well as a chemically distinct Bk(III) borate material for comparison. We demonstrate that berkelium's complexation is analogous to that of californium. However, from a range of spectroscopic techniques and quantum mechanical calculations, it is clear that spin-orbit coupling contributes significantly to berkelium's multiconfigurational ground state. PMID:27563098

  3. Extraction of tetravalent berkelium and cerium by aliquate-336-S-NO3 quaternary ammonium salt

    International Nuclear Information System (INIS)

    Extraction of tetravalent berkelium and cerium by aliquate-336-S-NO3 quaternary ammonium salt from nitric acid solutions is investigated. The effect of concentrations of nitric acid and extracting agent, nature of an oxidant (potassium bromate, potassium bichromate, mixture of AgNO3 and (NH4)2S2O8) and solvent on the distribution coefficient of berkelium(4) and cerium(4) is studied. It is established that solutions of aliquate-336-S-NO3 in carbon tetrachloride and dichloroethane extract quantitatively tetravalent berkelium from 10-12 M nitric acid solutions and cerium - from 1-10 M nitric acid solutions containing potassium bichromate as an oxidant. It is shown that the value of distribution coefficient for berkelium and cerium depends on the nature of an oxidant and extracting agent concentration. It is established that in the case of extraction by quaternary ammonium salt with one berkelium(4) mole four aliquate-336-SNO3 moles are associated and 1.5-1.6 mole of extracting agent are associated with one cerium(4) mole. It permits to make a conclusion that stoichiometry of extraction reactions by quaternary ammonium salt is not the same for tetravalent berkelium and cerium. It is shown that trivalent transplutonium and rare earth elements are not practically extracted by aliquate-336-S-NO3 from nitric acid solutions

  4. 48 CFR 242.7201 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... Management and Accounting System 242.7201 Definitions. Material management and accounting system and valid time-phased requirements are defined in the clause at 252.242-7004, Material Management and...

  5. 48 CFR 53.242 - Contract administration.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Contract administration. 53.242 Section 53.242 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION (CONTINUED) CLAUSES AND FORMS FORMS Prescription of Forms 53.242 Contract administration....

  6. 7 CFR 58.242 - Product adulteration.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Product adulteration. 58.242 Section 58.242... Procedures § 58.242 Product adulteration. All necessary precautions shall be taken throughout the entire operation to prevent the adulteration of one product with another. The commingling of one type of liquid...

  7. 17 CFR 242.406 - Undermargined accounts.

    Science.gov (United States)

    2010-04-01

    ...) REGULATIONS M, SHO, ATS, AC, AND NMS AND CUSTOMER MARGIN REQUIREMENTS FOR SECURITY FUTURES Customer Margin Requirements for Security Futures § 242.406 Undermargined accounts. (a) Failure to satisfy margin call. If any... Regulation (§§ 242.400 through 242.406), section 220.4(d) of Regulation T (12 CFR 220.4(d))...

  8. 32 CFR 242.7 - Responsibilities.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Responsibilities. 242.7 Section 242.7 National Defense Department of Defense (Continued) OFFICE OF THE SECRETARY OF DEFENSE (CONTINUED) MISCELLANEOUS... SCIENCES § 242.7 Responsibilities. (a) The President of the University shall: (1) Develop and...

  9. 33 CFR 242.3 - References.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false References. 242.3 Section 242.3 Navigation and Navigable Waters CORPS OF ENGINEERS, DEPARTMENT OF THE ARMY, DEPARTMENT OF DEFENSE FLOOD PLAIN MANAGEMENT SERVICES PROGRAM ESTABLISHMENT OF FEES FOR COST RECOVERY § 242.3 References. The references...

  10. 242-A evaporator hazards assessment

    International Nuclear Information System (INIS)

    This document establishes the technical basis in support of Emergency Planning activities for the 242-A Evaporator, on the Hanford Site. Through this document the technical basis for the development of facility specific Emergency Action Levels and the Emergency Planning Zone is demonstrated. The evaporator sues a conventional, forced-circulation, vacuum evaporation system to concentrate radioactive waste solutions. This concentration results in the reduction in waste volume and reduces the number of double-shelled tanks required to store the waste

  11. 37 CFR 2.42 - Concurrent use.

    Science.gov (United States)

    2010-07-01

    ... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Concurrent use. 2.42 Section... COMMERCE RULES OF PRACTICE IN TRADEMARK CASES The Written Application § 2.42 Concurrent use. An application..., and the mode of use for which applicant seeks registration; and also shall state, to the extent of...

  12. 24 CFR 242.61 - Management.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Management. 242.61 Section 242.61... Management. The mortgagor shall provide for management of the hospital in a manner satisfactory to HUD. (a) Contract Management of Hospital. The mortgagor shall not execute a management agreement or any...

  13. 42 CFR 24.2 - Allocation.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false Allocation. 24.2 Section 24.2 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES PERSONNEL SENIOR BIOMEDICAL RESEARCH SERVICE § 24... talent. (e) The Secretary will ensure that SBRS slots are used in support of high priority...

  14. 24 CFR 242.82 - Energy conservation.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Energy conservation. 242.82 Section... INSURANCE FOR HOSPITALS Miscellaneous Requirements § 242.82 Energy conservation. Construction, mechanical equipment, and energy and metering selections shall provide cost-effective energy conservation in...

  15. Dicty_cDB: SSA242 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA242 (Link to dictyBase) - G00584 DDB0206451 Contig-U04342-1 SSA...242E (Link to Original site) SSA242F 327 SSA242Z 501 SSA242P 828 SSA242E 622 Show SSA242 Library SS (Lin...Contig Contig-U04342-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSA2-B/SSA...242Q.Seq.d/ Representative seq. ID SSA242E (Link to Original site) Representative DNA sequence >SSA242 (SSA...242Q) /CSM/SS/SSA2-B/SSA242Q.Seq.d/ CAAAAAAATGGGACATGATATTAAAGCAATTATAGGTTTTTCTTGCGCATTTGCAGTTGG

  16. Dicty_cDB: VSG242 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available nomic clone Plate=9212 Col=23 Row=M, DNA sequence. 38 0.001 2 V00697 |V00697.1 Yeast (S. cerevisiae) mitochondrial genes for se...%: cytoplasmic 16.0 %: mitochondrial 4.0 %: nuclear >> prediction for VSG242 is cyt 5' end seq... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VS/VSG2-B/VSG242Q.Seq.d/ Representative seq.... ID VSG242P (Link to Original site) Representative DNA sequence >VSG242 (VSG242Q) /CSM/VS/VSG2-B/VSG242Q.Seq...TCAACAAATACCGTTAAGCTCTATATAATTAT TTTTTATTTAAATAAAAA sequence update 2001. 3.22 Translated Amino Acid seq

  17. 242-A evaporator vacuum condenser system

    International Nuclear Information System (INIS)

    This document is written for the 242-A evaporator vacuum condenser system (VCS), describing its purpose and operation within the evaporator. The document establishes the operating parameters specifying pressure, temperature, flow rates, interlock safety features and interfacing sub-systems to support its operation

  18. 48 CFR 242.7502 - Procedures.

    Science.gov (United States)

    2010-10-01

    ... OF DEFENSE CONTRACT MANAGEMENT CONTRACT ADMINISTRATION AND AUDIT SERVICES Contractor Accounting Systems and Related Controls 242.7502 Procedures. (a) Upon receipt of an audit report identifying significant accounting system or related internal control deficiencies, the ACO will— (1) Provide a copy...

  19. 48 CFR 242.002 - Interagency agreements.

    Science.gov (United States)

    2010-10-01

    .../Chief Financial Officer), from non-DoD organizations, except for— (A) Quality assurance, contract... subcontracts awarded by the Small Business Administration under FAR subpart 19.8; and (C) Quality assurance and..., DEPARTMENT OF DEFENSE CONTRACT MANAGEMENT CONTRACT ADMINISTRATION AND AUDIT SERVICES 242.002...

  20. 48 CFR 242.7203 - Review procedures.

    Science.gov (United States)

    2010-10-01

    ... plan; and (C) Any decision to reduce progress payments or disallow costs on vouchers. (ii) The... portion of withheld amounts commensurate with the contractor's progress in making corrections. However... Management and Accounting System 242.7203 Review procedures. (a) Criteria for conducting reviews. Conduct...

  1. A Syllabus for Biol 242--Human Anatomy.

    Science.gov (United States)

    Jacob, Willis H.

    This document is the fall and spring semester course syllabus of Biology 242--Human Anatomy at Southern University (Louisiana). Sections include: (1) Descriptive Information; (2) Specification of Course Goals and Objectives; (3) Readings; (4) Description of Instructional Procedures; (5) Course Requirements; (6) Course Schedule; (7) Evaluation of…

  2. 12 CFR 24.2 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... Institutions or Community Development Entities; (4) Limited liability companies or limited partnerships; (5... investments” under 12 CFR 25.23. The following is a non-exclusive list of examples of the types of entities... ENTITIES, COMMUNITY DEVELOPMENT PROJECTS, AND OTHER PUBLIC WELFARE INVESTMENTS § 24.2 Definitions....

  3. 24 CFR 242.16 - Applications.

    Science.gov (United States)

    2010-04-01

    ... mix, market trends, population forecasts, and business climate; (v) The hospital's demonstrated... Commitment Letter until HUD completes the environmental review under 24 CFR 242.79. ...) Market need. The approval process entails a determination of the market need of the proposal and...

  4. 17 CFR 242.301 - Requirements for alternative trading systems.

    Science.gov (United States)

    2010-04-01

    ... trading systems. 242.301 Section 242.301 Commodity and Securities Exchanges SECURITIES AND EXCHANGE... FUTURES Regulation Ats-Alternative Trading Systems § 242.301 Requirements for alternative trading systems. (a) Scope of section. An alternative trading system shall comply with the requirements in...

  5. 24 CFR 242.63 - Additional indebtedness and leasing.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Additional indebtedness and leasing. 242.63 Section 242.63 Housing and Urban Development Regulations Relating to Housing and Urban... Requirements § 242.63 Additional indebtedness and leasing. The mortgagor shall not enter into any...

  6. 25 CFR 242.5 - Disposition of unmarketable fish.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Disposition of unmarketable fish. 242.5 Section 242.5 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR FISH AND WILDLIFE COMMERCIAL FISHING ON RED LAKE INDIAN RESERVATION § 242.5 Disposition of unmarketable fish. All unmarketable live fish...

  7. 24 CFR 242.64 - Current and future property.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Current and future property. 242.64 Section 242.64 Housing and Urban Development Regulations Relating to Housing and Urban Development... § 242.64 Current and future property. All current or future property (including personalty) of...

  8. Determination of the242 m Am nuclear moments

    Science.gov (United States)

    Bekk, K.; Göring, S.; Kälber, W.; Meisel, G.; Rebel, H.; Sameh, A. Ali

    1988-09-01

    The hyperfine structure of Am atoms was investigated in an atomic beam by laser spectroscopy. The observed splittings were evaluated with respect to the magnetic dipole and electric quadrupole moments of242 m Am. The results are: μ I (242 m Am)=+0.97(5)nm, Q(242 m Am)=+6.5(2.0)b.

  9. Determination of the 242mAm nuclear moments

    International Nuclear Information System (INIS)

    The hyperfine structure of Am atoms was investigated in an atomic beam by laser spectroscopy. The observed splittings were evaluated with respect to the magnetic dipole and electric quadrupole moments of 242mAm. The results are: μI(242mAm) = +0.97(5) nm, Q(242mAm) = +6.5(2.0) b. (orig.)

  10. 7 CFR 1220.242 - Books and records.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Books and records. 1220.242 Section 1220.242... CONSUMER INFORMATION Soybean Promotion and Research Order Reports, Books, and Records § 1220.242 Books and... subpart shall maintain and make available for inspection by the Board or Secretary such books and...

  11. 17 CFR 242.505 - Exclusion for news media.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Exclusion for news media. 242.505 Section 242.505 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION (CONTINUED...-Analyst Certification § 242.505 Exclusion for news media. No provision of this Regulation AC shall...

  12. 32 CFR 242b.7 - Officers of the University.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Officers of the University. 242b.7 Section 242b...) MISCELLANEOUS GENERAL PROCEDURES AND DELEGATIONS OF THE BOARD OF REGENTS OF THE UNIFORMED SERVICES UNIVERSITY OF THE HEALTH SCIENCES § 242b.7 Officers of the University. (a) Dean of the University. (1) The...

  13. 25 CFR 242.12 - Authority to lease.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Authority to lease. 242.12 Section 242.12 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR FISH AND WILDLIFE COMMERCIAL FISHING ON RED LAKE INDIAN RESERVATION § 242.12 Authority to lease. The Band, with the approval of the Secretary, may execute a lease...

  14. Evaluation of neutron data for plutonium-242

    International Nuclear Information System (INIS)

    The evaluation of neutron data for 242Pu is made in the energy region from 10-5 eV up to 20 MeV. The results of the evaluation are compiled in the ENDF/B-VI format. This work is performed under the Project Agreement CIS-03-95 with the International Science and Technology Center (Moscow). The Financing Party for the Project is Japan. The evaluation was requested by Japan Nuclear Data Center (JAERI). (author)

  15. Determination of the /sup 242m/Am nuclear moments

    Energy Technology Data Exchange (ETDEWEB)

    Bekk, K.; Goering, S.; Kaelber, W.; Meisel, G.; Rebel, H.; Sameh, A.A.

    1988-07-01

    The hyperfine structure of Am atoms was investigated in an atomic beam by laser spectroscopy. The observed splittings were evaluated with respect to the magnetic dipole and electric quadrupole moments of /sup 242m/Am. The results are: ..mu../sub I/(/sup 242m/Am) = +0.97(5) nm, Q(/sup 242m/Am) = +6.5(2.0) b.

  16. 242-A evaporator safety analysis report

    International Nuclear Information System (INIS)

    This report provides a revised safety analysis for the upgraded 242-A Evaporator (the Evaporator). This safety analysis report (SAR) supports the operation of the Evaporator following life extension upgrades and other facility and operations upgrades (e.g., Project B-534) that were undertaken to enhance the capabilities of the Evaporator. The Evaporator has been classified as a moderate-hazard facility (Johnson 1990). The information contained in this SAR is based on information provided by 242-A Evaporator Operations, Westinghouse Hanford Company, site maintenance and operations contractor from June 1987 to October 1996, and the existing operating contractor, Waste Management Hanford (WMH) policies. Where appropriate, a discussion address the US Department of Energy (DOE) Orders applicable to a topic is provided. Operation of the facility will be compared to the operating contractor procedures using appropriate audits and appraisals. The following subsections provide introductory and background information, including a general description of the Evaporator facility and process, a description of the scope of this SAR revision,a nd a description of the basic changes made to the original SAR

  17. 242-A evaporator safety analysis report

    Energy Technology Data Exchange (ETDEWEB)

    CAMPBELL, T.A.

    1999-05-17

    This report provides a revised safety analysis for the upgraded 242-A Evaporator (the Evaporator). This safety analysis report (SAR) supports the operation of the Evaporator following life extension upgrades and other facility and operations upgrades (e.g., Project B-534) that were undertaken to enhance the capabilities of the Evaporator. The Evaporator has been classified as a moderate-hazard facility (Johnson 1990). The information contained in this SAR is based on information provided by 242-A Evaporator Operations, Westinghouse Hanford Company, site maintenance and operations contractor from June 1987 to October 1996, and the existing operating contractor, Waste Management Hanford (WMH) policies. Where appropriate, a discussion address the US Department of Energy (DOE) Orders applicable to a topic is provided. Operation of the facility will be compared to the operating contractor procedures using appropriate audits and appraisals. The following subsections provide introductory and background information, including a general description of the Evaporator facility and process, a description of the scope of this SAR revision,a nd a description of the basic changes made to the original SAR.

  18. 40 CFR 61.242-3 - Standards: Compressors.

    Science.gov (United States)

    2010-07-01

    ... under 40 CFR part 60, shall not be in VOC service. (d) Each barrier fluid system as described in... 40 Protection of Environment 8 2010-07-01 2010-07-01 false Standards: Compressors. 61.242-3... Leaks (Fugitive Emission Sources) § 61.242-3 Standards: Compressors. (a) Each compressor shall...

  19. 17 CFR 242.101 - Activities by distribution participants.

    Science.gov (United States)

    2010-04-01

    ... certain other sections. Transactions complying with §§ 242.103 or 242.104; or (3) Odd-lot transactions... standardized index; or (7) De minimis transactions. Purchases during the restricted period, other than by a... quotation system or electronic communications network; or (6) Basket transactions. (i) Bids or purchases,...

  20. 24 CFR 242.72 - Leasing of hospital.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Leasing of hospital. 242.72 Section... INSURANCE FOR HOSPITALS Miscellaneous Requirements § 242.72 Leasing of hospital. Leasing of a hospital in its entirety is prohibited. Notwithstanding this prohibition, any proposal in which leasing of...

  1. 48 CFR 352.242-70 - Key personnel.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Key personnel. 352.242-70... SOLICITATION PROVISIONS AND CONTRACT CLAUSES Texts of Provisions and Clauses 352.242-70 Key personnel. As prescribed in 342.302(c)(2), the Contracting Officer shall insert the following clause: Key...

  2. 24 CFR 242.45 - Early commencement of work.

    Science.gov (United States)

    2010-04-01

    ... review under 24 CFR 242.79. The work must meet all requirements and guidelines as if it were approved for... review under 24 CFR 242.79, previous participation review, and the agreement to certain conditions by the applicant. HUD will not approve such request until it has completed the environmental review under 24...

  3. Dicty_cDB: VFF242 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFF242 (Link to dictyBase) - - - Contig-U16605-1 VFF242P (Link to Original ... w*lldr*klmg yfmgygwlhfyeqr*k*qlwyrnngffpncliklkfyf*lsd *h*fivinkknknkk* Translated Amino Acid sequence (Al ... w*lldr*klmg yfmgygwlhfyeqr*k*qlwyrnngffpncliklkfyf*lsd *h*fivinkknknkk* Frame B: ikyiytknesfiiplfiis*lrfc* ...

  4. Dicty_cDB: AFG242 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AF (Link to library) AFG242 (Link to dictyBase) - - - Contig-U15589-1 AFG242F (Link to Original ... L*fsnitxsny--- Translated Amino Acid sequence (All Frames ) Frame A: nfqlf*FLIFLYIYININFYFYFFL*fsnitxsny--- F ...

  5. 24 CFR 242.65 - Distribution of assets.

    Science.gov (United States)

    2010-04-01

    ... CFR 242.1, or cash that has been expressly approved for distribution by HUD, may be distributed to... regulatory agreement, and in accordance with the release of lien conditions in 24 CFR 242.62, if applicable. ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Distribution of assets....

  6. 242-A evaporator safety analysis report

    International Nuclear Information System (INIS)

    In compliance with DOE Orders, an update of the 242-A SAR has been prepared, as documented in the referenced ECN. Several categories of changes were identified for inclusion in this revision of the SAR. These categories will be utilized to simplify the discussion of the changes for this USQ document. However, it is important to note that no new tests or experiments were included in this revision of the SAR. Editorial changes and/or informational updates to Chapters 9 and 11 were included as part of this revision. However, no changes to Operational Safety Requirements (OSRs) contained in Chapter 11 were required. General categories of changes included in this revision are listed

  7. The immunoradiometric assay for carbohydrate antigen CA-242

    International Nuclear Information System (INIS)

    Using 125I-labelled monoclonal antibody (C242) against carbohydrate antigen CA-242, the sandwich immunoradiometric assay (IRMA) was developed. In preliminary clinical application of this method, the results of serum CA-242 measurements were 2.5 ± 4.5 U/ml for 77 normal individuals, 3.5 ± 7.0 U/ml for 128 cases of benign diseases, and 56.0 ± 91.3 U/ml for 210 cases of malignant tumors. The CA-242 values of patients with malignant tumors were significantly higher than that of patients with benign diseases. Taking 12 U/ml as normal upper limit, the positive detective rates of pancreatic and colorectal cancers were 86.6% and 62.0% respectively, while the false positive rate for normal individuals was 4%

  8. 17 CFR 242.204 - Close-out requirement.

    Science.gov (United States)

    2010-04-01

    ... 600(b)(64) of Regulation NMS (17 CFR 242.600(b)(64)). Regulation ATS—Alternative Trading Systems...) REGULATIONS M, SHO, ATS, AC, AND NMS AND CUSTOMER MARGIN REQUIREMENTS FOR SECURITY FUTURES Regulation...

  9. Dicty_cDB: SSD242 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSD242 (Link to dictyBase) - - - Contig-U16373-1 SSD242E (Link to Original ... date 1999. 4. 5 Translated Amino Acid sequence IVIPSKW VTAKLIDLSPDDQTDLALLEIIDYDSIHHLNSNNNSISSSGSINSKESIKS ... *fnssfkf****y***w*y***rinkk*w ww**i**qi*kkttt**kr**skw ***q****kfk*kpyck***iyitii*lssfr*irk gkretrl*nhl*y* ... iniivyqlq qf*lglvkfqkriqsiflfkkiikkik Frame C: IVIPSKW VTAKLIDLSPDDQTDLALLEIIDYDSIHHLNSNNNSISSSGSINSKESIKS ...

  10. 242-A Campaign 99-1 process control plan

    Energy Technology Data Exchange (ETDEWEB)

    LE, E.Q.

    1999-08-25

    242-A Evaporator 99-1 will process approximately one million gallons of waste from tank 102-AW in June 1999. The process control Plan provides a general description of activities, which will occur during 242-A Evaporator Campaign 99-1 and to document analyses conducted to demonstrate that 102-AW waste is acceptable for processing. Predict is a registered trademark of Risk Decisions England Corporation, United Kingdom.

  11. Process control plan for 242-A Campaign 99-1

    International Nuclear Information System (INIS)

    242-A Evaporator 99-1 will process approximately one million gallons of waste from tank 102-AW in June 1999. The process control Plan provides a general description of activities, which will occur during 242-A Evaporator Campaign 99-1 and to document analyses conducted to demonstrate that 102-AW waste is acceptable for processing. Predict is a registered trademark of Risk Decisions England Corporation, United Kingdom

  12. 17 CFR 242.302 - Recordkeeping requirements for alternative trading systems.

    Science.gov (United States)

    2010-04-01

    ... alternative trading systems. 242.302 Section 242.302 Commodity and Securities Exchanges SECURITIES AND... SECURITY FUTURES Regulation Ats-Alternative Trading Systems § 242.302 Recordkeeping requirements for alternative trading systems. To comply with the condition set forth in paragraph (b)(8) of § 242.301,...

  13. National Low-Level Waste Management Program radionuclide report series. Volume 13, Curium-242

    International Nuclear Information System (INIS)

    This report, Volume 13 of the National Low-Level Waste Management Program Radionuclide Report Series, discusses the radiological and chemical characteristics of curium-242 (242Cm). This report also includes discussions about waste types and forms in which 242Cm can be found and 242Cm behavior in the environment and in the human body

  14. Measurement of the 242Pu neutron capture cross section

    Science.gov (United States)

    Buckner, M. Q.; Wu, C. Y.; Henderson, R. A.; Bucher, B.; Bredeweg, T. A.; Baramsai, B.; Couture, A.; Jandel, M.; Mosby, S.; O'Donnell, J. M.; Ullmann, J. L.; Chyzh, A.; Dance Collaboration

    2015-10-01

    Precision (n,f) and (n, γ) cross sections are important for the network calculations of the radiochemical diagnostic chain for the U.S. DOE's Stockpile Stewardship Program. 242Pu(n, γ) cross section is relevant to the network calculations of Pu and Am. Additionally, new reactor concepts have catalyzed considerable interest in the measurement of improved cross sections for neutron-induced reactions on key actinides. To date, little or no experimental data has been reported on 242Pu(n, γ) for incident neutron energy below 50 keV. A new measurement of the 242Pu(n, γ) reaction was performed with the DANCE together with an improved PPAC for fission-fragment detection at LANSCE during FY14. The relative scale of the 242Pu(n, γ) cross section spans four orders of magnitude for incident neutron energies from thermal to ~ 30 keV. The absolute scale of the 242Pu(n, γ) cross section is set according to the measured 239Pu(n,f) resonance at 7.8 eV; the target was spiked with 239Pu for this measurement. The absolute 242Pu(n, γ) neutron capture cross section is ~ 30% higher than the cross section reported in ENDF for the 2.7 eV resonance. Latest results to be reported. Funded by U.S. DOE Contract No. DE-AC52-07NA27344 (LLNL) and DE-AC52-06NA25396 (LANL). U.S. DOE/NNSA Office of Defense Nuclear Nonproliferation Research and Development. Isotopes (ORNL).

  15. 2-4-2 Concept for manned missions to Mars

    OpenAIRE

    Salotti, Jean-Marc

    2011-01-01

    In a previous paper, a new scenario for human missions to Mars has been presented. It can be named the 2-4-2 concept. The idea is to minimize IMLEO and the payload on Mars with a crew of only two astronauts. There are two astronauts in each rocket at departure from Earth. They meet on Mars to form a team of four and the pairs are reconstituted for the return (2-4-2). In the previous study it was proposed an assembly in LEO. We propose now a different approach with several small vehicles sent ...

  16. 24 CFR 242.2 - Program financial self-sufficiency.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Program financial self-sufficiency... self-sufficiency and actuarial soundness; i.e., to avoid mortgage defaults and claims for insurance... AUTHORITIES MORTGAGE INSURANCE FOR HOSPITALS General Eligibility Requirements § 242.2 Program financial...

  17. 36 CFR 242.18 - Regulation adoption process.

    Science.gov (United States)

    2010-07-01

    ... and B of this part shall be accepted by the Secretary of the Interior in accordance with 43 CFR part... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Regulation adoption process... SUBSISTENCE MANAGEMENT REGULATIONS FOR PUBLIC LANDS IN ALASKA Program Structure § 242.18 Regulation...

  18. Process Control Plan for 242A Evaporator Campaign

    Energy Technology Data Exchange (ETDEWEB)

    LE, E.Q.

    2000-04-06

    The wastes in tanks 107-AP and 108-AP are designated as feed for 242-A Evaporator Campaign 2000-1, which is currently scheduled for the week of April 17, 2000. Waste in tanks 107-AP and 108-AP is predominantly comprised of saltwell liquor from 200 West Tank Farms.

  19. 48 CFR 52.242-14 - Suspension of Work.

    Science.gov (United States)

    2010-10-01

    ... the work is, for an unreasonable period of time, suspended, delayed, or interrupted (1) by an act of... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Suspension of Work. 52.242... Suspension of Work. As prescribed in 42.1305(a), insert the following clause in solicitations and...

  20. 36 CFR 242.27 - Subsistence taking of fish.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Subsistence taking of fish... SUBSISTENCE MANAGEMENT REGULATIONS FOR PUBLIC LANDS IN ALASKA Subsistence Taking of Fish and Wildlife § 242.27 Subsistence taking of fish. Link to an amendment published at 75 FR 37969, June 30, 2010. (a)...

  1. 10 CFR 72.242 - Recordkeeping and reports.

    Science.gov (United States)

    2010-01-01

    ... Spent Fuel Storage Casks § 72.242 Recordkeeping and reports. (a) Each certificate holder or applicant... deficiency, for any spent fuel storage cask which has been delivered to a licensee, when the design or... knowledgeable readers familiar with the design of the spent fuel storage cask, but not familiar with the...

  2. 42 CFR 438.242 - Health information systems.

    Science.gov (United States)

    2010-10-01

    ... ensure, through its contracts, that each MCO and PIHP maintains a health information system that collects... disenrollments for other than loss of Medicaid eligibility. (b) Basic elements of a health information system... 42 Public Health 4 2010-10-01 2010-10-01 false Health information systems. 438.242 Section...

  3. 17 CFR 242.405 - Withdrawal of margin.

    Science.gov (United States)

    2010-04-01

    ... account after such withdrawal is sufficient to satisfy the required margin for the security futures and...) REGULATIONS M, SHO, ATS, AC, AND NMS AND CUSTOMER MARGIN REQUIREMENTS FOR SECURITY FUTURES Customer Margin Requirements for Security Futures § 242.405 Withdrawal of margin. (a) By the customer. Except as...

  4. 17 CFR 242.607 - Customer account statements.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Customer account statements... (CONTINUED) REGULATIONS M, SHO, ATS, AC, AND NMS AND CUSTOMER MARGIN REQUIREMENTS FOR SECURITY FUTURES Regulation Nms-Regulation of the National Market System § 242.607 Customer account statements. (a) No...

  5. 17 CFR 242.604 - Display of customer limit orders.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Display of customer limit... (CONTINUED) REGULATIONS M, SHO, ATS, AC, AND NMS AND CUSTOMER MARGIN REQUIREMENTS FOR SECURITY FUTURES Regulation Nms-Regulation of the National Market System § 242.604 Display of customer limit orders....

  6. 48 CFR 52.242-17 - Government Delay of Work.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Government Delay of Work....242-17 Government Delay of Work. As prescribed in 42.1305(c), insert the following clause in... services, or for supplies that are commercial or modified-commercial items. Government Delay of Work...

  7. 48 CFR 652.242-72 - Shipping Instructions.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Shipping Instructions. 652... SOLICITATION PROVISIONS AND CONTRACT CLAUSES Texts of Provisions and Clauses 652.242-72 Shipping Instructions. As prescribed in 642.1406-2-70(b), insert the following clause: Shipping Instructions (DEC 1994)...

  8. Electron-capture delayed fission properties of 242Es

    International Nuclear Information System (INIS)

    Electron-capture delayed fission of 242Es produced via the 233U(14N,5n)242Es reaction at 87 MeV (on target) was observed to decay with a half-life of 11±3 s, consistent with the reported α-decay half-life of 242Es of 16-4+6 s. The mass-yield distribution of the fission fragments is highly asymmetric. The average pre-neutron emission total kinetic energy of the fragments was measured to be 183±18 MeV. Based on the ratio of the measured number of fission events to the measured number of α decays from the electron-capture daughter 242Cf (100% α branch), the probability of delayed fission was determined to be 0.006±0.002. This value for the delayed fission probability fits the experimental trend of increasing delayed fission probability with increasing Q value for electron capture. (c) 2000 The American Physical Society

  9. 17 CFR 242.606 - Disclosure of order routing information.

    Science.gov (United States)

    2010-04-01

    ... (CONTINUED) REGULATIONS M, SHO, ATS, AC, AND NMS AND CUSTOMER MARGIN REQUIREMENTS FOR SECURITY FUTURES Regulation Nms-Regulation of the National Market System § 242.606 Disclosure of order routing information. (a... calendar quarter a report on its routing of non-directed orders in NMS securities during that quarter....

  10. 17 CFR 242.600 - NMS security designation and definitions.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false NMS security designation and... (CONTINUED) REGULATIONS M, SHO, ATS, AC, AND NMS AND CUSTOMER MARGIN REQUIREMENTS FOR SECURITY FUTURES Regulation Nms-Regulation of the National Market System § 242.600 NMS security designation and...

  11. 17 CFR 242.605 - Disclosure of order execution information.

    Science.gov (United States)

    2010-04-01

    ... (CONTINUED) REGULATIONS M, SHO, ATS, AC, AND NMS AND CUSTOMER MARGIN REQUIREMENTS FOR SECURITY FUTURES Regulation Nms-Regulation of the National Market System § 242.605 Disclosure of order execution information... covered orders in NMS stocks that it received for execution from any person. Such report shall be...

  12. Process Control Plan for 242-A Evaporator Campaign

    International Nuclear Information System (INIS)

    The wastes in tanks 107-AP and 108-AP are designated as feed for 242-A Evaporator Campaign 2000-1, which is currently scheduled for the week of April 17, 2000. Waste in tanks 107-AP and 108-AP is predominantly comprised of saltwell liquor from 200 West Tank Farms

  13. 40 CFR 180.242 - Thiabendazole; tolerances for residues.

    Science.gov (United States)

    2010-07-01

    ... Cauliflower 0.05 12/31/09 Lentil, seed 0.1 12/31/08 (c) Tolerances with regional exemptions. (d) Indirect or inadvertent residues. Editorial Note: For Federal Register citations affecting § 180.242, see the List of...

  14. 48 CFR 2452.242-71 - Contract management system.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Contract management system... 2452.242-71 Contract management system. As prescribed in 2442.1107, insert the following clause: Contract Management System (FEB 2006) (a) The contractor shall use contract management baseline...

  15. 16 CFR 24.2 - Deception as to composition.

    Science.gov (United States)

    2010-01-01

    ... example: 2 With regard to footwear, it is sufficient to disclose the presence of non-leather materials in... LEATHER AND IMITATION LEATHER PRODUCTS § 24.2 Deception as to composition. It is unfair or deceptive to... or deceptive to use the unqualified term “leather” or other unqualified terms suggestive of...

  16. 17 CFR 242.303 - Record preservation requirements for alternative trading systems.

    Science.gov (United States)

    2010-04-01

    ... requirements for alternative trading systems. 242.303 Section 242.303 Commodity and Securities Exchanges... REQUIREMENTS FOR SECURITY FUTURES Regulation Ats-Alternative Trading Systems § 242.303 Record preservation requirements for alternative trading systems. (a) To comply with the condition set forth in paragraph (b)(9)...

  17. 24 CFR 242.90 - Eligibility of mortgages covering hospitals in certain neighborhoods.

    Science.gov (United States)

    2010-04-01

    ... hospitals in certain neighborhoods. 242.90 Section 242.90 Housing and Urban Development Regulations Relating... UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES MORTGAGE INSURANCE FOR HOSPITALS Miscellaneous Requirements § 242.90 Eligibility of mortgages covering hospitals in certain neighborhoods. (a) A...

  18. 48 CFR 352.242-72 - Native American Graves Protection and Repatriation Act.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Native American Graves Protection and Repatriation Act. 352.242-72 Section 352.242-72 Federal Acquisition Regulations System HEALTH AND HUMAN SERVICES CLAUSES AND FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Texts of Provisions and Clauses 352.242-72 Native...

  19. 42 CFR 431.242 - Procedural rights of the applicant or recipient.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 4 2010-10-01 2010-10-01 false Procedural rights of the applicant or recipient. 431.242 Section 431.242 Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES, DEPARTMENT OF HEALTH... ADMINISTRATION Fair Hearings for Applicants and Recipients Procedures § 431.242 Procedural rights of...

  20. 19 CFR 24.2 - Persons authorized to receive Customs collections.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Persons authorized to receive Customs collections. 24.2 Section 24.2 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY CUSTOMS FINANCIAL AND ACCOUNTING PROCEDURE § 24.2 Persons authorized to...

  1. Fission cross section for 242Am.met

    International Nuclear Information System (INIS)

    The neutron-induced fission cross section for 242Am.met (152y) was measured at the Livermore 100-MeV electron linac in the neutron energy range of 0.01 eV to 20 MeV. Fission fragments were detected using a hemispherical fission chamber. The neutron flux was measured below 10 keV using lithium glass scintillators. Above 10 keV, the 242Am.met fission cross section was measured relative to the 235U fission cross section. Below 20 eV, the data were fit with a sum of single-level Breit-Wigner resonances. Results for the distribution of fission widths, the average fission width, and the average level spacing are presented. The fission cross section in the 100 keV to 20 MeV range is compared with previous measurements

  2. Observation of cold fission in 242Pu spontaneous fission

    International Nuclear Information System (INIS)

    Coincidence γ-ray data from the spontaneous fission of 242Pu were collected at the Lawrence Berkeley Laboratory high purity Ge (HPGe) array, GAMMASPHERE. Data from several cold-fission (0 neutron emission) isotopic pairs were observed and are presented. An interesting trend in the fractional population of cold-fission events was observed and is discussed. Relative yields of Zr-Xe, Sr-Ba, and Mo-Te pairs were measured. The Zr-Xe system has the most complete data set. Some speculations on the trend in the number of neutrons emitted as a function of the mass of the Xe isotope populated are presented. Comparisons between the yields from the spontaneous fission of 242Pu and the yields from thermal-neutron-induced fission of 241Pu are also presented. copyright 1996 The American Physical Society

  3. Performance of isotope correlations for the estimate of 242Pu

    International Nuclear Information System (INIS)

    The lack of a gamma-ray signature from 242 Pu represents an Achilles heel for many plutonium isotope abundance measurements made by high-resolution gamma spectrometry (HRGS). This holds in particular for plutonium materials containing a significant fraction of this isotope. The problem is partially solved through the application of isotope correlations estimating the relative abundance of 242 Pu from relations to ratios of other plutonium isotopes measurable by HRGS. In the mid of the nineties a new type of isotope correlation had been proposed for LWR plutonium with the recommended coefficients for PWR and BWR fuels. This type of correlation was adopted for the routine analysis of safeguards samples in the Euratom On-Site Laboratories and in the Institute for Transuranium Elements. In order to cover the full range of plutonium materials received for analysis, the application of the above correlation has been also extended to AGR and Magnox-type of plutonium with different sets of coefficients approximating best the correlation for the additional types of materials were determined from a set of reference isotopic data. Since in many instances the origin and the type of the plutonium are not known a priori, criteria for categorization were established helping to select the appropriate isotope correlation. Parametric plots of the ratios 238 Pu/239 Pu versus 240 Pu/239 Pu generally allow to discern unambiguously Magnox, AGR and LWR plutonium, and to some extent also BWR and PWR plutonium, as long as a mixing of the respective plutonium materials has not occurred. With this kind of categorization implemented in the routine analysis the performance of the 242 Pu estimate is substantially improving in most cases. Performance data for 242 Pu in particular, and for plutonium isotope abundance measurements by HRGS in general, as derived from a larger set of measurement data are presented and discussed in terms of their impact on the interpretation of passive neutron

  4. Hanford facility dangerous waste permit application, 242-A evaporator

    International Nuclear Information System (INIS)

    The Hanford Facility Dangerous Waste Permit Application is considered to be a single application organized into a General Information Portion (document number DOE/RL-91-28) and a Unit-Specific Portion. The scope of the Unit-Specific Portion is limited to Part B permit application documentation submitted for individual, 'operating' treatment, storage, and/or disposal units, such as the 242-A Evaporator (this document, DOE/RL-90-42)

  5. 242-A evaporator quality assurance project plan: Revision 1

    International Nuclear Information System (INIS)

    The scope of this quality assurance project plan (Plan) is sampling and analytical services including, but not limited to, sample receipt, handling and storage, analytical measurements, submittal of data deliverables, archiving selected portions of samples, returning unneeded sample material to Westinghouse Hanford Company (WHC), and/or sample disposal associated with candidate feed samples and process condensate compliance samples. Sampling and shipping activities are also included within the scope. The purpose of this project is to provide planning, implementation, and assessment guidance for achieving established data quality objectives measurement parameters. This Plan requires onsite and offsite laboratories to conform to that guidance. Laboratory conformance will help ensure that quality data are being generated and therefore, that the 242-A evaporator is operating in a safe and compliant manner. The 242-A evaporator feed stream originates from double-shell tanks (DSTs) identified as candidate feed tanks. The 242-A evaporator reduces the volume of aqueous waste contained in DSTs by boiling off water and sending it to the Liquid Effluent Retention Facility (LERF) storage basin before further treatment. The slurry product is returned to DSTs. Evaporation results in considerable savings by reducing the volume of mixed waste for disposal

  6. 242-A evaporator quality assurance project plan: Revision 1

    Energy Technology Data Exchange (ETDEWEB)

    Tucker, B.J.

    1994-11-04

    The scope of this quality assurance project plan (Plan) is sampling and analytical services including, but not limited to, sample receipt, handling and storage, analytical measurements, submittal of data deliverables, archiving selected portions of samples, returning unneeded sample material to Westinghouse Hanford Company (WHC), and/or sample disposal associated with candidate feed samples and process condensate compliance samples. Sampling and shipping activities are also included within the scope. The purpose of this project is to provide planning, implementation, and assessment guidance for achieving established data quality objectives measurement parameters. This Plan requires onsite and offsite laboratories to conform to that guidance. Laboratory conformance will help ensure that quality data are being generated and therefore, that the 242-A evaporator is operating in a safe and compliant manner. The 242-A evaporator feed stream originates from double-shell tanks (DSTs) identified as candidate feed tanks. The 242-A evaporator reduces the volume of aqueous waste contained in DSTs by boiling off water and sending it to the Liquid Effluent Retention Facility (LERF) storage basin before further treatment. The slurry product is returned to DSTs. Evaporation results in considerable savings by reducing the volume of mixed waste for disposal.

  7. 1998 242-A interim evaporator tank system integrity assessment plan

    International Nuclear Information System (INIS)

    Portions of the 242-A Evaporator on the Hanford Site must be assessed to meet the requirements of the Washington State Department of Ecology's Dangerous Waste Regulation, Washington Administrative Code (WAC) 173-303. The assessment is limited to the provisions of Section 173-303-640. This Integrity Assessment Plan (IAP) identifies tasks which will be performed during the assessment phase and describes the intended assessment techniques. The 242-A Evaporator facility processes waste solutions from most of the operating laboratories and plants of the Hanford Site. The waste solutions are concentrated in the evaporator to a slurry of liquid and crystallized salts. This concentrated slurry is returned to the Tank Farms at a significantly reduce volume. The water vapor from the evaporation process is condensed, filtered, and can be pumped through an ion exchange bed before transfer to a retention basin. The non-condensable portion of the vapor is filtered and continuously monitored before venting to the atmosphere. The 242-A Evaporator will be assessed as seven subsystems. Four of the subsystems store, transport or treat Washington State Dangerous wastes, the other three subsystems are integral parts of the process, however, they do not directly store, transfer, or treat listed dangerous wastes. The facility will be inspected, tested, and analyzed through this assessment. The seven subsystems, defined in detail in Appendix B, are: Evaporator Process and Slurry Subsystem; Vapor Condenser Subsystem; Vessel Vent Subsystem; Process Condensate Subsystem; Steam Condensate Subsystem; Raw Water Disposal Subsystem; and Building and Secondary Containment Subsystem

  8. 242-A Evaporator waste analysis plan. Revision 4

    International Nuclear Information System (INIS)

    This waste analysis plan (WAP) provides the plan for obtaining information needed for proper waste handling and processing in the 242-A Evaporator located on the Hanford Site. Regulatory and safety issues are addressed by establishing boundary conditions for waste received and treated at the 242-A Evaporator. The boundary conditions are set by establishing limits for items such as potential exothermic reactions, waste compatibility, and control of vessel vent organic emissions. Boundary conditions are also set for operational considerations and to ensure waste acceptance at receiving facilities. The issues that are addressed in this plan include prevention of exotherms in the waste, waste compatibility, vessel vent emissions, and compatibility with the liner in the Liquid Effluent Retention Facility (LERF). The 242-A Evaporator feed stream is separated into two liquid streams: a concentrated slurry stream and a process condensate. A gaseous exhaust stream is also produced. The slurry contains the majority of the radionuclides and inorganic constituents. This stream is pumped back to the double shell tanks (DSTs) and stored for further treatment after being concentrated to target levels. The process condensate (PC) is primarily water that contains trace amounts of organic material and a greatly reduced concentration of radionuclides. The process condensate is presently stored in the (LERF) until it can be further processed in the Effluent Treatment Facility once it is operational

  9. Performance of isotope correlations for the estimate of 242Pu

    International Nuclear Information System (INIS)

    Full text: The lack of a gamma-ray signature from 242Pu represents an Achilles heel for many plutonium isotope abundance measurements made by high-resolution gamma spectrometry (HRGS). This holds in particular for plutonium materials containing a significant fraction of this isotope. The problem is partially solved through the application of isotope correlations estimating the relative abundance of 242Pu from relations to ratios of other plutonium isotopes measurable by HRGS. In the mid of the nineties a new type of isotope correlation had been proposed for LWR plutonium based on the following relation: 242Pu/239Pu = C0·[238Pu/239Pu]c1 · [240Pu/239Pu]c2 with recommended coefficients C0, C1 and C2 for PWR and BWR fuels, respectively. We have adopted this type of correlation for the routine analysis of safeguards samples in the Euratom On-Site Laboratories and in the Institute for Transuranium Elements. In order to cover the full range of plutonium materials received for analysis, the application of the above correlation has been also extended to AGR and Magnox-type of plutonium. The differing sets of coefficients C0, C1 and C2 approximating best the correlation for the additional types of materials were determined from a set of reference isotopic data. Since in many instances the origin and the type of the plutonium are not known a priori, criteria for categorization were established helping to select the appropriate isotope correlation. Parametric plots of the ratios 238Pu/239Pu versus 240Pu/239Pu generally allow to discern unambiguously Magnox, AGR and LWR plutonium, and to some extent also BWR and PWR plutonium, as long as a mixing of the respective plutonium materials has not occurred. With this kind of categorization implemented in the routine analysis the performance of the 242Pu estimate is substantially improving in most cases. Performance data for 242Pu in particular, and for plutonium isotope abundance measurements by HRGS in general, as derived from a

  10. Review of fission product yields and delayed neutron data for the actinides NP-237, PU-242, AM-242M, AM-243, CM-243 and CM-245

    International Nuclear Information System (INIS)

    A review of fission product yields and delayed neutron data for Np-237, Pu-242, Am-242m, Am-243, Cm-243 and Cm-245 has been undertaken. Gaps in understanding and inconsistencies in existing data were identified and priority areas for further experimental, theoretical and evaluation investigation detailed

  11. Dicty_cDB: SFF242 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CTACCTAATCATGATCANATTATATTGTAAGAAT Length of 3' end seq. 703 Connected seq. ID SFF242P Connected seq. >SFF24...ATTCTGGAATGCATTTGACGATTTTACAAATGCAAAGAAATCTACCTAATCA TGATCANATTATATTGTAAGAAT Length of connect...ry*kn*nrittsp*i--- ---fsftkfsfickyfnkl*kv*n*r*rrkekkkiiiiiiiviiiiitkc*iitkwksin ystfkkqnsnyyctiiinsnn...mplete sequence. 36 2e-08 20 AE014839 |AE014839.1 Plasmodium falciparum 3D7 chromosome 11 section 4 of 8 of ...498 strain AX4, complete sequence. 38 3e-07 16 AE014825 |AE014825.1 Plasmodium falciparum 3D7 chromosome 14 section

  12. 242-A Control System device logic software documentation. Revision 2

    International Nuclear Information System (INIS)

    A Distributive Process Control system was purchased by Project B-534. This computer-based control system, called the Monitor and Control System (MCS), was installed in the 242-A Evaporator located in the 200 East Area. The purpose of the MCS is to monitor and control the Evaporator and Monitor a number of alarms and other signals from various Tank Farm facilities. Applications software for the MCS was developed by the Waste Treatment System Engineering Group of Westinghouse. This document describes the Device Logic for this system

  13. Clinical evaluation of serum tumour marker CA 242 in non-small cell lung cancer.

    OpenAIRE

    Pujol, J L; Cooper, E H; Lehmann, M.; Purves, D. A.; Dan-Aouta, M.; Midander, J.; Godard, P.; Michel, F B

    1993-01-01

    CA 242, a novel tumour carbohydrate antigen present in serum (upper limit of normal values: 20.0 U ml-1), has been measured in a group of 102 pathologically confirmed non-small cell lung cancer patients. The aim of the present prospective study was to identify any relationship between pre-treatment serum CA 242 level and different features of lung cancer including prognosis. Serum CA 242 was measured using the delayed europium lanthanide fluoroimmunometric assay. Sensitivity and specificity w...

  14. Preoperative serum levels of CEA and CA 242 in colorectal cancer.

    OpenAIRE

    Carpelan-Holmström, M; Haglund, C.; Kuusela, P.; Järvinen, H; Roberts, P. J.

    1995-01-01

    Preoperative serum levels of CEA and CA 242 were determined in 260 patients with colorectal cancer and in 92 patients with benign colorectal diseases. The overall sensitivity of the CEA test was 43% and of the CA 242 test 39%. The corresponding specificities were 90% and 87% respectively, using 5 ng ml-1 as cut-off level for CEA and 20 U ml-1 for CA 242. The sensitivity of CEA was 26%, 32%, 38% and 77% for Dukes A, B, C and D colorectal cancer, and the sensitivity of CA 242 was 26%, 26%, 40% ...

  15. Comparative study of CA242 and CA19-9 for the diagnosis of pancreatic cancer.

    OpenAIRE

    Kawa, S; Tokoo, M.; Hasebe, O.; Hayashi, K.; Imai, H; Oguchi, H.; Kiyosawa, K; Furuta, S; Homma, T

    1994-01-01

    A comparative study of a new tumour marker, CA242, and CA19-9 was conducted with special reference to their diagnostic usefulness in pancreatic cancer. CA242 showed sensitivity similar to that of CA19-9 for overall cases and early cases (stage I tumour) of pancreatic cancer. For other malignancies, the positive rates of CA242 were lower than those of CA19-9 except for colorectal cancer. An important characteristics of CA242 was that it was only slightly and infrequently elevated in the sera o...

  16. 242-A Evaporator Waste Analysis Plan. Revision 5

    Energy Technology Data Exchange (ETDEWEB)

    Basra, T.S.

    1995-04-13

    This Waste Analysis Plan (WAP) provides the plan for obtaining information needed for proper waste handling and processing in the 242-A Evaporator (Evaporator) located on the Hanford Site. In particular it addresses analysis necessary to manage the waste according to Washington Administrative Code (WAC) 173-303 and Parts 264 and 265 of the Code of Federal Regulations (CFR). Regulatory and safety issues are addressed by establishing boundary conditions for waste received and treated at the 242-A Evaporator. The boundary conditions are set by establishing limits for items such as potential exothermic reactions, waste compatibility, and control of vessel vent organic emissions. Boundary conditions are also set for operational considerations and to ensure waste acceptance at receiving facilities. The issues that are addressed in this plan include prevention of exotherms in the waste, waste compatibility, and vessel vent emissions. Samples from the other streams associated with the Evaporator are taken as required by Process Control Plans but are excluded from this plan because either the streams do not contain dangerous waste or the analyses are not required by WAC 173-303-300.

  17. 242A Distributed Control System Year 2000 Acceptance Test Report

    International Nuclear Information System (INIS)

    This report documents acceptance test results for the 242-A Evaporator distributive control system upgrade to D/3 version 9.0-2 for year 2000 compliance. This report documents the test results obtained by acceptance testing as directed by procedure HNF-2695. This verification procedure will document the initial testing and evaluation of the potential 242-A Distributed Control System (DCS) operating difficulties across the year 2000 boundary and the calendar adjustments needed for the leap year. Baseline system performance data will be recorded using current, as-is operating system software. Data will also be collected for operating system software that has been modified to correct year 2000 problems. This verification procedure is intended to be generic such that it may be performed on any D/3(trademark) (GSE Process Solutions, Inc.) distributed control system that runs with the VMSTM (Digital Equipment Corporation) operating system. This test may be run on simulation or production systems depending upon facility status. On production systems, DCS outages will occur nine times throughout performance of the test. These outages are expected to last about 10 minutes each

  18. Restart oversight assessment of Hanford 242-A evaporator: Technical report

    Energy Technology Data Exchange (ETDEWEB)

    Lagdon, R.; Lasky, R.

    1994-08-01

    An assessment team from the Office of Environment, Safety and Health (EH), US Department of Energy (DOE), conducted an independent assessment of the 242-A Evaporator at the Hanford Site during January 17--28, 1994. An EH team member remained on-site following the assessment to track corrective actions and resolve prestart findings. The primary objective of this assessment was independent assurance that the DOE Office of Environmental Management (EM), the DOE Richland Operations Office (DOE-RL), and Westinghouse Hanford Company (WHC) can safely restart the evaporator. Another objective of the EH team was to assess EM`s Operational Readiness Evaluation (ORE) to determine if the programs, procedures, and management systems implemented for operation of the 241-A Evaporator ensure the protection of worker safety and health. The following section of this report provides background information on the 242-A Evaporator and Operational Readiness Review (ORR) activities conducted to date. The next chapter is divided into sections that address the results of discrete assessment activities. Each section includes a brief statement of conclusions for the functional area in question, descriptions of the review bases and methods, and a detailed discussion of the results. Concerns identified during the assessment are listed for the section to which they apply, and the specific findings upon which the concern is based can be found immediately thereafter.

  19. 242-A campaign 95-1 post run document

    International Nuclear Information System (INIS)

    The 242-A Evaporator Campaign 95-1 was started on June 6, 1995 and finished July 27, 1995. An overall Waste Volume Reduction (WVR) of 8.18 million liters (2.16 mGAL OR 87.6% WVRF) was achieved from 9.35 million liters (2.47 Mgal) of processable waste contained in 108-AP, 107-AP, 106-AW and 102-AW. Slurry generated from Campaign 95-1 consisted of 1.05 million liters (278,000 gal) of dilute double-shell slurry feed (DDSSF) with a SpG of approximately 1.34. Total process condensate discharged to LERF was 10.3 million liters (2.72 Mgal), achieving a condensate/WVR efficiency ratio of 1.26. Total throughout for Campaign 95-1 was 18.1 million liters (4.79 Mgal). B Pond discharges from steam condensate and cooling water were 15.8 and 583 million liters (4.17 and 154 Mgal) respectively. Based on 145 hours of unplanned downtime, the 242-A Evaporator maintained an operating efficiency of 86% during the 49 day campaign

  20. Restart oversight assessment of Hanford 242-A evaporator: Technical report

    International Nuclear Information System (INIS)

    An assessment team from the Office of Environment, Safety and Health (EH), US Department of Energy (DOE), conducted an independent assessment of the 242-A Evaporator at the Hanford Site during January 17--28, 1994. An EH team member remained on-site following the assessment to track corrective actions and resolve prestart findings. The primary objective of this assessment was independent assurance that the DOE Office of Environmental Management (EM), the DOE Richland Operations Office (DOE-RL), and Westinghouse Hanford Company (WHC) can safely restart the evaporator. Another objective of the EH team was to assess EM's Operational Readiness Evaluation (ORE) to determine if the programs, procedures, and management systems implemented for operation of the 241-A Evaporator ensure the protection of worker safety and health. The following section of this report provides background information on the 242-A Evaporator and Operational Readiness Review (ORR) activities conducted to date. The next chapter is divided into sections that address the results of discrete assessment activities. Each section includes a brief statement of conclusions for the functional area in question, descriptions of the review bases and methods, and a detailed discussion of the results. Concerns identified during the assessment are listed for the section to which they apply, and the specific findings upon which the concern is based can be found immediately thereafter

  1. 242-A MCS Logic Acceptance Test Report for Year 2000 Upgrade

    International Nuclear Information System (INIS)

    242-A Evaporator distributive control system upgrade to D/3 version 9.0-2 for year 2000 compliance. Testing was performed per test procedure HNF-3568. There were no unresolved exceptions. The system responded correctly to all testing and meets the requirements to operate the 242-A This report documents the acceptance test results for the Evaporator facility

  2. Organic emission calculations for the 242-A evaporator vessel vent system

    International Nuclear Information System (INIS)

    This document contains historical calculations originally published in the 242-A Evaporator Dangerous Waste Permit Application, DOE/RL-90-42, Rev 0. They are being released as a supporting document, along with brief explanatory information, to be used as a reference in Rev 1 of the permit application and in other supporting documents, such as the 242-A Evaporator Data Quality Objectives

  3. 48 CFR 252.242-7004 - Material management and accounting system.

    Science.gov (United States)

    2010-10-01

    ... CLAUSES Text of Provisions And Clauses 252.242-7004 Material management and accounting system. As prescribed in 242.7204, use the following caluse: Material Management and Accounting System (JUL 2009) (a) Definitions. As used in this clause— (1) Material management and accounting system (MMAS) means the...

  4. 48 CFR 242.1403 - Shipping documents covering f.o.b. origin shipments.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Shipping documents... SERVICES Traffic and Transportation Management 242.1403 Shipping documents covering f.o.b. origin shipments....242-7003, Application for U.S. Government Shipping Documentation/Instructions. (ii) The...

  5. 24 CFR 242.81 - Lead-based paint poisoning prevention.

    Science.gov (United States)

    2010-04-01

    ... prevention. Requirements set forth in 24 CFR part 35 apply to this program. ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Lead-based paint poisoning prevention. 242.81 Section 242.81 Housing and Urban Development Regulations Relating to Housing and...

  6. Organic emission calculations for the 242-A evaporator vessel vent system

    Energy Technology Data Exchange (ETDEWEB)

    Bowman, M.R.

    1996-06-20

    This document contains historical calculations originally published in the 242-A Evaporator Dangerous Waste Permit Application, DOE/RL-90-42, Rev 0. They are being released as a supporting document, along with brief explanatory information, to be used as a reference in Rev 1 of the permit application and in other supporting documents, such as the 242-A Evaporator Data Quality Objectives.

  7. 20 CFR 404.242 - Use of old-start primary insurance amount as guaranteed alternative.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Use of old-start primary insurance amount as guaranteed alternative. 404.242 Section 404.242 Employees' Benefits SOCIAL SECURITY ADMINISTRATION FEDERAL OLD-AGE, SURVIVORS AND DISABILITY INSURANCE (1950- ) Computing Primary Insurance Amounts...

  8. Consistent Data Assimilation of Isotopes: 242Pu and 105Pd

    Energy Technology Data Exchange (ETDEWEB)

    G. Palmiotti; H. Hiruta; M. Salvatores

    2012-09-01

    In this annual report we illustrate the methodology of the consistent data assimilation that allows to use the information coming from integral experiments for improving the basic nuclear parameters used in cross section evaluation. A series of integral experiments are analyzed using the EMPIRE evaluated files for 242Pu and 105Pd. In particular irradiation experiments (PROFIL-1 and -2, TRAPU-1, -2 and -3) provide information about capture cross sections, and a critical configuration, COSMO, where fission spectral indexes were measured, provides information about fission cross section. The observed discrepancies between calculated and experimental results are used in conjunction with the computed sensitivity coefficients and covariance matrix for nuclear parameters in a consistent data assimilation. The results obtained by the consistent data assimilation indicate that not so large modifications on some key identified nuclear parameters allow to obtain reasonable C/E. However, for some parameters such variations are outside the range of 1 s of their initial standard deviation. This can indicate a possible conflict between differential measurements (used to calculate the initial standard deviations) and the integral measurements used in the statistical data adjustment. Moreover, an inconsistency between the C/E of two sets of irradiation experiments (PROFIL and TRAPU) is observed for 242Pu. This is the end of this project funded by the Nuclear Physics Program of the DOE Office of Science. We can indicate that a proof of principle has been demonstrated for a few isotopes for this innovative methodology. However, we are still far from having explored all the possibilities and made this methodology to be considered proved and robust. In particular many issues are worth further investigation: • Non-linear effects • Flexibility of nuclear parameters in describing cross sections • Multi-isotope consistent assimilation • Consistency between differential and integral

  9. 1998 interim 242-A Evaporator tank system integrity assessment report

    International Nuclear Information System (INIS)

    This Integrity Assessment Report (IAR) is prepared by Fluor Daniel Northwest (FDNW) under contract to Lockheed-Martin Hanford Company (LMHC) for Waste Management Hanford (WMH), the 242-A Evaporator (facility) operations contractor for Fluor Daniel Hanford, and the US Department of Energy, the system owner. The contract specifies that FDNW perform an interim (5 year) integrity assessment of the facility and prepare a written IAR in accordance with Washington Administrative Code (WAC) 173-303-640. The WAC 173-303 defines a treatment, storage, or disposal (TSD) facility tank system as the ''dangerous waste storage or treatment tank and its ancillary equipment and containment.'' This integrity assessment evaluates the two tank systems at the facility: the evaporator vessel, C-A-1 (also called the vapor-liquid separator), and the condensate collection tank, TK-C-100. This IAR evaluates the 242-A facility tank systems up to, but not including, the last valve or flanged connection inside the facility perimeter. The initial integrity assessment performed on the facility evaluated certain subsystems not directly in contact with dangerous waste, such as the steam condensate and used raw water subsystems, to provide technical information. These subsystems were not evaluated in this IAR. The last major upgrade to the facility was project B-534. The facility modifications, as a result of project B-534, were evaluated in the 1993 facility interim integrity assessment. Since that time, the following upgrades have occurred in the facility: installation of a process condensate recycle system, and installation of a package steam boiler to provide steam for the facility. The package boiler is not within the scope of the facility TSD

  10. 242Am/sup m/ fission cross section

    International Nuclear Information System (INIS)

    The neutron-induced fission cross section of 242Am/sup m/ has been measured over the energy region from 10-3 eV to approx.20 MeV in a series of experiments utilizing a linac-produced ''white'' neutron source and a monoenergetic source of 14.1 MeV neutrons. The cross section was measured relative to that of 235U in the thermal (0.001 to approx.3 eV) and high energy (1 keV to approx.20 MeV) regions and normalized to the ENDF/B-V 235U(n,f) evaluated cross section. In the resonance energy region (0.5 eV to 10 keV) the neutron flux was measured using thin lithium glass scintillators and the relative cross section thus obtained was normalized to the thermal energy measurement. This procedure allowed a consistency check between the thermal and high energy data. The cross section data have a statistical accuracy of approx.0.5% at thermal energies and in the 1-MeV energy region, and a systematic uncertainty of approx.5%. We confirmed that 242Am/sup m/ has the largest thermal fission cross section known with a 2200 m/sec value of 6328 b. Results of a Breit-Wigner sum-of-single-levels analysis of 48 fission resonances up to 20 eV are presented and the connection of these resonance properties to the large thermal cross section is discussed. Our measurements are compared with previously reported results

  11. 24 CFR 1000.242 - When does the requirement for exemption from taxation apply to affordable housing activities?

    Science.gov (United States)

    2010-04-01

    ... exemption from taxation apply to affordable housing activities? 1000.242 Section 1000.242 Housing and Urban... ACTIVITIES Indian Housing Plan (IHP) § 1000.242 When does the requirement for exemption from taxation apply to affordable housing activities? The requirement for exemption from taxation applies only to...

  12. 29 CFR 779.242 - Goods that “have been moved in” commerce.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 3 2010-07-01 2010-07-01 false Goods that âhave been moved inâ commerce. 779.242 Section... Commerce by Any Person § 779.242 Goods that “have been moved in” commerce. For the purpose of section 3(s), goods will be considered to “have been moved * * * in commerce” when they have moved across State...

  13. Comparative study of CA242 and CA19-9 in chronic pancreatitis.

    OpenAIRE

    Furuya, N; Kawa, S; Hasebe, O.; Tokoo, M.; Mukawa, K.; Maejima, S.; Oguchi, H.

    1996-01-01

    CA242 has been proved to be useful in the diagnosis of pancreatic cancer. The aim of the present study was to clarify the mechanisms contributing to the high specificity of CA242 as compared with CA19-9 resulting from scarce serum elevation of this antigen in patients with chronic pancreatitis by correlating serum levels and endoscopic retrograde choledocho-pancreatography (ERCP) findings and by immunohistochemical analysis. Serum CA19-9 levels were significantly elevated in patients with cal...

  14. Process control plan for 242-A Evaporator Campaign 94-2

    International Nuclear Information System (INIS)

    242-A Evaporator Campaign 94-2 will process approximately 3.42 million gallons of dilute waste from tanks 101-AP, 107-AP, 108AP, 102-AW, and 106-AW. The process control plant describes activities which will occur during Campaign 94-2. This document also addresses compliance with the tank farm waste compatibility program, the 242-A radiological source term, the criticality prevention specifications, and effluent discharge limits

  15. Quantitative molecular plating of large-area 242Pu targets with improved layer properties

    International Nuclear Information System (INIS)

    For measurements of the neutron-induced fission cross section of 242Pu, large-area (42 cm2) 242Pu targets were prepared on Ti-coated Si wafers by means of constant current density molecular plating. Radiochemical separations were performed prior to the platings. Quantitative deposition yields (>95%) were determined for all targets by means of alpha-particle spectroscopy. Layer densities in the range of 100–150 μg/cm2 were obtained. The homogeneity of the targets was studied by radiographic imaging. A comparative study between the quality of the layers produced on the Ti-coated Si wafers and the quality of layers grown on normal Ti foils was carried out by applying scanning electron microscopy and energy dispersive X-ray spectroscopy. Ti-coated Si wafers resulted clearly superior to Ti foils in the production of homogeneous 242Pu layers with minimum defectivity. - Highlights: • Large area (i.e., 42 cm2) 242Pu targets were prepared on Ti-coated Si wafers. • Quantitative deposition yields (>95%) were obtained. • Homogeneous 242Pu layers with minimum defectivity were produced. • The targets were prepared for future 242Pu(n, f) cross section measurements

  16. 242-A Campaign 94-1 post run document

    International Nuclear Information System (INIS)

    The purpose of this post-run document is to summarize the results of 242-A Evaporator Campaign 94-1 as required. Campaign 94-1 represents the first Evaporator operation since 1989, following completion of the B-534 upgrades and Liquid Effluent Retention Facility (LERF) construction. The purpose of Campaign 94-1 was to concentrate dilute waste from TK-102-AW, TK-106-AW, and TK-103-AP. From an available 2.87 million gallon feedstock of dilute waste contained in 102-AW, 106-AW and 103-AP, an overall Waste Volume Reduction (WVR) of 2.39 million gallons (83% WVRF) was achieved. At the completion of the campaign, approximately 477,000 gallons of dilute double-shell slurry feed (DDSSF) was produced with a SpG. of 1.25--1.30. Total process condensate discharged to LERF was 3.09 million gallons, achieving a condensate/WVR ratio of 1.29. Throughput for Campaign 94-1 was 5.27 million gallons. Total steam condensate and cooling water discharge to B-pond was 4.7 and 216 million gallons respectively. The evaporator operated approximately 43 days of the 60 day campaign for a total operating efficiency of 73%. Campaign 94-1 was completed without any discharge limit, Operating Specification Document, or Operational Safety Requirement violations. Major problems encountered during the run included the following: (1) high CA1 deentrainment pad dP's caused by foaming, (2) condensate pump P-C100 failure, and (3) ion exchange column dP's and efficiency

  17. CO observations of high-z radio galaxies MRC 2104-242 and MRC 0943-242: spectral-line performance of the Compact Array Broadband Backend

    CERN Document Server

    Emonts, B H C; Feain, I; Miley, G; Sadler, E M; Villar-Martin, M; Mao, M Y; Oosterloo, T A; Ekers, R D; Stevens, J B; Wieringa, M H; Coppin, K E K; Tadhunter, C N

    2011-01-01

    We present the first 7-millimetre observations of two high-redshift, Lya-bright radio galaxies (MRC 2104-242 and MRC 0943-242) performed with the 2 x 2 GHz instantaneous bandwidth of the Compact Array Broadband Backend (CABB) at the Australia Telescope Compact Array (ATCA). The aim was to search for 12CO(1-0) emission in these systems and test the millimetre capabilities of CABB for performing spectral line observations at high redshifts. We show that the stable band and enhanced velocity coverage of CABB, combined with hybrid array configurations, provide the ATCA with excellent 7-mm capabilities that allow reliable searches for the ground transition of CO at high redshifts. In this paper we explicitly discuss the calibration procedures used to reach our results. We set a firm upper limit to the mass of molecular gas in MRC 2104-242 (z = 2.5) of M(H2) < 2 x 10^10 (alpha_x/0.8) M_sun. For MRC 0943-242 (z=2.9) we derive an upper limit of M(H2) < 6 x 10^10 (alpha_x/0.8) M_sun. We also find a tentative 3-s...

  18. A molten Salt Am242M Production Reactor for Space Applications

    Science.gov (United States)

    Emrich, William

    2005-01-01

    The use of Am242m holds great promise for increasing the efficiency nuclear thermal rocket engines. Because Am242m has the highest fission cross section of any known isotope (1000's of barns), its extremely high reactivity may be used to directly heat a propellant gas with fission fragments. Since this isotope does not occur naturally, it must be bred in special production reactors designed for that purpose. The primary advantage to using molten salt reactors for breeding Am242m is that the reactors can be reprocessed continually yielding a constant rate of production of the isotope. Once built and initially fueled, the reactor will continually breed the additional fuel it needs to remain critical. The only feedstock required is a salt of U238. No enriched fuel is required during normal operation and all fissile material, except the Am242m, is maintained in a closed loop. For a reactor operating at 200 MW several kilograms of Am242m may be bred each year.

  19. Measurement of Neutron Induced and Spontaneous Fission in Pu-242 at DANCE

    Science.gov (United States)

    Chyzh, Andrii; Wu, C. Y.; Henderson, R.; Couture, A.; Lee, H. Y.; Ullmann, J.; O'Donnell, J. M.; Jandel, M.; Haight, R. C.; Bredeweg, T. A.; Dance Collaboration

    2013-10-01

    Neutron capture and fission reactions are important in nuclear engineering and physics. DANCE (Detector for Advanced Neutron Capture Measurement, LANL) combined with PPAC (avalanche technique based fission tagging detector, LLNL) were used to study neutron induced and spontaneous fission in 242Pu. 2 measurements were performed in 2013. The first experiment was done without the incident neutron beam with the fission tagging ability to study γ-rays emitted in the spontaneous fission of 242Pu. The second one - with the neutron beam to measure both the neutron capture and fission reactions. This is the first direct measurement of prompt fission γ-rays in 242Pu. The γ-ray multiplicity, γ-ray energy, and total energy of γ-rays per fission in 242Pu will be presented. These distributions of the 242Pu spontaneous fission will be compared to those in the 241Pu neutron induced fission. This work was performed under the auspices of the US Department of Energy by Los Alamos National Laboratory under Contract DE-AC52-06NA25396 and Lawrence Livermore National Laboratory under Contract DE-AC52-07NA27344.

  20. CA 242, a new tumour marker for pancreatic cancer: a comparison with CA 19-9, CA 50 and CEA.

    OpenAIRE

    Haglund, C.; Lundin, J; Kuusela, P.; Roberts, P. J.

    1994-01-01

    The serum expression of a novel tumour marker, CA 242, defined by monoclonal antibody C 242, was studied in 179 patients with pancreatic cancer. The results were compared with CA 19-9, CA 50 and CEA. CA 242 is a carbohydrate closely related, but not identical, to CA 19-9 and CA 50. The overall sensitivity of the CA 242 assay was 74%: 55% in stage I, 83% in stage II-III and 78% in stage IV disease. The specificity calculated from 112 patients with benign diseases was 91%. CA 19-9 had a higher ...

  1. Delisting strategy for the Hanford Site 242-A Evaporator PUREX Plant Condensate Treatment Facility

    International Nuclear Information System (INIS)

    This document describes the strategy that the US Department of Energy, Richland Field Office intends to use in preparing the delisting petition for the 242-A Evaporator/PUREX Plant Condensate Treatment Facility. Because the 242-A Evaporator/PUREX Plant Condensate Treatment Facility will not be operational until 1994, the delisting petition will be structured as an up-front petition based on the ''multiple waste treatment facility'' approach outline in the 1985 US Environmental Protection Agency's Petitions to Delist Hazardous Waste. The 242-A evaporator/PUREX Plant Condensate Treatment Facility effluent characterization data will not be available to support the delisting petition, because the delisting petition will be submitted to the US Environmental Protection Agency before start-up of the 242-A Evaporator/PUREX Plant Condensate Treatment Facility. Therefore, the delisting petition will be based on data collected during the pilot plant testing for the 242-A Evaporator/PUREX Plant Condensate Treatment Facility. This pilot plant testing will be conducted on synthetic waste. The composition of the synthetic waste will be based on: (1) constituents of regulatory concern, and (2) on process knowledge. The pilot plant testing will be performed to determine the removal efficiencies of the process equipment at concentrations greater than reasonably could be expected in the actual waste. This strategy document also describes the logic used to develop the synthetic waste, to develop the pilot plant testing program, and to prepare the delisting petition. This strategy document also described how full-scale operating data will be collected during initial operation of the 242-A Evaporator/PUREX Plant Condensate Treatment Facility to verify information presented in the delisting petition

  2. Independent Verification of Element 114 Production in the 48Ca+242Pu Reaction

    International Nuclear Information System (INIS)

    Independent verification of the production of element 114 in the reaction of 244-MeV 48Ca with 242Pu is presented. Two chains of time- and position-correlated decays have been assigned to 286114 and 287114. The observed decay modes, half-lives, and decay energies agree with published results. The measured cross sections at a center-of-target energy of 244 MeV for the 242Pu(48Ca,3-4n)287,286114 reactions were 1.4-1.2+3.2 pb each, which are lower than the reported values.

  3. The role of CA-242 and CEA in surveillance following curative resection for colorectal cancer.

    OpenAIRE

    Hall, N. R.; Finan, P. J.; Stephenson, B M; Purves, D. A.; Cooper, E H

    1994-01-01

    This study was undertaken to evaluate the role of a new tumour marker, CA-242, alone or in combination with CEA in the practical management of colorectal cancer patients after potentially curative resection. A cohort of 149 patients who had undergone 'curative' surgery was followed up according to an intensive protocol in order to detect recurrent disease. Over a median tumour marker follow-up period of 24 months there were 25 recurrences in 24 patients. Both CEA and CA-242 alone detected hal...

  4. 40 CFR 436.242 - Effluent limitations guidelines representing the degree of effluent reduction attainable by the...

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 29 2010-07-01 2010-07-01 false Effluent limitations guidelines... technology currently available. 436.242 Section 436.242 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS MINERAL MINING AND PROCESSING POINT SOURCE...

  5. 17 CFR 242.601 - Dissemination of transaction reports and last sale data with respect to transactions in NMS stocks.

    Science.gov (United States)

    2010-04-01

    ... reports and last sale data with respect to transactions in NMS stocks. 242.601 Section 242.601 Commodity..., AND NMS AND CUSTOMER MARGIN REQUIREMENTS FOR SECURITY FUTURES Regulation Nms-Regulation of the... transactions in NMS stocks. (a) Filing and effectiveness of transaction reporting plans. (1) Every...

  6. 40 CFR 408.242 - Effluent limitations guidelines representing the degree of effluent reduction attainable by the...

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 28 2010-07-01 2010-07-01 true Effluent limitations guidelines representing the degree of effluent reduction attainable by the application of the best practicable control technology currently available. 408.242 Section 408.242 Protection of Environment ENVIRONMENTAL...

  7. 27 CFR 24.242 - Authority to use greater quantities of decolorizing material in juice or wine.

    Science.gov (United States)

    2010-04-01

    ... quantities of decolorizing material in juice or wine. 24.242 Section 24.242 Alcohol, Tobacco Products and... juice or wine. (a) Proprietor's notice. If the proprietor desires to remove color from juice prior to... twenty-five pounds per 1,000 gallons (3.0 grams per liter) of juice or wine to remove this color,...

  8. Estimation of 242Cm neutron cross sections for total file creation

    International Nuclear Information System (INIS)

    Description of evaluation of 242Cm neutron cross sections in 10-5 eV-20 MeV energy range is given. Due to the lack of experimental data the evaluation is largely based on the application of theoretical models and systematics. The data obtained are compared to evaluations by other authors. 10 refs.; 2 figs.; 2 tabs

  9. 5 CFR 531.242 - Setting pay upon loss of GM status.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Setting pay upon loss of GM status. 531... PAY UNDER THE GENERAL SCHEDULE Determining Rate of Basic Pay Special Rules for Gm Employees § 531.242 Setting pay upon loss of GM status. (a) On loss of status as a GM employee under § 531.241 (except...

  10. Absolute measurement of the 242Pu neutron-capture cross section

    Science.gov (United States)

    Buckner, M. Q.; Wu, C. Y.; Henderson, R. A.; Bucher, B.; Chyzh, A.; Bredeweg, T. A.; Baramsai, B.; Couture, A.; Jandel, M.; Mosby, S.; O'Donnell, J. M.; Ullmann, J. L.; Dance Collaboration

    2016-04-01

    The absolute neutron-capture cross section of 242Pu was measured at the Los Alamos Neutron Science Center using the Detector for Advanced Neutron-Capture Experiments array along with a compact parallel-plate avalanche counter for fission-fragment detection. The first direct measurement of the 242Pu(n ,γ ) cross section was made over the incident neutron energy range from thermal to ≈6 keV, and the absolute scale of the (n ,γ ) cross section was set according to the known 239Pu(n ,f ) resonance at En ,R=7.83 eV. This was accomplished by adding a small quantity of 239Pu to the 242Pu sample. The relative scale of the cross section, with a range of four orders of magnitude, was determined for incident neutron energies from thermal to ≈40 keV. Our data, in general, are in agreement with previous measurements and those reported in ENDF/B-VII.1; the 242Pu(n ,γ ) cross section at the En ,R=2.68 eV resonance is within 2.4 % of the evaluated value. However, discrepancies exist at higher energies; our data are ≈30 % lower than the evaluated data at En≈1 keV and are approximately 2 σ away from the previous measurement at En≈20 keV.

  11. Highly accurate measurements of the spontaneous fission half-life of 240,242Pu

    Science.gov (United States)

    Salvador-Castiñeira, P.; Bryś, T.; Eykens, R.; Hambsch, F.-J.; Moens, A.; Oberstedt, S.; Sibbens, G.; Vanleeuw, D.; Vidali, M.; Pretel, C.

    2013-12-01

    Fast spectrum neutron-induced fission cross-section data for transuranic isotopes are of special demand from the nuclear data community. In particular highly accurate data are needed for the new generation IV nuclear applications. The aim is to obtain precise neutron-induced fission cross sections for 240Pu and 242Pu. To do so, accurate data on spontaneous fission half-lives must be available. Also, minimizing uncertainties in the detector efficiency is a key point. We studied both isotopes by means of a twin Frisch-grid ionization chamber with the goal of improving the present data on the neutron-induced fission cross section. For the two plutonium isotopes the high α-particle decay rates pose a particular problem to experiments due to piling-up events in the counting gas. Argon methane and methane were employed as counting gases, the latter showed considerable improvement in signal generation due to its higher drift velocity. The detection efficiency for both samples was determined, and improved spontaneous fission half-lives were obtained with very low statistical uncertainty (0.13% for 240Pu and 0.04% for 242Pu): for 240Pu, T1/2,SF=1.165×1011 yr (1.1%), and for 242Pu, T1/2,SF=6.74×1010 yr (1.3%). Systematic uncertainties are due to sample mass (0.4% for 240Pu and 0.9% for 242Pu) and efficiency (1%).

  12. Determination of the 242Pu Branching Ratio via Alpha-Gamma Coincidence

    Energy Technology Data Exchange (ETDEWEB)

    Wang, T F

    2012-05-24

    When the burn-up is high, the {sup 242}Pu isotopic content becomes more important. The traditional correlation method will fail. The {sup 242}Pu isotopic content in the sample plays an essential role if the neutron coincidence method is used to quantify the total amount of plutonium. In one of the earlier measurements we had a chance to measure an isotopic pure (> 99.95 %) {sup 242}Pu thick sample and realized that the difference in the branching ratio (BR) value among current nuclear data3) for the two important gamma-rays at 103.5-keV and 158.8-keV. In this study, the thick sample was counted on a 15% ORTEC safeguards type HPGe to further improve BR determination of the 159-keV gamma-ray. Furthermore, we have made a thin {sup 242}Pu sample from the thick sample and performed alpha-gamma coincidence measurements. Our preliminary gamma-ray BR results are 4.37(6) E-4, 2.79(8) E-5, and 2.25(8) E-6 for 44.9-keV, 103.5-keV, and 158.9-keV, respectively.

  13. Reliable determination of 237Np in environmental solid samples using 242Pu as a potential tracer

    DEFF Research Database (Denmark)

    Qiao, Jixin; Hou, Xiaolin; Roos, Per;

    2011-01-01

    , thereby demonstrating the usefulness of 242Pu as a non-isotopic tracer for 237Np chemical yield monitoring. The on-column separation procedure fosters rapid analysis as required in emergency situations since each individual sample can be handled within 2.5h, and leads to a significant decrease in labor...

  14. Recommendations for the 242Pu content evaluation using a new algorithm

    International Nuclear Information System (INIS)

    Plutonium isotopic determination by gamma spectrometry is an important nondestructive assay (NDA) method widely used by laboratories, operators, and safeguards directorates. Significant improvements have been made in the last few years on plutonium gamma-ray analysis, which have led to a very low discrepancy between gamma measurement and mass spectrometry (≤ ±2%) for the detectable isotopes. This leads to the fact that one important source of error is now the 242Pu content evaluation using correlation with the other isotopes. Moreover, the 242Pu content on the total plutonium is not negligible for typical burnup (it can reach 8 to 10% for burnup of ∼40 GWd/tonne U). This means that a lack of knowledge on the 242Pu content evaluation will generate an important error on the total plutonium mass estimation. The correlation used by many codes (like MGA) is as follows: 242Pu = C240Pu/Pu239241Pu/239Pu. This correlation leads to an average difference between NDA evaluation and mass spectrometry of ∼20%

  15. Determination of the 242Pu Branching Ratio via Alpha-Gamma Coincidence

    International Nuclear Information System (INIS)

    When the burn-up is high, the 242Pu isotopic content becomes more important. The traditional correlation method will fail. The 242Pu isotopic content in the sample plays an essential role if the neutron coincidence method is used to quantify the total amount of plutonium. In one of the earlier measurements we had a chance to measure an isotopic pure (> 99.95 %) 242Pu thick sample and realized that the difference in the branching ratio (BR) value among current nuclear data3) for the two important gamma-rays at 103.5-keV and 158.8-keV. In this study, the thick sample was counted on a 15% ORTEC safeguards type HPGe to further improve BR determination of the 159-keV gamma-ray. Furthermore, we have made a thin 242Pu sample from the thick sample and performed alpha-gamma coincidence measurements. Our preliminary gamma-ray BR results are 4.37(6) E-4, 2.79(8) E-5, and 2.25(8) E-6 for 44.9-keV, 103.5-keV, and 158.9-keV, respectively.

  16. 36 CFR 242.25 - Subsistence taking of fish, wildlife, and shellfish: general regulations.

    Science.gov (United States)

    2010-07-01

    ... requests are received and/or are based on priorities as determined by 50 CFR 100.17 and 36 CFR 242.17... skull. Bait means any material excluding a scent lure that is placed to attract an animal by its sense... designed to surround fish and is set from and hauled to the beach. Bear means black bear, or brown...

  17. Prompt fission γ -ray spectrum characteristics from 240Pu(sf ) and 242Pu(sf )

    Science.gov (United States)

    Oberstedt, S.; Oberstedt, A.; Gatera, A.; Göök, A.; Hambsch, F.-J.; Moens, A.; Sibbens, G.; Vanleeuw, D.; Vidali, M.

    2016-05-01

    In this paper we present first results for prompt fission γ -ray spectra (PFGS) characteristics from the spontaneous fission (sf) of 240Pu and 242Pu. For 242Pu(sf ) we obtained, after proper unfolding of the detector response, an average energy per photon ɛ¯γ=(0.843 ±0.012 ) MeV, an average multiplicity M¯γ=(6.72 ±0.07 ) , and an average total γ -ray energy release per fission E¯γ ,tot = (5.66 ± 0.06) MeV. The 240Pu(sf ) emission spectrum was obtained by applying a so-called detector-response transformation function determined from the 242Pu spectrum measured in exactly the same geometry. The results are an average energy per photon ɛ¯γ=(0.80 ±0.07 ) MeV, the average multiplicity M¯γ = (8.2 ± 0.4), and an average total γ -ray energy release per fission E¯γ ,tot = (6.6 ± 0.5) MeV. The PFGS characteristics for 242Pu(sf ) are in very good agreement with those from thermal-neutron-induced fission on 241Pu and scales well with the corresponding prompt neutron multiplicity. Our results in the case of 240Pu(sf ), although drawn from a limited number of events, show a significantly enhanced average multiplicity and average total energy, but may be understood from a different fragment yield distribution in 240Pu(sf ) compared to that of 242Pu(sf ).

  18. Analytical services: 222-S characterization of 242-A Evaporator Slurry, Campaign 94-1. Addendum 1A

    International Nuclear Information System (INIS)

    During the 242-A Evaporator's 94-1 campaign, five process samples were collected from the slurry stream for waste characterization. The five samples were collected over a 36 day time span, respectively on May 4, May 9, May 16, May 23, and June 9, 1994. Sample collections were performed per the protocol described in 242-A Evaporator Waste Analysis Plan, WHC-SD-WM-EV-060, Rev. 3 and in 242-A Evaporator Quality Assurance Project Plan, WHC-SD-WM-QAPP-009, Rev. 0. Slurry waste was characterized chemically and radiochemically by the Westinghouse Hanford Company, 222-S Laboratory as directed

  19. Analytical services: 222-S characterization of 242-A Evaporator Slurry, Campaign 94-1. Addendum 1A

    Energy Technology Data Exchange (ETDEWEB)

    1994-09-13

    During the 242-A Evaporator`s 94-1 campaign, five process samples were collected from the slurry stream for waste characterization. The five samples were collected over a 36 day time span, respectively on May 4, May 9, May 16, May 23, and June 9, 1994. Sample collections were performed per the protocol described in 242-A Evaporator Waste Analysis Plan, WHC-SD-WM-EV-060, Rev. 3 and in 242-A Evaporator Quality Assurance Project Plan, WHC-SD-WM-QAPP-009, Rev. 0. Slurry waste was characterized chemically and radiochemically by the Westinghouse Hanford Company, 222-S Laboratory as directed.

  20. Measurement of the 240,242Pu Neutron-induced Fission Cross Sections

    Science.gov (United States)

    Salvador-Castiñeira, P.; Bevilacqua, R.; Bryś, T.; Hambsch, F.-J.; Oberstedt, S.; Pretel, C.; Vidali, M.

    The neutron-induced fission cross section of 240,242Pu has been measured at the Van de Graaff facility of the Institute for Reference Materials and Measurements (JRC-IRMM). A Twin-Frisch Grid Ionization Chamber (TFGIC) has been used in a back-to-back geometry with the secondary standards 237Np and 238U to normalize the cross section. The energy range measured is from 0.2 keV up to 3 MeV. Preliminary results show some discrepancies around 1 MeV for the 242Pu with the ENDF/B-VII.1 evaluation. The spontaneous fission half-life has been measured for both isotopes, too. Preliminary results show reasonable agreement with the recommended values.

  1. Measurement of the 240Am production cross section via proton irradiation of 242Pu

    International Nuclear Information System (INIS)

    A new nuclear reaction for the production of 240Am was experimentally investigated. Targets of 150-500 μg/cm2242Pu on 2 μm Ti were produced through molecular deposition. Five irradiations, in which 242Pu, natTi, and natNi targets were jointly activated with protons from the Lawrence Berkeley National Laboratory 88-Inch Cyclotron produced 240Am, 48V, and 57Ni, respectively. The radioactive decay of these nuclides was monitored using high-purity Ge gamma ray detectors in the weeks following irradiation. A maximum 242Pu(p, 3n)240Am nuclear reaction cross section was measured to be 45 ± 13 mb with 23 MeV protons. While this value is lower than theoretical predictions, it is high enough to be the most viable nuclear reaction for the large-scale production of 240Am. (orig.)

  2. New Superheavy Element Isotopes: 242Pu(48Ca,5n)285114

    International Nuclear Information System (INIS)

    The new, neutron-deficient, superheavy element isotope 285114 was produced in 48Ca irradiations of 242Pu targets at a center-of-target beam energy of 256 MeV (E*=50 MeV). The α decay of 285114 was followed by the sequential α decay of four daughter nuclides, 281Cn, 277Ds, 273Hs, and 269Sg. 265Rf was observed to decay by spontaneous fission. The measured α-decay Q values were compared with those from a macroscopic-microscopic nuclear mass model to give insight into superheavy element shell effects. The 242Pu(48Ca,5n)285114 cross section was 0.6-0.5+0.9 pb.

  3. Sequence and batch language programs and alarm related C Programs for the 242-A MCS

    Energy Technology Data Exchange (ETDEWEB)

    Berger, J.F.

    1996-04-15

    A Distributive Process Control system was purchased by Project B-534, 242-A Evaporator/Crystallizer Upgrades. This control system, called the Monitor and Control system (MCS), was installed in the 242-A evaporator located in the 200 East Area. The purpose of the MCS is to monitor and control the Evaporator and monitor a number of alarms and other signals from various Tank Farm facilities. Applications software for the MCS was developed by the Waste Treatment Systems Engineering (WTSE) group of Westinghouse. The standard displays and alarm scheme provide for control and monitoring, but do not directly indicate the signal location or depict the overall process. To do this, WTSE developed a second alarm scheme.

  4. Measurement of the 242Pu(n,f cross section at n_TOF

    Directory of Open Access Journals (Sweden)

    Tsinganis A.

    2014-03-01

    Full Text Available Knowledge of neutron cross sections of various plutonium isotopes and other minor actinides is crucial for the design of advanced nuclear systems. The 242Pu(n,f cross sections were measured at the CERN n_TOF facility, taking advantage of the wide energy range (from thermal to GeV and the high instantaneous flux of the neutron beam. In this work, preliminary results are presented along with a theoretical cross section calculation performed with the EMPIRE code.

  5. Material balance software for 242A Evaporator and tank farms. Revision 2

    International Nuclear Information System (INIS)

    This document presents the Material Balance Software System used by the operator to calculate a Material Balance during the operation of the 242A Evaporator and the transfer of material between primary tanks supporting the evaporation process. It describes intent and design of each program used within the software system and gives details into the algorithms and methods used to create each program. This document also presents program source file listings, data file formats and printed output format

  6. Clinical evaluation of a new serum tumour marker CA 242 in pancreatic carcinoma.

    OpenAIRE

    Pasanen, P. A.; Eskelinen, M.; Partanen, K.; Pikkarainen, P; Penttilä, I.; Alhava, E

    1992-01-01

    The aim of this study was to evaluate the new monoclonal tumour marker CA 242 in the diagnosis of pancreatic carcinoma and to compare it with the established markers CA 50 and CEA. Serum concentrations were determined in 113 patients with jaundice, in 20 patients with laboratory values suggesting cholestasis, and in 60 patients with a suspicion to have chronic pancreatitis. Twenty-four of these 193 patients had pancreatic carcinoma and two patients had carcinoma of papilla of Vater. The sensi...

  7. Total cross section of 242Pu between 0.7 and 170 MeV

    International Nuclear Information System (INIS)

    Various evaluations of the neutron cross sections of 242Pu lead to widely different predictions of bulk neutronics properties such as critical mass. These evaluations also show rather different behavior of the energy dependence of the total cross section. The total cross section of 242Pu from 0.7 to 170 MeV was measured to a statistical accuracy of = 0.5% below 6 MeV, using 8 g of high purity material and the WNR pulsed neutron facility. Recent evaluations by Madland and Young and by Lagrange and Jary are found to be reasonably consistent with the data obtained. Best agreement, however, is found by using a relationship between the total cross sections for 238U, 239Pu, and 235U. The remarkable accuracy of this description for 242Pu suggests that it could be extended to other deformed actinides for which inadequate amounts of material exist for direct measurements of sigma/sub T/ in the MeV region, as an evaluation constraint

  8. Neutron-induced Fission Cross Section of 240,242Pu

    Science.gov (United States)

    Salvador-Castiñeira, P.; Bryś, T.; Eykens, R.; Hambsch, F.-J.; Göök, A.; Oberstedt, S.; Pretel, C.; Sibbens, G.; Vanleeuw, D.; Vidali, M.

    A sensitivity analysis for the new generation of fast reactors [Salvatores (2008)] has shown the importance of improved cross section data for several actinides. Among them, the 240,242Pu(n,f) cross sections require an accuracy improvement to 1-3% and 3-5%, respectively, from the current level of 6% and 20%. At the Van de Graaff facility of the Institute for Reference Materials and Measurements (JRC-IRMM) the fission cross section of the two isotopes was measured relative to two secondary standard reactions, 237Np(n,f) and 238U(n,f), using a twin Frisch-grid ionization chamber. The secondary standard reactions were benchmarked through measurements against the primary standard reaction 235U(n,f) in the same geometry. Sample masses were determined by means of low-geometry alpha counting or/and a 2π Frisch-grid ionization chamber, with an uncertainty lower than 2%. The neutron flux and the impact of scattering from material between source and target was examined, the largest effect having been found in cross section ratio measurements between a fissile and a fertile isotope. Our 240,242Pu(n,f) cross sections are in agreement with previous experimental results and slightly lower than present evaluations. In case of the 242Pu(n,f) reaction no evidence for a resonance at En=1.1 MeV was found.

  9. Project C-018H, 242-A Evaporator/PUREX Plant Process Condensate Treatment Facility, functional design criteria. Revision 3

    International Nuclear Information System (INIS)

    This document provides the Functional Design Criteria (FDC) for Project C-018H, the 242-A Evaporator and Plutonium-Uranium Extraction (PUREX) Plant Condensate Treatment Facility (Also referred to as the 200 Area Effluent Treatment Facility [ETF]). The project will provide the facilities to treat and dispose of the 242-A Evaporator process condensate (PC), the Plutonium-Uranium Extraction (PUREX) Plant process condensate (PDD), and the PUREX Plant ammonia scrubber distillate (ASD)

  10. Project C-018H, 242-A Evaporator/PUREX Plant Process Condensate Treatment Facility, functional design criteria. Revision 3

    Energy Technology Data Exchange (ETDEWEB)

    Sullivan, N.

    1995-05-02

    This document provides the Functional Design Criteria (FDC) for Project C-018H, the 242-A Evaporator and Plutonium-Uranium Extraction (PUREX) Plant Condensate Treatment Facility (Also referred to as the 200 Area Effluent Treatment Facility [ETF]). The project will provide the facilities to treat and dispose of the 242-A Evaporator process condensate (PC), the Plutonium-Uranium Extraction (PUREX) Plant process condensate (PDD), and the PUREX Plant ammonia scrubber distillate (ASD).

  11. Functional design criteria for the 242-A evaporator and PUREX [Plutonium-Uranium Extraction] Plant condensate interim retention basin

    International Nuclear Information System (INIS)

    This document contains the functional design criteria for a 26- million-gallon retention basin and 10 million gallons of temporary storage tanks. The basin and tanks will be used to store 242-A Evaporator process condensate, the Plutonium-Uranium Extraction (PUREX) Plant process distillate discharge stream, and the PUREX Plant ammonia scrubber distillate stream. Completion of the project will allow both the 242-A Evaporator and the PUREX Plant to restart. 4 refs

  12. 242-A Evaporator/Liquid Effluent Retention Facility data quality objectives

    International Nuclear Information System (INIS)

    The purpose of data quality objectives (DQO) is to determine the most cost effective methods of gathering the essential data necessary to make decisions to support successful operation of the facility. The essential data is defined by such information as sample amount, sample location, required analyses, and how sampling and analyses are performed. Successful operation is defined as meeting the campaign objectives while operating within established requirements. This DQO document addresses that portion of the system from 242-A Evaporator candidate feed tanks through discharge of process condensate to the Liquid Effluent Retention of Facility (LERF). Later revisions will incorporate and integrate the entire system, including the Effluent Treatment Facility (ETF)

  13. The evaluation of the mass distribution data for 238U, 239Pu and 242Pu fission

    International Nuclear Information System (INIS)

    The mass distribution data for 238U at En=1.5, 5.5, 8.3, 11.3, 14.9, 22.0, 27.5, 50.0, 99.5, 160.0 MeV, Ep=20.0, 60.0 MeV 239Pu at En=0.17, 7.9, 14.5 MeV and 242Pu at En=15.1 MeV were evaluated and recommended based on the main available experimental data up to now. The experimental data were make necessary corrections and their errors were also made necessary adjustments. The problems concerned were discussed

  14. Highly accurate measurements of the spontaneous fission half-life of 240,242Pu

    OpenAIRE

    SALVADOR CASTINEIRA PAULA; BRYS TOMASZ; EYKENS ROGER; Hambsch, Franz-Josef; MOENS Andre; Oberstedt, Stephan; SIBBENS Goedele; VANLEEUW DAVID; Vidali, Marzio; Pretel, C.

    2013-01-01

    Fast spectrum neutron-induced fission cross-section data for transuranic isotopes are of special demand from the nuclear data community. In particular highly accurate data are needed for the new generation IV nuclear applications. The aim is to obtain precise neutron-induced fission cross sections for 240Pu and 242Pu. To do so, accurate data on spontaneous fission half-lives must be available. Also, minimizing uncertainties in the detector efficiency is a key point. We studied both isotopes b...

  15. Neutron-induced fission cross section of 240,242Pu

    OpenAIRE

    Salvador Castiñeira, Paula

    2014-01-01

    A recent sensitivity analysis done for the new generation of fast reactors [1] has shown the importance of improved cross section data for several actinides. Among them, the neutron-induced fission cross section of 240,242Pu requires a level of accuracy of 1-3% and 3-5%, respectively, from the current status of 6% and 20%. Moreover, nearly all the measurements in the literature have been done relative to 235U(n,f). Therefore, using other references samples such as 237Np or 238U will provide t...

  16. 242-A Evaporator/Liquid Effluent Retention Facility data quality objectives

    Energy Technology Data Exchange (ETDEWEB)

    Von Bargen, B.H.

    1994-09-29

    The purpose of data quality objectives (DQO) is to determine the most cost effective methods of gathering the essential data necessary to make decisions to support successful operation of the facility. The essential data is defined by such information as sample amount, sample location, required analyses, and how sampling and analyses are performed. Successful operation is defined as meeting the campaign objectives while operating within established requirements. This DQO document addresses that portion of the system from 242-A Evaporator candidate feed tanks through discharge of process condensate to the Liquid Effluent Retention of Facility (LERF). Later revisions will incorporate and integrate the entire system, including the Effluent Treatment Facility (ETF).

  17. Tissue expression of the tumour associated antigen CA242 in benign and malignant pancreatic lesions. A comparison with CA 50 and CA 19-9.

    OpenAIRE

    Haglund, C.; Lindgren, J.; Roberts, P. J.; Kuusela, P.; Nordling, S.

    1989-01-01

    The expression of a novel tumour associated antigen CA 242, defined by the monoclonal antibody C 242, was studied by immunoperoxidase staining in formalin-fixed, paraffin-embedded tissue sections from normal pancreata, pancreata with pancreatitis and benign and malignant pancreatic neoplasms. The antigenic determinant of the C 242 antibody is a sialylated carbohydrate structure, related but chemically different from tumour marker antigens CA 19-9 and CA 50. Thirty-eight of 41 (93%) well to mo...

  18. Combined detection of preoperative serum CEA, CA19-9 and CA242 improve prognostic prediction of surgically treated colorectal cancer patients

    OpenAIRE

    Wang, Jingtao; Xiao WANG; Yu, Fudong; Chen, Jian; Zhao, Senlin; Zhang, Dongyuan; YU, Yang; Liu, Xisheng; Tang, Huamei; Peng, Zhihai

    2015-01-01

    We assessed the prognostic significance of preoperative serum carcinoembryonic antigen (CEA), carbohydrate antigen 19-9 (CA19-9) and carbohydrate antigen 242 (CA242) levels in surgically treated colorectal cancer patients. The relationship of preoperative serum CEA, CA19-9 and CA242 levels with disease characteristics was investigated in 310 patients. Correlation between tumor markers was investigated using Pearson correlation test. Univariate and multivariate survival analyses were used to s...

  19. Measurement of the neutron-induced fission cross sections of /sup 242/Cm and /sup 238/Pu

    International Nuclear Information System (INIS)

    The neutron-induced fission cross sections of /sup 242/Cm and /sup 238/Pu have been measured from 0.1 eV to 100 keV using the Rensselaer Intense Neutron Spectrometer. Fission areas and widths were determined for several resolved low-energy resonances of /sup 242/Cm and /sup 238/Pu. The fission resonance integrals for /sup 242/Cm and /sup 238/Pu were found to be 12.9 +- 0.7 and 15.9 +- 0.6 b, respectively. The gross structure observed in the unresolved energy region of the /sup 242/Cm and /sup 238/Pu fission cross sections is suggestive of intermediate structure, and is consistent with the second well lying 2 to 3 MeV above the first well. The ENDF/B-V library fission cross section of /sup 238/Pu is, in general, not in good agreement with this measurement and a new evaluation is recommended. This is the first reported fission measurement of /sup 242/Cm in the 0.1-eV through 100-keV energy range

  20. Sensitivity and specificity of CA242 in gastro-intestinal cancer. A comparison with CEA, CA50 and CA 19-9.

    OpenAIRE

    Nilsson, O; Johansson, C.; Glimelius, B.; Persson, B.; Nørgaard-Pedersen, B.; Andrén-Sandberg, A.; Lindholm, L.

    1992-01-01

    A serological assay for the quantitative determination of the novel tumour-associated epitope CA242 was developed and used for determination of sensitivity and specificity of CA242 in gastrointestinal cancer. The CA242 assay showed a better tumour specificity than CA50 (and CA 19-9). This was most noticeable in benign hepatobiliary disease. The sensitivity at 90% specificity cut-off level was approximately three times higher for CA242 compared to CA50 in colo-rectal cancer Dukes A, B and C, w...

  1. Process control plan for 242-A Evaporator Campaign 95-1

    International Nuclear Information System (INIS)

    The wastes from tanks 106-AP, 107-AP, and 106-AW have been selected to be candidate feed wastes for Evaporator Campaign 95-1. The wastes in tank 106-AP and 107-AP are primarily from B-Plant strontium processing and PUREX neutralized cladding removal, respectively. The waste in tank 106-AW originated primarily from the partially concentrated product from 242-A Evaporator Campaign 94-2. Approximately 8.67 million liters of waste from these tanks will be transferred to tank 102-AW during the campaign. Tank 102-AW is the dedicated waste feed tank for the evaporator and currently contains 647,000 liters of processable waste. The purpose of the 242-A Evaporator Campaign 95-1 Process Control Plan (hereafter referred to as PCP) is to certify that the wastes in tanks 106-AP, 107-AP, 102-AW, and 106-AW are acceptable for processing through evaporator and provide a general description of process strategies and activities which will take place during Campaign 95-1. The PCP also summarizes and presents a comprehensive characterization of the wastes in these tanks

  2. Direct Detection of Pu-242 with a Metallic Magnetic Calorimeter Gamma-Ray Detector

    Science.gov (United States)

    Bates, C.; Pies, C.; Kempf, S.; Hengstler, D.; Fleischmann, A.; Gastaldo, L.; Enss, C.; Friedrich, S.

    2016-07-01

    Cryogenic high-resolution γ -ray detectors can improve the accuracy of non-destructive assay (NDA) of nuclear materials in cases where conventional high-purity germanium detectors are limited by line overlap or by the Compton background. We have improved the performance of gamma detectors based on metallic magnetic calorimeters (MMCs) by separating the 0.5 × 2 × 0.25 mm3 Au absorber from the Au:Er sensor with sixteen 30-\\upmu m-diameter Au posts. This ensures that the entire γ -ray energy thermalizes in the absorber before heating the Au:Er sensor, and improves the energy resolution at 35 mK to as low as 90 eV FWHM at 60 keV. This energy resolution enables the direct detection of γ -rays from Pu-242, an isotope that cannot be measured by traditional NDA and whose concentration is therefore inferred through correlations with other Pu isotopes. The Pu-242 concentration of 11.11 ± 0.42 % measured by NDA with MMCs agrees with mass spectrometry results and exceeds the accuracy of correlation measurements.

  3. Process control plan for 242-A Evaporator Campaign 95-1

    Energy Technology Data Exchange (ETDEWEB)

    Le, E.Q.; Guthrie, M.D.

    1995-05-18

    The wastes from tanks 106-AP, 107-AP, and 106-AW have been selected to be candidate feed wastes for Evaporator Campaign 95-1. The wastes in tank 106-AP and 107-AP are primarily from B-Plant strontium processing and PUREX neutralized cladding removal, respectively. The waste in tank 106-AW originated primarily from the partially concentrated product from 242-A Evaporator Campaign 94-2. Approximately 8.67 million liters of waste from these tanks will be transferred to tank 102-AW during the campaign. Tank 102-AW is the dedicated waste feed tank for the evaporator and currently contains 647,000 liters of processable waste. The purpose of the 242-A Evaporator Campaign 95-1 Process Control Plan (hereafter referred to as PCP) is to certify that the wastes in tanks 106-AP, 107-AP, 102-AW, and 106-AW are acceptable for processing through evaporator and provide a general description of process strategies and activities which will take place during Campaign 95-1. The PCP also summarizes and presents a comprehensive characterization of the wastes in these tanks.

  4. Herança da resistência à antracnose na cultivar de feijoeiro comum Cornell 49-242 Inheritance of resistance to anthracnose in the common bean cultivar Cornell 49-242

    OpenAIRE

    Ana Lilia A. Marin; Márcia Regina Costa; Henrique Menarim; MAURILIO A. MOREIRA; Everaldo G. de Barros

    2003-01-01

    A cultivar de feijoeiro (Phaseolus vulgaris) Cornell 49-242, possuidora do gene de resistência Co-2 (Are), é uma das mais antigas fontes de resistência à antracnose, causada por Colletotrichum lindemuthianum. Visando a utilização desta fonte no programa de piramidação de genes em cultivares do tipo "carioca" do BIOAGRO/UFV, este trabalho teve como objetivos: (1) definir o padrão de herança da resistência da cultivar de feijoeiro Cornell 49-242 em cruzamentos com cultivares suscetíveis às raça...

  5. Tumour associated antigen CA-50, CA-242 immunoradiometric assay (IRMA) in genitourinary malignancy and gastrointestinal carcinoma early diagnosis

    International Nuclear Information System (INIS)

    Tumour markers CA-50 and CA-242 were measured by immunometric assay (IRMA) to investigate their usefulness in the diagnosis of cancer of the pancreas, biliary tract, liver, breast, lung, gastrointestinal and genitourinary systems. The cutoff points, derived from studies on normal subjects and those with proven benign disease, were 20 u/ml and 12 u/ml for CA-50 and CA-242 respectively. Both markers were found to be generally useful with significant differences between malignant and non malignant disease. The highest positive rates, were found in cancers of the pancreas and gall bladder. The overall rate of false positives was low. It is concluded that measurements of CA-50 and CA-242 are useful in the detection of malignancy, particularly of the pancreas and biliary tract. 2 figs, 2 tabs

  6. Comparison of size modulation and conventional standard automated perimetry with the 24-2 test protocol in glaucoma patients

    OpenAIRE

    Hirasawa, Kazunori; Shoji, Nobuyuki; Kasahara, Masayuki; Matsumura, Kazuhiro; Shimizu, Kimiya

    2016-01-01

    This prospective randomized study compared test results of size modulation standard automated perimetry (SM-SAP) performed with the Octopus 600 and conventional SAP (C-SAP) performed with the Humphrey Field Analyzer (HFA) in glaucoma patients. Eighty-eight eyes of 88 glaucoma patients underwent SM-SAP and C-SAP tests with the Octopus 600 24-2 Dynamic and HFA 24-2 SITA-Standard, respectively. Fovea threshold, mean defect, and square loss variance of SM-SAP were significantly correlated with th...

  7. Neutron-induced fission cross section of 240,242Pu up to En = 3 MeV

    OpenAIRE

    SALVADOR CASTINEIRA PAULA; BRYS TOMASZ; Hambsch, Franz-Josef; Oberstedt, Stephan; Pretel, C.; Vidali, Marzio

    2014-01-01

    The neutron-induced fission cross sections of 240,242Pu have been measured at JRC-IRMM with incident neutron energy from 0.2 MeV up to 3 MeV. A Twin-Frisch Grid Ionization Chamber (TFGIC) has been used in a back-to-back geometry. The measurements have been performed using the secondary standards 237Np and 238U as a reference. The purity of the plutonium samples was 99.89% for 240Pu and 99.97% for 242Pu. The results obtained follow the ENDF/B-VII.1 evaluation for 240Pu, but some discrepancies ...

  8. THE FLAMMABILITY ANALYSIS AND TIME TO REACH LOWER FLAMMABILITY LIMIT CALCULATIONS ON THE WASTE EVAPORATION AT 242-A EVAPORATOR

    Energy Technology Data Exchange (ETDEWEB)

    HU TA

    2007-10-31

    This document describes the analysis of the waste evaporation process on the flammability behavior. The evaluation calculates the gas generation rate, time to reach 25% and 100% of the lower flammability limit (LFL), and minimum ventilation rates for the 242-A Evaporator facility during the normal evaporation process and when vacuum is lost. This analysis performs flammability calculations on the waste currently within all 28 double-shell tanks (DST) under various evaporation process conditions to provide a wide spectrum of possible flammable gas behavior. The results of this analysis are used to support flammable gas control decisions and support and upgrade to Documented Safety Analysis for the 242-A Evaporator.

  9. Tumor markers CA19-9, CA242 and CEA in the diagnosis of pancreatic cancer: a meta-analysis

    OpenAIRE

    Zhang, Yimin; Yang, Jun; Li, Hongjuan; WU, YIHUA; Zhang, Honghe; Chen, Wenhu

    2015-01-01

    Background: Pancreatic cancer has the worst prognosis and early detection is crucial for improving patient prognosis. Therefore, we performed a meta-analysis to evaluate and compare the sensitivity and specificity of single test of CA19-9, CA242, and CEA, as well as combination test in pancreatic cancer detection. Methods: We searched PubMed, Embase, Medline, and Wanfang databases for studies that evaluated the diagnostic validity of CA19-9, CA242, and CEA between January 1990 and September 2...

  10. Comparison of size modulation and conventional standard automated perimetry with the 24-2 test protocol in glaucoma patients

    Science.gov (United States)

    Hirasawa, Kazunori; Shoji, Nobuyuki; Kasahara, Masayuki; Matsumura, Kazuhiro; Shimizu, Kimiya

    2016-01-01

    This prospective randomized study compared test results of size modulation standard automated perimetry (SM-SAP) performed with the Octopus 600 and conventional SAP (C-SAP) performed with the Humphrey Field Analyzer (HFA) in glaucoma patients. Eighty-eight eyes of 88 glaucoma patients underwent SM-SAP and C-SAP tests with the Octopus 600 24-2 Dynamic and HFA 24-2 SITA-Standard, respectively. Fovea threshold, mean defect, and square loss variance of SM-SAP were significantly correlated with the corresponding C-SAP indices (P testing modalities were well correlated. PMID:27149561

  11. Measurement of the $^{240,242}$Pu(n,f) cross section at the CERN n_TOF facility

    CERN Document Server

    Tsinganis, A; Guerrero, C; Colonna, N; Calviani, M; Vlastou, R; Andriamonje, S; Vlachoudis, V; Gunsing, F; Massimi, C; Altstadt, S; Andrzejewski, J; Audouin, L; Barbagallo, M; Bécares, V; Becvár, F; Belloni, F; Billowes, J; Boccone, V; Bosnar, D; Brugger, M; Calviño, F; Cano-Ott, D; Carrapiço, C; Cerutti, F; Chin, M; Cortés, G; Cortés-Giraldo, M A; Diakaki, M; Domingo-Pardo, C; Duran, I; Dressler, R; Dzysiuk, N; Eleftheriadis, C; Ferrari, A; Fraval, K; Ganesan, S; García, A R; Giubrone, G; Gómez-Hornillos, M B; Gonçalves, I F; González-Romero, E; Griesmayer, E; Gurusamy, P; Hernández-Prieto, A; Jenkins, D G; Jericha, E; Kadi, Y; Käppeler, F; Karadimos, D; Kivel, N; Koehler, P; Kokkoris, M; Krtiˇcka, M; Kroll, J; Lampoudis, C; Langer, C; Leal-Cidoncha, E; Lederer, C; Leeb, H; Leong, L S; Losito, R; Mallick, A; Manousos, A; Marganiec, J; Martínez, T; Mastinu, P F; Mastromarco, M; Meaze, M; Mendoza, E; Mengoni, A; Milazzo, P M; Mingrone, F; Mirea, M; Mondalaers, W; Paradela, C; Pavlik, A; Perkowski, J; Plompen, A; Praena, J; Quesada, J M; Rauscher, T; Reifarth, R; Riego, A; Robles, M S; Roman, F; Rubbia, C; Sabaté-Gilarte, M; Sarmento, R; Saxena, A; Schillebeeckx, P; Schmidt, S; Schumann, D; Tagliente, G; Tain, J L; Tarrío, D; Tassan-Got, L; Valenta, S; Vannini, G; Variale, V; Vaz, P; Ventura, A; Versaci, R; Vermeulen, M J; Wallner, A; Ware, T; Weigand, M; Weiss, C; Wright, T; Zugec, P

    2014-01-01

    Knowledge of neutron cross sections of various plutonium isotopes and other minor actinides is crucial for the design of advanced nuclear systems. The $^{240 , 242}$Pu(n,f) cross sections were measured at the CERN n_TOF facility, taking advantage of the wide energy range (from thermal to GeV) and the high instantaneous f ux of the neutron beam. In this work, preliminary results for $^{242}$Pu are presented along with a theoretical cross section calculation performed with the EMPIRE code.

  12. 17q24.2 microdeletions: a new syndromal entity with intellectual disability, truncal obesity, mood swings and hallucinations

    OpenAIRE

    Vergult, Sarah; Dauber, Andrew; Chiaie, Barbara Delle; Van Oudenhove, Elke; Simon, Marleen; Rihani, Ali; Loeys, Bart; Hirschhorn, Joel; Pfotenhauer, Jean; Phillips, John A.; Mohammed, Shehla; Ogilvie, Caroline; Crolla, John; Mortier, Geert; Menten, Björn

    2011-01-01

    Although microdeletions of the long arm of chromosome 17 are being reported with increasing frequency, deletions of chromosome band 17q24.2 are rare. Here we report four patients with a microdeletion encompassing chromosome band 17q24.2 with a smallest region of overlap of 713 kb containing five Refseq genes and one miRNA. The patients share the phenotypic characteristics, such as intellectual disability (4/4), speech delay (4/4), truncal obesity (4/4), seizures (2/4), hearing loss (3/4) and ...

  13. MR imaging of musculoskeletal tumors and tumor mimickers with intravenous gadolinium: experience with 242 patients

    International Nuclear Information System (INIS)

    Purpose. This pictorial essay reviews our experience with MR scans with gadolinium in patients with musculoskeletal tumors and tumor mimickers. Design. Review of 242 MR scans obtained in the initial evaluation of a possible primary musculoskeletal neoplasm. All scans included a T1-weighted, fat-suppressed sequence following intravenous administration of gadolinium. Results. MR scans with gadolinium did not contribute to differential diagnosis or patient management in 89% of the patients in this series. However, intravenous gadolinium did assist in guiding the biopsy of bulky lesions and evaluating treated tumor beds for possible recurrence. MR scans with gadolinium were sometimes helpful when the differential diagnosis included synovitis, Morton's neuroma or intramuscular myxoma, and when it was important to differentiate cystic from solid lesions. Conclusions. Routine use of gadolinium in every initial MR examination of a possible musculoskeletal mass is not warranted. However, there are appropriate selected indications for gadolinium administration as outlined above. (orig.). With 19 figs., 1 tab

  14. Study of 242‑248Cm isotopes in the projected shell model framework

    Science.gov (United States)

    Sadiq, Saiqa; Devi, Rani; Khosa, S. K.

    2016-04-01

    The projected shell model framework is employed to study the band spectra in 242‑248Cm isotopes. The present calculations reproduce the available experimental data on the yrast bands. Besides this, B(E2) transition probabilities of even-even Cm isotopes have also been calculated. The low spin states of yrast band are seen to arise purely from zero-quasi-particle (o-qp) intrinsic states whereas the high spin states have multi-quasi-particle structure. For the odd-neutron (odd-N) isotopes, the calculated results qualitatively reproduce the available data on ground and lowest excited state bands for 243,245Cm. However, for 247Cm the negative-parity ground state band is in reasonable agreement with the experimental data.

  15. MR imaging of musculoskeletal tumors and tumor mimickers with intravenous gadolinium: experience with 242 patients

    Energy Technology Data Exchange (ETDEWEB)

    May, D.A. [Department of Radiology, Wilford Hall USAF Medical Center, San Antonio, TX (United States)]|[WHMC/PSRD, Lackland AFB, TX (United States); Good, R.B. [Department of Radiology, Wilford Hall USAF Medical Center, San Antonio, TX (United States); Smith, D.K. [Department of Radiology, Wilford Hall USAF Medical Center, San Antonio, TX (United States); Parsons, T.W. [Department of Orthopaedic Surgery, Wilford Hall USAF Medical Center, San Antonio, TX (United States)

    1997-01-01

    Purpose. This pictorial essay reviews our experience with MR scans with gadolinium in patients with musculoskeletal tumors and tumor mimickers. Design. Review of 242 MR scans obtained in the initial evaluation of a possible primary musculoskeletal neoplasm. All scans included a T1-weighted, fat-suppressed sequence following intravenous administration of gadolinium. Results. MR scans with gadolinium did not contribute to differential diagnosis or patient management in 89% of the patients in this series. However, intravenous gadolinium did assist in guiding the biopsy of bulky lesions and evaluating treated tumor beds for possible recurrence. MR scans with gadolinium were sometimes helpful when the differential diagnosis included synovitis, Morton`s neuroma or intramuscular myxoma, and when it was important to differentiate cystic from solid lesions. Conclusions. Routine use of gadolinium in every initial MR examination of a possible musculoskeletal mass is not warranted. However, there are appropriate selected indications for gadolinium administration as outlined above. (orig.). With 19 figs., 1 tab.

  16. Measurement of the neutron-induced fission cross-section of 240,242Pu

    International Nuclear Information System (INIS)

    Fast spectrum neutron-induced fission cross-section data for transuranic isotopes are in high demand in the nuclear data community. In particular, highly accurate data are needed for the new Generation-IV nuclear applications. The aim is to obtain precise neutron-induced fission cross-sections for 240Pu and 242Pu. In this context accurate data on spontaneous fission half-lives have also been measured. To minimise the total uncertainty on the fission cross-sections the detector efficiency has been studied in detail. Both isotopes have been measured using a twin Frisch-grid ionisation chamber (TFGIC) due to its superiority compared to other detector systems in view of radiation hardness, 2 x 2π solid angle coverage and very good energy resolution. (authors)

  17. Gamma-ray studies of the spontaneous fission of 242Pu and 252Cr using gammasphere

    International Nuclear Information System (INIS)

    The authors report on the new results on 242Pu and 252Cf spontaneous fission gamma-rays with emphasis on the dependence of spin distributions on numbers of neutrons emitted. The analysis has concentrated first on extracting relative intensities of ground rotational transitions as a function of number of neutrons emitted. open-quotes Cold fissionclose quotes, or zero-neutron fission, is observed in a number of fissioning systems. Some isotopic series show a trend of decreasing fragment average spin with increasing numbers of neutrons emitted, contrary to the initial expectations of a simple quantal model based on neck thickness expected at scission. A simple open-quotes atomic orbitalclose quotes model plus Coulomb excitation is compared with the data. Preliminary results from an April 1994 run using 36 Ge detectors in Early Implementation of Gammasphere coupled with 4 neutron detectors and 1 X-ray detector are shown

  18. Fission cross section measurement of Am-242m using lead slowing-down spectrometer

    Energy Technology Data Exchange (ETDEWEB)

    Kai, Tetsuya; Kobayashi, Katsuhei; Yamamoto, Shuji; Fujita, Yoshiaki [Kyoto Univ., Kumatori, Osaka (Japan). Research Reactor Inst.; Kimura, Itsuro; Ohkawachi, Yasushi; Wakabayashi, Toshio

    1998-03-01

    By making use of double fission chamber and lead slowing-down spectrometer coupled to an electron linear accelerator, fission cross section for the {sup 242m}Am(n,f) reaction has been measured relative to that for the {sup 235}U(n,f) reaction in the energy range from 0.1 eV to 10 keV. The measured result was compared with the evaluated nuclear data appeared in ENDF/B-VI and JENDL-3.2, of which evaluated data were broadened by the energy resolution function of the spectrometer. Although the JENDL-3.2 data seem to be a little smaller than the present measurement, good agreement can be seen in the general shape and the absolute values. The ENDF/B-VI data are larger more than 50 % than the present values above 3 eV. (author)

  19. High-level waste storage tank farms/242-A evaporator Standards/Requirements Identification Document (S/RID), Volume 1

    International Nuclear Information System (INIS)

    The High-Level Waste Storage Tank Farms/242-A Evaporator Standards/Requirements Identification Document (S/RID) is contained in multiple volumes. This document (Volume 1) presents the standards and requirements for the Management Systems and the Configuration Management sections

  20. High-level waste storage tank farms/242-A evaporator Standards/Requirements Identification Document (S/RID), Volume 4

    Energy Technology Data Exchange (ETDEWEB)

    1994-04-01

    The High-Level Waste Storage Tank Farms/242-A Evaporator Standards/Requirements Identification Document (S/RID) is contained in multiple volumes. This document (Volume 4) presents the standards and requirements for the following sections: Radiation Protection and Operations.

  1. High-level waste storage tank farms/242-A evaporator Standards/Requirements Identification Document (S/RID), Volume 4

    International Nuclear Information System (INIS)

    The High-Level Waste Storage Tank Farms/242-A Evaporator Standards/Requirements Identification Document (S/RID) is contained in multiple volumes. This document (Volume 4) presents the standards and requirements for the following sections: Radiation Protection and Operations

  2. High-level waste storage tank farms/242-A evaporator Standards/Requirements Identification Document (S/RID), Volume 5

    Energy Technology Data Exchange (ETDEWEB)

    1994-04-01

    The High-Level Waste Storage Tank Farms/242-A Evaporator Standards/Requirements Identification Document (S/RID) is contained in multiple volumes. This document (Volume 5) outlines the standards and requirements for the Fire Protection and Packaging and Transportation sections.

  3. 17 CFR 242.603 - Distribution, consolidation, and display of information with respect to quotations for and...

    Science.gov (United States)

    2010-04-01

    ..., and display of information with respect to quotations for and transactions in NMS stocks. 242.603...) REGULATIONS M, SHO, ATS, AC, AND NMS AND CUSTOMER MARGIN REQUIREMENTS FOR SECURITY FUTURES Regulation Nms... with respect to quotations for and transactions in NMS stocks. (a) Distribution of information. (1)...

  4. High-level waste storage tank farms/242-A evaporator Standards/Requirements Identification Document (S/RID), Volume 2

    Energy Technology Data Exchange (ETDEWEB)

    1994-04-01

    The High-Level Waste Storage Tank Farms/242-A Evaporator Standards/Requirements Document (S/RID) is contained in multiple volumes. This document (Volume 2) presents the standards and requirements for the following sections: Quality Assurance, Training and Qualification, Emergency Planning and Preparedness, and Construction.

  5. High-level waste storage tank farms/242-A evaporator Standards/Requirements Identification Document (S/RID)

    Energy Technology Data Exchange (ETDEWEB)

    1994-04-01

    The High-Level Waste Storage Tank Farms/242-A Evaporator Standards/Requirements Identification Document (S/RID) is contained in multiple volumes. This document (Volume 3) presents the standards and requirements for the following sections: Safeguards and Security, Engineering Design, and Maintenance.

  6. High-level waste storage tank farms/242-A evaporator Standards/Requirements Identification Document (S/RID), Volume 5

    International Nuclear Information System (INIS)

    The High-Level Waste Storage Tank Farms/242-A Evaporator Standards/Requirements Identification Document (S/RID) is contained in multiple volumes. This document (Volume 5) outlines the standards and requirements for the Fire Protection and Packaging and Transportation sections

  7. High-level waste storage tank farms/242-A evaporator Standards/Requirements Identification Document (S/RID), Volume 2

    International Nuclear Information System (INIS)

    The High-Level Waste Storage Tank Farms/242-A Evaporator Standards/Requirements Document (S/RID) is contained in multiple volumes. This document (Volume 2) presents the standards and requirements for the following sections: Quality Assurance, Training and Qualification, Emergency Planning and Preparedness, and Construction

  8. High-level waste storage tank farms/242-A evaporator Standards/Requirements Identification Document (S/RID)

    International Nuclear Information System (INIS)

    The High-Level Waste Storage Tank Farms/242-A Evaporator Standards/Requirements Identification Document (S/RID) is contained in multiple volumes. This document (Volume 3) presents the standards and requirements for the following sections: Safeguards and Security, Engineering Design, and Maintenance

  9. High level waste storage tank farms/242-A evaporator Standards/Requirements Identification Document (S/RID), Volume 6

    International Nuclear Information System (INIS)

    The High-Level Waste Storage Tank Farms/242-A Evaporator Standards/Requirements Identification Document (S/RID) is contained in multiple volumes. This document (Volume 6) outlines the standards and requirements for the sections on: Environmental Restoration and Waste Management, Research and Development and Experimental Activities, and Nuclear Safety

  10. 78 FR 43205 - Federal Acquisition Regulation; Submission for OMB Review; Bankruptcy (FAR Subpart 42.9; 52.242-13)

    Science.gov (United States)

    2013-07-19

    ... approved information collection requirement concerning Bankruptcy. A notice was published in the Federal Register at 77 FR 73660, December 11, 2012. No comments were received. DATES: Submit comments on or before... Regulation; Submission for OMB Review; Bankruptcy (FAR Subpart 42.9; 52.242-13) AGENCY: Department of...

  11. 77 FR 73660 - Federal Acquisition Regulation; Information Collection; Bankruptcy (FAR subpart 42.9; 52.242-13)

    Science.gov (United States)

    2012-12-11

    ... Regulation; Information Collection; Bankruptcy (FAR subpart 42.9; 52.242-13) AGENCY: Department of Defense... approved information collection requirement concerning Bankruptcy. Public comments are particularly invited... statute, contractors may enter into bankruptcy which may have a significant impact on the...

  12. Combination of cetuximab and PP242 synergistically suppress the progression of wild-type KRAS colorectal carcinoma

    Directory of Open Access Journals (Sweden)

    Cheng L

    2015-11-01

    Full Text Available Lei Cheng,1,* Zuguang Xia,2,3,* Xinyu Bian,1 Guangchao Li,4 Jing Hu,1 Ya Cao,5 Qing Wang,1 Xiaoping Qian1 1Comprehensive Cancer Center of Drum-Tower Hospital, Medical School of Nanjing University, Clinical Cancer Institute of Nanjing University, Nanjing, 2Department of Medical Oncology, Fudan University Shanghai Cancer Center, Shanghai, 3Department of Oncology, Shanghai Medical College, Fudan University, Shanghai, 4School of Bioscience and Bioengineering, South China University of Technology, Guangzhou, Guangdong, 5Department of Biological Science and Technology and State Key Laboratory of Pharmaceutical Biotechnology, School of Life Sciences, Nanjing University, Nanjing, People’s Republic of China *These authors contributed equally to this work Abstract: Mammalian target of rapamycin (mTOR has been shown to be overactive in human colorectal cancer, but the first-generation mTOR inhibitor, rapamycin, has failed to show clinical efficacy against colorectal cancer. On the other hand, although the second-generation mTOR inhibitor, PP242, has exerted substantial efficacy, it was revealed that independent inhibition by PP242 was transient, which could lead to positive-feedback loop to EGFR. Using wild-type KRAS colorectal cancer cells as models, we investigate the treatment efficacy of a widely used anti-EGFR monoclonal antibody, cetuximab, and PP242, alone or in combination in vitro and in vivo. Results of cell viability assays confirmed the synergistic inhibitory effect of PP242 and cetuximab on the survival of Caco-2 and HT-29 cells. Moreover, the ability of cancer-cell invasion and proliferation was also significantly inhibited by the combination therapy when compared with cetuximab or PP242 alone. Interestingly, the percentage of CD44-positive cancer cells was substantially decreased by the combination therapy in comparison with PP242 alone through fluorescence-activated cell sorting. The growth of cancer stem-like cell spheres in vitro was

  13. Comparison of a new tumour marker CA 242 with CA 19-9, CA 50 and carcinoembryonic antigen (CEA) in digestive tract diseases.

    OpenAIRE

    Kuusela, P.; Haglund, C.; Roberts, P. J.

    1991-01-01

    The levels of CA 242, a new tumour marker of carbohydrate nature, were measured in sera of 185 patients with malignancies of the digestive tract and of 123 patients with benign digestive tract diseases. High percentages of elevated CA 242 levels (greater than 20 U ml-1) were recorded in patients with pancreatic and biliary cancers (68%). The sensitivity was somewhat lower than that of CA 19-9 (76%) and CA 50 (73%). On the other hand, in benign pancreatic and biliary tract diseases the CA 242 ...

  14. Nuclear data evaluation for 237Np, 241Am, 242gAm and 242mAm irradiated by neutrons and protons at energies up to 250 MeV

    International Nuclear Information System (INIS)

    Evaluation of nuclear data has been performed for 237Np, 241Am, 242gAm and 242mAm. Neutron data were obtained at energies from 20 to 250 MeV and combined with JENDL-3.3 data at 20 MeV. Evaluation of the proton data has been done from 1 to 250 MeV. The coupled channel optical model was used to obtain angular distributions for elastic and inelastic scattering and transmission coefficients. Pre-equilibrium exciton model and Hauser-Feshbach statistical model were used to describe neutron and charged particles emission from excited nuclei. These evaluation is the first work for producing full sets of evaluated file up to 250 MeV for 237Np and Americium isotopes. (author)

  15. Fast, Low-ionization Emission Regions of the Planetary Nebula M2-42

    Science.gov (United States)

    Danehkar, A.; Parker, Q. A.; Steffen, W.

    2016-02-01

    Spatially resolved observations of the planetary nebula M2-42 (PN G008.2-04.8) obtained with the Wide Field Spectrograph on the Australian National University 2.3 m telescope have revealed the remarkable features of bipolar collimated jets emerging from its main structure. Velocity-resolved channel maps derived from the [N ii] λ6584 emission line disentangle different morphological components of the nebula. This information is used to develop a three-dimensional morpho-kinematic model, which consists of an equatorial dense torus and a pair of asymmetric bipolar outflows. The expansion velocity of about 20 km s-1 is measured from the spectrum integrated over the main shell. However, the deprojected velocities of the jets are found to be in the range of 80-160 km s-1 with respect to the nebular center. It is found that the mean density of the collimated outflows, 595 ± 125 cm-3, is five times lower than that of the main shell, 3150 cm-3, whereas their singly ionized nitrogen and sulfur abundances are about three times higher than those determined from the dense shell. The results indicate that the features of the collimated jets are typical of fast, low-ionization emission regions.

  16. New measurement of the 242Pu(n,γ cross section at n_TOF

    Directory of Open Access Journals (Sweden)

    Lerendegui-Marco J.

    2016-01-01

    Full Text Available The use of MOX fuel (mixed-oxide fuel made of UO2 and PuO2 in nuclear reactors allows substituting a large fraction of the enriched Uranium by Plutonium reprocessed from spent fuel. With the use of such new fuel composition rich in Pu, a better knowledge of the capture and fission cross sections of the Pu isotopes becomes very important. In particular, a new series of cross section evaluations have been recently carried out jointly by the European (JEFF and United States (ENDF nuclear data agencies. For the case of 242Pu, the two only neutron capture time-of-flight measurements available, from 1973 and 1976, are not consistent with each other, which calls for a new time-of flight capture cross section measurement. In order to contribute to a new evaluation, we have perfomed a neutron capture cross section measurement at the n_TOF-EAR1 facility at CERN using four C6D6 detectors, using a high purity target of 95 mg. The preliminary results assessing the quality and limitations (background, statistics and γ-flash effects of this new experimental data are presented and discussed, taking into account that the aimed accuracy of the measurement ranges between 7% and 12% depending on the neutron energy region.

  17. Polymorphism C242T in the Cyp19 gene in meat sheep.

    Science.gov (United States)

    Mora, N H A P; Silva, S C C; Tanamati, F; Schuroff, G P; Macedo, F A F; Gasparino, E

    2016-02-01

    The objective of this study was to evaluate the frequency of C242T polymorphism on the aromatase gene and the allelic and genotypic frequency of these variants in sheep belonging to four breed groups. Blood samples were collected from 187 animals of four breed groups: Dorper, Santa Inês, Texel and White Dorper, originated from herds in the region of Maringá/PR, Brazil. The genomic DNA was extracted using alkaline extraction, with subsequent amplification of the fragments via PCR with specific primer. The samples resulting from amplification were subjected to digestion process using the Dpn II restriction enzyme and to polyacrylamide gel electrophoresis 10.0% and stained with silver nitrate. Three distinct genotypes were observed: homozygous (CC), heterozygous (CT) and homozygous for no cut (TT). The resulting data were analyzed using the POPGENE software with 5% significance. Genotypic frequencies among the breed groups were: Texel (CC - 0.426; CT - 0.511; TT - 0.064), Dorper (CC - 0.073; CT - 0.732; TT - 0.439), White Dorper (CC - 0.021; CT - 0.255; TT - 0.723) and Santa Inês (CC - 0.115; CT - 0.462; TT - 0.423). PMID:26909637

  18. Fast, low-ionization emission regions of the planetary nebula M2-42

    CERN Document Server

    Danehkar, A; Steffen, W

    2016-01-01

    Spatially resolved observations of the planetary nebula M2-42 (PN G008.2-04.8) obtained with the Wide Field Spectrograph on the Australian National University 2.3 m telescope have revealed the remarkable features of bipolar collimated jets emerging from its main structure. Velocity-resolved channel maps derived from the [N II] $\\lambda$6584 emission line disentangle different morphological components of the nebula. This information is used to develop a three-dimensional morpho-kinematic model, which consists of an equatorial dense torus and a pair of asymmetric bipolar outflows. The expansion velocity of about 20 km s$^{-1}$ is measured from the spectrum integrated over the main shell. However, the deprojected velocities of the jets are found to be in the range of 80-160 km s$^{-1}$ with respect to the nebular center. It is found that the mean density of the collimated outflows, 595 $\\pm$ 125 cm$^{-3}$, is five times lower than that of the main shell, 3150 cm$^{-3}$, whereas their singly ionized nitrogen and ...

  19. The Mysterious Morphology of MRC0943-242 as Revealed by ALMA and MUSE

    CERN Document Server

    Gullberg, Bitten; Lehnert, Matthew D; Vernet, Joel; Bacon, Roland; Drouart, Guillaume; Emonts, Bjorn; Galametz, Audrey; Ivison, Rob; Nesvadba, Nicole P H; Richard, Johan; Seymour, Nick; Stern, Daniel; Wylezalek, Dominika

    2015-01-01

    We present a pilot study of the z=2.923 radio galaxy MRC0943-242, where we for the first time combine information from ALMA and MUSE data cubes. Even with modest integration times, we disentangle an AGN and a starburst dominated set of components. These data reveal a highly complex morphology, as the AGN, starburst, and molecular gas components show up as widely separated sources in dust continuum, optical continuum and CO line emission observations. CO(1-0) and CO(8-7) line emission suggest that there is a molecular gas reservoir offset from both the dust and the optical continuum that is located ~90kpc from the AGN. The UV line emission has a complex structure in emission and absorption. The line emission is mostly due to i) a large scale ionisation cone energised by the AGN, ii) a Ly-alpha emitting bridge of gas between the radio galaxy and a heavily star-forming set of components. Strangely, the ionisation cone has no Ly-alpha emission. We find this is due to an optically thick layer of neutral gas with u...

  20. Effect Of Cooling Rate On Thermal And Mechanical Properties Of Cu-%24.2Mn Alloy

    International Nuclear Information System (INIS)

    In this research, different heat and mechanical treatments have been applied to the Cu-%24.2Mn and some samples have been obtained from this alloy. On these samples, phase transformations have been formed by thermal and mechanical effect. Morphological, mechanical and crystallographic properties of the phase transformations have been examined by using different physical methods. Austenite phase has been obtained in the samples which have been applied slow and rapid cooling according to the SEM analysis. It has been observed that the grain size obtained by the rapid cooling is smaller than the grain size obtained by the slow cooling. Therefore, it has been concluded that the cooling process differences, changes the grain size of the alloy. Compression stress has been applied to the alloy in order to search the deformation effect on the austenite phase transformation. The structural features of the phase transformations have been examined. Slip lines and martensite structural were observed on the surface of the alloys after the deformation. Changes in phase structure of the alloy are also examined by means of XRD technique.

  1. Re-evaluation of neutron nuclear data for 242mAm, 243Am, 99Tc and140Ce

    International Nuclear Information System (INIS)

    The evaluated nuclear data given in JENDL-3.2 were compared with other evaluated data sets and available experimental data, for important minor actinides of 242mAm and 243Am, and fission product nuclides of 99Tc and 140Ce. Since problems were found as a result of the comparison, the data of JENDL-3.2 were improved for these nuclides. It was found that the evaluated data of Maslov et al. were superior to the others. They were adopted for 242mAm and 243Am after further improvements. For 99Tc and 140Ce, resonance parameters and optical model parameters were improved. The cross sections of these two nuclides in the smooth part were re-calculated. The present results were given in the neutron energy range from 10-5 eV to 20 MeV in the ENDF-6 format, and adopted to JENDL-3.3. (author)

  2. Association between NADPH Oxidase p22phox C242T Polymorphism and Ischemic Cerebrovascular Disease: A Meta-Analysis

    OpenAIRE

    Li, Bing-Hu; Zhang, Li-li; Zhang, Bei-Bei; Yin, Yan-Wei; Dai, Li-Meng; Pi, Yan; Guo, Lu; Chang-yue GAO; Fang, Chuan-Qin; Wang, Jing-Zhou; Li, Jing-Cheng

    2013-01-01

    Background Epidemiological studies have evaluated the association between nicotinamide adenine dinucleotide phosphate (NADPH) oxidase p22phox C242T polymorphism and risk of ischemic cerebrovascular disease (ICVD), but the results remain inconclusive. This meta-analysis was therefore designed to clarify these controversies. Methodology/Principal Findings Systematic searches of electronic databases Embase, PubMed and Web of Science, as well as hand searching of the references of identified arti...

  3. Measurement of the 242Pu(n,f) Cross Section at the CERN n_TOF Facility

    CERN Document Server

    Tsinganis, A; Guerrero, C; Colonna, N; Calviani, M; Vlastou, R; Andriamonje, S; Vlachoudis, V; Gunsing, F; Massimi, C; Altstadt, S; Andrzejewski, J; Audouin, L; Barbagallo, M; Bécares, V; Bečvář, F; Belloni, F; Billowes, J; Boccone, V; Bosnar, D; Brugger, M; Calviño, F; Cano-Ott, D; Carrapiço, C; Cerutti, F; Chin, M; Cortés, G; Cortés-Giraldo, M A; Diakaki, M; Domingo-Pardo, C; Duran, I; Dressler, R; Dzysiuk, N; Eleftheriadis, C; Ferrari, A; Fraval, K; Ganesan, S; García, A R; Giubrone, G; Gómez-Hornillos, M B; Gonçalves, I F; González-Romero, E; Griesmayer, E; Gurusamy, P; Hernández-Prieto, A; Jenkins, D G; Jericha, E; Kadi, Y; Käppeler, F; Karadimos, D; Kivel, N; Koehler, P; Kokkoris, M; Krtička, M; Kroll, J; Lampoudis, C; Langer, C; Leal-Cidoncha, E; Lederer, C; Leeb, H; Leong, L S; Losito, R; Mallick, A; Manousos, A; Marganiec, J; Martínez, T; Massimi, C; Mastinu, P F; Mastromarco, M; Meaze, M; Mendoza, E; Mengoni, A; Milazzo, P M; Mingrone, F; Mirea, M; Mondalaers, W; Paradela, C; Pavlik, A; Perkowski, J; Plompen, A; Praena, J; Quesada, J M; Rauscher, T; Reifarth, R; Riego, A; Robles, M S; Roman, F; Rubbia, C; Sabaté-Gilarte, M; Sarmento, R; Saxena, A; Schillebeeckx, P; Schmidt, S; Schumann, D; Tagliente, G; Tain, J L; Tarrío, D; Tassan-Got, L; Valenta, S; Vannini, G; Variale, V; Vaz, P; Ventura, A; Versaci, R; Vermeulen, M J; Wallner, A; Ware, T; Weigand, M; Weiss, C; Wright, T; Žugec, P

    2014-01-01

    The accurate knowledge of relevant nuclear data is crucial for the design of advanced nuclear systems. These data include neutron cross sections of various plutonium isotopes and other minor actinides. The Pu-242(n,f) cross section was measured at the CERN n\\_TOF facility, taking advantage of the wide energy range (from thermal to GeV) and the high instantaneous flux of the neutron beam. Preliminary results for the measurement are presented.

  4. Comparison of evaluations for 235U, 239Pu, 240Pu, 241Pu and 242Pu with integral measurements

    International Nuclear Information System (INIS)

    The evaluations for 235U, 239Pu, 240Pu, 241Pu and 242Pu are considered. Intercomparison is made of the neutron cross section data from INDL/A, ENDL-84, ENDF/B-5 and ENDF/B-6 (where applicable). Integral measurements of the spectrum averaged cross sections are compared to the values derived from evaluated data libraries. (author). 40 refs, 49 figs, 11 tabs

  5. Diagnostic value of combined determination of serum tumor markers (NSE, CA-242, TPA, CEA) levels in patients with lung cancer

    International Nuclear Information System (INIS)

    Objective: To investigate the diagnostic value of combined determination of serum NSE, CA242, tissue polypeptide antigen (TPA) and CEA levels in patients with primary lung cancer. Methods: Serum NSE, CA242, TPA and CEA levels were determined with ELISA in (1) 102 patients with various types of primary lung carcinoma (adenocarcinoma 38, squamous cell carcinoma 32, small cell lung carcinoma 32) (2) 33 patients with open lung T. B. and (3) 30 controls. Results: (1) In patients with lung cancer, serum levels of all the four markers were increased and significantly higher than their respective values in patients with open lung T.B. and controls. (2) Positive rate of combined any two markers were 75% for adenocarcinoma, 50% for squamous cell carcinoma and 65% for small cell lung carcinoma, while false positive rate was only 9% for T.B patients and none for the controls. (3) The most appropriate single marker for each specific type of lung cancer was: NSE for SCLC (sensitivity 72%, specificity 97%, CA242 for adenocarcinoma sensitivity 62%, specificity 90%). Conclusion: Combined determination of these tumor markers would improve the sensitivity and specificity for diagnosis of primary lung carcinoma. (authors)

  6. Measurement of Am-242 fission yields at the Lohengrin spectrometer; improvement and Benchmarking of the semi-empirical code GEF

    International Nuclear Information System (INIS)

    The study of fission yields has a major impact on the characterization and understanding of the fission process and is mandatory for reactor applications. While the yields are known for the major actinides (U-235, Pu-239) in the thermal neutron-induced fission, only few measurements were performed on Am-242. Moreover, the two main data libraries do not agree among each other on the light peak. Am-241 and Am-242 are nuclei of interest for the MOX-fuel reactors and for the reduction of nuclear waste radiotoxicity using transmutation reactions. Thus, a campaign of precise measurement of the fission mass yields from the reaction Am-241(2n,f) was performed at the Lohengrin mass spectrometer (ILL, France) for both the light and the heavy peak. Forty-one masses were measured. Moreover, the measurement of the isotopic fission yields on the heavy peak by gamma-ray spectrometry led to the extraction of 20 independent isotopic yields. Our measurement was also meant to determine whether there is a difference in fission yields between the Am-242 isomeric state and its ground state as it exists in fission cross sections. The experimental method used to answer this question is based on the measurement a set of fission mass yields as a function of the ratio of Am-242gs to Am-242m fission rate. Results show that the mass yields are independent of the fission rate ratio. A future experimental campaign is proposed to observe a possible influence on the isomeric yields. The theoretical models are nowadays unable to predict the fission yields with enough accuracy and therefore we have to rely on experimental data and phenomenological models. The accuracy of the predictions of the semi empirical GEF fission model predictions makes it a useful tool for evaluation. This thesis also presents the physical content and part of the development of this model. Validation of the kinetic energy distributions, isomeric yields and fission yields predictions was performed. The extension of the GEF

  7. Diagnostic value of combined determinations of serum CA19-9, CA242 and CA50 levels in patients with pancreatic cancer

    International Nuclear Information System (INIS)

    Objective: To explore the diagnostic value of combined determinations of serum CA19-9, CA242 and CA50 levels in patients with pancreatic cancer. Methods: Serum CA19-9, CA242 and CA50 levels were determined with RIA in 120 patients with pancreatic cancer, 50 patients with chronic pancreatitis and 80 controls. Results: The serum levels of CA19-9, CA242 and CA50 in patients with pancreatic cancer were significantly higher than those in patients with pancreatitis and controls. With CA19-9, the diagnostic sensitivity and specificity for pancreatic cnrcinoma was 82.0% and 78.6% respectively. With CA242, the diagnostic sensitivity and specificity for pancreatic carcinoma was 78.5% and 81.6% respectively. With CA50, the diagnostic sensitivity and specificity for pancreatic carcinoma was 52.7% and 74.6% respectively. With combined determinations of CA19-9, CA242 and CA50, the sensitivity and specificity was enhanced to 96.82% and 98.75% respectively. Conclusion: Combined detection of CA19-9, CA242 and CA50 is clinically useful for early diagnosis of pancreatic cancer. (authors)

  8. The mysterious morphology of MRC0943-242 as revealed by ALMA and MUSE

    Science.gov (United States)

    Gullberg, Bitten; De Breuck, Carlos; Lehnert, Matthew D.; Vernet, Joël; Bacon, Roland; Drouart, Guillaume; Emonts, Bjorn; Galametz, Audrey; Ivison, Rob; Nesvadba, Nicole P. H.; Richard, Johan; Seymour, Nick; Stern, Daniel; Wylezalek, Dominika

    2016-02-01

    We present a pilot study of the z = 2.923 radio galaxy MRC0943-242, where we combine information from ALMA and MUSE data cubes for the first time. Even with modest integration times, we disentangle the AGN and starburst dominated components. These data reveal a highly complex morphology as the AGN, starburst, and molecular gas components show up as widely separated sources in dust continuum, optical continuum, and CO line emission observations. CO(1-0) and CO(8-7) line emission suggest that there is a molecular gas reservoir offset from both the dust and the optical continuum that is located ~90 kpc from the AGN. The UV line emission has a complex structure in emission and absorption. The line emission is mostly due to a large scale ionisation cone energised by the AGN, and a Lyα emitting bridge of gas between the radio galaxy and a heavily star-forming set of components. Strangely, the ionisation cone has no Lyα emission. We find this is due to an optically thick layer of neutral gas with unity covering fraction spread out over a region of at least ~100 kpc from the AGN. Other less thick absorption components are associated with Lyα emitting gas within a few tens of kpc from the radio galaxy and are connected by a bridge of emission. We speculate that this linear structure of dust, Lyα and CO emission, and the redshifted absorption seen in the circum nuclear region may represent an accretion flow feeding gas into this massive AGN host galaxy.

  9. 242周期夫精宫腔人工授精临床观察

    Institute of Scientific and Technical Information of China (English)

    梅园园; 彭璇; 雷美云

    2012-01-01

    目的比较分析自然周期和促排卵两种方式行夫精官腔人工授精(IUI)的妊娠结局。方法回顾性分析242周期IUI患者的临床资料,其中160周期以促排卵方式行IUI,82周期采用自然周期行IUI,随访所有患者的妊娠结局。结果促排卵方式行IUI的妊娠率较自然周期组高,但两组比较无统计学差异.P〉O.05;促排卵组发生OHSS、LUFS及多胎并发症比自然周期组高,但两组比较亦无统计学差异,P〉0.05。结论虽然采用促排卵方式行IUI能提高患者妊娠率,但发生OHSS,LFUS和多胎并发症比自然周期组也高。自然周期符合自身卵泡生长规律,并可减少药物对卵巢的刺激,节约经济成本,也是值得一定推广的IUI方式。

  10. 242例未行准分子激光原位角膜磨镶术患者角膜因素分析%Analysis of 242 cases which unable to carry out LASIK

    Institute of Scientific and Technical Information of China (English)

    王林; 张庆生; 王忠海

    2014-01-01

    Objective Analyze the cornea factors which result in unable to carry out the LASIK operation .Method Do retrospective analysis research and summarize 242 patients’ medical records who did not undergo LASIK because of factors in the cornea.Results In total 242 cases, 112 patient’s corneal thickness less than normal that account for the to-tal 46.3%, 87 cases of suspected keratoconus that make up 36.0%of the total, 5 cases (2.1%) of keratoconus , 25 ca-ses (10.3%) are wearing orthokeratology lens , 8 cases (3.3%) are fell ill with keratitis, 5 cases (2.0%) are due to some other corneal problems .Conclusion Corneal factors are the main reasons for unable to carry out the LASIK opera-tions , carry out strict check work on patients ’ cornea to know the relevant indications and contraindications before the oper -ation is very critical to improve the safety of the LASIK operations .%探讨因角膜因素未行准分子激光原位角膜磨镶术( LASIK)的原因。方法回顾分析242例因角膜因素未行LASIK的原因。结果在242例因角膜因素未行LASIK中,角膜厚度不足112例(46.3%),可疑圆锥角膜87例(36.0%),圆锥角膜5例(2.1%),佩戴角膜塑形镜25例(10.3%),角膜炎8例(3.3%),其它角膜因素5例(2.0%)。结论角膜因素是未行LASIK的主要原因,严格的手术前角膜筛查,掌握手术的适应证与禁忌证,可以提高LASIK手术的安全性。

  11. Evaluation of 242Pu data for the incident neutron energy range 5-20 MeV

    International Nuclear Information System (INIS)

    Models, procedures and parameters are presented for the calculation of neutron cross sections, the neutron angular distributions and the neutron energy distributions of 242Pu in the energy range 5-20 MeV. The interaction takes place through direct interaction and compound nucleus mechanism. For heavy deformed nucleus the direct interaction was treated with the coupled channel process, using the ECIS code. For the compound nucleus mechanism, a statistical treatment was used for fission, neutron elastic and inelastic scattering, radiative capture, (n,2n), (n,3n), (n,4n) cross section calculations, using the GNASH code. (R.P.)

  12. Synthesis of novel 2-(4-(2-morpholinoethoxy)phenyl)-N-phenylacetamide analogues and their antimicrobial study

    Indian Academy of Sciences (India)

    H P Jayadevappa; G Nagendrappa; S Umesh; S Chandrashekar

    2012-09-01

    A new class of potential biologically active 2-(4-(2-morpholinoethoxy)phenyl)-N-phenylacetamides has been synthesized from hydroxyphenylacetic acid. The products were characterized through IR, 1H NMR, mass spectral studies and elemental analysis. The compounds were screened for antimicrobial activity by disc agar diffusion technique. The potency of compounds is tested against variety of fungal and bacterial strains in comparison to clotrimazole and streptomycin, respectively. Some of the synthesized compounds exhibit superior in vitro activity compared to the standard drugs.

  13. Association of the p22phox polymorphism C242T with the risk of late-onset Alzheimer's disease in a northern Han Chinese population.

    Science.gov (United States)

    Fu, Qingxi; Qi, Faying; Tian, Fengyun; Ma, Guozhao; Che, Fengyuan; Du, Yifeng; Gao, Naiyong

    2016-07-01

    The C242T polymorphism of the CYBA gene that encodes p22phox, a component of nicotinamide adenine dinucleotide phosphate oxidase, has been found to modulate reactive oxygen species (ROS) production. Oxidative stress is thought to play a pivotal role in the pathophysiology of Alzheimer's disease (AD), which is manifested as increased availability of ROS because of an imbalanced redox state. Therefore, the aim of this study was to investigate potential associations of the p22phox C242T polymorphism with the risk of late-onset AD (LOAD) in a northern Han Chinese population. Patients with LOAD (n = 276) and 320 control subjects were recruited for the study. Polymerase chain reaction-restriction fragment length polymorphism was used to detect the genotypes. No significant differences were found between LOAD and p22phox C242T polymorphism, but a significant association was obtained in the genotype and allele distributions of p22phox C242T between LOAD patients and controls in apolipoprotein E (ApoE) ϵ4 carriers. These results suggested that p22phox C242T polymorphism has a possible role in changing the genetic susceptibility to LOAD in ApoE ϵ4 carriers of this northern Han Chinese population. PMID:26000926

  14. Relationship between peripheral and mesenteric serum levels of CEA and CA 242 with staging and histopathological variables in colorectal adenocarcinoma Níveis séricos periféricos e mesentéricos de CEA e CA 242, estadiamento e variáveis histopatológicas no adenocarcinoma colorretal

    OpenAIRE

    Mauro Lamelas Cardoso; Luís Cesar Fernandes; Su Bong Kim; Delcio Matos

    2009-01-01

    PURPOSE: To compare histopathological variables and staging in colorectal adenocarcinoma cases with CEA and CA 242 in peripheral and mesenteric blood. METHODS: In 169 individuals underwent surgery for colorectal cancer, CEA and CA 242 were analyzed and compared to mesenteric and peripheral blood and correlated with macroscopic tumor's morphology and size, degree of cell differentiation, venous, neural and lymphatic involvement and TNM classification. RESULTS: There was a difference between th...

  15. Sequence and batch language programs and alarm-related ``C`` programs for the 242-A MCS. Revision 2

    Energy Technology Data Exchange (ETDEWEB)

    Berger, J.F.

    1995-03-01

    A Distributive Process Control system was purchased by Project B-534, ``242-A Evaporator/Crystallizer Upgrades``. This control system, called the Monitor and Control System (MCS), was installed in the 242-A Evaporator located in the 200 East Area. The purpose of the MCS is to monitor and control the Evaporator and monitor a number of alarms and other signals from various Tank Farm facilities. Applications software for the MCS was developed by the Waste Treatment Systems Engineering (WTSE) group of Westinghouse. The standard displays and alarm scheme provide for control and monitoring, but do not directly indicate the signal location or depict the overall process. To do this, WTSE developed a second alarm scheme which uses special programs, annunciator keys, and process graphics. The special programs are written in two languages; Sequence and Batch Language (SABL), and ``C`` language. The WTSE-developed alarm scheme works as described below: SABL relates signals and alarms to the annunciator keys, called SKID keys. When an alarm occurs, a SABL program causes a SKID key to flash, and if the alarm is of yellow or white priority then a ``C`` program turns on an audible horn (the D/3 system uses a different audible horn for the red priority alarms). The horn and flashing key draws the attention of the operator.

  16. Sequence and batch language programs and alarm-related ''C'' programs for the 242-A MCS. Revision 2

    International Nuclear Information System (INIS)

    A Distributive Process Control system was purchased by Project B-534, ''242-A Evaporator/Crystallizer Upgrades''. This control system, called the Monitor and Control System (MCS), was installed in the 242-A Evaporator located in the 200 East Area. The purpose of the MCS is to monitor and control the Evaporator and monitor a number of alarms and other signals from various Tank Farm facilities. Applications software for the MCS was developed by the Waste Treatment Systems Engineering (WTSE) group of Westinghouse. The standard displays and alarm scheme provide for control and monitoring, but do not directly indicate the signal location or depict the overall process. To do this, WTSE developed a second alarm scheme which uses special programs, annunciator keys, and process graphics. The special programs are written in two languages; Sequence and Batch Language (SABL), and ''C'' language. The WTSE-developed alarm scheme works as described below: SABL relates signals and alarms to the annunciator keys, called SKID keys. When an alarm occurs, a SABL program causes a SKID key to flash, and if the alarm is of yellow or white priority then a ''C'' program turns on an audible horn (the D/3 system uses a different audible horn for the red priority alarms). The horn and flashing key draws the attention of the operator

  17. High-level waste storage tank farms/242-A evaporator standards/requirements identification document (S/RID), Vol. 4

    Energy Technology Data Exchange (ETDEWEB)

    1994-04-01

    Radiation protection of personnel and the public is accomplished by establishing a well defined Radiation Protection Organization to ensure that appropriate controls on radioactive materials and radiation sources are implemented and documented. This Requirements Identification Document (RID) applies to the activities, personnel, structures, systems, components, and programs involved in executing the mission of the Tank Farms. The physical boundaries within which the requirements of this RID apply are the Single Shell Tank Farms, Double Shell Tank Farms, 242-A Evaporator-Crystallizer, 242-S, T Evaporators, Liquid Effluent Retention Facility (LERF), Purgewater Storage Facility (PWSF), and all interconnecting piping, valves, instrumentation, and controls. Also included is all piping, valves, instrumentation, and controls up to and including the most remote valve under Tank Farms control at any other Hanford Facility having an interconnection with Tank Farms. The boundary of the structures, systems, components, and programs to which this RID applies, is defined by those that are dedicated to and/or under the control of the Tank Farms Operations Department and are specifically implemented at the Tank Farms.

  18. High-level waste storage tank farms/242-A evaporator standards/requirements identification document (S/RID), Vol. 4

    International Nuclear Information System (INIS)

    Radiation protection of personnel and the public is accomplished by establishing a well defined Radiation Protection Organization to ensure that appropriate controls on radioactive materials and radiation sources are implemented and documented. This Requirements Identification Document (RID) applies to the activities, personnel, structures, systems, components, and programs involved in executing the mission of the Tank Farms. The physical boundaries within which the requirements of this RID apply are the Single Shell Tank Farms, Double Shell Tank Farms, 242-A Evaporator-Crystallizer, 242-S, T Evaporators, Liquid Effluent Retention Facility (LERF), Purgewater Storage Facility (PWSF), and all interconnecting piping, valves, instrumentation, and controls. Also included is all piping, valves, instrumentation, and controls up to and including the most remote valve under Tank Farms control at any other Hanford Facility having an interconnection with Tank Farms. The boundary of the structures, systems, components, and programs to which this RID applies, is defined by those that are dedicated to and/or under the control of the Tank Farms Operations Department and are specifically implemented at the Tank Farms

  19. 17q24.2 microdeletions: a new syndromal entity with intellectual disability, truncal obesity, mood swings and hallucinations.

    Science.gov (United States)

    Vergult, Sarah; Dauber, Andrew; Delle Chiaie, Barbara; Van Oudenhove, Elke; Simon, Marleen; Rihani, Ali; Loeys, Bart; Hirschhorn, Joel; Pfotenhauer, Jean; Phillips, John A; Mohammed, Shehla; Ogilvie, Caroline; Crolla, John; Mortier, Geert; Menten, Björn

    2012-05-01

    Although microdeletions of the long arm of chromosome 17 are being reported with increasing frequency, deletions of chromosome band 17q24.2 are rare. Here we report four patients with a microdeletion encompassing chromosome band 17q24.2 with a smallest region of overlap of 713 kb containing five Refseq genes and one miRNA. The patients share the phenotypic characteristics, such as intellectual disability (4/4), speech delay (4/4), truncal obesity (4/4), seizures (2/4), hearing loss (3/4) and a particular facial gestalt. Hallucinations and mood swings were also noted in two patients. The PRKCA gene is a very interesting candidate gene for many of the observed phenotypic features, as this gene plays an important role in many cellular processes. Deletion of this gene might explain the observed truncal obesity and could also account for the hallucinations and mood swings seen in two patients, whereas deletion of a CACNG gene cluster might be responsible for the seizures observed in two patients. In one of the patients, the PRKAR1A gene responsible for Carney Complex and the KCNJ2 gene causal for Andersen syndrome are deleted. This is the first report of a patient with a whole gene deletion of the KCNJ2 gene. PMID:22166941

  20. Research on the controlling of rare earth permanent magnet brushless DC motor based on TMS320C242%基于TMS320C242的稀土永磁无刷直流电机控制系统研究

    Institute of Scientific and Technical Information of China (English)

    董艺

    2012-01-01

    对用TMS320C242控制稀土永磁无刷直流电机(REPMBLDCM)进行了深入的探讨。作为驱动设备,稀土永磁无刷直流电机在很多方面性能优于普通直流电机;作为控制核心,TMS320C242无论是集成度还是控制速度都远超普通的单片机。所以用TMS320C242控制REPMBLDCM可获得极为优秀的控制效果和驱动性能。%A deep discussion has been made on how to control rare earth permanent magnet brushless DC motor with TMS320C242. As a driving device, rare earth permanent magnet brushless DC motor is superior to the common DC motor in many ways. As a core of the control system, TMS320C242 is far more superior to the common single chip microcontroller unit whether on its integration or its controlling speed. Therefore, excellent control effects and driving properties can be obtained by adopting TMS320C242 to control REPMBLDCM.

  1. Relationship between peripheral and mesenteric serum levels of CEA and CA 242 with staging and histopathological variables in colorectal adenocarcinoma Níveis séricos periféricos e mesentéricos de CEA e CA 242, estadiamento e variáveis histopatológicas no adenocarcinoma colorretal

    Directory of Open Access Journals (Sweden)

    Mauro Lamelas Cardoso

    2009-10-01

    Full Text Available PURPOSE: To compare histopathological variables and staging in colorectal adenocarcinoma cases with CEA and CA 242 in peripheral and mesenteric blood. METHODS: In 169 individuals underwent surgery for colorectal cancer, CEA and CA 242 were analyzed and compared to mesenteric and peripheral blood and correlated with macroscopic tumor's morphology and size, degree of cell differentiation, venous, neural and lymphatic involvement and TNM classification. RESULTS: There was a difference between the mesenteric (M and peripheral (P serum levels of CEA (p=0.020. Higher levels of markers were correlated with venous invasion CEA (P p=0.013, CEA (M p=0.05, CA 242 (M p=0.005 and CA 242 (P p=0.038; with advanced staging CEA (P OBJETIVO: Comparar variáveis histopatológicas e graus de estadiamento do adenocarcinoma colorretal com níveis sanguíneos periféricos e mesentéricos de CEA e CA-242. MÉTODOS: Em 169 doentes submetidos ao tratamento cirúrgico por adenocarcinoma colorretal, CEA e CA-242 foram analisados e comparados quanto aos níveis sanguíneos periféricos e mesentéricos e correlacionados com o tamanho e a morfologia macroscópica do tumor, grau de diferenciação celular, invasões venosa, linfática, neural e a classificação TNM. RESULTADOS: Verificou-se diferença significante entre o nível sérico mesentérico e periférico de CEA (p= 0,02. Níveis séricos mais elevados dos marcadores foram observados e correlacionados com invasão venosa, CEA (P p=0,013, CEA(M, p=0,05, CA-242 (M p=0,005 e CA-242 (P p=0,038. Grau de estadiamento TNM avançado foi associado com CEA(P < CEA(M p<0,05, CA-242(P < CA-242(M p<0,05. Nas maiores dimensões tumorais constatou-se CEA(P < CEA(M p=0,001 e CA 242 (P < CA 242 (M (p < 0.001. O CA 242 periférico e mesentérico aumentados associaram-se com a invasão neural, p=0.014 e p=0.003, respectivamente. CONCLUSÕES: O nível sérico mesentérico de CEA é superior ao nível sérico periférico. Os níveis s

  2. I. Nuclear Production Reaction and Chemical Isolation Procedure for 240Am II. New Superheavy Element Isotopes: 242Pu(48Ca,5n)285-114

    OpenAIRE

    Ellison, Paul Andrew

    2011-01-01

    Part I discusses the study of a new nuclear reaction and chemical separation procedure for the production of 240Am. Thin 242Pu, natTi, and natNi targets were coincidently activated with protons from the 88-Inch Cyclotron, producing 240Am, 48V, and 57Ni, respectively. The radioactive decay of these isotopes was monitored using high-purity Ge gamma ray detectors in the weeks following irradiation. The excitation function for the 242Pu(p, 3n)240Am nuclear reaction was measured to be lower than t...

  3. The 24-2 Visual Field Test Misses Central Macular Damage Confirmed by the 10-2 Visual Field Test and Optical Coherence Tomography

    OpenAIRE

    Grillo, Lola M.; Wang, Diane L.; Ramachandran, Rithambara; Ehrlich, Alyssa C.; De Moraes, Carlos Gustavo; Ritch, Robert; Hood, Donald C.

    2016-01-01

    Purpose To determine the extent to which the 24-2 visual field (VF) misses macular damage confirmed with both 10-2 VF and optical coherence tomography (OCT) tests and to evaluate the patterns of damage missed. Methods One hundred forty-one eyes of 141 glaucoma patients or suspects underwent 24-2 VF (mean deviation [MD] better than −6 dB), 10-2 VF, and OCT testing. Retinal nerve fiber layer (RNFL) and retinal ganglion cell plus inner plexiform (RGC+) probability plots were combined with 10-2 V...

  4. Low energy transmission measurements of 240,242Pu at Galina and their impact on the capture width

    International Nuclear Information System (INIS)

    We present an approach to account for sample inhomogeneities as observed in thin powder samples. To test this model a series of transmission measurements on enriched 240Pu and 242Pu oxide samples was carried out. These measurements were performed at GELINA, the pulsed, white neutron source at the Institute for Reference Materials and Measurements in Geel. For all samples a mixture of PuO2 and graphite powder was used. To reduce the influence of the models for Doppler broadening on the extracted resonance parameters, measurements were performed with sample temperatures of approximately 12 K, 77 K and 300 K. To describe the variation in the sample thickness, caused by the particle distribution in a thin powder sample, a Monte Carlo and an analytical description were used in the resonance shape analysis. The values and uncertainties of the extracted resonance parameters are discussed, and suggestion for future measurements are given. (authors)

  5. Towards high accurate neutron-induced fission cross sections of 240,242Pu: Spontaneous fission half-lives

    Science.gov (United States)

    Salvador-Castiñeira, P.; Bryś, T.; Eykens, R.; Hambsch, F.-J.; Moens, A.; Oberstedt, S.; Pretel, C.; Sibbens, G.; Vanleeuw, D.; Vidali, M.

    2013-12-01

    Fast spectrum neutron-induced fission cross sections of transuranic isotopes are being of special demand in order to provide accurate data for the new GEN-IV nuclear power plants. To minimize the uncertainties on these measurements accurate data on spontaneous fission half-lives and detector efficiencies are a key point. High α-active actinides need special attention since the misinterpretation of detector signals can lead to low efficiency values or underestimation in fission fragment detection. In that context, 240,242Pu isotopes have been studied by means of a Twin Frisch-Grid Ionization Chamber (TFGIC) for measurements of their neutron-induced fission cross section. Gases with different drift velocities have been used, namely P10 and CH4. The detector efficiencies for both samples have been determined and improved spontaneous fission half-life values were obtained.

  6. Measurement of the fission cross-section of $^{240}$Pu and $^{242}$Pu at CERN's n_TOF Facility

    CERN Multimedia

    Pavlik, A F; Gonzalez romero, E M

    The n_TOF Collaboration proposes to continue the fission program, already started in 2002-2004, taking advantage of the newly constructed Work Sector Type A, with the measurement of the two isotopes : $^{240}$ Pu and $^{242}$ Pu. They are both of major importance for reactor physics applications and are included in the Nuclear Energy Agency (NEA) High Priority List [1], in the NEA WPEC Subgroup 26 Report on the accuracy of nuclear data for advanced reactor designe [2] and in the EU 6$^{th}$ Framework Programme IP-EUROTRANS/NUDATRA reports [3]. Based on those requests, the measurement of the fission cross-section of the two Pu isotopes is one of the objectives of the project ANDES of the FP7 EURATOM program [4].

  7. Towards high accurate neutron-induced fission cross sections of 240,242Pu: Spontaneous fission half-lives

    Directory of Open Access Journals (Sweden)

    Salvador-Castiñeira P.

    2013-12-01

    Full Text Available Fast spectrum neutron-induced fission cross sections of transuranic isotopes are being of special demand in order to provide accurate data for the new GEN-IV nuclear power plants. To minimize the uncertainties on these measurements accurate data on spontaneous fission half-lives and detector efficiencies are a key point. High α-active actinides need special attention since the misinterpretation of detector signals can lead to low efficiency values or underestimation in fission fragment detection. In that context, 240,242Pu isotopes have been studied by means of a Twin Frisch-Grid Ionization Chamber (TFGIC for measurements of their neutron-induced fission cross section. Gases with different drift velocities have been used, namely P10 and CH4. The detector efficiencies for both samples have been determined and improved spontaneous fission half-life values were obtained.

  8. Comparison of size modulation and conventional standard automated perimetry with the 24-2 test protocol in glaucoma patients.

    Science.gov (United States)

    Hirasawa, Kazunori; Shoji, Nobuyuki; Kasahara, Masayuki; Matsumura, Kazuhiro; Shimizu, Kimiya

    2016-01-01

    This prospective randomized study compared test results of size modulation standard automated perimetry (SM-SAP) performed with the Octopus 600 and conventional SAP (C-SAP) performed with the Humphrey Field Analyzer (HFA) in glaucoma patients. Eighty-eight eyes of 88 glaucoma patients underwent SM-SAP and C-SAP tests with the Octopus 600 24-2 Dynamic and HFA 24-2 SITA-Standard, respectively. Fovea threshold, mean defect, and square loss variance of SM-SAP were significantly correlated with the corresponding C-SAP indices (P < 0.001). The false-positive rate was slightly lower, and false-negative rate slightly higher, with SM-SAP than C-SAP (P = 0.002). Point-wise threshold values obtained with SM-SAP were moderately to strongly correlated with those obtained with C-SAP (P < 0.001). The correlation coefficients of the central zone were significantly lower than those of the middle to peripheral zone (P = 0.031). The size and depth of the visual field (VF) defect were smaller (P = 0.039) and greater (P = 0.043), respectively, on SM-SAP than on C-SAP. Although small differences were observed in VF sensitivity in the central zone, the defect size and depth and the reliability indices between SM-SAP and C-SAP, global indices of the two testing modalities were well correlated. PMID:27149561

  9. Coulomb excitation of a 242Am isomeric target: E2 and E3 strengths, rotational alignment, and collective enhancement

    International Nuclear Information System (INIS)

    A 98% pure 242mAm (K=5-, t1/2=141 years) isomeric target was Coulomb excited with a 170.5-MeV 40Ar beam. The selectivity of Coulomb excitation, coupled with the sensitivity of Gammasphere plus CHICO, was sufficient to identify 46 new states up to spin 18(ℎ/2π) in at least four rotational bands; 11 of these new states lie in the isomer band, 13 in a previously unknown yrast Kπ=6- rotational band, and 13 in a band tentatively identified as the predicted yrast Kπ=5+ band. The rotational bands based on the Kπ=5- isomer and the 6- bandhead were populated by Coulomb excitation with unexpectedly equal cross sections. The γ-ray yields are reproduced by Coulomb excitation calculations using a two-particle plus rotor model (PRM), implying nearly complete ΔK=1 mixing of the two almost-degenerate rotational bands, but recovering the Alaga rule for the unperturbed states. The degeneracy of the 5- and 6- bands allows for precise determination of the mixing interaction strength V, which approaches the strong-mixing limit; this agrees with the 50% attenuation of the Coriolis matrix element assumed in the model calculations. The fractional admixture of the IKπ=66- state in the nominal 65- isomer band state is measured within the PRM as 45.6-1.1+0.3%. The E2 and M1 strengths coupling the 5- and 6- bands are enhanced significantly by the mixing, while E1 and E2 couplings to other low-K bands are not measurably enhanced. The yields of the 5+ band are reproduced by an E3 strength of ≅15 W.u., competitive with the interband E2 strength. Alignments of the identified two-particle Nilsson states in 242Am are compared with the single-particle alignments in 241Am.

  10. New experimental set-ups for investigating properties of the spontaneously fissionable 242Am isomer in the IBR-30 and IBR-2 pulsed reactors

    International Nuclear Information System (INIS)

    The mean neutron number per isomeric fission event of 242Am is measured. Correlations between the isomeric fission probabilities and the fission widths of neutron resonance of 241Am are investigated. For these experiments neutron time-of-flight spectrometers based on pulsed reactors IBR-30 and IBR-2 at the JINR Dubna are used

  11. 240Pu(n,f), 242Pu(n,f), 237Np(n,f), neutron fission cross sections, Esub(n) = 2.5 MeV

    International Nuclear Information System (INIS)

    Measurements of the absolute neutron fission cross section of 240Pu, 242Pu and 237Np have been made at 2.5 MeV using a hybrid detector. The fission events were detected in an ionization chamber (2π) and the neutron flux was determined by a proton recoil telescope and a directional long counter. Our values are compared to previous data

  12. High-level waste storage tank farms/242-A evaporator Standards/Requirements Identification Document (S/RID), Volume 7. Revision 1

    Energy Technology Data Exchange (ETDEWEB)

    Burt, D.L.

    1994-04-01

    The High-Level Waste Storage Tank Farms/242-A Evaporator Standards/Requirements Identification Document (S/RID) is contained in multiple volumes. This document (Volume 7) presents the standards and requirements for the following sections: Occupational Safety and Health, and Environmental Protection.

  13. High-level waste storage tank farms/242-A evaporator Standards/Requirements Identification Document (S/RID), Volume 7. Revision 1

    International Nuclear Information System (INIS)

    The High-Level Waste Storage Tank Farms/242-A Evaporator Standards/Requirements Identification Document (S/RID) is contained in multiple volumes. This document (Volume 7) presents the standards and requirements for the following sections: Occupational Safety and Health, and Environmental Protection

  14. I. Nuclear Production Reaction and Chemical Isolation Procedure for Americium-240 II. New Superheavy Element Isotopes: Plutonium-242(Calcium-48,5n)(285)114

    Science.gov (United States)

    Ellison, Paul Andrew

    2011-12-01

    Part I discusses the study of a new nuclear reaction and chemical separation procedure for the production of 240Am. Thin 242Pu, natTi, and natNi targets were coincidently activated with protons from the 88-Inch Cyclotron, producing 240Am, 48V, and 57Ni, respectively. The radioactive decay of these isotopes was monitored using high-purity Ge gamma ray detectors in the weeks following irradiation. The excitation function for the 242 Pu(p, 3n)240Am nuclear reaction was measured to be lower than theoretical predictions, but high enough to be the most viable nuclear reaction for the large-scale production of 240 Am. Details of the development of a chemical separation procedure for isolating 240Am from proton-irradiated 242Pu are discussed. The separation procedure, which includes two anion exchange columns and two extraction chromatography columns, was experimentally investi- gated using tracer-level 241Am, 239Pu, and model proton-induced fission products 95Zr, 95Nb, 125Sb, and 152Eu. The separation procedure was shown to have an Am/Pu separation factor of >2x10 7 and an Am yield of ˜70%. The separation procedure was found to purify the Am sample from >99.9% of Eu, Zr, Nb, and Sb. The procedure is well suited for the processing of ˜1 gram of proton-irradiated 242Pu to produce a neutron-induced fission target consisting of tens of nanograms of 240Am. Part II describes the use of the Berkeley Gas-filled Separator at the Lawrence Berkeley National Laboratory 88-Inch Cyclotron for the study of the 242Pu(48Ca,5n)285114 nuclear re- action. The new, neutron-deficient, superheavy element isotope 285114 was produced in 48Ca irradiations of 242Pu targets at a center-of-target beam energy of 256 MeV ( E* = 50 MeV). The alpha decay of 285114 was followed by the sequential alpha decay of four daughter nuclides, 281Cn, 277Ds, 273Hs, and 269 Sg. 265Rf was observed to decay by spontaneous fission. The measured alpha-decay Q-values were compared with those from a macroscopic

  15. Deep vlt spectroscopy of high redshift radio galaxy MRC 2104{242: evidence for a metallicity gradient

    Directory of Open Access Journals (Sweden)

    R. Overzier

    2002-01-01

    Full Text Available En esta contribuci on vamos a presentar observaciones espectrosc opicas profundas del VLT (siglas en ingl es: Very Large Telescope del halo gigante de l neas de emisi on alrededor de la radiogalaxia MRC 2104{242 a z = 2:49. La morfolog a del halo viene determinado por dos regiones espaciales resueltas. Ly se extiende por > 1200 a lo largo del radioeje, C IV 1549 y He II 1640 se extienden por 800. El espectro total es t pico para radiogalaxias de alto corrimiento al rojo. Es interesante notar que N V 1240 est a presente en el espectro de la regi on asociada con el centro de la galaxia que contiene la radiofuente, la regi on del norte, mientras que est a ausente en la regi on del sur. Usando un modelo de fotoionizaci on simple, la diferencia en la emisi on N V 1240 se puede explicar por un gradiente de metalicidad en el halo. Esto es consistente con un escenario en el cual el halo se form o por un "cooling ow" masivo o tiene su origen en los residuos de la fusi on de dos o m as galaxias. Sin embargo, tambi en podr an ser importantes otros mecanismos como son las interacciones entre jets y nubes y los vientos debido a un \\starburst".

  16. Generalized gamma-ray isotopic analysis software and re-evaluation of the two important 242Pu branching ratios

    Energy Technology Data Exchange (ETDEWEB)

    Wang, T; Raschke, K; Roberts, K; Dougan, A

    2009-07-06

    The goal of the generalized gamma-ray analysis software is to provide precise and accurate isotopic analyses of samples that do not have a standard experimental geometry. This analysis tool will analyze gamma-ray data from all types of measurement scenarios with little or no interaction from the user. This tool also provides complete transparency regarding the gamma-ray peaks and branching intensities used in the analysis with the capability for the user to modify this information. They are currently at the data collected phase of building a validated spectral library. One of the by-products in this data collection phase is enabling them to reevaluate the two important branching ratios in {sup 242}Pu. These branching ratios are required for very high burn-up plutonium fuels. The preliminary analysis shows that the energy of the states are 103.5 keV and 158.82 keV, the branching ratio are 1.36E-5 (9%) and 3.37E-6(7%), respectively. More accurate measurements and analysis are currently being carried out.

  17. Configuration management plan for waste tank farms and the 242-A evaporator of tank waste remediation system

    International Nuclear Information System (INIS)

    The configuration management architecture presented in this Configuration Management Plan is based on the functional model established by DOE-STD-1073-93, ''Guide for Operational Configuration Management Program.'' The DOE Standard defines the configuration management program by the five basic program elements of ''program management,'' ''design requirements,'' ''document control,'' ''change control,'' and ''assessments,'' and the two adjunct recovery programs of ''design reconstitution,'' and ''material condition and aging management.'' The CM model of five elements and two adjunct programs strengthen the necessary technical and administrative control to establish and maintain a consistent technical relationship among the requirements, physical configuration, and documentation. Although the DOE Standard was originally developed for the operational phase of nuclear facilities, this plan has the flexibility to be adapted and applied to all life-cycle phases of both nuclear and non-nuclear facilities. The configuration management criteria presented in this plan endorses the DOE Standard and has been tailored specifically to address the technical relationship of requirements, physical configuration, and documentation during the full life cycle of the Waste Tank Farms and 242-A Evaporator of Tank Waste Remediation System

  18. Evaluation of 242Pu data for the incident neutron energy range 0.1 - 6 MeV

    International Nuclear Information System (INIS)

    This report presents the models and the procedures used for the calculation of the quantities required by Files 3, 4 and 5 of ENDF-6 for 242Pu. These quantities are the integrated cross sections for the total, fission, scattering and gamma-capture reactions and the angular and energy distributions of the scattered neutrons for the incident neutron energies 0.01/6 MeV. The direct mechanism was treated with the coupled-channel method using a deformed optical potential defined by a set of actinide region parameters established by the authors. For the compound nucleus calculations, a new HRTW version of the statistical model extended to describe the fission at subbarrier energies was used. To describe the continuous part of the transition states spectrum, analytical expressions have been established. The energy distributions of the scattered neutrons have been calculated with an author's version of the Los Alamos model. The agreement of the calculations with the existing experimental data is good. (author)

  19. Evaluation of nuclear data for 242Pu in the region of resolved and unresolved resonances (10-5 eV-200 keV)

    International Nuclear Information System (INIS)

    Neutron data for 242Pu are evaluated in the resolved and unresolved resonance regions. In the 10-5-1 keV region, the evaluation is based on the Breit-Wigner resonance parameters. In the unresolved resonance region, all types of average cross-section and width are calculated. The authors quote average parameters and cross-sections in the 1-200 keV region and analyse the errors in the evaluated data. (author)

  20. Receiver operating characteristic (ROC) curve analysis of the tumour markers CEA, CA 50 and CA 242 in pancreatic cancer; results from a prospective study.

    OpenAIRE

    Pasanen, P. A.; Eskelinen, M.; Partanen, K.; Pikkarainen, P; Penttilä, I.; Alhava, E

    1993-01-01

    The serum values of the tumour markers carcinoembryonic antigen (CEA), cancer-associated carboanhydrate antigens CA 50 and CA 242 were evaluated in 193 patients with hepatopancreato-biliary diseases by receiver operating characteristic (ROC) curve analysis in order to compare their diagnostic accuracy in pancreatic cancer (n = 26), and to define optimal cut-off levels for the serum values of these tumour markers in the diagnosis of pancreatic cancer. The ROC analysis showed that all marker te...

  1. The use of tumour markers CEA, CA-195 and CA-242 in evaluating the response to chemotherapy in patients with advanced colorectal cancer.

    OpenAIRE

    Ward, U.; Primrose, J N; Finan, P. J.; Perren, T. J.; Selby, P.; Purves, D. A.; Cooper, E H

    1993-01-01

    Tumour markers CEA, CA-195 and CA-242 were measured in 33 patients undergoing chemotherapy for advanced colorectal cancer. The aim was to determine whether they could be used to accurately monitor the course of the disease, and reduce the need for imaging. Treatment with a 5-fluorouracil based regimen resulted in a partial response in nine patients (27%), whereas the remainder either had disease stabilisation or suffered from progression. Before treatment the CEA was elevated in 85% of patien...

  2. A 233U/236U/242Pu/244Pu spike for isotopic and isotope dilution analysis by mass spectrometry with internal calibration

    International Nuclear Information System (INIS)

    The Khlopin Radium Institute prepared on behalf of the IAEA a synthetic mixture of 233U, 236U, 242Pu and 244Pu isotopes. The isotopic composition and elemental concentration of uranium and plutonium were certified on the basis of analyses done by four laboratories of the IAEA Network, using mass spectrometry with internal standardization. The certified values for 233U/236U ratio and the 236U chemical concentration have a coefficient of variation of 0.05%. The latter is fixed by the uncertainty in the 235U/238U ratio of NBS500 used as internal standard. The coefficients of variation of the 244Pu/242Pu ratio and the 242Pu chemical concentration are respectively 0.10% and 0.16% and limited by the uncertainty in the 240Pu/239Pu ratio of NBS947. This four isotope mixture was used as an internal standard as well as a spike, to analyze 30 batches of LWR spent fuel solutions. The repeatability of the mass spectrometric measurements have a coefficient of variation of 0.025% for the uranium concentration, and of 0.039% for the plutonium concentration. The spiking and treatment errors had a coefficient of variation of 0.048%. (author). Refs, figs and tabs

  3. Empiema paraneumónico: caracterización y factores asociados a morbi-mortalidad en 242 casos tratados quirúrgicamente Parapneuminic empyema: characterization and factors associated with morbility and mortality in 242 surgical cases

    Directory of Open Access Journals (Sweden)

    Roberto González L

    2012-03-01

    Full Text Available Objetivos: Describir las características y evaluar los factores asociados a morbi-mortalidad en el empiema paraneumónico (EPN tratado quirúrgicamente. Método: Revisión retrospectiva entre Enero 2000 y Agosto 2006. Se describen características y factores asociados a morbi-mortalidad, se realizó análisis univariado y multivariado utilizando programa SPSS 15.0. Resultados: 242 pacientes tenían EPN (70,6% de los empiemas tratados, 165 (68,2% fueron hombres, edad promedio 52,1 años, 229 (94,6% fueron neumonías adquiridas en la comunidad (NAC y 13 (5,4% intrahospitalarias. Se aisló gérmenes en líquido pleural en 57 (23,6%. Se realizaron 183 (75,6% decorticaciones, 49 (20,2% pleurotomías, 7 (2,9%, cirugías video-asistidas y 3 (1,2% decorticaciones con resección pulmonar. Presentaron complicaciones 65 (26,9%. Fallecieron 16 pacientes (6,6%. Se identificaron variables asociadas a morbi-mortalidad. Conclusiones: El EPN es la causa más frecuente de empiema, la mayoría está asociado a NAC y en pocos se identifican gérmenes. La decorticación es el procedimiento más frecuente. Se identificaron las variables asociadas a morbi-mortalidad en esta serie clínica.Objectives: To describe and evaluate factors associated with morbidity and mortality in surgically treated parapneumonic empyemas (PNE. Method: Retrospective review between January 2000 and August 2006. We described clinical features and we performed univariate and multivariate analysis to find the factors associated with morbidity and mortality. SPSS 15.0 program was used in the statistical analysis. Results: 242 of343 surgically treated empyemas (70.6% were paraneumonic. Of these 165 (68.2% were men, average age 52.1 years, 229 (94.6% were community-acquired pneumonia (CAP and 13 (5.4% nosocomial. Germs were isolated in pleural fluid in 57 (23.6%. Surgical procedures were: 183 (75.6% decortications, 49 (20.2% pleurotomies, 7 (2.9% video-assisted surgery and 3 (1.2% decortications

  4. The C242T polymorphism of the p22-phox gene (CYBA is associated with higher left ventricular mass in Brazilian hypertensive patients

    Directory of Open Access Journals (Sweden)

    Krieger José E

    2011-08-01

    Full Text Available Abstract Background Reactive oxygen species have been implicated in the physiopathogenesis of hypertensive end-organ damage. This study investigated the impact of the C242T polymorphism of the p22-phox gene (CYBA on left ventricular structure in Brazilian hypertensive subjects. Methods We cross-sectionally evaluated 561 patients from 2 independent centers [Campinas (n = 441 and Vitória (n = 120] by clinical history, physical examination, anthropometry, analysis of metabolic and echocardiography parameters as well as p22-phox C242T polymorphism genotyping. In addition, NADPH-oxidase activity was quantified in peripheral mononuclear cells from a subgroup of Campinas sample. Results Genotype frequencies in both samples were consistent with the Hardy- Weinberg equilibrium. Subjects with the T allele presented higher left ventricular mass/height2.7 than those carrying the CC genotype in Campinas (76.8 ± 1.6 vs 70.9 ± 1.4 g/m2.7; p = 0.009, and in Vitória (45.6 ± 1.9 vs 39.9 ± 1.4 g/m2.7; p = 0.023 samples. These results were confirmed by stepwise regression analyses adjusted for age, gender, blood pressure, metabolic variables and use of anti-hypertensive medications. In addition, increased NADPH-oxidase activity was detected in peripheral mononuclear cells from T allele carriers compared with CC genotype carriers (p = 0.03. Conclusions The T allele of the p22-phox C242T polymorphism is associated with higher left ventricular mass/height2.7 and increased NADPH-oxidase activity in Brazilian hypertensive patients. These data suggest that genetic variation within NADPH-oxidase components may modulate left ventricular remodeling in subjects with systemic hypertension.

  5. Pembuatan Model Poros Roda Depan Vespa pada Mesin Bubut CNC EMCOTURN 242 Menggunakan Software AutoCAD 2004 dan Program Simulasi Mastercam X

    OpenAIRE

    Kurniawan

    2011-01-01

    This research aims to make product in the form of vespa front axle model using CNC lathe ET 242. AutoCAD 2004 software is used for making of engineering drawings of vespa front axle model and Mastercam X software has also been used for the machining process planning. The result of design using AutoCAD 2004 software is obtained the technical drawing of vespa front axle model then transferred to the software Mastercam X. In Mastercam X is done through the machining process planning by creating ...

  6. De novo 14q24.2q24.3 microdeletion including IFT43 is associated with intellectual disability, skeletal anomalies, cardiac anomalies, and myopia.

    Science.gov (United States)

    Stokman, Marijn F; Oud, Machteld M; van Binsbergen, Ellen; Slaats, Gisela G; Nicolaou, Nayia; Renkema, Kirsten Y; Nijman, Isaac J; Roepman, Ronald; Giles, Rachel H; Arts, Heleen H; Knoers, Nine V A M; van Haelst, Mieke M

    2016-06-01

    We report an 11-year-old girl with mild intellectual disability, skeletal anomalies, congenital heart defect, myopia, and facial dysmorphisms including an extra incisor, cup-shaped ears, and a preauricular skin tag. Array comparative genomic hybridization analysis identified a de novo 4.5-Mb microdeletion on chromosome 14q24.2q24.3. The deleted region and phenotype partially overlap with previously reported patients. Here, we provide an overview of the literature on 14q24 microdeletions and further delineate the associated phenotype. We performed exome sequencing to examine other causes for the phenotype and queried genes present in the 14q24.2q24.3 microdeletion that are associated with recessive disease for variants in the non-deleted allele. The deleted region contains 65 protein-coding genes, including the ciliary gene IFT43. Although Sanger and exome sequencing did not identify variants in the second IFT43 allele or in other IFT complex A-protein-encoding genes, immunocytochemistry showed increased accumulation of IFT-B proteins at the ciliary tip in patient-derived fibroblasts compared to control cells, demonstrating defective retrograde ciliary transport. This could suggest a ciliary defect in the pathogenesis of this disorder. © 2016 Wiley Periodicals, Inc. PMID:26892345

  7. Developing an Anticancer Copper(II) Pro-Drug Based on the His242 Residue of the Human Serum Albumin Carrier IIA Subdomain.

    Science.gov (United States)

    Qi, Jinxu; Zhang, Yao; Gou, Yi; Zhang, Zhenlei; Zhou, Zuping; Wu, Xiaoyang; Yang, Feng; Liang, Hong

    2016-05-01

    To increase delivery efficiency, anticancer activity, and selectivity of anticancer metal agents in vivo, we proposed to develop the anticancer metal pro-drug based on His242 residue of the human serum albumin (HSA) carrier IIA subdomain. To confirm our hypothesis, we prepared two Cu(II) compounds [Cu(P4 mT)Cl and Cu(Bp44 mT)Cl] by modifying Cu(II) compound ligand structure. Studies with two HSA complex structures revealed that Cu(P4 mT)Cl bound to the HSA subdomain IIA via hydrophobic interactions, but Cu(Bp44 mT)Cl bound to the HSA subdomain IIA via His242 replacement of a Cl atom of Cu(Bp44 mT)Cl, and a coordination to Cu(2+). Furthermore, Cu(II) compounds released from HSA could be regulated at different pHs. In vivo data revealed that the HSA-Cu(Bp44 mT) complex increased copper's selectivity and capacity of inhibiting tumor growth compared to Cu(Bp44 mT)Cl alone. PMID:27017838

  8. Thermal neutron capture cross-section measurements of 243Am and 242Pu using the new mini-INCA α- and γ-spectroscopy station

    International Nuclear Information System (INIS)

    In the framework of the Mini-INCA project, dedicated to the study of Minor Actinide transmutation process in high neutron fluxes, an α- and γ-spectroscopy station has been developed and installed at the High Flux Reactor of the Laue-Langevin Institut. This set-up allows short irradiations as well as long irradiations in a high quasi-thermal neutron flux and post-irradiation spectroscopy analysis. It is well suited to measure precisely, in reference to 59Co cross-section, neutron capture cross-sections, for all the actinides, in the thermal energy region. The first measurements using this set-up were done on 243Am and 242Pu isotopes. Cross-section values, at En=0.025eV, were found to be (81.8+/-3.6)b for 243Am and (22.5+/-1.1)b for 242Pu. These values differ from evaluated data libraries by a factor of 9% and 17%, respectively, but are compatible with the most recent measurements, validating by the way the experimental apparatus

  9. Partial trisomy 9p22 to 9p24.2 in combination with partial monosomy 9pter in a Syrian girl

    Directory of Open Access Journals (Sweden)

    Moassass Faten

    2010-10-01

    Full Text Available Abstract Background Partial trisomy of the short arm of chromosome 9 is among the most common autosomal structural chromosomal anomalies leading to chromosomal imbalance in human. Clinical characteristics are craniofacial dysmorphism including hypertelorism, prominent nose, deep-set eyes, and down-slanting palpebral fissures. The degree of clinical severity in partial trisomy 9p roughly correlates with the size of the chromosomal imbalance. Therefore, breakpoints as well as clinical findings need to be precisely defined for differential diagnosis. Results Chromosomes of a young female were analyzed due to primary amenorrhea, short stature, developmental delay and a characteristic facial appearance. Cytogenetic analysis using GTG banding identified a karyotype 46, XX, add(9pter. Surprisingly the application of high resolution molecular cytogenetic techniques characterized a partial trisomy 9p24.2-p22 and partial monosomy 9pter-p24.2. To the best of our knowledge only four similar case were reported by now. Conclusion Attempts for genotype-phenotype correlations for partial trisomy 9p might have been hampered by the fact that more complex, cryptic aberrations were neither considered nor detected in comparable clinical cases.

  10. A double feedback loop mediated by microRNA-23a/27a/24-2 regulates M1 versus M2 macrophage polarization and thus regulates cancer progression.

    Science.gov (United States)

    Ma, Sisi; Liu, Min; Xu, Zhenbiao; Li, Yanshuang; Guo, Hui; Ge, Yehua; Liu, Yanxin; Zheng, Dexian; Shi, Juan

    2016-03-22

    In response to microenvironmental signals, macrophages undergo different types of activation, including the "classic" pro-inflammatory phenotype (also called M1) and the "alternative" anti-inflammatory phenotype (also called M2). Macrophage polarized activation has profound effects on immune and inflammatory responses, but mechanisms underlying the various types of macrophage is still in its infancy. In this study, we reported that M1-type stimulation could down-regulate miR-23a/27a/24-2 cluster transcription through the binding of NF-κB to this cluster's promoter and that miR-23a in turn activated the NF-κB pathway by targeting A20 and thus promoted the production of pro-inflammatory cytokines. Furthermore, STAT6 occupied the miR-23a/27a/24-2 cluster promoter and activated their transcription in IL-4-stimulated macrophages. In addition, miR-23a in turn suppressed the JAK1/STAT-6 pathway and reduced the production of M2 type cytokines by targeting JAK1 and STAT-6 directly, while miR-27a showed the same phenotype by targeting IRF4 and PPAR-γ. The miR-23a/27a/24-2 cluster was shown to be significantly decreased in TAMs of breast cancer patients, and macrophages overexpressing the miR-23a/27a/24-2 cluster inhibited tumor growth in vivo. Taken together, these data integrated microRNA expression and function into macrophage polarization networks and identified a double feedback loop consisting of the miR-23a/27a/24-2 cluster and the key regulators of the M1 and M2 macrophage polarization pathway. Moreover, miR-23a/27a/24-2 regulates the polarization of tumor-associated macrophages and thus promotes cancer progression. PMID:26540574

  11. ALGUNS ASPECTOS DO MANUSCRITO P-CUG MM 242: OS TENTOS E AS FANTASIAS DE ANTÓNIO CARREIRA E A SUA RELAÇÃO PRÓXIMA COM OS RICERCARI DO LIBRO PRIMO…(1547) DE JACQUES BUUS.

    OpenAIRE

    Oliveira, Filipe

    2011-01-01

    O manuscrito P-Cug MM 242 da Biblioteca Geral da Universidade de Coimbra constitui um dos grandes testemunhos do que foi a realidade da música instrumental em Portugal por volta de meados do século XVI. Em formato de partitura, inclui cópias de motetes, chansons, madrigais e diversas peças instrumentais de alguns dos principais impressos quinhentistas, flamengos e norte italianos. É também no MM 242 que se encontra copiada a totalidade da produção instrumental que até hoje conhecemos de Antón...

  12. RV SONNE Fahrtbericht / Cruise Report SO242-1: JPI OCEANS Ecological Aspects of Deep-Sea Mining, DISCOL Revisited, Guayaquil - Guayaquil (Equador), 28.07.-25.08.2015

    OpenAIRE

    2015-01-01

    Cruise SO242/1 ran from 28 July to 25 August 2015 starting and ending in Guayaquil, Ecuador. In total, 40 scientists from five European countries took part in this cruise of the JPIO project ‚Ecological Aspects of Deep‐Sea Mining‘ to study the ecological long‐term impact of deep sea disturbances. The working area, the DISCOL area in the Peru Basin, was ploughed in 1989 and thoroughly studied in the years thereafter, the last cruise, SO106, happened in 1996. SO242/2 aimed at map...

  13. The synthesis and complex anion-vacancy ordered structure of La0.33Sr0.67MnO2.42

    International Nuclear Information System (INIS)

    The low-temperature topotactic reduction of La0.33Sr0.67MnO3 with NaH results in the formation of La0.33Sr0.67MnO2.42. A combination of neutron powder and electron diffraction data show that La0.33Sr0.67MnO2.42 adopts a novel anion-vacancy ordered structure with a 6-layer OOTOOT' stacking sequence of the 'octahedral' and tetrahedral layers (Pcmb, a=5.5804(1) A, b=23.4104(7) A, c=11.2441(3) A). A significant concentration of anion vacancies at the anion site, which links neighbouring 'octahedral' layers means that only 25% of the 'octahedral' manganese coordination sites actually have 6-fold MnO6 coordination, the remainder being MnO5 square-based pyramidal sites. The chains of cooperatively twisted apex-linked MnO4 tetrahedra adopt an ordered -L-R-L-R- arrangement within each tetrahedral layer. This is the first published example of a fully refined structure of this type which exhibits such intralayer ordering of the twisted tetrahedral chains. The rationale behind the contrasting structures of La0.33Sr0.67MnO2.42 and other previously reported reduced La1-xSrxMnO3-y phases is discussed. - Graphical Abstract: The topotactic reduction of the perovskite phase La0.33Sr0.67MnO3 with NaH yields La0.33Sr0.67MnO2.42(3), which adopts a novel anion vacancy ordered structure with a 6-layer OOTOOT' stacking sequence of the 'octahedral' and tetrahedral layers. The anion site that links the neighbouring octahedral layers is partially occupied so only 25% of the 'octahedral' manganese sites actually have 6-fold MnO6 coordination. Highlights: → Topotactic reduction with NaH to form a mixed valent Mn2+/Mn3+ phase. → Novel layered anion-vacancy ordered structure. → Comparison to related brownmillerite structure types.

  14. Neutron-induced fission cross sections of 242Pu from 0.3 MeV to 3 MeV

    Science.gov (United States)

    Salvador-Castiñeira, P.; Bryś, T.; Eykens, R.; Hambsch, F.-J.; Göök, A.; Moens, A.; Oberstedt, S.; Sibbens, G.; Vanleeuw, D.; Vidali, M.; Pretel, C.

    2015-10-01

    The majority of the next generation of nuclear power plants (GEN-IV) will work in the fast-neutron-energy region, as opposed to present day thermal reactors. This leads to new and more accurate nuclear-data needs for some minor actinides and structural materials. Following those upcoming demands, the Organisation for Economic Cooperation and Development Nuclear Energy Agency performed a sensitivity study. Based on the latter, an improvement in accuracy from the present 20% to 5% is required for the 242Pu(n ,f ) cross section. Within the same project both the 240Pu(n ,f ) cross section and the 242Pu(n ,f ) cross section were measured at the Van de Graaff accelerator of the Joint Research Centre at the Institute for Reference Materials and Measurements, where quasimonoenergetic neutrons were produced in an energy range from 0.3 MeV up to 3 MeV. A twin Frisch-grid ionization chamber has been used in a back-to-back configuration as fission-fragment detector. The 242Pu(n ,f ) cross section has been normalized to three different isotopes: 237Np(n ,f ) , 235U(n ,f ) , and 238U(n ,f ) . A comprehensive study of the corrections applied to the data and the uncertainties associated is given. The results obtained are in agreement with previous experimental data at the threshold region up to 0.8 MeV. The resonance-like structure at 0.8 to 1.1 MeV, visible in the evaluations and in most previous experimental values, was not reproduced with the same intensity in this experiment. For neutron energies higher than 1.1 MeV, the results of this experiment are slightly lower than the Evaluated Nuclear Data File/B-VII.1 evaluation but in agreement with the experiment of Tovesson et al. (2009) as well as Staples and Morley (1998). Finally, for energies above 1.5 MeV, the results show consistency with the present evaluations.

  15. Oxidation-reduction properties of americium, curium, berkelium, californium, einsteinium and fermium, and thermodynamic consequences for the 5f series

    International Nuclear Information System (INIS)

    The amalgamation of 5f elements from Am to Fm has been studied by using 241Am, 244Cm, 249Bk, 249Cf, 252Cf, 253Es, 254Es, 252Fm and 255Fm with two electrochemical methods, radiocoulometry and radiopolarography, perfectly adapted to investigate extremely diluted solutions when the concentration of electroactive species is as low as 10-16M. The theory of radiocoulometry has been developed in the general cases of reversible and irreversible electrode process. It has been used to interpret the experimental data on the kinetic curves of amalgamation, and to estimate the standard rate constant of the electrode process in complexing medium (citric). On the other hand the radiopolarographic method has been applied to study the mechanism of reduction at the dropping mercury electrode of cations M3+ in aqueous medium to the metal M with formation of amalgam. The results are exploited into two directions: 1- Acquisition of some data concerning the oxidation-reduction properties of elements from Am to Fm. Therefore the standard electrode E0 [M(III-0)] potentials for Bk, Cf and Es, and the standard electrode E0 [M(II-0)] potential for Fm are estimated and the relative stability of each oxidation state (from II to VII) of 5f elements is discussed; 2- Acquisition of unknown thermodynamic data on transcalifornium elements. Correlations between 4f and 5f elements are precised and some divergences appear for the second half of 4f and 5f series (i.e. for 65<=Z<=71 and 97<=Z<=103)

  16. Evaluation of thermal neutron cross-sections and resonance integrals of protactinium, americium, curium, and berkelium isotopes

    International Nuclear Information System (INIS)

    Data on the thermal neutron fission and capture cross-sections as well as their corresponding resonance integrals are reviewed and analysed. The data are classified according to the form of neutron spectra under investigation. The weighted mean values of the cross-sections and resonance integrals for every type of neutron spectra were adopted as evaluated data. (author). 87 refs, 2 tabs

  17. Simultaneous measurement of 239Pu, 240Pu, 241Pu, and 242Pu by high resolution inductively coupled plasma mass spectrometer (HR ICP-MS) in marine sediments

    International Nuclear Information System (INIS)

    Transuranics elements are of particular interest in radioecological studies because of their radiotoxicity and their potential use to decipher source fingerprints and transport processes. The simultaneous measurement of 239Pu, 240Pu, 241Pu, and 242Pu in environmental samples requires a specific chemical procedure. This work deals with an analytical procedure which yields a very high grade of purification of Pu suitable for ultra low level detection by HR ICP-MS, from marine sediments. After the elimination of major elements (Fe, Al, Mg...) by a first chromatographic separation, a new device of purification by solvent extraction and concentration by a second chromatographic separation is used to obtain a concentrated and high purified solution of plutonium. The chemical procedure have been validated on IAEA certified sediment samples and on sediment samples collected in the roads of Cherbourg which had been previously analysed by other techniques (a spectrometry and thermo-ionisation mass spectrometer). (author)

  18. Microwave dielectric properties and microstructure of Ba2-xSm4+2x/3Ti8+yO24+2y ceramics

    International Nuclear Information System (INIS)

    The microstructure and microwave dielectric properties of barium samarium titanium oxide Ba2-xSm4+2x/3Ti8+yO24+2y (x=0.1, y=0∼2) ceramics (BST) were investigated. The optimum compositions of BST ceramics were synthesized and discussed base on the structure formula of the tungsten-bronze-type crystal phase. Differential thermal analysis (DTA) was used to select the suitable sintering temperatures. The relative dielectric constant of the BST compositions saturated in a range from 63 to 85. Qxf values of 8500-13000 (GHz) were obtained for various y values in dense samples. The temperature coefficient of resonant frequency τf was adjusted from a negative -12 ppm per deg. C value to a positive value 17 ppm per deg. C. X-ray diffraction, SEM and EDS analysis were used to investigate the microstructure and correlate its relationship with microwave dielectric properties of BST ceramics

  19. Method for Determination of Neptunium in Large-Sized Urine Samples Using Manganese Dioxide Coprecipitation and 242Pu as Yield Tracer

    DEFF Research Database (Denmark)

    Qiao, Jixin; Hou, Xiaolin; Roos, Per

    2013-01-01

    A novel method for bioassay of large volumes of human urine samples using manganese dioxide coprecipitation for preconcentration was developed for rapid determination of 237Np. 242Pu was utilized as a nonisotopic tracer to monitor the chemical yield of 237Np. A sequential injection extraction...... 100% and high separation capacity of processing up to 5 L of human urine samples. The MnO2 coprecipitation process is simple and straightforward in which a batch (8–12) of samples can be pretreated within 4 h (i.e., <0.5 h/sample). In connection with the automated column separation and ICPMS...... quantification, which takes less than 1.5 h in total, the overall analytical time was on average less than 2 h for each sample. The high effectiveness and sample throughput make the developed method well suited for urine bioassay of 237Np in routine monitoring of occupationally internal radiation exposure and...

  20. Separation and activity determination of 239+240Pu, 241Am and Curium (242and244Cm) in evaporator concentrate by Alpha Spectrometry

    International Nuclear Information System (INIS)

    Alpha spectrometry analysis was used for activity determinations of Pu, Am and Cm isotopes in evaporator concentrate samples from nuclear power plants. Using a sequential procedure the first step was Pu isolation by an anion exchange column followed by an Am and Cm separation of U and Fe by a co-precipitation with oxalic acid. The precipitate was used for americium and curium separation of strontium by using a TRU resin extraction chromatography column. Due to their chemical similarities and energy difference it was seen that the simultaneous determination of 241Am, 242Cm and 243,244Cm isotopes is possible using the 243Am as tracer, once they have peaks in different region of interest (ROI) in the alpha spectrum. In this work it was used tracers, 238Pu, 243Am, 244Cm and 232U, for determination and quantification of theirs isotopes, respectively. The standard deviations for replicate analysis were calculated and for 241Am it was (1,040 ± 160 mBqKg-1), relative standard deviation 15.38%, and for 239+240Pu it was (551 +- 44 mBqKg-1), relative standard deviation 7.98%. In addition, for the 242Cm isotope the standard deviation for determinations was(75 ± 23 mBqKg-1), with the relative standard deviation 30.67% higher than for 241Am and 239+240Pu. The radiometric yields ranged from 90% to 105% and the lower limit of detection was estimated as being 2.05 mBqKg-1. (author)

  1. The relationship between NAD(P)H oxidase p22phox C242T polymorphism and stroke in the population of Han nationality of Shanghai city%中国上海汉族人群NAD(P)H氧化酶p22phox亚基C242T基因多态性与脑卒中相关性

    Institute of Scientific and Technical Information of China (English)

    李洪涛; 顾彬; 于芳苹; 赵迎春; 娄晓丽; 梁冬雨

    2013-01-01

    目的:研究NAD(P)H氧化酶p22phox亚基C242T基因多态性与脑卒中的相关性.方法:收集118例脑出血患者、125例脑梗死患者和147例正常对照组,研究对象均来自上海地区汉族人群,3组在年龄、性别构成比、体质指数(BMI)等基线指标均没有明显差异,分别进行血糖、血脂等各项指标的测定,用聚合酶链反应、限制性片段长度多态性分析(PCR-RFLP)和基因测序方法比较其在不同人群中的基因突变频率.结果:脑出血组、脑梗死组CT+ TT基因型(9.3%、9.6%)和T等位基因(4.7%、5.2%),均明显高于对照组(2.0%和1.0%,P< 0.05),脑梗死组中发现1例TT基因型,出血组与正常对照组均未发现TT基因型,与基因测序结果一致.采用二分类Logistic回归分析p22phox亚基C242T基因多态性与脑出血的相关性(β=1.712,OR=5.537,95%CI:1.120~27.381,P=0.036),与脑梗死的相关性(B=1.432,OR=4.187,95%CI:0.934~18.774,P=0.061),表明C242T基因多态性可能是脑出血、脑梗死的危险因素.结论:NAD(P)H氧化酶p22phox亚基C242T多态性与脑出血、脑梗死均有一定的相关性,可能是脑卒中的一个危险因素.但与高血压和饮酒等传统危险因素相比,C242T多态性对脑梗死的影响并不显著.%Objective:To investigate the relationship between the NAD (P)H oxidase p22phox C242T gene polymorphism and stroke.Methods:In this study,118 cases of cerebral hemorrhage,125 cases of cerebral infarction and 147 healthy controls were included,all cases are Han people in Shanghai region of China.Three groups had same baseline features of age,sexual proportion and BMI.Fasting glucose,and serum lipids were tested.The genotype and allele frequencies of the p22phox C242T polymorphism were determined by polymemse chain reaction-restriction fragment length polymorphism (PCR-RFLP) and gene sequencing technology.Results:The CT+TT genotype frequencies in the cecebral hemorrhage group,cerebral infarction group

  2. Apparent molar volumes of aqueous calcium chloride to 250{degrees}C, 400 bars, and from molalities of 0.242 to 6.150

    Energy Technology Data Exchange (ETDEWEB)

    Oakes, C.S.; Bodnar, R.J. [Virginia Polytechnic Inst. and Univ., Blacksburg, VA (United States); Simonson, J.M. [Univ. of California, Berkeley, CA (United States)

    1995-09-01

    Relative densities of CaCl{sub 2}(aq) with 0.242 {le} m/(mol-kg{sup {minus}1}) {le} 6.150 were measured with vibrating-tube densimeters between 25 and 250{degrees}C and near 70 and 400 bars. Apparent molar volumes V{sub {null}} calculated from the measured density differences were represented with the Pitzer ion-interaction treatment, with appropriate expressions chosen for the temperature and pressure dependence of the virial coefficients of the model. It was found that the partial molar volume at infinite dilution V{sub {null}}{sup o}, and the second and third virial coefficients B{sup v} and C{sup v}, were necessary to represent V{sub {null}} near the estimated experimental uncertainty. The ionic-strength dependent {Beta}{sup 1}{sup v} term in the B{sup v} coefficient was included in the fit. The representation for V{sub {null}} has been integrated with respect to pressure to establish the pressure dependence of excess free energies over the temperature range studied. The volumetric data indicate that the logarithm of the mean ionic activity coefficient, ln {gamma}{plus_minus}(CaCl{sub 2}), increases by a maximum of 0.3 at 400 bars, 250{degrees}C, and 6 mol-kg{sup {minus}1} as compared with its value at saturation pressure.

  3. Hypoxia Enhances the Toxicity of Corexit EC9500A and Chemically Dispersed Southern Louisiana Sweet Crude Oil (MC-242 to Sheepshead Minnow (Cyprinodon variegatus Larvae.

    Directory of Open Access Journals (Sweden)

    Subham Dasgupta

    Full Text Available Oil exploration and production activities are common in the northern Gulf of Mexico as well as many other coastal and near coastal areas worldwide. Seasonal hypoxia is also a common feature in the Northern Gulf, and many other coastal areas, which is likely to increase in severity and extent with continuing anthropogenic nutrient inputs. Hypoxia has well established physiological effects on many organisms, and it has been shown to enhance the toxicity of polycyclic aromatic hydrocarbons (persistent components of petroleum in fish. The goal of this study was to examine the combined effects of hypoxia and exposure to contaminants associated with oil spills. We evaluated the effects of short term (48 hr exposures to Corexit EC9500A, water accommodated fractions (WAF, and chemically enhanced water accommodated fractions (CEWAF prepared from Southern Louisiana Sweet Crude Oil (MC 242 on survival of sheepshead minnow (Cyprinodon variegatus larvae held under normoxic (ambient air or hypoxic (2 mg/L O2 conditions. Results demonstrated that hypoxia significantly enhances mortality observed in response to Corexit or CEWAF solutions. In the latter case, significant interactions between the two stressors were also observed. Our data supports the need to further evaluate the combined stresses imparted by hypoxia and exposure to petroleum hydrocarbons and dispersants.

  4. Micromegakaryocytes in a patient with partial deletion of the long arm of chromosome 11 [del(11)(q24.2qter)] and chronic thrombocytopenic purpura

    Energy Technology Data Exchange (ETDEWEB)

    Gangarossa, S.; Mattina, T.; Romano, V.; Milana, G.; Mollica, F.; Schiliro, G. [Universita di Catania (Italy)

    1996-03-15

    Thrombocytopenia or pancytopenia is frequently reported in patients with partial 11q deletion but there are no reports on bone marrow morphology of these patients. We report on a patient with partial deletion of the long arm of chromosome 11 [del(11)(q24.2qter)] and its classical clinical manifestations including chronic thrombocytopenic purpura in whom micromegakaryocytes were found in the bone marrow aspirate. This is the first report of the presence of micromegakaryocytes in the bone marrow of a patient with 11q deletion. Accurate examination of the bone marrow of other patients with the 11q deletion may clarify whether the observation of micromegakaryocytes is common in these patients. Micromegakaryocytes may indicate a defect of development. Two genes for two DNA binding proteins that are likely to be involved in hematopoiesis map in the 11q region: Ets-1, that maps to 11q24, close to D11S912, and the nuclear-factor-related-kB gene that maps to 11q24-q25. It is possible that these genes, when present in only one copy, result in thrombocytopenia or pancytopenia as observed in this patient. 23 refs., 2 figs., 1 tab.

  5. Micromegakaryocytes in a patient with partial deletion of the long arm of chromosome 11 [del(11)(q24.2qter)] and chronic thrombocytopenic purpura.

    Science.gov (United States)

    Gangarossa, S; Mattina, T; Romano, V; Milana, G; Mollica, F; Schilirò, G

    1996-03-15

    Thrombocytopenia or pancytopenia is frequently reported in patients with partial 11q deletion but there are no reports on bone marrow morphology of these patients. We report on a patient with partial deletion of the long arm of chromosome 11 [del(11)(q24.2qter)] and its classical clinical manifestations including chronic thrombocytopenic purpura in whom micromegakaryocytes were found in the bone marrow aspirate. This is the first report of the presence of micromegakaryocytes in the bone marrow of a patient with 11q deletion. Accurate examination of the bone marrow of other patients with the 11q deletion may clarify whether the observation of micromegakaryocytes is common in these patients. Micromegakaryocytes may indicate a defect of development. Two genes for two DNA binding proteins that are likely to be involved in hematopoiesis map in the 11q region: Ets-1, that maps to 11q24, close to D11S912, and the nuclear-factor-related-kB gene that maps to 11q24-q25. It is possible that these genes, when present in only one copy, result in thrombocytopenia or pancytopenia as observed in this patient. PMID:8882392

  6. Excited levels of 238Np from spectroscopic measurements of the 237Np(n,γ)238Np reaction and /sup 242m/Am alpha decay

    International Nuclear Information System (INIS)

    The gamma rays and conversion electrons emitted following neutron capture in a 237Np target have been measured by use of the GAMS and BILL spectrometers at Grenoble. Gamma ray and alpha particle measurements of /sup 242m/Am alpha decay (Ge(Li)γ singles, γ-γ coincidences, α singles) have been made at Livermore. The data from these measurements have been combined with earlier measurements (Ionescu 1979, Asaro 1964) to produce a more detailed level scheme for 238Np. Approximately 36 levels have been identified from all of the experimental evidence. The experimentally-observed bandhead energies can be compared with predicted values derived from a simple linear addition of excitation energies observed in neighboring odd-mass nuclei. Values for the Gallagher-Moszkowski splitting of each configurational pair were obtained from theoretical calculations (Piepenbring 1978). We have assigned configurations to ten rotational bands whose bandhead energies range from 0 to 342 keV and which represent all but one of the configurations predicted to occur below 385 keV

  7. SOME ASPECTS OF MANUSCRIPT P-CUG MM 242: ANTÓNIO CARREIRA´S KEYBOARD TENTOS AND FANTASIAS IN ITS CLOSE RELATION WITH JACQUES BUUS´S RICERCARI FROM HIS LIBRO PRIMO…(1547).

    OpenAIRE

    Oliveira, Filipe

    2011-01-01

    Manuscript P-Cug MM 242 from the Biblioteca Geral da Universidade de Coimbra contains important evidence regarding mid-sixteenth century instrumental practice in Portugal. In score-format, it includes copies of motets, chansons, madrigals and instrumental works from some of the most important Flemish and North Italian sixteenth century prints. Additionally, it contains all the music that we know so far by the most important sixteenth century Portuguese keyboard composer, António Carreira. The...

  8. A prospective study of serum tumour markers carcinoembryonic antigen, carbohydrate antigens 50 and 242, tissue polypeptide antigen and tissue polypeptide specific antigen in the diagnosis of pancreatic cancer with special reference to multivariate diagnostic score.

    OpenAIRE

    Pasanen, P. A.; Eskelinen, M.; Partanen, K.; Pikkarainen, P; Penttilä, I.; Alhava, E

    1994-01-01

    The aim of this study was to assess by a stepwise multivariate discriminant analysis the value of four current serum tumour markers - carcinoembryonic antigen (CEA), carbohydrate antigen (CA) 50 and CA 242 and tissue polypeptide antigen (TPA) - and a new serum tumour marker, tissue polypeptide specific antigen (TPS), in the diagnosis of pancreatic cancer. The serum values were measured in a prospective series of patients with jaundice, with unjaundiced cholestasis and with a suspicion of chro...

  9. Association of the NAD(P)H oxidase p22 phox gene C242T polymorphism with type 2 diabetes mellitus, diabetic nephropathy, and carotid atherosclerosis with type 2 diabetes mellitus: A meta-analysis

    OpenAIRE

    Tao Li; Hai-feng Xi; Hong-min Luo; Wen-xuan Liu; Xia Gao; Dian-wu Liu; Lei Yang

    2015-01-01

    Background: Several epidemiological studies have evaluated the association between the NAD(P)H oxidase p22 phox gene C242T polymorphism and the risk of type 2 diabetes mellitus (T2DM), diabetic nephropathy (DN), and carotid atherosclerosis with T2DM (CA), but the results are inconclusive. This meta-analysis was therefore designed to clarify these controversies. Methods: Systematic searches were performed using electronic databases such as MEDLINE, PubMed, EMBASE, and China National Knowled...

  10. Independent prognostic value of preoperative serum markers CA 242, specific tissue polypeptide antigen and human chorionic gonadotrophin beta, but not of carcinoembryonic antigen or tissue polypeptide antigen in colorectal cancer.

    OpenAIRE

    Carpelan-Holmström, M; Haglund, C.; Lundin, J; Alfthan, H.; Stenman, U H; Roberts, P. J.

    1996-01-01

    The prognostic value of preoperative serum concentrations of carcinoembryonic antigen (CEA), CA 242, tissue polypeptide antigen (TPA), specific tissue polypeptide antigen (TPS) and human chorionic gonadotrophin beta (hCG beta) in 251 patients with colorectal cancer (39 Dukes' A, 98 Dukes' B, 56 Dukes' C and 58 Dukes' D) was investigated. When using the cut-off levels recommended for diagnostic purposes, there was a significantly longer overall survival in patients with low tumour marker level...

  11. «Some aspects of P-Cug, MM 242: António Carreira’s keyboard tentos and fantasias and their close relationship with Jacques Buus’s ricercari from his Libro primo (1547)»

    OpenAIRE

    Oliveira, Filipe Mesquita de

    2013-01-01

    Manuscript P-Cug MM 242 from the Biblioteca Geral da Universidade de Coimbra contains important evidence regarding mid-sixteenth century instrumental practice in Portugal. In score-format, it includes copies of motets, chansons, madrigals and instrumental works from some of the most important Flemish and North Italian sixteenth century prints. Additionally, it contains all the music that we know so far by the most important sixteenth century Portuguese keyboard composer, António Carreira. The...

  12. CHLOROPHYLL A, growth rate and graze rate (or grazing rate) site samples data collected in the Gulf of Alaska on the ALPHA HELIX cruises HX242, HX244 and others as part of the NEP project from 2001-04-18 to 2003-08-10 (NODC Accession 0114241)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NODC Accession 0114241 includes site samples and biological data collected aboard the ALPHA HELIX during cruises HX242, HX244, HX247, HX271 and HX275 in the Gulf of...

  13. SILICATE, WATER TEMPERATURE, FLUORESCENCE, PHOTOSYNTHETIC ACTIVE RADIATION (PAR) and other profile and discrete sample data collected in the Gulf of Alaska on the ALPHA HELIX cruises HX242, HX244 and others as part of the NEP project from 2001-04-18 to 2003-08-11 (NODC Accession 0113348)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NODC Accession 0113348 includes profile, discrete sample, biological, chemical and physical data collected aboard the ALPHA HELIX during cruises HX242, HX244,...

  14. SALINITY, WATER TEMPERATURE, FLUORESCENCE, PHOTOSYNTHETIC ACTIVE RADIATION (PAR) and other profile data collected in the Gulf of Alaska on the ALPHA HELIX cruises HX242, HX244 and others as part of the NEP project from 2001-04-18 to 2003-08-11 (NODC Accession 0115255)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NODC Accession 0115255 includes profile, biological and physical data collected aboard the ALPHA HELIX during cruises HX242, HX244, HX247, HX271 and HX275 in the...

  15. Fission barrier determinations and fragment angular correlations for the 244Pu, 242Pu, 240U, 238U, 234Th, and 232Th compound nuclei from (t, pf) reactions

    International Nuclear Information System (INIS)

    Fission probabilities and the angular distribution of the fission fragments have been measured for six even-even compound nuclear systems using the (t, pf) reaction. Angular correlations of fission fragments obtained in these experiments provide information about the low-lying collective excitations or transition states at the fission barrier. The (t, p) reaction in particular leads to neutron-rich residual nuclei unobtainable by other methods. The absence of spin coupling for (t, p) reactions on even-even targets provides angular distributions with well defined structure in the region of the fission barrier. The experimental data were obtained using an 18-MeV triton beam on targets of 242Pu, 240Pu, 238U, 236U, 232Th and 230Th at Los Alamos Van-de-Graaff accelerator facility. Outgoing protons were detected at 140 deg relative to the incident triton beam. Excitation energies ranging from 3.0 to 9.0 MeV were obtained in these experiments. Fission fragment angular distributions were measured at 24 angles from 0 deg to 140 deg relative to the kinematic recoil angle. The data were fitted to a series of even Legendre polynomials W(θ) = A0 [1 + ΣL gL PL (cos θ)] and the coefficients g2 through g12 and A0 were determined as a function of excitation energy. The fission probability Pf was obtained from the ratio of A0 to the (t, p) cross-section for the target nucleus. The results exhibit well defined structure in the angular coefficients which correlates with structure in the fission probability for most of the nuclei studied. In an attempt to interpret this observed structure the experimentally determined fitting parameters Pf and g are compared with calculated results of a microscopic model. This model takes into consideration the penetrability and angular dependence of fission through each member of the various transition bands at the saddle point and appropriately sums the results for comparison with the data. The effects of barrier penetration through a two

  16. Effects of a superantigen-antibody recombinant fusion protein (r-C242 Fab-SEA) on toxicological responses in the anaesthetised rabbit

    International Nuclear Information System (INIS)

    The objective was to study toxin-induced effects on physiological parameters in the rabbit and whether these parameters show dose-response and co-variation after administration of a recombinant fusion protein between staphylococcal enterotoxin (SE) and the Fab fragment of an antibody. Rabbits are very sensitive to SE toxins and the cardiovascular and immune effects are similar to those observed in septic shock in man. The test compound, r-C242 Fab-SEA, was administered intravenously to anaesthetised New Zealand white rabbits at doses in the range of 0.00005-50 μg/kg. All rabbits were checked for titres of anti-SEA antibodies before entering the experiment, since they could neutralise the effect of the test compound. Heart rate, blood pressure and body temperature were continuously monitored before and during 6 h after dosing. Immediately before the start of administration and 3 and 6 h during the experiment, blood gases (pO2 and pCO2), pH, haematology, clinical chemistry, cytokine response (TNF-α) and trace elements (Mn, Cu, Zn, Se, Ag, Cd, Hg and Pb) were measured. No mortality occurred, but at 50 μg/kg severe adverse clinical signs developed. The decrease in blood pressure was weakly dose-related. Heart rate, ECG, body temperature, pCO2 and pH were not affected by the treatment. pO2 tended to increase as a function of time, but not in relation to dose. WBC and PLT decreased dose dependently. TNF-α was not affected by the treatment. The major effects on clinical chemistry were a dose-dependent increase in AST and creatinine. Potassium and urea showed dose dependent increases, mainly at higher doses, though these changes were of less value for drug selection purposes. Trace element changes were observed, including an increase in Mn and a decrease of Zn at all doses. The Cu/Zn ratio decreased below normal at low doses, whereas at high doses in which adverse effects developed, it increased above normal. Post mortem examination revealed minimal to moderate dose

  17. Measurement of the Neutron Capture Cross Sections of $^{233}$U, $^{237}$Np, $^{240,242}$Pu, $^{241,243}$Am and $^{245}$Cm with a Total Absorption Calorimeter at n_TOF

    CERN Multimedia

    Beer, H; Wiescher, M; Cox, J; Rapp, W; Embid, M; Dababneh, S

    2002-01-01

    Accurate and reliable neutron capture cross section data for actinides are necessary for the poper design, safety regulation and precise performance assessment of transmutation devices such as Fast Critical Reactors or Accelerator Driven Systems (ADS). The goal of this proposal is the measurement of the neutron capture cross sections of $^{233}$U, $^{237}$Np, $^{240,242}$Pu, $^{241,243}$Am and $^{245}$Cm at n_TOF with an accuracy of 5~\\%. $^{233}$U plays an essential role in the Th fuel cycle, which has been proposed as a safer and cleaner alternative to the U fuel cycle. The capture cross sections of $^{237}$Np,$^{240,242}$Pu, $^{241,243}$Am and $^{245}$Cm play a key role in the design and optimization of a strategy for the Nuclear Waste Transmutation. A high accuracy can be achieved at n_TOF in such measurements due to a combination of features unique in the world: high instantaneous neutron fluence and excellent energy resolution of the facility, innovative Data Acquisition System based on flash ADCs and t...

  18. The fission cross sections of 230Th, 232Th, 233U, 234U, 236U, 238U, 237Np, 239Pu and 242Pu relative 235U at 14.74 MeV neutron energy

    International Nuclear Information System (INIS)

    The measurement of the fission cross section ratios of nine isotopes relative to 235U at an average neutron energy of 14.74 MeV is described with particular attention to the determination of corrections and to sources of error. The results are compared to ENDF/B-V and to other measurements of the past decade. The ratio of the neutron induced fission cross section for these isotopes to the fission cross section for 235U are: 230Th - 0.290 +- 1.9%; 232Th - 0.191 +- 1.9%; 233U - 1.132 +- 0.7%; 234U - 0.998 +- 1.0%; 236U - 0.791 +- 1.1%; 238U - 0.587 +- 1.1%; 237Np - 1.060 +- 1.4%; 239Pu - 1.152 +- 1.1%; 242Pu - 0.967 +- 1.0%. 40 refs., 11 tabs., 9 figs

  19. Measurements of Cross Sections and Decay Properties of the Isotopes of Elements 112, 114 and 116 Produced in the Fusion Reactions $^{233,238}$U, $^{242}$Pu, and $^{248}$Cm + $^{48}$Ca

    CERN Document Server

    Oganessian, Yu T; Utyonkov, V K; Lobanov, Yu V; Abdullin, F S; Polyakov, A N; Shirokovsky, I V; Tsyganov, Yu S; Gulbekyan, G G; Bogomolov, S L; Gikal, B N; Mezentsev, A N; Iliev, S; Subbotin, V G; Sukhov, A M; Voinov, A A; Buklanov, G V; Subotic, K M; Zagrebaev, V I; Itkis, M G; Patin, J B; Moody, K J; Wild, J F; Stoyer, M A; Stoyer, N J; Shaughnessy, D A; Kenneally, J M; Wilk, P A; Lougheed, R W; Ilkaev, R I; Vesnovskii, S P

    2004-01-01

    We have studied the dependence of the production cross-sections of the isotopes $^{282,283}$112 and $^{286,287}$114 on the excitation energy of the compound nuclei $^{286}$112 and $^{290}$114. The maximum cross-section values of the \\textit{xn}-evaporation channels for the reaction $^{238}$U($^{48}$Ca, \\textit{xn})$^{286 - x}$112 were measured to be: $\\sigma _{3n}=2.5_{-1.1}^{ + 1.8} $pb and $\\sigma _{4n}=0.6_{ - 0.5}^{ + 1.6} $ pb; for the reaction $^{242}$Pu($^{48}$Ca, \\textit{xn})$^{290 - x}$114: $\\sigma _{2n}\\sim 0.5$ pb, $\\sigma _{3n}=3.6_{- 1.7}^{ + 3.4} $ pb and $\\sigma _{4n}=4.5_{ - 1.9}^{ + 3.6} $ pb. In the reaction $^{233}$U($^{48}$Ca, 2--4$n$)$^{277 - 279}$112 at $E^*=34.9\\pm $2.2 MeV we measured an upper cross-section limit of $\\sigma _{xn} \\leqslant 0.6$ pb. The observed shift of the excitation energy associated with the maximum sum evaporation residue cross section $\\sigma _{\\rm {ER}}(E^*)$ to values significantly higher than that associated with the calculated Coulomb barrier can be caused by ...

  20. Prevalência e padrão de distribuição das doenças cerebrovasculares em 242 idosos, procedentes de um hospital geral, necropsiados em Belo Horizonte, Minas Gerais, no período de 1976 a 1997 Prevalence and types of cerebrovascular diseases in 242 hospitalized elderly patients, autopsied in Belo Horizonte, Minas Gerais, Brazil, from 1976 to 1997

    Directory of Open Access Journals (Sweden)

    José Eymard H. Pittella

    2002-03-01

    Full Text Available OBJETIVO: Descrever a prevalência e os tipos das doenças cerebrovasculares (DCVs em indivíduos idosos necropsiados. MÉTODO: Foram consultados os laudos neuropatológicos de 242 pacientes com idade igual ou superior a 61 anos, procedentes em sua maioria do Hospital das Clínicas da Universidade Federal de Minas Gerais, em Belo Horizonte, Minas Gerais, e necropsiados consecutivamente no período 1976 a 1997. RESULTADO: Os principais grupos de doenças do sistema nervoso central (SNC foram representados por DCVs (71,9%, infecções (12,4%, neoplasias (7,1%, traumatismos crânio-encefálicos (3,7%, doenças nutricionais (2,5% e doenças degenerativas (1,7%. As DCVs mais frequentes foram: aterosclerose (61,2%, doença cerebrovascular hipertensiva (25,6% e infarto cerebral (14,9%. Observou-se aumento da frequência e da gravidade da aterosclerose e da frequência da doença cerebrovascular hipertensiva com o avançar da idade. Houve associação significativa entre doença cerebrovascular hipertensiva e aterosclerose. As DCVs foram clinicamente sintomáticas e as responsáveis diretas pelo óbito em 42,7% e 17,3% dos pacientes, respectivamente. CONCLUSÃO: As DCVs constituíram o principal grupo de doenças do SNC no idoso. A aterosclerose e a doença cerebrovascular hipertensiva foram as principais doenças deste grupo, notando-se aumento de sua frequência com o avançar da idade e associação significativa entre ambas.OBJECTIVE: To describe the prevalence and the types of cerebrovascular diseases (CVDs in autopsied elderly individuals. METHOD: Consecutive clinical charts and neuropathological reports of 242 patients aged 61 years or older were reviewed. The patients died in Hospital das Clínicas, Federal University of Minas Gerais, in Belo Horizonte, Minas Gerais, Brazil, from 1976 to 1997. RESULTS: The prevalent diseases of the central nervous system (CNS found in decreasing order were: CVDs (71.9%, infections (12.4%, neoplasms (7.1%, head

  1. 24 CFR 242.1 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... donors, and all other revenues and accounts receivable from whatever source paid or payable. All... financial statements and as of the date of distribution; (4) Days in Accounts Receivable are less than or.... Mortgage Reserve Fund means a trust account, or an account held by the mortgagee, for and on behalf of...

  2. 24 CFR 242.54 - Nondiscrimination.

    Science.gov (United States)

    2010-04-01

    ... all applicable civil rights laws and regulations, including 24 CFR part 200, subpart J (Equal... financed with mortgages insured under this part must be made available without discrimination as to race... and sex discrimination do not affect the eligibility of hospitals for women and children....

  3. 32 CFR 242a.2 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... of the Uniformed Services University of the Health Sciences as specified in Title 10, U.S. Code 2113... PUBLIC MEETING PROCEDURES OF THE BOARD OF REGENTS, UNIFORMED SERVICES UNIVERSITY OF THE HEALTH SCIENCES... civilian life by the President, by and with the advice and consent of the Senate; (2) The Secretary...

  4. 19 CFR 10.242 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... the United States free of duty and free of any quantitative restrictions, limitations, or consultation... knitting machine. Several components with finished edges may be linked by yarn or thread as they are produced from the knitting machine. Wholly formed fabric components. “Wholly formed,” when used...

  5. 43 CFR 24.2 - Purpose.

    Science.gov (United States)

    2010-10-01

    ... new opportunities to foster a “good neighbor” policy with the States. ...: Interior Office of the Secretary of the Interior DEPARTMENT OF THE INTERIOR FISH AND WILDLIFE POLICY: STATE... Policy is to clarify and support the broad authorities and responsibilities of Federal 2 and...

  6. 32 CFR 242.4 - Policies.

    Science.gov (United States)

    2010-07-01

    ... the principle of equal educational opportunity for all. Sex, race, religion, national origin, marital... entrance shall be judged strictly on merit, in terms of demonstrated aptitude, motivation, and...

  7. 17 CFR 242.201 - Price test.

    Science.gov (United States)

    2010-04-01

    ... M, SHO, ATS, AC, AND NMS AND CUSTOMER MARGIN REQUIREMENTS FOR SECURITY FUTURES Regulation Sho... price to satisfy the order to buy, exclusive of any explicitly disclosed markup or markdown, commission... same price to satisfy the order to sell, exclusive of any explicitly disclosed markup or...

  8. 48 CFR 242.7501 - Policy.

    Science.gov (United States)

    2010-10-01

    ... provide reasonable assurance that— (a) Applicable laws and regulations are complied with; (b) The... DEFENSE CONTRACT MANAGEMENT CONTRACT ADMINISTRATION AND AUDIT SERVICES Contractor Accounting Systems...

  9. 17 CFR 242.403 - Required margin.

    Science.gov (United States)

    2010-04-01

    ...) REGULATIONS M, SHO, ATS, AC, AND NMS AND CUSTOMER MARGIN REQUIREMENTS FOR SECURITY FUTURES Customer Margin... of a customer in a securities account or futures account as set forth in this section. (b) Required... be twenty (20) percent of the current market value of such security future. (2) Offsetting...

  10. 17 CFR 242.300 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... M, SHO, ATS, AC, AND NMS AND CUSTOMER MARGIN REQUIREMENTS FOR SECURITY FUTURES Regulation Ats... or more of the capital of the alternative trading system. (g) NMS stock shall have the meaning... NMS stock for purposes of this Regulation ATS. (h) Effective transaction reporting plan shall have...

  11. 17 CFR 242.402 - General provisions.

    Science.gov (United States)

    2010-04-01

    ... Regulation T, U or X of the Board of Governors of the Federal Reserve System (12 CFR parts 220, 221, and 224...) REGULATIONS M, SHO, ATS, AC, AND NMS AND CUSTOMER MARGIN REQUIREMENTS FOR SECURITY FUTURES Customer...

  12. 17 CFR 242.401 - Definitions.

    Science.gov (United States)

    2010-04-01

    ...) Regulation T means Regulation T promulgated by the Board of Governors of the Federal Reserve System, 12 CFR... M, SHO, ATS, AC, AND NMS AND CUSTOMER MARGIN REQUIREMENTS FOR SECURITY FUTURES Customer...

  13. 35 years to UN resolution 242

    OpenAIRE

    Reinhart, T.

    2006-01-01

    The state of Israel was founded in 1948, following a war that the Israelis call the War of Independence, and the Palestinians – the Nakba (catastrophe). A haunted, persecuted people sought to find a shelter and a state for itself, and did so at a horrible price to another people. During the war of 1948, more than half of the Palestinian population of 1,380,000 at the time, were driven off their homeland by the Israeli army. Though Israel officially claimed that the majority of these refugees ...

  14. 36 CFR 242.4 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... means any member of the animal kingdom, including without limitation any mammal, fish, bird (including... an Alaska Permanent Fund dividend application; an Alaska license to drive, hunt, fish, or engage in... trade. Take or taking as used with respect to fish or wildlife, means to pursue, hunt, shoot, trap,...

  15. Sections 273, 320, 433, 823, 1004 and 242 of the 17th Civil Code; Articles 4(I), 5(I), 20(IV) of the Basic Law; Sect. 256 of the Code of Civil Procedure (Refusal to pay electricity rates, with electricity being generated by means of atomic energy)

    Energy Technology Data Exchange (ETDEWEB)

    Krueger, W.

    1981-01-01

    Anyone who buys electricity from an energy supply utility which also supplies electricity generated by means of nuclear energy, has neither the right to withhold payment according to sect. 273 of the Code of Civil Procedure nor according to sect. 242 of the Civil Code in conjunction with paragraph I of Art. 4, pararagraph I of Art. 5, paragraph IV of Article 20 of the Basic Law. Decision of the Regional Court of Dortmund, as of Oct. 10, 1980 - 3 O 673/79 (non-appealable).

  16. The clinical analysis about the dilatation for the stoma narrow after operation of carcinoma of esophago cardia%扩张治疗242例食管贲门癌术后吻合口狭窄疗效分析

    Institute of Scientific and Technical Information of China (English)

    林焕雄; 蔡文

    2010-01-01

    目的 总结扩张治疗食管贲门癌术后吻合口狭窄的临床疗效.方法 采用沙氏扩张器治疗242例吻合口狭窄患者.结果 共行扩张治疗647例次,平均2.67次/人.有效率99.1%,痊愈率达87.6%.结论 采用沙氏扩张器是治疗食管贲门癌术后吻合口狭窄一种安全、简便、有效手段之一.%Objective The author summarizes the clinical curative effect about the dilatation for the stoma narrow after operation of carcinoma of esophago cardia. Methods 242 patients included were expanded with Savary-Gilliard dilator. Results 647 expanding therapies were made, average 2.67 times per patient. The effective rate is 99.1%,the recovery rate is 87.6%. Conclusion The dilatation using Savary-Gilliard dilator is one of the safe, convenient, effective methods in the treatment of stoma narrow after operation of carcinoma of esophago cardia.

  17. Two different zinc(II)-aqua complexes held up by a metal-oxide based support: Synthesis, crystal structure and catalytic activity of [HMTAH]2[{Zn(H2O)5}{Zn(H2O)4}{Mo7O24}].2H2O (HMTAH = protonated hexamethylenetetramine)

    Indian Academy of Sciences (India)

    T Arumuganathan; A Srinivasarao; T Vijay Kumar; Samar K Das

    2008-01-01

    An inorganic−organic hybrid material, [HMTAH]2[{Zn(H2O)5}{Zn(H2O)4}{Mo7O24}].2H2O (1) (where HMTAH = protonated hxamethylenetetramine) has been synthesized and structurally characterized. The compound 1 crystallizes in a monoclinic space group 2/. The crystal data of 1: = 43.12(3), = 12.399(10), = 16.285(13), = 111.131(11), = 8. Its crystal structure shows that two different Zn(II)-aqua complexes, [Zn(H2O)5]2+ and [Zn(H2O)4]2+ are covalently coordinated to a heptamolybdateanion [Mo7O24]6- resulting in an anionic species of polyoxometalate supported zinc-aqua complexes, [{Zn(H2O)}{Zn(H2O)4}{Mo7O24}]2-, that is stabilized with two protonated hexamethylenetetramine cations in the title compound 1. In the crystal structure, both lattice water molecules are found to interact with the heptamolybdate cluster anion and the protonated hexamethylenetetramine cation resulting in an intricate three-dimensional hydrogen bonding network. Interestingly, compound 1 exhibits catalytic activity towards oxidation of some primary alcohols.

  18. Measurements of cross sections and decay properties of the isotopes of elements 112, 114, and 116 produced in the fusion reactions 233,238U, 242Pu, and 248Cm+48Ca

    International Nuclear Information System (INIS)

    We have studied the dependence of the production cross sections of the isotopes 282,283112 and 286,287114 on the excitation energy of the compound nuclei 286112 and 290114. The maximum cross section values of the xn-evaporation channels for the reaction 238U(48Ca,xn)286-x112 were measured to be σ3n=2.5-1.1+1.8 pb and σ4n=0.6-0.5+1.6 pb; for the reaction 242Pu(48Ca,xn)290-x114: σ2n∼0.5 pb, σ3n=3.6-1.7+3.4 pb, and σ4n=4.5-1.9+3.6 pb. In the reaction 233U(48Ca,2-4n)277-279112 at E*=34.9=2.2 MeV we measured an upper cross section limit of σxn≤0.6 pb. The observed shift of the excitation energy associated with the maximum sum evaporation residue cross section σER(E*) to values significantly higher than that associated with the calculated Coulomb barrier can be caused by the orientation of the deformed target nucleus in the entrance channel of the reaction. An increase of σER in the reactions of actinide targets with 48Ca is consistent with the expected increase of the survivability of the excited compound nucleus upon closer approach to the closed neutron shell N=184. In the present work we detected 33 decay chains arising in the decay of the known nuclei 282112, 283112, 286114, 287114, and 288114. In the decay of 287114(α)→283112(α)→279110(SF), in two cases out of 22, we observed decay chains of four and five sequential α transitions that end in spontaneous fission of 271Sg (Tα/SF=2.4-1.0+4.3 min) and 267Rf (TSF∼2.3 h), longer decay chains than reported previously. We observed the new nuclide 292116 (Tα=18-6+16 ms,Eα=10.66±0.07 MeV) in the irradiation of the 248Cm target at a higher energy than in previous experiments. The observed nuclear decay properties of the nuclides with Z=104-118 are compared with theoretical nuclear mass calculations and the systematic trends of spontaneous fission properties. As a whole, they give a consistent pattern of decay of the 18 even-Z neutron-rich nuclides with Z=104-118 and N=163-177. The experiments were

  19. Measurements of cross sections and decay properties of the isotopes of elements 112, 114 and 116 produced in the fusion reactions 233,238U, 242Pu, and 248Cm + 48Ca

    International Nuclear Information System (INIS)

    We have studied the dependence of the production cross sections of the isotopes 282,283112 and 286,287114 on the excitation energy of the compound nuclei 286112 and 290114. The maximum cross-section values of the xn-evaporation channels for the reaction 238U(48Ca, xn)286-x112 were measured to be: σ3n = 2.5-1.1+1.8 pb and σ4n = 0.6-0.5+1.6 pb; for the reaction 242Pu(48Ca, xn)290-x114: σ2n ∼ 0.5 pb, σ3n 3.6-1.7+3.4 pb and σ4n = 4.5-1.9+3.6 pb. In the reaction 233U(48Ca, 2-4n)277-279112 at E* = 34.9±2.2 MeV we measured an upper cross-section limit of σxn ≤ 0.6 pb. The observed shift of the excitation energy associated with the maximum sum evaporation residue cross section σER(E*) to values significantly higher than that associated with the calculated Coulomb barrier can be caused by the orientation of the deformed target nucleus in the entrance channel of the reaction. An increase of σER in the reactions of actinide targets with 48Ca is consistent with the expected increase of the survivability of the excited compound nucleus upon closer approach to the closed neutron shell N = 184. In the present work we detected 33 decay chains arising in the decay of the known nuclei: 282112, 283112, 286114, and 288114. In the decay of 287114(α) → 283112(α) → 279110(SF), in two cases out of 22, we observed decay chains of four and five sequential α transitions that end in spontaneous fission of 271Sg(Tα/SF = 2.4 -1.0+4.3 min) and 267Rf(TSF ∼ 2.3 h), longer decay chains than reported previously. We observed the new nuclide 292116(Tα = 18-6+16 ms, Eα = 10.66 ± 0.07 MeV in the irradiation of 248Cm target at a higher energy than in previous experiments. The observed nuclear decay properties of the nuclides with Z = 104-118 are compared with theoretical nuclear mass calculations and the systematic trends of spontaneous fission properties. As a whole, they give a consistent pattern of decay of the 18 even-Z neutron-rich nuclides with Z = 104-118 and N = 163

  20. Simultaneous measurement of {sup 239}Pu, {sup 240}Pu, {sup 241}Pu, and {sup 242}Pu by high resolution inductively coupled plasma mass spectrometer (HR ICP-MS) in marine sediments; Mesure des isotopes du plutonium des sediments marins par spectrometrie de masse a plasma couple inductivement haute resolution (HR ICP-MS)

    Energy Technology Data Exchange (ETDEWEB)

    Bruneau, F

    1999-07-01

    Transuranics elements are of particular interest in radioecological studies because of their radiotoxicity and their potential use to decipher source fingerprints and transport processes. The simultaneous measurement of {sup 239}Pu, {sup 240}Pu, {sup 241}Pu, and {sup 242}Pu in environmental samples requires a specific chemical procedure. This work deals with an analytical procedure which yields a very high grade of purification of Pu suitable for ultra low level detection by HR ICP-MS, from marine sediments. After the elimination of major elements (Fe, Al, Mg...) by a first chromatographic separation, a new device of purification by solvent extraction and concentration by a second chromatographic separation is used to obtain a concentrated and high purified solution of plutonium. The chemical procedure have been validated on IAEA certified sediment samples and on sediment samples collected in the roads of Cherbourg which had been previously analysed by other techniques (a spectrometry and thermo-ionisation mass spectrometer). (author)

  1. Use of trioctylphosphine oxide for transplutonium element extraction and purification

    International Nuclear Information System (INIS)

    Investigated was extraction of tri-valent curium, berkelium, californium, einsteinium as well as cerium and europium with trioctylphosphin oxide from lactic acid solutions, containing DTPA and aluminium nitrate depending on the aluminium nitrate and TOPO concentrations and nitric acid solutions of variable concentration as well. Under optimum conditions of extraction chromatography of berkelium studied was the distribution of cobalt, nickel, chromium, iron, aluminium, titanium, zirconium and niobium ions, and the coefficients of berkelium purification from cations investigated were determined. The effect of weight quantities of cation impurities on extraction chromatographic yield of berkelium has been investigated. Examples of practice application of the extraction chromatography with the use of TOPO are given

  2. Catch-C MS242. Soil degradation issues in France

    OpenAIRE

    N. Turpin; Perret, E.; Guiffant, N.

    2013-01-01

    The Catch-C project assesses the farm compatibility of Best Management Practices (BMPs) that aim to promote productivity, climate change mitigation and soil quality. These are the three overall goals of sustainable soil management. This milestone inventories the current soil related issues in France, as a second step in the project.

  3. Facility effluent monitoring plan for 242-A Evaporator facility

    International Nuclear Information System (INIS)

    A facility effluent monitoring plan is required by the US Department of Energy in DOE Order 5400.1* for any operations that involve hazardous materials and radioactive substances that could affect employee or public safety or the environment. A facility effluent monitoring plan determination was performed during Calendar Year 1991 and the evaluation showed the need for a facility effluent monitoring plan. This document is prepared using the specific guidelines identified in A Guide for Preparing Hanford Site Facility effluent Monitoring Plans, WHC-EP-0438-1**. This facility effluent monitoring plan assesses effluent monitoring systems and evaluates whether they are adequate to ensure the public health and safety as specified in applicable federal, state, and local requirements

  4. 36 CFR 242.26 - Subsistence taking of wildlife.

    Science.gov (United States)

    2010-07-01

    ... AGRICULTURE SUBSISTENCE MANAGEMENT REGULATIONS FOR PUBLIC LANDS IN ALASKA Subsistence Taking of Fish and... individual, gear, or wildlife during an emergency rescue operation in a life-threatening situation; (4... this paragraph, and black bears of all color phases taken in Units 1-7, 11-17, and 20. (2) You may...

  5. Dicty_cDB: VHM242 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 00 m3a: 0.00 m3b: 0.00 m_ : 1.00 28.0 %: cytoplasmic 28.0 %: nuclear 20.0 %: plasma membrane 8.0 %: extracel...:none) Bos taurus L-pipecolic acid oxidas... 74 4e-12 protein upda... Homo sapiens full open reading fra... 74 3e-12 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecolic acid oxid...TCAATTTACCATTGGTATTACGTTCTCTTTACAAGTTATGTTTAC AATATGGTTGTAAAATGGTAAGXXXXXXXXXX sequence update 2002.10.25 Translated Amino Acid...:none) Streptomyces tendae strain Tue901, nik... 107 2e-22 AM286415_1545( AM286415 |pid:none) Yers

  6. 36 CFR 242.9 - Information collection requirements.

    Science.gov (United States)

    2010-07-01

    ... the Paperwork Reduction Act. The burden in this situation is negligible, and information gained from... estimate to: Information Collection Officer, U.S. Fish and Wildlife Service, 1849 C Street, N.W., MS...

  7. Dicty_cDB: VFE242 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available *ffhf*i*klkpmi*elsiv ikpmiklqlmqpmqlrd*klvlnvqqlhqtkhvsqsld*rrwgnhqmvpfvihwvahyle sqlfvrmshvwspvginl*llvvmhl...qrtqfsrdttxvsktfskrstkestklnstlpvfgmsidssttwspml*rvrvasfg lvktmtvmfnqmpsprvmvvwvs...SGFMTKDLAICVKGSVENVKR TDYLNTEEYINKVAELLVSKLTAL*eil*illtttttttllhyfvlrsiihfsp*kshf...vtnteplis**relasws*pthqptavhhknsks ltshpmvv*pweciipt--- ---hkehnsqeirrpfqrhfprdlr...krvqs*irhcrylv*a*thrrhgrlcyee*gwlrl gl*kl*r*csircrrpglw*fgshdfsftlcrlfsc*slpwych*tfp*tskr*rnqyqf nrfylcldsws

  8. Dicty_cDB: AFK242 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ato germinating seedlings, TAMU Lycopersicon esculentum cDNA clone cLEI7M10 5', mRNA seque... 1 AW033447 |AW033447.1 EST277018 tomato callus, TAMU Lycopersicon esculentum cDNA clone cLEC28B21 similar to calreticulin...c, DNA sequence. 78 3e-21 4 BI921109 |BI921109.1 EST541012 tomato callus Lycopersicon esculentum cDNA c..., putative, mRNA sequence. 74 5e-09 1 AI489195 |AI489195.1 EST247534 tomato ovary, TAMU Lyco...nce. 74 5e-09 1 AW626316 |AW626316.1 EST320223 tomato radicle, 5 d post-imbibition, Cornell University Lyc

  9. 48 CFR 3052.242-71 - Dissemination of contract information.

    Science.gov (United States)

    2010-10-01

    ... prescribed in (HSAR) 48 CFR 3042.202-70, insert the following clause: Dissemination of Contract Information... performance of this contract, without the prior written consent of the Contracting Officer. An electronic or... 48 Federal Acquisition Regulations System 7 2010-10-01 2010-10-01 false Dissemination of...

  10. 48 CFR 1552.242-72 - Financial administrative contracting officer.

    Science.gov (United States)

    2010-10-01

    ... statements are in compliance with Cost Accounting Standards and FAR part 31; (C) Determine the contractor's compliance with Cost Accounting Standards and disclosure statements, if applicable; and (D) Negotiate price... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Financial...

  11. 24 CFR 242.79 - Environmental quality determinations and standards.

    Science.gov (United States)

    2010-04-01

    ... Environmental quality determinations and standards. Requirements set forth in 24 CFR part 50, “Protection and Enhancement of Environmental Quality,” 24 CFR part 51, “Environmental Criteria and Standards,” and 24 CFR part... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Environmental...

  12. 48 CFR 242.302 - Contract administration functions.

    Science.gov (United States)

    2010-10-01

    ... report identifying significant accounting system or related internal control deficiencies. (9) For...) Contractor estimating systems (see FAR 15.407-5); and (B) Contractor material management and accounting... SYSTEM, DEPARTMENT OF DEFENSE CONTRACT MANAGEMENT CONTRACT ADMINISTRATION AND AUDIT SERVICES...

  13. 17 CFR 242.100 - Preliminary note; definitions.

    Science.gov (United States)

    2010-04-01

    ... the distribution. (3) In the case of a distribution involving a merger, acquisition, or exchange offer... distribution participant, issuer, or selling security holder in connection with the acquisition or...

  14. Preface: phys. stat. sol. (b) 242/1

    Science.gov (United States)

    Ginzburg, V. L.; Maksimov, E. G.

    2005-01-01

    We have accepted with great pleasure the suggestion of the Guest Editor Miodrag Kuli to write a short preface to the special issue of this journal, which is devoted to the role played by electron-phonon interaction (EPI) in high-temperature superconductors (HTSC). From the very beginning, it was absolutely clear to us that there is no metal in which the EPI could be ignored, and high-temperature superconducting compounds cannot be an exception in this respect. We expressed this opinion, in particular, in our early Review Article [1] and in the talk [2] given at the Grenoble M2S HTSC Conference in 1994. We would like to emphasize that we were not in isolation. There have been many other researchers, some authors of this issue among them, who have also considered the EPI as an essential part of the physics of high-temperature superconductors. However, a large part of researchers in the field, including a few famous scientists, have considered the EPI to be irrelevant to high-temperature superconductivity. Up to now, we do not understand the scientific basis for such an opinion. Moreover, that point of view has never been shared by some other famous scientists; in this respect mention should be made of J. Friedel and A. A. Abrikosov.Turning back to physics, we would like to point out some features of high-temperature superconducting cuprates, which should lead to the existence of a strong EPI in these materials. First of all, it is the proximity of these compounds, even in the optimally doped case, to the layered ionic crystals. This fact has been emphasized in our early publications as well as in many papers by other authors, and it is discussed in detail in the Review Article by C. Falter published in this issue. There are other approaches to the HTSC compounds, which allow to consider that a strong EPI exists. They are also based on some peculiarities in the crystalline and chemical structure of these compounds, in particular, on their multiphase nanoscale structure. This point is discussed by J. Phillips in this issue.There are also many experimental indications in favor of the existence of a strong EPI in the HTSC cuprates. For example, the behavior of the electron relaxation, the peculiarities of the phonon spectra, the interaction of the Josephson current with phonons, and the electron mass renormalization. All these phenomena have been discussed in the recent Review Articles [3, 4]. Currently, additional evidence was provided which has thrown new light on the role played by the EPI in HTSC systems. These are the ARPES experiments conducted by the Stanford group, which have given an unambiguous proof of the electron mass renormalization due to the EPI. A Review Article of this group by T. Cuk et al. is also presented in this issue. We should also mention the contribution of L. Pintschovius who presented new interesting results on the electron-phonon coupling effects observed by means of inelastic neutron scattering.A comprehensive discussion of a major part of the electron-phonon coupling effects presented in the Review Articles [1, 3] has been based on the traditional approach of the Eliashberg type. Up to now, we consider this approach to be quite suitable for pursuing a number of goals, mainly for describing properties of the normal state. Nevertheless, we do not disclaim the importance of more detailed investigations of the EPI, which take into account the strong anisotropy, the interplay between electron-phonon and electron-electron interaction, and the non-adiabatic effects. Four Review Articles in this issue, by Schneider, by Rösch, Han, Gunnarsson and Crespi, by Kuli and Dolgov, and by Cappelluti and Pietronero are devoted to different aspects of these problems.To conclude, we would like to emphasize that the main problem related to the mechanism of superconductivity in the HTSC cuprates is the interplay between the strong EPI and the electron exchange and correlation. Unfortunately, previous work did not crack this problem and much effort should be made in the future. We hope that the publication of this issue will aid to attract the attention of many researchers to the investigation of unsolved problems of the EPI in HTSC systems.

  15. 7 CFR 2.42 - Administrator, Farm Service Agency.

    Science.gov (United States)

    2010-01-01

    ... to the Secretary by Executive Order 12580, 3 CFR, 1987 Comp., p. 193, under the following provisions... standards and section 1-601 of Executive Order 12088, 3 CFR, 1978 Comp., p. 243, to enter into an inter... thereto by the Attorney General and the Comptroller General (4 CFR chapter II), with respect to claims...

  16. 36 CFR 242.24 - Customary and traditional use determinations.

    Science.gov (United States)

    2010-07-01

    ... Unit 9B, 9C, 9E, 17, Nelson Lagoon and Sand Point. Unit 9A, Unit 9B, Unit 9C and Unit 9E Moose Residents of Unit 9A, 9B, 9C, and 9E. Unit 9D Moose Residents of Cold Bay, False Pass, King Cove, Nelson... the Pickerel Lake Winter Trail from the Canadian border to Pickerel Lake Moose Residents of Unit...

  17. 24 CFR 242.58 - Books, accounts, and financial statements.

    Science.gov (United States)

    2010-04-01

    ... AUTHORITIES MORTGAGE INSURANCE FOR HOSPITALS Regulatory Agreement, Accounting and Reporting, and Financial... (Handbook 2000.04). (d) Changes in accounting policies. The annual audited financial statements shall identify any changes in accounting policies and their financial effect on the balance sheet and on...

  18. 50 CFR 216.242 - Permissible methods of taking.

    Science.gov (United States)

    2010-10-01

    ... annually). (G) Blue whale (Balaenoptera musculus)—4005 (an average of 801 annually). (ii) Odontocetes: (A... of 4202 annually). (C) Minke whale (Balaenoptera acutorostrata)—2075 (an average of 415 annually). (D) Sei whale (Balaenoptera borealis)—5285 (an average of 1057 annually). (E) Fin whale...

  19. 40 CFR 52.242 - Disapproved rules and regulations.

    Science.gov (United States)

    2010-07-01

    ... regulations. Link to an amendment published at 75 FR 37730, June 30, 2010. (a) The following Air Pollution... Cellular (Foam) Products,” submitted on March 7, 2008 and adopted on September 7, 2007. (2) Antelope Valley Air Pollution Control District. (i) Rule 118, Emergencies, submitted on March 10, 1998. (3)...

  20. 40 CFR 98.242 - GHGs to report.

    Science.gov (United States)

    2010-07-01

    ... process unit. Process emissions include CO2 generated by reaction in the process and by combustion of process off-gas in stationary combustion units and flares. (1) If you comply with § 98.243(b) or (d... source and flare that burns any amount of petrochemical process off-gas. (2) If you comply with §...

  1. 17 CFR 242.612 - Minimum pricing increment.

    Science.gov (United States)

    2010-04-01

    ...) REGULATIONS M, SHO, ATS, AC, AND NMS AND CUSTOMER MARGIN REQUIREMENTS FOR SECURITY FUTURES Regulation Nms... display, rank, or accept from any person a bid or offer, an order, or an indication of interest in any NMS... accept from any person a bid or offer, an order, or an indication of interest in any NMS stock priced...

  2. 17 CFR 242.611 - Order protection rule.

    Science.gov (United States)

    2010-04-01

    ...) REGULATIONS M, SHO, ATS, AC, AND NMS AND CUSTOMER MARGIN REQUIREMENTS FOR SECURITY FUTURES Regulation Nms... NMS stocks that do not fall within an exception set forth in paragraph (b) of this section and, if... bid was priced higher than a protected offer in the NMS stock. (5) The transaction that...

  3. 17 CFR 242.610 - Access to quotations.

    Science.gov (United States)

    2010-04-01

    ...) REGULATIONS M, SHO, ATS, AC, AND NMS AND CUSTOMER MARGIN REQUIREMENTS FOR SECURITY FUTURES Regulation Nms... national securities exchange or national securities association to the quotations in an NMS stock displayed... displays quotations in an NMS stock through an SRO display-only facility shall provide a level and cost...

  4. 17 CFR 242.203 - Borrowing and delivery requirements.

    Science.gov (United States)

    2010-04-01

    ... (CONTINUED) REGULATIONS M, SHO, ATS, AC, AND NMS AND CUSTOMER MARGIN REQUIREMENTS FOR SECURITY FUTURES...) If a broker or dealer knows or has reasonable grounds to believe that the sale of an equity security was or will be effected pursuant to an order marked “long,” such broker or dealer shall not lend...

  5. 7 CFR 1951.242 - Servicing delinquent Community Facility loans.

    Science.gov (United States)

    2010-01-01

    ... HOUSING SERVICE, RURAL BUSINESS-COOPERATIVE SERVICE, RURAL UTILITIES SERVICE, AND FARM SERVICE AGENCY... loans. (a) For the purpose of this section, a loan is delinquent when a borrower fails to make all or... 7 Agriculture 14 2010-01-01 2009-01-01 true Servicing delinquent Community Facility loans....

  6. 36 CFR 242.11 - Regional advisory councils.

    Science.gov (United States)

    2010-07-01

    ... Board will identify the interest(s) the applicants propose to represent on the respective Regional... Regional Council. To ensure that each Council represents a diversity of interests, the Board will strive to... councils. (a) The Board shall establish a Regional Council for each subsistence resource region...

  7. Radiative capture on $^{242}$Pu for MOX fuel reactors

    CERN Multimedia

    The use of MOX fuel (mixed-oxide fuel made of UO$_{2}$ and PuO$_{2}$) in nuclear reactors allows substituting a large fraction of the enriched Uranium by Plutonium reprocessed from spent fuel. Indeed around 66% of the plutonium from spent fuel is made of $^{239}$Pu and $^{241}$Pu, which are fissile in thermal reactors. A typical reactor of this type uses a fuel with 7% reprocessed Pu and 93% depleted U, thus profiting from both the spent fuel and the remaining $^{238}$U following the $^{235}$U enrichment. With the use of such new fuel compositions rich in Pu the better knowledge of the capture and fission cross sections of the Pu isotopes becomes very important. This is clearly stated in the recent OECD NEA’s “High Priority Request List” and in the WPEC-26 “Uncertainty and target accuracy assessment for innovative systems using recent covariance data evaluations” report. In particular, a new series of cross section evaluations have been recently carried out jointly by the European (JEFF) and United ...

  8. 49 CFR 24.2 - Definitions and acronyms.

    Science.gov (United States)

    2010-10-01

    ... United States as defined in 8 CFR 103.12 and includes: (i) An alien present in the United States who has... date, supported by the presentation and analysis of relevant market information. (4) Business. The term... received or earned by dependent children and full time students under 18 years of age. (See appendix...

  9. Facility effluent monitoring plan for 242-A evaporator facility

    International Nuclear Information System (INIS)

    A facility effluent monitoring plan is required by the U.S. Department of Energy in DOE Order 5400.1 for any operations that involve hazardous materials and radioactive substances that could affect employee or public safety or the environment. A facility effluent monitoring plan determination was performed during Calendar Year 1991 and the evaluation showed the need for a facility effluent monitoring plan. This document is prepared using the specific guidelines identified in A Guide for Preparing Hanford Site Facility Effluent Monitoring Plans, WHC-EP-0438-1. This facility effluent monitoring plan assesses effluent monitoring systems and evaluates whether they are adequate to ensure the public health and safety as specified in applicable federal, state, and local requirements. This facility effluent monitoring plan shall ensure long-range integrity of the effluent monitoring systems by requiring an update whenever a new process or operation introduces new hazardous materials or significant radioactive materials. This document must be reviewed annually even if there are no operational changes, and it must be updated, as a minimum, every three years

  10. 47 CFR 90.242 - Travelers' information stations.

    Science.gov (United States)

    2010-10-01

    ... station. (4) For a station employing a conventional radiating antenna(s) (ex. vertical monopole... point on the cable. For a conventional radiating antenna, the estimated field strength contour at 1.5 km...) For each transmitter site, the transmitter's output power, the type of antenna utilized, its...

  11. Motivation for New Measurements on 241, 242, 243Am Isotopes

    International Nuclear Information System (INIS)

    The initial objective of this work was an updated review on the Am isotopes data since the next official release (3.1) of the JEFF3 evaluated data file is foreseen around June 2005. Alternatively, this work searches for the possible reasons of the observed discrepancies between differential and integral measurement results. In particular, strong differences are encountered on σγth values and epithermal branching ratio values for the 241Am. Although the JEF2.2 validation is used as guide in parallel with a systematic study of all differential and integral results available, the need for new measurements clearly shows up. This paper finally draws up a list of desired and feasible new differential and integral measurements on the Am isotopes

  12. Dicty_cDB: CHE242 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CAGATT ATAAT sequence update 2002. 9.10 Translated Amino Acid sequence ---xikrgxanfc*xlsxgkpipxxx*rf*xh*kx*k...nce (All Frames) Frame A: ---xikrgxanfc*xlsxgkpipxxx*rf*xh*kx*kpxskxkkgfpxrsxkvxfsvgkq ikxwwxffrtitfqkespspl...slvkxsl*klkvlitlkmlkprskikkvfxqinkd*slpvnn*kmvxlsqii Frame C: ---x*kgxskfllkxfxxkahpxxxlkvlxtlkxlkaxiqxxkrvs

  13. 小儿脑性瘫痪242例临床分析%Clinical analysis of 242 cases of children cerebral palsy

    Institute of Scientific and Technical Information of China (English)

    赵蒙

    2003-01-01

    BACKGROUND:Children cerebral palsy not only affects the quality of the affected children's lives but also burdens the family and the society heavily.Therefore, analysis of the disease and its causes from the viewpoint of clinic might helpful in treatment and prevention of the disease.

  14. Radiochemical studies of neutron deficient actinide isotopes

    International Nuclear Information System (INIS)

    The production of neutron deficient actinide isotopes in heavy ion reactions was studied using alpha, gamma, x-ray, and spontaneous fission detection systems. A new isotope of berkelium, 242Bk, was produced with a cross-section of approximately 10 μb in reactions of boron on uranium and nitrogen on thorium. It decays by electron capture with a half-life of 7.0 +- 1.3 minutes. The alpha-branching ratio for this isotope is less than 1% and the spontaneous fission ratio is less than 0.03%. Studies of (Heavy Ion, pxn) and (Heavy Ion, αxn) transfer reactions in comparison with (Heavy ion, xn) compound nucleus reactions revealed transfer reaction cross-sections equal to or greater than the compound nucleus yields. The data show that in some cases the yield of an isotope produced via a (H.I.,pxn) or (H.I.,αxn) reaction may be higher than its production via an xn compound nucleus reaction. These results have dire consequences for proponents of the ''Z1 + Z2 = Z/sub 1+2/'' philosophy. It is no longer acceptable to assume that (H.I.,pxn) and (H.I.,αxn) product yields are of no consequence when studying compound nucleus reactions. No evidence for spontaneous fission decay of 228Pu, 230Pu, 232Cm, or 238Cf was observed indicating that strictly empirical extrapolations of spontaneous fission half-life data is inadequate for predictions of half-lives for unknown neutron deficient actinide isotopes

  15. Radiochemical studies of neutron deficient actinide isotopes

    Energy Technology Data Exchange (ETDEWEB)

    Williams, K.E.

    1978-04-01

    The production of neutron deficient actinide isotopes in heavy ion reactions was studied using alpha, gamma, x-ray, and spontaneous fission detection systems. A new isotope of berkelium, /sup 242/Bk, was produced with a cross-section of approximately 10 ..mu..b in reactions of boron on uranium and nitrogen on thorium. It decays by electron capture with a half-life of 7.0 +- 1.3 minutes. The alpha-branching ratio for this isotope is less than 1% and the spontaneous fission ratio is less than 0.03%. Studies of (Heavy Ion, pxn) and (Heavy Ion, ..cap alpha..xn) transfer reactions in comparison with (Heavy ion, xn) compound nucleus reactions revealed transfer reaction cross-sections equal to or greater than the compound nucleus yields. The data show that in some cases the yield of an isotope produced via a (H.I.,pxn) or (H.I.,..cap alpha..xn) reaction may be higher than its production via an xn compound nucleus reaction. These results have dire consequences for proponents of the ''Z/sub 1/ + Z/sub 2/ = Z/sub 1+2/'' philosophy. It is no longer acceptable to assume that (H.I.,pxn) and (H.I.,..cap alpha..xn) product yields are of no consequence when studying compound nucleus reactions. No evidence for spontaneous fission decay of /sup 228/Pu, /sup 230/Pu, /sup 232/Cm, or /sup 238/Cf was observed indicating that strictly empirical extrapolations of spontaneous fission half-life data is inadequate for predictions of half-lives for unknown neutron deficient actinide isotopes.

  16. Biosorption of Americium-242 by saccharomyces cerevisiae: preliminary evaluation and mechanism

    International Nuclear Information System (INIS)

    As an important radioisotope in nuclear industry and other fields, americium-241 is one of the most serious contamination concerns duo to its high radiation toxicity and long half-life. In this experiment, the biosorption of 241Am from solution by a fungus, Saccharomyces cerevisiae (S. cerevisiae), and the effects of various experimental conditions on the biosorption and the mechanism were explored. The preliminary results showed that S. cerevisiae is a very efficient biosorbent. An average of more than 99% of the total 241Am could be removed by S. cerevisiae of 2.1g/L (dry weight) from 241Am solutions of 2.22MBq/L -555 MBq/L (Co). The adsorption equilibrium was achieved within 1 hour and the optimum pH ranged 1-3. The culture times of more than 16 hours were suitable and the efficient adsorption of 241Am by the S. cerevisiae could be noted. The biosorption of 241Am by the decomposed cell wall, protoplasm or cell membrane of S. cerevisiae was same efficient as by the intact fungus, but the some components of S. cerevisiae, such as protein and acylation group had obvious effect on adsorption. When the concentrations of coexistent Eu3+, Nd3+ were 100 times more than that of 241Am, the adsorption rates would drop to 65%. However, most of the investigated acidic ions have no significant influence on the 241Am adsorption but minute change of pH value, while the saturated EDTA can strong inhibit the biosorption of 241Am.. (authors)

  17. 17 CFR 242.602 - Dissemination of quotations in NMS securities.

    Science.gov (United States)

    2010-04-01

    ... effect a transaction with a priced order widely disseminated by the electronic communications network... responsible broker or dealer other than an exchange market maker which is cancelled or withdrawn if not... transaction reporting plan, collect, process, and make available to vendors the best bid, best offer,...

  18. 17 CFR 242.404 - Type, form and use of margin.

    Science.gov (United States)

    2010-04-01

    ... other requirement. (e) Alternative collateral valuation for margin equity securities in a futures... other asset permitted under Regulation T to satisfy a margin deficiency in a securities margin account... requirement”); and (iii) Cash, securities, or other assets deposited as margin for the positions in an...

  19. Common variants on 8p12 and 1q24.2 confer risk of schizophrenia

    DEFF Research Database (Denmark)

    Shi, Yongyong; Li, Zhiqiang; Xu, Qi;

    2011-01-01

    Schizophrenia is a severe mental disorder affecting ~1% of the world population, with heritability of up to 80%. To identify new common genetic risk factors, we performed a genome-wide association study (GWAS) in the Han Chinese population. The discovery sample set consisted of 3,750 individuals ...

  20. 24 CFR 242.23 - Maximum mortgage amounts and cash equity requirements.

    Science.gov (United States)

    2010-04-01

    ... cost of substantial rehabilitation, plus (ii) Such portion of the outstanding indebtedness as does not... substantial rehabilitation, plus (ii) The actual purchase price of the land and improvements or HUD's estimate (prior to substantial rehabilitation) of the fair market value of such land and improvements,...

  1. High level waste storage tanks 242-A evaporator S/RID phase II assessment report

    Energy Technology Data Exchange (ETDEWEB)

    Biebesheimer, E.

    1996-09-27

    This document, the Standards/Requirements Identification Document (S/RID) Phase 2 Assessment Report for the subject facility, represents the results of a Performance Assessment to determine whether procedures containing S/RID requirements are fully implemented by field personnel in the field. It contains a summary report and three attachments; an assessment schedule, performance objectives, and assessments for selected functional areas.

  2. 32 CFR 242a.7 - Transcripts, recordings, and minutes of closed meetings.

    Science.gov (United States)

    2010-07-01

    .... (a) The Board of Regents shall maintain a complete transcript or electronic recording adequate to... any item and the record of any roll call vote (reflecting the vote of each member on the question... complete electronic recording of each meeting or portion of a meeting, closed to the public, for a...

  3. 17 CFR 242.608 - Filing and amendment of national market system plans.

    Science.gov (United States)

    2010-04-01

    ... EXCHANGE COMMISSION (CONTINUED) REGULATIONS M, SHO, ATS, AC, AND NMS AND CUSTOMER MARGIN REQUIREMENTS FOR... by the sponsors to satisfy a plan filing requirement contained in any other section of...

  4. High level waste storage tanks 242-A evaporator standards/requirement identification document

    International Nuclear Information System (INIS)

    This document, the Standards/Requirements Identification Document (S/RIDS) for the subject facility, represents the necessary and sufficient requirements to provide an adequate level of protection of the worker, public health and safety, and the environment. It lists those source documents from which requirements were extracted, and those requirements documents considered, but from which no requirements where taken. Documents considered as source documents included State and Federal Regulations, DOE Orders, and DOE Standards

  5. MeteoIO 2.4.2: a preprocessing library for meteorological data

    Directory of Open Access Journals (Sweden)

    M. Bavay

    2014-06-01

    (i provides a uniform interface to meteorological data in the models; (ii hides the complexity of the processing taking place; and (iii guarantees a robust behaviour in case of format errors, erroneous or missing data. Moreover, in an operational context, this error handling should avoid unnecessary interruptions in the simulation process. A strong emphasis has been put on simplicity and modularity in order to make it extremely easy to support new data formats or protocols and to allow contributors with diverse backgrounds to participate. This library can also be used in the context of High Performance Computing in a parallel environment. Finally, it is released under an Open Source license and is available at http://models.slf.ch/p/meteoio. This paper gives an overview of the MeteoIO library from the point of view of conceptual design, architecture, features and computational performance. A scientific evaluation of the produced results is not given here since the scientific algorithms that are used have already been published elsewhere.

  6. NATO/CCMS PILOT STUDY - CLEAN PRODUCTS AND PROCESSES (PHASE I) 2000 ANNUAL REPORT, NUMBER 242

    Science.gov (United States)

    This annual report presents the proceedings of the Third Annual NATO/CCMS pilot study meeting in Copenhagen, Denmark. Guest speakers focused on efforts in the area of research of clean products and processes, life cycle analysis, computer tools and pollution prevention.

  7. 48 CFR 1252.242-70 - Dissemination of information-educational institutions.

    Science.gov (United States)

    2010-10-01

    ... (TAR) 48 CFR 1242.7000(a), insert the following clause: Dissemination of Information—Educational... journals, books, trade publications, or other appropriate media (a thesis or collection of theses...

  8. 17 CFR 242.609 - Registration of securities information processors: form of application and amendments.

    Science.gov (United States)

    2010-04-01

    ... Exchanges SECURITIES AND EXCHANGE COMMISSION (CONTINUED) REGULATIONS M, SHO, ATS, AC, AND NMS AND CUSTOMER MARGIN REQUIREMENTS FOR SECURITY FUTURES Regulation Nms-Regulation of the National Market System §...

  9. 17 CFR 242.200 - Definition of “short sale” and marking requirements.

    Science.gov (United States)

    2010-04-01

    ... standardized options contracts as defined in 17 CFR 240.9b-1(a)(4); and (2) If and to the extent that the... COMMISSION (CONTINUED) REGULATIONS M, SHO, ATS, AC, AND NMS AND CUSTOMER MARGIN REQUIREMENTS FOR...

  10. 36 CFR 242.6 - Licenses, permits, harvest tickets, tags, and reports.

    Science.gov (United States)

    2010-07-01

    ... utilization. Upon the request of a State or Federal law enforcement agent, you must also produce any licenses... fish and wildlife under the regulations in this part, you must allow State or Federal law enforcement... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Licenses, permits,...

  11. Comparative Analysis of the Orphan CRISPR2 Locus in 242 Enterococcus faecalis Strains

    OpenAIRE

    Hullahalli, Karthik; Rodrigues, Marinelle; Schmidt, Brendan D.; Li, Xiang; Bhardwaj, Pooja; Palmer, Kelli L.

    2015-01-01

    Clustered, Regularly Interspaced Short Palindromic Repeats and their associated Cas proteins (CRISPR-Cas) provide prokaryotes with a mechanism for defense against mobile genetic elements (MGEs). A CRISPR locus is a molecular memory of MGE encounters. It contains an array of short sequences, called spacers, that generally have sequence identity to MGEs. Three different CRISPR loci have been identified among strains of the opportunistic pathogen Enterococcus faecalis. CRISPR1 and CRISPR3 are as...

  12. Comparative Analysis of the Orphan CRISPR2 Locus in 242 Enterococcus faecalis Strains.

    Directory of Open Access Journals (Sweden)

    Karthik Hullahalli

    Full Text Available Clustered, Regularly Interspaced Short Palindromic Repeats and their associated Cas proteins (CRISPR-Cas provide prokaryotes with a mechanism for defense against mobile genetic elements (MGEs. A CRISPR locus is a molecular memory of MGE encounters. It contains an array of short sequences, called spacers, that generally have sequence identity to MGEs. Three different CRISPR loci have been identified among strains of the opportunistic pathogen Enterococcus faecalis. CRISPR1 and CRISPR3 are associated with the cas genes necessary for blocking MGEs, but these loci are present in only a subset of E. faecalis strains. The orphan CRISPR2 lacks cas genes and is ubiquitous in E. faecalis, although its spacer content varies from strain to strain. Because CRISPR2 is a variable locus occurring in all E. faecalis, comparative analysis of CRISPR2 sequences may provide information about the clonality of E. faecalis strains. We examined CRISPR2 sequences from 228 E. faecalis genomes in relationship to subspecies phylogenetic lineages (sequence types; STs determined by multilocus sequence typing (MLST, and to a genome phylogeny generated for a representative 71 genomes. We found that specific CRISPR2 sequences are associated with specific STs and with specific branches on the genome tree. To explore possible applications of CRISPR2 analysis, we evaluated 14 E. faecalis bloodstream isolates using CRISPR2 analysis and MLST. CRISPR2 analysis identified two groups of clonal strains among the 14 isolates, an assessment that was confirmed by MLST. CRISPR2 analysis was also used to accurately predict the ST of a subset of isolates. We conclude that CRISPR2 analysis, while not a replacement for MLST, is an inexpensive method to assess clonality among E. faecalis isolates, and can be used in conjunction with MLST to identify recombination events occurring between STs.

  13. Tris{2-[4-(2-pyridylpyrimidin-2-ylsulfanyl]ethyl}amine

    Directory of Open Access Journals (Sweden)

    Jian-Quan Wang

    2009-08-01

    Full Text Available The tripodal character of the title compound, C33H30N10S3, arises from the three thioether arms surrounding a central amine N atom. The three arms have approximately the same conformation but distinct geometries in a trans–trans–cis conformation, resulting in a short pyridine–sulfanyl N...S distance of 4.320 (7 Å. The distances of the central N atom to the N atoms of three pyridine rings in the arms are 8.305 (7, 8.032 (7 and 5.076 (9Å. In the crystal, molecules are joined into a three-dimensional supramolecular network via effective π–π stacking between adjacent heterocycles [centroid–centroid distances of 3.700 (3–4.118 (4 Å between adjacent interlayer pyrimidine rings and 3.676 (4 Å between the pyridine rings].

  14. Common variants on 8p12 and 1q24.2 confer risk of schizophrenia

    DEFF Research Database (Denmark)

    Shi, Yongyong; Li, Zhiqiang; Xu, Qi;

    2011-01-01

    Schizophrenia is a severe mental disorder affecting ∼1% of the world population, with heritability of up to 80%. To identify new common genetic risk factors, we performed a genome-wide association study (GWAS) in the Han Chinese population. The discovery sample set consisted of 3,750 individuals ...

  15. 40 CFR 61.242-4 - Standards: Pressure relief devices in gas/vapor service.

    Science.gov (United States)

    2010-07-01

    ... devices in gas/vapor service. (a) Except during pressure releases, each pressure relief device in gas... 40 Protection of Environment 8 2010-07-01 2010-07-01 false Standards: Pressure relief devices in... each pressure release, the pressure relief device shall be returned to a condition of no...

  16. 40 CFR 61.242-8 - Standards: Pressure relief services in liquid service and connectors.

    Science.gov (United States)

    2010-07-01

    ...: Pressure relief services in liquid service and connectors. (a) If evidence of a potential leak is found by visual, audible, olfactory, or any other detection method at pressure relief devices in liquid service... 40 Protection of Environment 8 2010-07-01 2010-07-01 false Standards: Pressure relief services...

  17. High level waste storage tanks 242-A evaporator standards/requirement identification document

    Energy Technology Data Exchange (ETDEWEB)

    Biebesheimer, E.

    1996-01-01

    This document, the Standards/Requirements Identification Document (S/RIDS) for the subject facility, represents the necessary and sufficient requirements to provide an adequate level of protection of the worker, public health and safety, and the environment. It lists those source documents from which requirements were extracted, and those requirements documents considered, but from which no requirements where taken. Documents considered as source documents included State and Federal Regulations, DOE Orders, and DOE Standards

  18. 2-[4-(2-Chloroacetylphenyl]-2-methyl-1-(pyrrolidin-1-ylpropan-1-one

    Directory of Open Access Journals (Sweden)

    Dong-mei Ren

    2013-08-01

    Full Text Available The asymmetric unit of the title compound, C16H20ClNO2, contains two molecules in which the dihedral angles between the benzene ring and the plane of the amide unit are 77.4 (1 and 81.1 (1°. In both molecules, the five-membered ring adopts an envelope conformation with one of the β-C atoms as the flap. In the crystal, molecules are connected via C—H...O hydrogen bonds, forming chains along the b-axis direction. These chains are further linked by C—H...π interactions, forming a three-dimensional network.

  19. Analysis of volatile headspace gases sampled by cryogenic traps from Westinghouse Hanford Company Tank 242-C-112 March 1992

    International Nuclear Information System (INIS)

    Results are given from gas chromatography/mass spectrometry (GC/MS) analyses of the headspace samples obtained by using cryogenic traps from Westinghouse Hanford Company (WHC) Tank 112-C during the month of March, 1992. Samples were analyzed as received with no sample preparation. Analyses included direct GC/MS for volatile/semivolatile components, and direct GC/MS for ammonia. Purge and trap GC/MS analysis was not done. In addition, aliquots were sent to Karl Pool, Pacific Northwest Laboratory, for hydrogen cyanide analysis by ion chromatography, the results are reported here. All concentrations are reported for the methanol extract solutions. To calculate concentrations in the headspace, the cryo-sampling air volume and the methanol rinse volume must be obtained from cryo-sampling personnel at WHC. Triplicate analyses were done on all samples, and average concentrations and standard deviations are reported. One significant result was that no ammonia was detected

  20. High-level waste storage tank farms/242-A evaporator standards/requirements identification document (S/RID), Vol. 1

    Energy Technology Data Exchange (ETDEWEB)

    1994-04-01

    The purpose of this Requirements Identification Document (RID) section is to identify, in one location, all of the facility specific requirements and good industry practices which are necessary or important to establish an effective Issues Management Program for the Tank Farm Facility. The Management Systems Functional Area includes the site management commitment to environmental safety and health (ES&H) policies and controls, to compliance management, to development and management of policy and procedures, to occurrence reporting and corrective actions, resource and issue management, and to the self-assessment process.

  1. 2-[4-(2-Hydroxyethoxyphenyl]-4,4,5,5-tetramethyl-2-imidazoline-1-oxyl 3-oxide

    Directory of Open Access Journals (Sweden)

    Lin-Lin Jing

    2011-12-01

    Full Text Available In the title compound, C15H21N2O4, the imidazoline ring displays a twisted conformation. The dihedral angle between the mean plane of the imidazoline ring and the benzene ring is 33.50 (12°. In the crystal, molecules are connected by O—H...O hydrogen bonds, forming a zigzag chain along the c axis. The chains are linked by C—H...O and C—H...π interactions.

  2. Air Stripping of 1-Butanol During Cleaning of the 242-16H Evaporator: 1. Model Development and Conservative Predictions

    International Nuclear Information System (INIS)

    This report describes an analysis performed using conservative and bounding assumptions. These assumptions lead to a lower bound on the butanol removal rate and an upper bound on the liquid phase butanol concentration

  3. Air Stripping of 1-Butanol During Cleaning of the 242-16H Evaporator: 1. Model Development and Conservative Predictions

    Energy Technology Data Exchange (ETDEWEB)

    Poirier, M.R.

    2001-04-04

    This report describes an analysis performed using conservative and bounding assumptions. These assumptions lead to a lower bound on the butanol removal rate and an upper bound on the liquid phase butanol concentration.

  4. High-level waste storage tank farms/242-A evaporator standards/requirements identification document (S/RID), Vol. 7

    Energy Technology Data Exchange (ETDEWEB)

    1994-04-01

    This Requirements Identification Document (RID) describes an Occupational Health and Safety Program as defined through the Relevant DOE Orders, regulations, industry codes/standards, industry guidance documents and, as appropriate, good industry practice. The definition of an Occupational Health and Safety Program as specified by this document is intended to address Defense Nuclear Facilities Safety Board Recommendations 90-2 and 91-1, which call for the strengthening of DOE complex activities through the identification and application of relevant standards which supplement or exceed requirements mandated by DOE Orders. This RID applies to the activities, personnel, structures, systems, components, and programs involved in maintaining the facility and executing the mission of the High-Level Waste Storage Tank Farms.

  5. High-level waste storage tank farms/242-A evaporator standards/requirements identification document (S/RID), Vol. 7

    International Nuclear Information System (INIS)

    This Requirements Identification Document (RID) describes an Occupational Health and Safety Program as defined through the Relevant DOE Orders, regulations, industry codes/standards, industry guidance documents and, as appropriate, good industry practice. The definition of an Occupational Health and Safety Program as specified by this document is intended to address Defense Nuclear Facilities Safety Board Recommendations 90-2 and 91-1, which call for the strengthening of DOE complex activities through the identification and application of relevant standards which supplement or exceed requirements mandated by DOE Orders. This RID applies to the activities, personnel, structures, systems, components, and programs involved in maintaining the facility and executing the mission of the High-Level Waste Storage Tank Farms

  6. 0.94 - 2.42 micron ground-based transmission spectra of the hot-Jupiter HD-189733b

    CERN Document Server

    Danielski, C; Waldmann, I P; Hollis, M D J; Tinetti, G; Swain, M R

    2012-01-01

    We present here new transmission spectra of the hot Jupiter HD-189733b using the SpeX instrument on the NASA Infrared Telescope Facility. We obtained two nights of observations where we recorded the primary transit of the planet in the J-, H- and K-bands simultaneously, covering a total spectral range from 0.94 to 2.4 micron. We used Fourier analysis and other de-trending techniques validated previously on other datasets to clean the data. We tested the statistical significance of our results by calculating the auto-correlation function, and we found that, after the detrending, white noise dominates at most frequencies. Additionally, we repeated our analysis on the out-of-transit data only, showing that the residual telluric contamination is well within the error bars. While these techniques are very efficient when multiple nights of observations are combined together, our results prove that even one good night of observations is enough to provide statistically meaningful data, which might appear counterintui...

  7. High-level waste storage tank farms/242-A evaporator standards/requirements identification document (S/RID), Vol. 5

    Energy Technology Data Exchange (ETDEWEB)

    1994-04-01

    The Fire Protection functional area for the Hanford Site Tank Farm facilities and support structures is based on the application of relevant DOE orders, regulations, and industry codes and standards. The fire protection program defined in this document may be divided into three areas: (1) organizational, (2) administrative programmatic features, and (3) technical features. The information presented in each section is in the form of program elements and orders, regulations, industry codes, and standards that serve as the attributes of a fire protection program for the Tank Farm facilities. Upon completion this document will be utilized as the basis to evaluate compliance of the fire protection program being implemented for the Tank Farm facilities with the requirements of DOE orders and industry codes and standards.

  8. High-level waste storage tank farms/242-A evaporator standards/requirements identification document (S/RID), Vol. 2

    Energy Technology Data Exchange (ETDEWEB)

    1994-04-01

    The Quality Assurance Functional Area Requirements Identification Document (RID), addresses the programmatic requirements that ensure risks and environmental impacts are minimized, ensure safety, reliability, and performance are maximized through the application of effective management systems commensurate with the risks posed by the Tank Farm Facility and its operation. This RID incorporates guidance intended to provide Tank Farms management with the necessary requirements information to develop, upgrade, or assess the effectiveness of a Quality Assurance Program in the performance of organizational and functional activities. Quality Assurance is defined as all those planned and systematic actions necessary to provide adequate confidence that a facility, structure, system, or component will perform satisfactorily and safely in service. This document will provide the specific requirements to meet DNFSB recommendations and the guidance provided in DOE Order 5700.6C, utilizing industry codes, standards, regulatory guidelines, and industry good practices that have proven to be essential elements for an effective and efficient Quality Assurance Program as the nuclear industry has matured over the last thirty years.

  9. The emission of heavy clusters described in the mean-field HFB theory: the case of 242Cm

    International Nuclear Information System (INIS)

    The emission of a nucleus of 34Si by the parent 96242Cm is a process in the diffuse borderline between cluster emission and standard mass asymmetric fission. In this paper we analyze in a microscopic framework such process using the standard mean field techniques used to describe cluster emission. They include Hartree-Fock-Bogoliubov constrained calculations with the Gogny D1S interaction and the octupole moment operator as the collective coordinate to describe the process. Collective masses and all kind of zero point energy corrections are considered which allows for a parameter free estimation of the process' half-life. The agreement with experiment is quite satisfactory. (author)

  10. Project C-018H, 242-A evaporator/PUREX Plant Process Condensate Treatment Facility Instrumentation and Control (I ampersand C)

    International Nuclear Information System (INIS)

    This Acceptance Test Procedure (ATP) has been prepared to demonstrate that the Collection System Instrumentation ampersand Control System for Project C-018H performs according to design. Specifically, this ATP is designed to verify the following overall system requirements: The input and outputs properly connected to the LCU terminal strips. The control system software conforms to the configuration specified by the logic diagrams, piping and instrumentation diagrams (P ampersand ID), and the LERF operating philosophy. Testing will be performed using actual signals. If actual signals are not available, then simulated signals will be used to complete the tests

  11. High-level waste storage tank farms/242-A evaporator standards/requirements identification document (S/RID), Vol. 3

    Energy Technology Data Exchange (ETDEWEB)

    1994-04-01

    The Safeguards and Security (S&S) Functional Area address the programmatic and technical requirements, controls, and standards which assure compliance with applicable S&S laws and regulations. Numerous S&S responsibilities are performed on behalf of the Tank Farm Facility by site level organizations. Certain other responsibilities are shared, and the remainder are the sole responsibility of the Tank Farm Facility. This Requirements Identification Document describes a complete functional Safeguards and Security Program that is presumed to be the responsibility of the Tank Farm Facility. The following list identifies the programmatic elements in the S&S Functional Area: Program Management, Protection Program Scope and Evaluation, Personnel Security, Physical Security Systems, Protection Program Operations, Material Control and Accountability, Information Security, and Key Program Interfaces.

  12. 32 CFR 242.8 - Academic, intellectual, and personal requirements for admission to the first-year class.

    Science.gov (United States)

    2010-07-01

    ... Test. (3) Evidence of character and motivation. Judgments about character and motivation will be based... selection predicated on: (a) Evidence of sound character and high motivation for a career in the...

  13. High level waste storage tank farms/242-A evaporator standards/requirements identification document phase 1 assessment report

    Energy Technology Data Exchange (ETDEWEB)

    Biebesheimer, E., Westinghouse Hanford Co.

    1996-09-30

    This document, the Standards/Requirements Identification Document (S/RID) Phase I Assessment Report for the subject facility, represents the results of an Administrative Assessment to determine whether S/RID requirements are fully addressed by existing policies, plans or procedures. It contains; compliance status, remedial actions, and an implementing manuals report linking S/RID elements to requirement source to implementing manual and section.

  14. High-level waste storage tank farms/242-A evaporator standards/requirements identification document (S/RID), Vol. 3

    International Nuclear Information System (INIS)

    The Safeguards and Security (S ampersand S) Functional Area address the programmatic and technical requirements, controls, and standards which assure compliance with applicable S ampersand S laws and regulations. Numerous S ampersand S responsibilities are performed on behalf of the Tank Farm Facility by site level organizations. Certain other responsibilities are shared, and the remainder are the sole responsibility of the Tank Farm Facility. This Requirements Identification Document describes a complete functional Safeguards and Security Program that is presumed to be the responsibility of the Tank Farm Facility. The following list identifies the programmatic elements in the S ampersand S Functional Area: Program Management, Protection Program Scope and Evaluation, Personnel Security, Physical Security Systems, Protection Program Operations, Material Control and Accountability, Information Security, and Key Program Interfaces

  15. High-level waste storage tank farms/242-A evaporator standards/requirements identification document (S/RID), Vol. 2

    International Nuclear Information System (INIS)

    The Quality Assurance Functional Area Requirements Identification Document (RID), addresses the programmatic requirements that ensure risks and environmental impacts are minimized, ensure safety, reliability, and performance are maximized through the application of effective management systems commensurate with the risks posed by the Tank Farm Facility and its operation. This RID incorporates guidance intended to provide Tank Farms management with the necessary requirements information to develop, upgrade, or assess the effectiveness of a Quality Assurance Program in the performance of organizational and functional activities. Quality Assurance is defined as all those planned and systematic actions necessary to provide adequate confidence that a facility, structure, system, or component will perform satisfactorily and safely in service. This document will provide the specific requirements to meet DNFSB recommendations and the guidance provided in DOE Order 5700.6C, utilizing industry codes, standards, regulatory guidelines, and industry good practices that have proven to be essential elements for an effective and efficient Quality Assurance Program as the nuclear industry has matured over the last thirty years

  16. 49 CFR 173.242 - Bulk packagings for certain medium hazard liquids and solids, including solids with dual hazards.

    Science.gov (United States)

    2010-10-01

    ... the tank opening and any pressure relief device. Pressure relief devices must be mounted, shielded, or... requirements of § 178.346-3 or § 178.347-4 of this subchapter. However, pressure relief devices on MC 310, MC... for Class 8, Packing Group I and II). Pressure relief devices on MC 330 and MC 331 cargo tanks...

  17. Towards high accurate neutron-induced fission cross sections of 240,242Pu: Spontaneous fission half-lives

    OpenAIRE

    Salvador-Castiñeira P.; Bryś T.; Eykens R.; Hambsch F.-J.; Moens A.; Oberstedt S.; Pretel C.; Sibbens G.; Vanleeuw D.; Vidali M.;

    2013-01-01

    Fast spectrum neutron-induced fission cross sections of transuranic isotopes are being of special demand in order to provide accurate data for the new GEN-IV nuclear power plants. To minimize the uncertainties on these measurements accurate data on spontaneous fission half-lives and detector efficiencies are a key point. High α-active actinides need special attention since the misinterpretation of detector signals can lead to low efficiency values or underestimation in fission fragment detect...

  18. High-level waste storage tank farms/242-A evaporator standards/requirements identification document (S/RID), Vol. 6

    International Nuclear Information System (INIS)

    The scope of the Environmental Restoration and Waste Management (EM) Functional Area includes the programmatic controls associated with the management and operation of the Hanford Tank Farm Facility. The driving management organization implementing the programmatic controls is the Tank Farms Waste Management (WM)organization whose responsibilities are to ensure that performance objectives are established; and that measurable criteria for attaining objectives are defined and reflected in programs, policies and procedures. Objectives for the WM Program include waste minimization, establishment of effective waste segregation methods, waste treatment technology development, radioactive (low-level, high-level) hazardous and mixed waste transfer, treatment, and storage, applicability of a corrective action program, and management and applicability of a decontamination and decommissioning (D ampersand D) program in future years

  19. 32 CFR 242a.4 - Grounds on which meetings may be closed, or information may be withheld.

    Science.gov (United States)

    2010-07-01

    ...) Disclose the identity of a confidential source and, in the case of a record compiled by a criminal law... international tribunal, or an arbitration, or the initiation, conduct, or disposition by the USUHS of a... closed, or information may be withheld. Except in a case where the Board or a committee finds that...

  20. High-level waste storage tank farms/242-A evaporator standards/requirements identification document (S/RID), Vol. 1

    International Nuclear Information System (INIS)

    The purpose of this Requirements Identification Document (RID) section is to identify, in one location, all of the facility specific requirements and good industry practices which are necessary or important to establish an effective Issues Management Program for the Tank Farm Facility. The Management Systems Functional Area includes the site management commitment to environmental safety and health (ES ampersand H) policies and controls, to compliance management, to development and management of policy and procedures, to occurrence reporting and corrective actions, resource and issue management, and to the self-assessment process

  1. Electrical/instrumentation acceptance test report for Project C-018H, 242-A Evaporator/PUREX Plant condensate treatment facility

    International Nuclear Information System (INIS)

    This project is part of the 200 Area Effluent Treatment Facility. The acceptance test procedure describes test methods for leak detection units, pump flow switches, pump level control valves, room air temperature monitor, leachate pump status contacts, basin pump status contacts, catch basin leak detector, leachate level monitors, and basin level monitors. These are all components of the C-018H Collection System

  2. Acceptance test procedure for C-018H, 242-A evaporator/PUREX plant process condensate treatment facility

    International Nuclear Information System (INIS)

    This Acceptance Test Procedure (ATP) has been prepared to demonstrate that the Electrical/Instrumentation system function as required for this facility. Each company or organization participating in this ATP will designate personnel to assume the responsibilities and duties as defined herein for their respective roles

  3. Discovery of Isotopes of the Transuranium Elements with 93 <= Z <= 98

    OpenAIRE

    Fry, C; Thoennessen, M

    2012-01-01

    One hundred and five isotopes of the transuranium elements neptunium, plutonium, americium, curium, berkelium and californium have so far been observed; the discovery of these isotopes is discussed. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  4. Neutron multiplicities for the transplutonium nuclides

    International Nuclear Information System (INIS)

    This paper continues, with respect to the transplutonium nuclides, earlier efforts to collate and evaluate data from the scientific literature on the prompt neutron multiplicity distribution from fission and its first moment = ΣnuPnu. The isotopes considered here for which P/sub nu/ and or data (or both) were found in the literature are of americium (Am), curium (Cm), berkelium (Bk), californium (Cf), einsteinium (Es), fermium (Fm), and nobelium (No)

  5. Final characterization and safety screen report of double shell tank 241-AP-104 for 242-A evaporator, campaign 96-1

    International Nuclear Information System (INIS)

    This data package satisfies the requirement for a format IV, final report. It is a follow-up to the 45-day safety screen report for tank AP-104. Evaporator candidate feed from tank 241-AP-104 (hereafter referred to as AP-104) was characterized for physical, inorganic, organic and radiochemical parameters by the Westinghouse Hanford Company, 222-S Laboratory, and by the Battelle Pacific Northwest National Laboratory (PNNL), Analytical Chemistry Laboratory (ACL) as directed by the Tank Sample and Analysis Plan (TSAP), References 1 through 4. Preliminary data in the form of summary analytical tables were provided to the project in advance of this final report to enable early estimation of evaporator operational parameters, using the Predict modeling program. Laboratory analyses at ACL Laboratory was performed according to the TSAP. Analyses were performed at the 222-S Laboratory as defined and specified in the TSAP and the Laboratory's Quality Assurance Plan, References 5 and 6. Any deviations from the instructions documented in the TSAP are discussed in this narrative and are supported with additional documentation. SAMPLING The TSAP, section 2, provided sampling information for waste samples collected from tank AP-104. The bottle-on-a-string method was used to collect liquid grab samples from the tank. Each glass sample bottle was amber, precleaned, and contained approximately 100 milliliters. Each bottle was closed with a teflon seal cap (or teflon septum for volatile organic analysis samples). Field blank samples were prepared by placing deionized water into sampling bottles, lowering the unclosed bottles into the riser for a period of time, retrieving them from the riser, and then closing the bottles with the same types of caps used for the tank samples. None of the samples were preserved by acidification. Upon receipt, the sample bottles destined for organic analyses were placed in a refrigerator. No attempt was made during sampling to assure the complete filling of the bottles so as to exclude all headspace. These actions were consistent with safety procedures, which attempt to limit personnel exposure to hazardous ionizing radiation

  6. Ancient Haplotypes at the 15q24.2 Microdeletion Region Are Linked to Brain Expression of MAN2C1 and Children's Intelligence

    Science.gov (United States)

    Cáceres, Alejandro; Esko, Tõnu; Pappa, Irene; Gutiérrez, Armand; Lopez-Espinosa, Maria-Jose; Llop, Sabrina; Bustamante, Mariona; Tiemeier, Henning; Metspalu, Andres; Wilsonx, James F.; Reina-Castillón, Judith; Shin, Jean; Pausova, Zdenka; Paus, Tomáš; Sunyer, Jordi; Pérez-Jurado, Luis A.; González, Juan R.

    2016-01-01

    The chromosome bands 15q24.1-15q24.3 contain a complex region with numerous segmental duplications that predispose to regional microduplications and microdeletions, both of which have been linked to intellectual disability, speech delay and autistic features. The region may also harbour common inversion polymorphisms whose functional and phenotypic manifestations are unknown. Using single nucleotide polymorphism (SNP) data, we detected four large contiguous haplotype-genotypes at 15q24 with Mendelian inheritance in 2,562 trios, African origin, high population stratification and reduced recombination rates. Although the haplotype-genotypes have been most likely generated by decreased or absent recombination among them, we could not confirm that they were the product of inversion polymorphisms in the region. One of the blocks was composed of three haplotype-genotypes (N1a, N1b and N2), which significantly correlated with intelligence quotient (IQ) in 2,735 children of European ancestry from three independent population cohorts. Homozygosity for N2 was associated with lower verbal IQ (2.4-point loss, p-value = 0.01), while homozygosity for N1b was associated with 3.2-point loss in non-verbal IQ (p-value = 0.0006). The three alleles strongly correlated with expression levels of MAN2C1 and SNUPN in blood and brain. Homozygosity for N2 correlated with over-expression of MAN2C1 over many brain areas but the occipital cortex where N1b homozygous highly under-expressed. Our population-based analyses suggest that MAN2C1 may contribute to the verbal difficulties observed in microduplications and to the intellectual disability of microdeletion syndromes, whose characteristic dosage increment and removal may affect different brain areas. PMID:27355585

  7. On Interpolation Functions of the Generalized Twisted 242X-2009-946569-i1.gif"/>-Euler Polynomials

    OpenAIRE

    Park KyoungHo

    2009-01-01

    The aim of this paper is to construct -adic twisted two-variable Euler-( , )- -functions, which interpolate generalized twisted ( , )-Euler polynomials at negative integers. In this paper, we treat twisted ( , )-Euler numbers and polynomials associated with -adic invariant integral on . We will construct two-variable twisted ( , )-Euler-zeta function and two-variable ( , )- -function in Complex -plane.

  8. Spectrum of Class 242X-2007-027195-i1.gif"/> Operators

    OpenAIRE

    Yuan Jiangtao; Gao Zongsheng

    2007-01-01

    This paper discusses some spectral properties of class operators for , , , and . It is shown that if is a class operator, then the Riesz idempotent of with respect to each nonzero isolated point spectrum is selfadjoint and . Afterwards, we prove that every class operator has SVEP and property , and Weyl's theorem holds for when .

  9. A note on 242X-2002-920209-i1.gif"/> weights: Pasting weights and changing variables

    OpenAIRE

    Riera Mario Pérez

    2002-01-01

    For two weights , on , we show that (the Muckenhoupt class of weights) if and only if and , under the assumption that for every . We also prove a rather general result on pasting weights on that satisfy the condition.

  10. Powers of class 242X-2002-735735-i1.gif"/> operators associated with generalized Aluthge transformation

    OpenAIRE

    Yanagida Masahiro

    2002-01-01

    An operator belongs to class for and if and only if if and only if where is generalized Aluthge transformation of , that is, . Class was introduced by Ito as a generalization of -hyponormality which was introduced by Aluthge and Wang. We shall show that if is a class operator for and , then belongs to class for all positive integer . As an immediate corollary of this result, we shall also show that if is a -hyponormal operator, then is also -hyponormal for all positive integer .

  11. Bounds of Eigenvalues of 242X-2009-852406-i1.gif"/>-Minor Free Graphs

    OpenAIRE

    Fang Kun-Fu

    2009-01-01

    The spectral radius of a graph is the largest eigenvalue of its adjacency matrix. Let be the smallest eigenvalue of . In this paper, we have described the -minor free graphs and showed that (A) let be a simple graph with order . If has no -minor, then . (B) Let be a simple connected graph with order . If has no -minor, then , where equality holds if and only if is isomorphic to .

  12. Approximately 242X-2009-870843-i1.gif"/>-Jordan Homomorphisms on Banach Algebras

    OpenAIRE

    Karimi T; Kaboli Gharetapeh S; Gordji MEshaghi

    2009-01-01

    Let , and let be two rings. An additive map is called -Jordan homomorphism if for all . In this paper, we establish the Hyers-Ulam-Rassias stability of -Jordan homomorphisms on Banach algebras. Also we show that (a) to each approximate 3-Jordan homomorphism from a Banach algebra into a semisimple commutative Banach algebra there corresponds a unique 3-ring homomorphism near to , (b) to each approximate -Jordan homomorphism between two commutative Banach algebras there corresp...

  13. On 242X-2009-921634-i1.gif"/>-Quasiclass A Operators

    OpenAIRE

    Gao Fugen; Fang Xiaochun

    2009-01-01

    An operator is called -quasiclass if for a positive integer , which is a common generalization of quasiclass . In this paper, firstly we prove some inequalities of this class of operators; secondly we prove that if is a -quasiclass operator, then is isoloid and has finite ascent for all complex number at last we consider the tensor product for -quasiclass operators.

  14. Interpolation Functions of 242X-2009-451217-i1.gif"/>-Extensions of Apostol's Type Euler Polynomials

    OpenAIRE

    Kim Young-Hee; Kim Taekyun; Hwang Kyung-Won

    2009-01-01

    The main purpose of this paper is to present new -extensions of Apostol's type Euler polynomials using the fermionic -adic integral on . We define the - -Euler polynomials and obtain the interpolation functions and the Hurwitz type zeta functions of these polynomials. We define -extensions of Apostol type's Euler polynomials of higher order using the multivariate fermionic -adic integral on . We have the interpolation functions of these - -Euler polynomials. We also give -extensions...

  15. On powers of 242X-2000-892676-i1.gif"/>-hyponormal and log-hyponormal operators

    OpenAIRE

    Furuta Takayuki; Yanagida Masahiro

    2000-01-01

    A bounded linear operator on a Hilbert space is said to be -hyponormal for if , and is said to be log-hyponormal if is invertible and . Firstly, we shall show the following extension of our previous result: If is -hyponormal for , then and hold for all positive integer . Secondly, we shall discuss the best possibilities of the following parallel result for log-hypponormal operators by Yamazaki: If is log-hyponormal, then and hold for all positive integer .

  16. Estimates of 242X-2010-435450-i1.gif"/>-Harmonic Conjugate Operator

    OpenAIRE

    Lee Jaesung; Rim KyungSoo

    2010-01-01

    We define the -harmonic conjugate operator and prove that for , there is a constant such that for all if and only if the nonnegative weight satisfies the -condition. Also, we prove that if there is a constant such that for all , then the pair of weights satisfies the -condition.

  17. Transfinite diameter of Bernstein sets in 242X-2002-680202-i1.gif"/>

    OpenAIRE

    Bialas-Cież Leokadia; Jedrzejowski Mieczysław

    2002-01-01

    Let be a compact set in satisfying the following generalized Bernstein inequality: for each such that , for each polynomial of degree where is a constant independent of and , is an infinite set of natural numbers that is also independent of and . We give an estimate for the transfinite diameter of the set : For satisfying the usual Bernstein inequality (i.e., ), we prove that

  18. SYNTHESIS, COMPUTATIONAL STUDY AND PRELIMINARY PHARMACOLOGICAL EVALUATION OF 2-[4-(2-CHLOROBENZYL/BENZOYL SUBSTITUTED PIPERAZIN-1-YL]-N-PHENYLACETAMIDE: POTENTIAL ANTIPSYCHOTICS

    Directory of Open Access Journals (Sweden)

    Tomar Amita

    2011-06-01

    Full Text Available Benzyl and benzoyl substituted acetamides have been synthesized and evaluated as potential antipsychotic agents. The target compounds (4a-b were prepared by reaction of substituted anilines with chloroacetylchloride which further treated with 2-chlorobenzyl or 2-chlorobenzoyl piperazine in presence of potassium carbonate and potassium iodide as catalyst in acetonitrile. The structures of the target compounds (4a-b were characterized on the basis of their M.P., TLC, IR and 1H-NMR data. Computational studies of target compounds (4a-b were carried out by using software programs. The target compounds showed good similarity with respect to standard drugs. The target compounds (4a-b showed inhibition of 5-HTP induced head twitches behavior and low induction of catalepsy in mice.

  19. Air Stripping of 1-Butanol During Cleaning of the 242-16H Evaporator: 2. Optimized Mass Transfer and Equilibrium Predictions

    Energy Technology Data Exchange (ETDEWEB)

    Poirier, M.R.

    2001-04-17

    This study contains an aggressive ''equilibrium'' upper-limit for the butanol removal rate, as well as a ''best estimate'' approximation of the butanol removal during evaporator cleaning.

  20. catena-Poly[[[tetraaquacobalt(II]-μ-4,4′-bipyridine-κ2N:N′] 2-[4-(2-carboxylatoethylphenoxy]acetate

    Directory of Open Access Journals (Sweden)

    Xi-Fang Wang

    2009-07-01

    Full Text Available In the title complex, {[Co(C10H8N2(H2O4](C11H10O5}n, the unique CoII ion lies on an inversion center and is coordinated by two N atoms from two 4,4′-bipyridine ligands and four O atoms from four water molecules in a slightly distorted octahedral coordination geometry. The 4,4′-bipyridine ligands bridge CoII ions into a one-dimensional chain structure. In the crystal structure, intermolecular O—H...O hydrogen bonds link cations and anions into a three-dimensional network. The dianions are completely disordered about an inversion center.

  1. Neutron-induced fission cross sections of Pu-242 from 0.3 MeV to 3 MeV

    OpenAIRE

    Salvador Castiñeira, Paula Genoveva; Brys, Tomasz; Eykens, Roger; Hambsch, Franz Josef; Gook, A.; Moens, André; Oberstedt, Stephan; Sibbens, Geodele; Vanleeuw, David; Vidali, Marzio; Pretel Sánchez, Carme

    2015-01-01

    The majority of the next generation of nuclear power plants (GEN-IV) will work in the fast-neutron-energy region, as opposed to present day thermal reactors. This leads to new and more accurate nuclear-data needs for some minor actinides and structural materials. Following those upcoming demands, the Organisation for Economic Cooperation and Development Nuclear Energy Agency performed a sensitivity study. Based on the latter, an improvement in accuracy from the present 20% to 5% is required f...

  2. SU-E-J-242: Volume-Dependence of Quantitative Imaging Features From CT and CE-CT Images of NSCLC

    International Nuclear Information System (INIS)

    Purpose: To determine whether tumor volume plays a significant role in the values obtained for texture features when they are extracted from computed tomography (CT) images of non-small cell lung cancer (NSCLC). We also sought to identify whether features can be reliably measured at all volumes or if a minimum volume threshold should be recommended. Methods: Eleven features were measured on 40 CT and 32 contrast-enhanced CT (CECT) patient images for this study. Features were selected for their prognostic/diagnostic value in previous publications. Direct correlations between these textures and volume were evaluated using the Spearman correlation coefficient. Any texture that the Wilcoxon rank-sum test was used to compare the variation above and below a volume cutoff. Four different volume thresholds (5, 10, 15, and 20 cm3) were tested. Results: Four textures were found to be significantly correlated with volume in both the CT and CE-CT images. These were busyness, coarseness, gray-level nonuniformity, and run-length nonuniformity with correlation coefficients of 0.92, −0.96, 0.94, and 0.98 for the CT images and 0.95, −0.97, 0.98, and 0.98 for the CE-CT images. After volume normalization, the correlation coefficients decreased substantially. For the data obtained from the CT images, the results of the Wilcoxon rank-sum test were significant when volume thresholds of 5–15 cm3 were used. No volume threshold was shown to be significant for the CE-CT data. Conclusion: Equations for four features that have been used in several published studies were found to be volume-dependent. Future studies should consider implementing normalization factors or removing these features entirely to prevent this potential source of redundancy or bias. This work was supported in part by National Cancer Institute grant R03CA178495-01. Xenia Fave is a recipient of the American Association of Physicists in Medicine Graduate Fellowship

  3. Thermodynamic Assessment of Hot Corrosion Mechanisms of Superalloys Hastelloy N and Haynes 242 in Eutectic Mixture of Molten Salts KF and ZrF4

    Energy Technology Data Exchange (ETDEWEB)

    Michael V. Glazoff

    2012-02-01

    The KF - ZrF4 system was considered for the application as a heat exchange agent in molten salt nuclear reactors (MSRs) beginning with the work carried out at ORNL in early fifties. Based on a combination of excellent properties such as thermal conductivity, viscosity in the molten state, and other thermo-physical and rheological properties, it was selected as one of possible candidates for the nuclear reactor secondary heat exchanger loop.

  4. Deborah FITZGERALD, Every Farm A Factory: The Industrial Ideal in American Agriculture, New Haven/Londres, Yale University Press, 2003, 242 p.

    OpenAIRE

    Jas, Nathalie

    2005-01-01

    Historienne de formation et originaire de l’État rural de l’Iowa, Deborah Fitzgerald a consacré son premier livre  à la reconstitution et à l’analyse sur la période 1890-1940 des processus complexes par lesquels les agriculteurs de l’État de l’Illinois ont finalement été amenés à utiliser des semences de maïs hybrides, plus coûteuses — et réclamant également davantage d’engrais et de produits phytosanitaires — que les semences sélectionnées de manière traditionnelle. Elle insistait alors sur ...

  5. A root hairless barley mutant for elucidating genetic of root hairs and phosphorus uptake (Correction in v. 242, 2002, p. 299)

    DEFF Research Database (Denmark)

    Gahoonia, T.S.; Nielsen, N.E.; Priyavadan, A.J.; Jahoor, A.

    2001-01-01

    This paper reports a new barley mutant missing root hairs. The mutant was spontaneously discovered among the population of wild type (Pallas, a spring barley cultivar), producing normal, 0.8 mm long root hairs. We have called the mutant bald root barley (brb). Root anatomical studies confirmed the...

  6. 2.4-2 Management of Educational Technology in Networked Education(Issues on Cross-Cultural Distance Education : Collaborative Research Outcomes and Open Workshops)

    OpenAIRE

    小林, 登志生; コバヤシ, トシオ; Cemil, ULUKAN; Toshio, Kobayashi

    2004-01-01

    Management of educational technology becomes more challenging as education transforms into networked modes thanks to the advancements in information and communication technologies (ICTs). This transformation implies that a deliberate and purposeful approach is needed for effective utilization of educational technology, which involves many organizational aspects that most higher education (HE) leaders do not recognize. Having the latest versions of technology will not solve the problems; rathe...

  7. Takotsubo cardiomyopathy associated with sepsis due to Pseudomonas aeruginosa pneumoniadoi: 10.12662/2317-3076jhbs.v3i4.169.p242-244.2015

    Directory of Open Access Journals (Sweden)

    Márcio da Silva Pereira

    2015-12-01

    Full Text Available The authors describe a case report of a 71 year-old female patient admitted at the emergency service due to severe precordial chest pain associated with dyspnea and sweating. The electrocardiogram performed on admission showed ST elevation on V2 and V3 leads and the ventriculography revealed left ventricular apical ballooning, denoting the diagnosis of Takotsubo Cardiomyopathy. At the eighth day of hospitalization, although the heart function was recovered, the patient died due the clinical complications of a septic shock.

  8. 40 CFR 721.8950 - Chromate(3-), bis[3-[[6-amino-1,4-dihydro-2-[[[4-[(2-hydroxy-1-naphthalenyl)azo] phenyl]sulfonyl...

    Science.gov (United States)

    2010-07-01

    ...]amino]-4-(oxo-.kappa.O)-5-pyrimidinyl]azo-.kappaN1]-4-hydroxy-.kappa.O)-5-nitrobenzenesulfonato(3...-(oxo-.kappa.O)-5-pyrimidinyl]azo-.kappaN1]-4-hydroxy-.kappa.O)-5-nitrobenzenesulfonato(3-)]-, sodium... substance identified as chromate(3-), bis...

  9. 40 CFR 721.8940 - Chromate(3-), bis[3-[[6-amino-1,4-dihydro-2-[[[4-[(2-hydroxy-1-naphthalenyl)azo] phenyl]sulfonyl...

    Science.gov (United States)

    2010-07-01

    ...] amino]-4-(oxo-.kappa.O)-5- pyrimidinyl]azo-.kappaN1] -4-hydroxy-.kappa.O)-5-nitrobenzenesulfonato(3...- pyrimidinyl]azo-.kappaN1] -4-hydroxy-.kappa.O)-5-nitrobenzenesulfonato(3-)]-, trisodium. (a) Chemical...-), bis phenyl] sulfonyl]amino]-4-(oxo-.kappa.O)-5-pyrimidinyl]azo-.kappaN1]...

  10. On Convergence of 242X-2009-170526-i1.gif"/>-Series Involving 242X-2009-170526-i2.gif"/> Basic Hypergeometric Series

    OpenAIRE

    Zhao Xilai; Wang Mingjin

    2009-01-01

    We use inequality technique and the terminating case of the -binomial formula to give some results on convergence of -series involving basic hypergeometric series. As an application of the results, we discuss the convergence for special Thomae -integral.

  11. An Estimate of the Essential Norm of a Composition Operator from 242X-2010-132970-i1.gif"/> to 242X-2010-132970-i2.gif"/> in the Unit Ball

    OpenAIRE

    Zeng Hong-Gang; Zhou Ze-Hua

    2010-01-01

    Abstract Let be the unit ball of and a holomorphic self-map of Let , , , , and let be the composition operator between the space and -Bloch space induced by . This paper gives an estimate of the essential norm of . As a consequence, a necessary and sufficient condition for the composition operator to be compact from to is obtained.

  12. Extensions of the results on powers of 242X-2006-36919-i1.gif"/>-hyponormal and 242X-2006-36919-i2.gif"/>-hyponormal operators

    OpenAIRE

    Yang Changsen; Yuan Jiangtao

    2006-01-01

    Firstly, we will show the following extension of the results on powers of -hyponormal and -hyponormal operators: let and be positive integers, if is -hyponormal for , then: (i) in case , and hold, (ii) in case , and hold. Secondly, we will show an estimation on powers of -hyponormal operators for which implies the best possibility of our results. Lastly, we will show a parallel estimation on powers of -hyponormal operators as follows: let , then the following hold for each positive i...

  13. TOWARD AN IMPROVED UNDERSTANDING OF STRUCTURE AND MAGNETISM IN NEPTUNIUM AND PLUTONIUM PHOSPHONATES AND SULFONATES

    Energy Technology Data Exchange (ETDEWEB)

    Albrecht-Schmitt, Thomas

    2012-03-01

    This grant supported the exploratory synthesis of new actinide materials with all of the actinides from thorium to californium with the exceptions of protactinium and berkelium. We developed detailed structure-property relationships that allowed for the identification of novel materials with selective ion-exchange, selective oxidation, and long-range magnetic ordering. We found novel bonding motifs and identified periodic trends across the actinide series. We identified structural building units that would lead to desired structural features and novel topologies. We also characterized many different spectroscopic trends across the actinide series. The grant support the preparation of approximately 1200 new compounds all of which were structurally characterized.

  14. Composition containing transuranic elements for use in the homeopathic treatment of aids

    International Nuclear Information System (INIS)

    A homeopathic remedy consisting of a composition containing one or more transuranic elements, particularly plutonium, for preventing and treating acquired immunodeficiency syndrome (AIDS) in humans, as well as seropositivity for human immunodeficiency virus (HIV). Said composition is characterized in that it uses any chemical or isotopic form of one or more transuranic elements (neptunium, plutonium, americium, curium, berkelium, californium or einsteinium), particularly plutonium, said form being diluted and dynamized according to conventional homeopathic methods, particularly the so-called Hahnemann and Korsakov methods, and provided preferably but not exclusively in the form of lactose and/or saccharose globules or granules impregnated with the active principle of said composition. (author)

  15. Detection of rare earth elements in Powder River Basin sub-bituminous coal ash using laser-induced breakdown spectroscopy (LIBS)

    Energy Technology Data Exchange (ETDEWEB)

    Tran, Phuoc [National Energy Technology Lab. (NETL), Pittsburgh, PA, (United State; Mcintyre, Dustin [National Energy Technology Lab. (NETL), Pittsburgh, PA, (United State

    2015-10-01

    We reported our preliminary results on the use of laser-induced breakdown spectroscopy to analyze the rare earth elements contained in ash samples from Powder River Basin sub-bituminous coal (PRB-coal). We have identified many elements in the lanthanide series (cerium, europium, holmium, lanthanum, lutetium, praseodymium, promethium, samarium, terbium, ytterbium) and some elements in the actinide series (actinium, thorium, uranium, plutonium, berkelium, californium) in the ash samples. In addition, various metals were also seen to present in the ash samples

  16. PROCEEDINGS OF THE SYMPOSIUM COMMEMORATING THE 25th ANNIVERSARY OF ELEMENTS 97 and 98 HELD ON JAN. 20, 1975

    Energy Technology Data Exchange (ETDEWEB)

    Seaborg, Glenn T.; Street Jr., Kenneth; Thompson, Stanley G.; Ghiorso, Albert

    1976-07-01

    This volume includes the talks given on January 20, 1975, at a symposium in Berkeley on the occasion of the celebration of the 25th anniversary of the discovery of berkelium and californium. Talks were given at this symposium by the four people involved in the discovery of these elements and by a number of people who have made significant contributions in the intervening years to the investigation of their nuclear and chemical properties. The papers are being published here, without editing, in the form in which they were submitted by the authors in the months following the anniversary symposium, and they reflect rather faithfully the remarks made on that occasion.

  17. An upper bound for the 242X-2006-25020-i1.gif"/> norm of a GCD-related matrix

    OpenAIRE

    Haukkanen Pentti

    2006-01-01

    We find an upper bound for the norm of the matrix whose entry is , where and are the greatest common divisor and the least common multiple of and and where and are real numbers. In fact, we show that if and , then for all positive integers , where is the Riemann zeta function.

  18. Integral-Type Operators from 242X-2010-789285-i1.gif"/> Spaces to Zygmund-Type Spaces on the Unit Ball

    OpenAIRE

    Yang Congli

    2010-01-01

    Let denote the space of all holomorphic functions on the unit ball . This paper investigates the following integral-type operator with symbol , , , , where is the radial derivative of . We characterize the boundedness and compactness of the integral-type operators from general function spaces to Zygmund-type spaces , where is normal function on .

  19. Comment on ``Measurements of the hydration numbers for halide ions by the mass spectrometric method of field evaporation of ions out of solution'' [Chem. Phys. Lett. 242 (1995) 390

    Science.gov (United States)

    Symons, Martyn C. R.

    2000-08-01

    It has been suggested by Dunsyuryun, Karpov and Morozov that two different terms should be used to describe the solvation of halide ions in aqueous solutions. The term co-ordination number gives the primary `solvation number' (ca. 6), whilst the term hydration number gives the number of water molecules that stay co-ordinated to the anions as they move through the liquid (ca. 2). Here it is suggested that since these two terms are widely used to mean the same thing, it is better not to change one of them. It is also suggested that the number of water molecules that move with ions is variable and ill defined and that it is not appropriate to specify a precise number for this.

  20. Comida ritual em festas de Tambor de Mina no Maranhão (Ritual food in Maranhão’s Tambor De Mina festivities) - DOI: 10.5752/P.2175-5841.2011v9n21p242

    OpenAIRE

    Sérgio Figueiredo Ferretti

    2011-01-01

    Resumo Tambor de Mina é o nome da religião afro-brasileira no Maranhão e na Amazônia estabelecida a partir de São Luís desde meados do século XIX. Existem duas casas fundadas por africanos que se continuam: a Casa das Minas Jeje, de origem daomeana e a Casa de Nagô, iorubana de onde derivam a maioria dos terreiros de Mina recentes e atuantes. Trata-se de religião muito ritualizada e discreta, envolvida em segredos e mistérios cuja mitologia é pouco comentada e os rituais muito desenvolvidos. ...

  1. Composição química do capim-Mombaça (Panicum maximum Jacq. cv. Mombaça adubado com diferentes fontes de fósforo sob pastejo - DOI: 10.4025/actascianimsci.v29i1.242 Chemical composition of Mombaça grass (Panicum maximum Jacq. cv. Mombaça fertilized with different phosphorus on grazing - DOI: 10.4025/actascianimsci.v29i1.242

    Directory of Open Access Journals (Sweden)

    Ulysses Cecato

    2007-11-01

    Full Text Available O objetivo foi avaliar a composição química do Panicum maximum Jacq. cv. Mombaça, adubado com 140 kg ha-1 de P2O5 com diferentes fontes de fósforo, sob pastejo, no período de dezembro de 2002 a abril de 2003, com intervalo de coleta a cada 28 dias. Tratamentos: 1- termofosfato magnesiano Yoorin®; 2-fosfato natural Gafsa®; 3-superfosfato simples + superfosfato triplo (SS + ST; e 4-testemunha. Os teores de proteína bruta na lâmina foliar (PBf e colmo (PBc, nitrogênio insolúvel em detergente ácido (NIDA, fibra em detergente neutro (FDN, fibra em detergente ácido (FDA, celulose (CEL, hemicelulose (HCEL, lignina (LIG, extrato etéreo (EE, cálcio (Ca, fósforo (P, cinzas e carboidratos não-estruturais (CNE, não foram influenciados pela adubação fosfatada. As variáveis PBc, FDNf, FDNc, LIGf, LIGc, CELf, CELc, NIDAf, EEf, EEc, Caf, Cac, Pf, Pc, CINZAc, CNEc, apresentaram efeito do período de coleta. Não ocorreu diferença na composição química da forragem do capim-Mombaça em função das fontes de fósforo utilizadas na adubação da pastagem. As variações qualitativas foram de baixa magnitude.This study aimed to evaluate the chemical composition of Panicum maximum Jacq. cv. Mombaça. Grassland was fertilized with 140 kg ha-1 of P2O5 from different phosphorus sources on grazing, in December, 2002, until April, 2003, with a collection interval of every 28 days. Treatments: 1-Yoorin® magnesium thermophosphate; 2-Gafsa® natural phosphate; 3-simple superphosphate + triple superphosphate (SS + TS and 4-control. Leaf (lCP and stem (sCP crude protein, acid detergent fiber nitrogen (ADFN, neutral detergent fiber (NDF, acid detergent fiber (ADF, cellulose (CEL, hemicellulose (HEM, lignin (LIG, ether extract (EE, calcium (Ca, phosphorus (P, ash (A and non-structural carbohydrates (NSC were not influenced by phosphated fertilization. The variables sCP, lNDF, sNDF, sLIG, lLIG, sCEL, lCEL, lADFN, sEE, lEE, lCa, sCa, lP, sP, sA and sNSC, showed some effects from the collection period. There was no difference in the chemical composition of forage of the grass-Mombaça in function of phosphorus sources used in the pasture. The qualitative variations were of low magnitude.

  2. Pediatric Palliative Care: A Personal Story

    Medline Plus

    Full Text Available ... total__ Find out why Close Pediatric Palliative Care: A Personal Story NINRnews Subscribe Subscribed Unsubscribe 242 242 ... later? Sign in to add this video to a playlist. Sign in Share More Report Need to ...

  3. GETDB: 103550 [GETDB

    Lifescience Database Archive (English)

    Full Text Available onal Institute of Genetics. FM7c Link to clone table - 1 242 Link to cluster table 242 1 Request - cns, mg, good driver...er table 242 Num of clusters 1 Stock Request Request - Embryonic Expression cns, mg, good driver Larval GFP

  4. An atomic beam source for actinide elements: concept and realization

    International Nuclear Information System (INIS)

    For ultratrace analysis of actinide elements and studies of their atomic properties with resonance ionization mass spectroscopy (RIMS), efficient and stable sources of actinide atomic beams are required. The thermodynamics and kinetics of the evaporation of actinide elements and oxides from a variety of metals were considered, including diffusion, desorption, and associative desorption. On this basis various sandwich-type filaments were studied. The most promising system was found to consist of tantalum as the backing material, an electrolytically deposited actinide hydroxide as the source of the element, and a titanium covering layer for its reduction to the metal. Such sandwich sources were experimentally proven to be well suited for the production of atomic beams of plutonium, curium, berkelium and californium at relatively low operating temperatures and with high and reproducible yields. (orig.)

  5. EC decay of 244Bk

    Science.gov (United States)

    Sodaye, Suparna; Tripathi, R.; Sudarshan, K.; Sharma, S. K.; Pujari, P. K.; Palit, R.; Mukhopadhyay, S.

    2014-12-01

    Berkelium isotopes have been produced in 11B-induced reaction on 238U. The EC decay of 244Bk → 244Cm has been studied by carrying out the single and coincidence measurements of the γ-rays emitted during the de-excitation of the 244Cm levels. Radiochemical separations have been carried out to minimize the contribution from the fission products and target. The new half-life of 244Bk is obtained as 5.02 ± 0.03 h, which is close to the theoretically calculated value. The relative intensities of the decay γ-rays have been re-evaluated. Based on the coincidence measurements, a tentative partial level scheme for 244Bk → 244Cm decay has been proposed.

  6. Nuclear fission and the transuranium elements

    International Nuclear Information System (INIS)

    Many of the transuranium elements are produced and isolated in large quantities through the use of neutrons furnished by nuclear fission reactions: plutonium (atomic number 94) in ton quantities; neptunium (93), americium (95), and curium (96) in kilogram quantities; berkelium (97) in 100 milligram quantities; californium (98) in gram quantities; and einsteinium (99) in milligram quantities. Transuranium isotopes have found many practical applications---as nuclear fuel for the large-scale generation of electricity, as compact, long-lived power sources for use in space exploration, as means for diagnosis and treatment in the medical area, and as tools in numerous industrial processes. Of particular interest is the unusual chemistry and impact of these heaviest elements on the periodic table. This account will feature these aspects. 9 refs., 5 figs

  7. Nuclear fission and the transuranium elements

    Energy Technology Data Exchange (ETDEWEB)

    Seaborg, G.T.

    1989-02-01

    Many of the transuranium elements are produced and isolated in large quantities through the use of neutrons furnished by nuclear fission reactions: plutonium (atomic number 94) in ton quantities; neptunium (93), americium (95), and curium (96) in kilogram quantities; berkelium (97) in 100 milligram quantities; californium (98) in gram quantities; and einsteinium (99) in milligram quantities. Transuranium isotopes have found many practical applications---as nuclear fuel for the large-scale generation of electricity, as compact, long-lived power sources for use in space exploration, as means for diagnosis and treatment in the medical area, and as tools in numerous industrial processes. Of particular interest is the unusual chemistry and impact of these heaviest elements on the periodic table. This account will feature these aspects. 9 refs., 5 figs.

  8. EC decay of 244Bk

    International Nuclear Information System (INIS)

    Berkelium isotopes have been produced in 11B-induced reaction on 238U. The EC decay of 244Bk → 244Cm has been studied by carrying out the single and coincidence measurements of the γ-rays emitted during the de-excitation of the 244Cm levels. Radiochemical separations have been carried out to minimize the contribution from the fission products and target. The new half-life of 244Bk is obtained as 5.02 ± 0.03 h, which is close to the theoretically calculated value. The relative intensities of the decay γ-rays have been re-evaluated. Based on the coincidence measurements, a tentative partial level scheme for 244Bk → 244Cm decay has been proposed. (paper)

  9. Production of transuranium elements

    International Nuclear Information System (INIS)

    The Radiochemical Engineering Development Center (REDC) has the programmatic responsibility for the Department of Energy's Transuranium Element Program. Principle elements from the program are einsteinium, berkelium, and fermium. Targets containing curium oxide mixed with aluminum powder are fabricated by the REDC and irradiated in the Oak Ridge National Laboratory (ORNL) High Flux Isotope Reactor. Following an irradiation period of 6-12 months, targets are returned to the REDC for chemical processing. Processing operations consists of aluminum dejacketing in a caustic-nitrate solution, filtration, acid dissolution, solvent extraction, anion exchange, and finally a cation exchange to recover the actinides. The processing operations take place in heavily shielded hot cell facilities and all operations are carried out remotely. The chemistry for the separations has been well established over the 26-yr. operating life of the facility

  10. The Majority of Library Clients Still Use Person-to-Person Interaction When Asking Reference Questions. A review of: De Groote, Sandra L. “Questions Asked at the Virtual and Physical Health Sciences Reference Desk: How Do They Compare and What Do They Tell Us?” Medical Reference Services Quarterly 24.2 (Summer 2005): 11-23.

    OpenAIRE

    Suzanne Pamela Lewis

    2006-01-01

    Objective - To identify similarities and difference in the questions asked at the virtual and physical refernece desks of a helath scienmces library, in order to better undertand user needs and highlight areas for service improvement. Also to retrospectively analyze reference statistics collected over the previous six years. Design - Use study; retrospective study of reference statistics for the period July 1997 to June 2003; literature review. Setting - Large academic helath sciences l...

  11. Improving the pharmacokinetic and CYP inhibition profiles of azaxanthene-based glucocorticoid receptor modulators-identification of (S)-5-(2-(9-fluoro-2-(4-(2-hydroxypropan-2-yl)phenyl)-5H-chromeno[2,3-b]pyridin-5-yl)-2-methylpropanamido)-N-(tetrahydro-2H-pyran-4-yl)-1,3,4-thiadiazole-2-carboxamide (BMS-341).

    Science.gov (United States)

    Yang, Michael G; Dhar, T G Murali; Xiao, Zili; Xiao, Hai-Yun; Duan, James J-W; Jiang, Bin; Galella, Michael A; Cunningham, Mark; Wang, Jinhong; Habte, Sium; Shuster, David; McIntyre, Kim W; Carman, Julie; Holloway, Deborah A; Somerville, John E; Nadler, Steven G; Salter-Cid, Luisa; Barrish, Joel C; Weinstein, David S

    2015-05-28

    An empirical approach to improve the microsomal stability and CYP inhibition profile of lead compounds 1a and 1b led to the identification of 5 (BMS-341) as a dissociated glucocorticoid receptor modulator. Compound 5 showed significant improvements in pharmacokinetic properties and, unlike compounds 1a-b, displayed a linear, dose-dependent pharmacokinetic profile in rats. When tested in a chronic model of adjuvant-induced arthritis in rat, the ED50 of 5 (0.9 mg/kg) was superior to that of both 1a and 1b (8 and 17 mg/kg, respectively). PMID:25905990

  12. The Majority of Library Clients Still Use Person-to-Person Interaction When Asking Reference Questions. A review of: De Groote, Sandra L. “Questions Asked at the Virtual and Physical Health Sciences Reference Desk: How Do They Compare and What Do They Tell Us?” Medical Reference Services Quarterly 24.2 (Summer 2005: 11-23.

    Directory of Open Access Journals (Sweden)

    Suzanne Pamela Lewis

    2006-03-01

    Full Text Available Objective - To identify similarities and difference in the questions asked at the virtual and physical refernece desks of a helath scienmces library, in order to better undertand user needs and highlight areas for service improvement. Also to retrospectively analyze reference statistics collected over the previous six years. Design - Use study; retrospective study of reference statistics for the period July 1997 to June 2003; literature review. Setting - Large academic helath sciences library in the United States. Subjects - All questions asked at the reference and information desks, plus questions submitted to the University-wide virtual reference service and answered by a health sciences librarian, over a period of one month. The questions were asked by faculty, staff, students and members of the public. Methods - A literature review was carried out to examine the types of information/reference questions typically asked in health sciences libraries both before and after the mass introduction of remote end-user searching of online resources and the establishment of virtual reference services. Next, the reference statistics collected at the University of Illinois at Chicage (UIC Library of the Health Sciences between July 1997 and June 2003 were examined. For most of this period a digital reference service was offered using a listserv address to which patrons would submit email queries. Beginning in March 2003, a formal virtual reference service (chat and email was provided using commercial software. Finally, data was gathered on questions answered by a health sciences librarians, and clients who asked the question, at either the physical or cirtual reference desk, during the month of November 2003 at the UIC Library of the Health Sciences. Library staff completed an online survey form for each question, and if a client asked more than one question, each question was coded individually. Data included: status of client using the service (faculty/staff. undergarduate student, graduate student, non0UIC, unknown; mode of submission (email, chat, phone, in person; and type of question asked (directional, ready reference, in-depth/mediated, instructional, technical, accounts/status and other. In subsequent analysis, the original seven types of questions were further broken down into 19 categories. Main results - It was not possible to undertake a meta-analysis or systematic review of the studies identified in the literature review because of differences in time frames, settings and the categories used to code reference questions. However the following trends emerged: directional questions accounted for between 30 and 35% of questions asked at both the physical and virtual reference desks; the remainder of questions were generally about known item searched, library policies and services, research, dadabase use and quick reference. The statistics collected at UIC Library of the Health Sciences over the period July 1997 to June 2003 were analyzed. Coded reference questions fell into one of four categories; ready reference, in-depth reference, mediated searched and digital reference. There was a noticeable drop in the number of reference questions received in 1999/2000 which reflects trends reported in some of the studies identified in the literature review. The number of mediated searches decreased from 154 in 1997-98 to 4 in 2002/2003, but the number of digital reference questions increased from 0 to 508 in the same period. Statistics were collected over the month of November 2003 for 939 questions asked at the reference and information desks which included: 38 email; 48 chat; 156 phone; and 697 in person. The major findings were as follows: - appoximately 55% of questions were reference questions (33.5% ready reference, 9.7% in-depth/mediated, 9.7% instructional; 30% were directional; and 10% were technical; it is not stated what the remaining 5% of questions were; - library clients who asked the questions comprised graduate students (26%, faculty (24%, undergraduate students (24% and non-UIC patrons (22%; - all groups were most likely to ask their reference questions in person; - graduate students were the largest group of email reference (34%, undergraduates were the largest group to use chat (35% and faculty/staff were the largest group to use the telephone (39%; - 28% of the questions were answered from the library's staff's general knowledge of the library; 22% using the online catalogue or electronic journals list; 22% by referrning the patron to, or using an online database or resource; 13% by referring the patron to another department in the library (such as circulation; 7% by consulting another individual; and 5% by using print resources. Conclusion - The results of the three parts of this study - literature review, study of 1997-2003 statistics, and in-depth collection of statistics for November 2003 - are difficult to compare with each other. However, the general trend emerging from the results is that some kinds of questions asked by health sciences library clients have remained very much the same regardless of the rise of remote end-user searching and the mode of transmission of the questions. These include questions about library policies and services, journal and book holdings, database searching and instructional support. Questions about citation verification and consumer health appear to be decreasing while technical questions and questions about accessing remote databases and online journals are increasing. The majority of reference questions are still asked in person.

  13. Effects on air-processed NdBCO superconductor bulks when adding a Ba-rich Nd2Ba4Cu2O9 phase

    International Nuclear Information System (INIS)

    Employing a novel Ba-rich Nd2Ba4Cu2O9 (Nd242) phase in the precursor, air-processed NdBCO bulk superconductors were grown by using NdBCO film seeds. To obtain single-phase Nd242 powders, the sintering conditions were adjusted by varying the processing atmosphere and temperature. Furthermore, the influences of adding Nd242 on both the superconducting property and the crystal growth of the NdBCO bulk were investigated. We present experimental evidence suggesting that the addition of Nd242 can effectively improve the superconducting performance of NdBCO bulks, which showed optimal properties when the Ba:Cu ratio in the precursor was 0.80. We also found that the addition of Nd242 caused an increase in growth rate, particularly along the c-axis direction of the NdBCO. Moreover, the effect of the addition of Nd242 on the growth rate was clarified. (paper)

  14. Dicty_cDB: VHF392 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available asidiella neoformans var. neo... 242 1e-62 DQ357217_1( DQ357217 |pid:none) Leishmania braziliensis elongatio...n... 242 2e-62 AM494972_26( AM494972 |pid:none) Leishmania braziliensis chromosom... 242 2e-62 AY618550_1( A...YCPRKRYWWYLICXQSSXRYCYW*rtsyrfpiiicqssftsiriprfhr*ftfp hcrsxfptmcxrsxgfnwccqqr*esx*srfsxqkekrfsprnprs*qiprkt...*skelvllpik flvi*dichvvlmnksvvsplnlhlyhftskcqrktnyqlvvlhtnf*silsipqvtlis vqk*llpsvllmvl*slsia...*fq frsnccppcy*wcfsryrlrrrclrtnrncitssrr*tyqtslirqqsrsflirtpikh* rslsl--- ---SRNY

  15. Plate Tectonics: A Paradigm under Threat.

    Science.gov (United States)

    Pratt, David

    2000-01-01

    Discusses the challenges confronting plate tectonics. Presents evidence that contradicts continental drift, seafloor spreading, and subduction. Reviews problems posed by vertical tectonic movements. (Contains 242 references.) (DDR)

  16. Comparison of fission and capture cross sections of minor actinides

    CERN Document Server

    Nakagawa, T

    2003-01-01

    The fission and capture cross sections of minor actinides given in JENDL-3.3 are compared with other evaluated data and experimental data. The comparison was made for 32 nuclides of Th-227, 228, 229, 230, 233, 234, Pa-231, 232, 233, U-232, 234, 236, 237, Np-236, 237, 238, Pu-236, 237, 238, 242, 244, Am-241, 242, 242m, 243, Cm-242, 243, 244, 245, 246, 247 and 248. Given in the present report are figures of these cross sections and tables of cross sections at 0.0253 eV and resonance integrals.

  17. Comparison of fission and capture cross sections of minor actinides

    International Nuclear Information System (INIS)

    The fission and capture cross sections of minor actinides given in JENDL-3.3 are compared with other evaluated data and experimental data. The comparison was made for 32 nuclides of Th-227, 228, 229, 230, 233, 234, Pa-231, 232, 233, U-232, 234, 236, 237, Np-236, 237, 238, Pu-236, 237, 238, 242, 244, Am-241, 242, 242m, 243, Cm-242, 243, 244, 245, 246, 247 and 248. Given in the present report are figures of these cross sections and tables of cross sections at 0.0253 eV and resonance integrals. (author)

  18. Radiochemical determination of the neutron capture cross sections of {sup 241}Am irradiated in the JMTR reactor

    Energy Technology Data Exchange (ETDEWEB)

    Shinohara, N.; Hatsukawa, Y.; Hata, K.; Kohno, N. [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment

    1997-03-01

    The thermal neutron capture cross section {sigma}{sub 0} and Resonance integral I{sub 0} of {sup 241}Am leading to the production of {sup 242m}Am and {sup 242g}Am were measured by radiochemical method. The cross sections obtained in this study are {sigma}{sub 0}=60.9 {+-} 2.6 barn, I{sub 0}=213 {+-} 13 barn for {sup 241}Am(n,{gamma}){sup 242m}Am and {sigma}{sub 0}=736 {+-} 31 barn, I{sub 0}=1684 {+-} 92 barn for {sup 241}Am(n,{gamma}){sup 242g}Am. (author)

  19. Dicty_cDB: Contig-U11690-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available = 190/190 (100%) Strand = Plus / Plus Query: 182 gatgnagatatcnttcaaagatttaatccnattagnntggtcntttcnatnaaaccna...aa 241 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 182 gatgnagatatcnttcaaagatttaatccna...ttagnntggtcntttcnatnaaaccnaaa 241 Query: 242 tnggattnntcnattaggccatatnttttnaaan... = 9e-41 Identities = 189/189 (100%) Strand = Plus / Minus Query: 183 atgnagatatcnttcaaagatttaatccna...ttagnntggtcntttcnatnaaaccnaaat 242 ||||||||||||||||||||||||||||||||||||||||||||||||||||||

  20. Numerical Investigations on Nucleation Processes in Supercooled Droplets

    Czech Academy of Sciences Publication Activity Database

    Eisenschmidt, K.; Němec, Tomáš; Rauschenberger, P.; Weigand, B.

    Darmstadt : Technische Universität Darmstadt, 2012 - (Alber, H.; Tropea, C.). s. 242--242 [Annual Scientific Conference of the International Association of Applied Mathematics and Mechanics /83./. 26.05.2012-30.05.2012, Darmstadt] Institutional research plan: CEZ:AV0Z20760514 Keywords : supercooled water * ice nucleation * direct numerical simulation Subject RIV: BK - Fluid Dynamics

  1. Time recorded in cave deposits - 10 Years of paleomagnetic research in Slovenian caves

    Czech Academy of Sciences Publication Activity Database

    Zupan Hajna, N.; Mihevc, A.; Pruner, Petr; Bosák, Pavel

    2007-01-01

    Roč. 36, č. 1 (2007), s. 242-242. ISSN 0583-6050. [Time in karst. 14.03.2007-18.03.2007, Postojna] Institutional research plan: CEZ:AV0Z30130516 Keywords : cave deposits * karst * paleomagnetism * Slovenian caves Subject RIV: DB - Geology ; Mineralogy

  2. Flammable gas/slurry growth unreviewed safety question:justification for continued operation for the tank farms at the Hanford site

    Energy Technology Data Exchange (ETDEWEB)

    Leach, C.E., Westinghouse Hanford

    1996-07-31

    This Justification for Continued Operation (JCO) provides a basis for continued operation in 176 high level waste tanks, double contained receiver tanks (DCRTs), catch tanks, 244-AR Vault, 242-S and 242-T Evaporators and inactive miscellaneous underground storage tanks (IMUSTs) relative to flammable gas hazards. Required controls are specified.

  3. 77 FR 3787 - Notice of Submission of Proposed Information Collection to OMB; Office of Hospital Facilities...

    Science.gov (United States)

    2012-01-25

    ... Facilities Transactional Forms for FHA Programs 242, 241, 223(f), 223(a)(7) AGENCY: Office of the Chief...: Office of Hospital Facilities Transactional Forms for FHA Programs 242, 241, 223(f), 223(a)(7). OMB..., HUD-92464-OHF, HUD- 92441-OHF, 2466-GP, 41901, 92403, 92450-CA-OHF, 92422, 92451, 92452-A- OHF,...

  4. 77 FR 58213 - Actions on Special Permit Applications

    Science.gov (United States)

    2012-09-19

    ...; manufacture, mark, 173.241; sale and use of non- 173.242; DOT specification 178.345-1; -2; cargo tanks -3; -4... Enterprises, 173.203, manufacture, Inc., 173.241, marking, sale and Texarkana, TX. 173.242. use of multiple.... transportation in Draper, UT. commerce of 2142 kg of unapproved fireworks from Carson, CA to the Lantis...

  5. 17 CFR 270.17a-7 - Exemption of certain purchase or sale transactions between an investment company and certain...

    Science.gov (United States)

    2010-04-01

    ...: (1) If the security is an “NMS stock” as that term is defined in 17 CFR 242.600, the last sale price... such security (reported pursuant to 17 CFR 242.602) if there are no reported transactions in the... other remuneration is paid in connection with the transaction; (e) The board of directors of...

  6. Drug: D03093 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D03093 Drug Benzoyl peroxide (JAN/USP) C14H10O4 242.0579 242.2268 D03093.gif Keratolytic Same as ... sification [BR:br08303] D DERMATOLOGICALS D10 ANTI-ACNE ... PREPARATIONS D10A ANTI-ACNE ... PREPARATIONS FOR TOPIC ...

  7. Zebrafish model of tuberous sclerosis complex reveals cell-autonomous and non-cell-autonomous functions of mutant tuberin

    Directory of Open Access Journals (Sweden)

    Seok-Hyung Kim

    2011-03-01

    Tuberous sclerosis complex (TSC is an autosomal dominant disease caused by mutations in either the TSC1 (encodes hamartin or TSC2 (encodes tuberin genes. Patients with TSC have hamartomas in various organs throughout the whole body, most notably in the brain, skin, eye, heart, kidney and lung. To study the development of hamartomas, we generated a zebrafish model of TSC featuring a nonsense mutation (vu242 in the tsc2 gene. This tsc2vu242 allele encodes a truncated Tuberin protein lacking the GAP domain, which is required for inhibition of Rheb and of the TOR kinase within TORC1. We show that tsc2vu242 is a recessive larval-lethal mutation that causes increased cell size in the brain and liver. Greatly elevated TORC1 signaling is observed in tsc2vu242/vu242 homozygous zebrafish, and is moderately increased in tsc2vu242/+ heterozygotes. Forebrain neurons are poorly organized in tsc2vu242/vu242 homozygous mutants, which have extensive gray and white matter disorganization and ectopically positioned cells. Genetic mosaic analyses demonstrate that tsc2 limits TORC1 signaling in a cell-autonomous manner. However, in chimeric animals, tsc2vu242/vu242 mutant cells also mislocalize wild-type host cells in the forebrain in a non-cell-autonomous manner. These results demonstrate a highly conserved role of tsc2 in zebrafish and establish a new animal model for studies of TSC. The finding of a non-cell-autonomous function of mutant cells might help explain the formation of brain hamartomas and cortical malformations in human TSC.

  8. Nuclear Chemistry Institute, Mainz University. Annual Report 1995

    International Nuclear Information System (INIS)

    The annual report of the Institut fuer Kernchemie addresses inter alia three main research activities. The first belongs to the area of basic research, covering studies in the fields of nuclear fission, chemistry of the super-heavy elements and of heavy-ion reactions extending from the Coulomb barrier to relativistic energies, and nuclear astrophysics in connection with the ''r process''. By means of laser technology, high-precision data could be measured of the ionization energies of berkelium and californium. Studies of atomic clusters in the vacuum of an ionization trap revealed interesting aspects. The second major activity was devoted to the analysis of environmental media, applying inter alia neutron activation analysis and resonance ionization mass spectroscopy (RIMS). The third activity resulted in the development of novel processes, or the enhancement of existing processes or methods, for applications in basic research work and in environmental analytics. Another item of interest is the summarizing report on the operation of the TRIGA research reactor. (orig./SR)

  9. Paul Scherrer Institute Scientific Report 1999. Volume I: Particles and Matter

    International Nuclear Information System (INIS)

    Although originally planned for fundamental research in nuclear physics, the particle beams of pions, muons, protons and neutrons are now used in a large variety of disciplines in both natural science and medicine. The beams at PSI have the world's highest intensities and therefore allow certain experiments to be performed, which would not be possible elsewhere. The highlight of research this year was the first-ever determination of the chemical properties of the superheavy element 107 Bohrium. This was undertaken, by an international team led by H. Gaeggeler of PSI's Laboratory for Radiochemistry. Bohrium was produced by bombarding a Berkelium target with Neon ions from the Injector I cyclotron and six atoms were detected after having passed through an online gas chromatography device. At the Laboratory for Particle Physics the focus has shifted from nuclear physics to elementary particle physics with about a fifty-fifty split between investigations of rare processes or particle decays using the high intensity muon, pion and recently also polarized neutron beams of PSI, and research at the highest energy frontier at CERN (Geneva) and DESY (Hamburg). Important space instrumentation has been contributed by the Laboratory for Astrophysics to the European Space Agency and NASA satellite programmes. The Laboratory for Micro and Nanotechnology continued to focus on research into molecular nanotechnology and SiGeC nanostructures, the latter with the aim of producing silicon based optoelectronics. Progress in 1999 in these topical areas is described in this report. A list of scientific publications in 1999 is also provided

  10. Investigations for the influence of geochemical parameters on the sorption and desorption of lanthanides and uranium onto opalinus clay as potential host rock for a repository

    International Nuclear Information System (INIS)

    The development of a disposal in deep geological formations for radioactive waste is a very important task for the future. The safety assessment for more than a hundred thousand years needs a full understanding of all processes of interaction between the radioactive waste and the surrounded formations. This work contributes to this understanding. The interaction between lanthanides (homologues of the actinides americium, curium and berkelium) / uranium and the host rock opalinus clay under influence of organic substances (NOM) have been analyzed and discussed. The complex system was split into 3 binary basic systems with the following interactions - Interactions between lanthanides / uranium and NOM - Interactions between lanthanides / uranium and the opalinus clay - Interactions between NOM and opalinus clay All binary systems can be influenced by geological parameters like pH, ion strength and competing cations. The sorption / desorption of the lanthanides onto the opalinus clay is analyzed via inductively coupled plasma mass spectrometry. For the investigation of the complexation behavior of metals with NOM we used capillary electrophoresis coupled with inductively coupled plasma mass spectrometry. Under these conditions the chosen model organic humic acid affected the sorption of the lanthanides onto opalinus clay favorably. The smaller organic compounds, which dominate in the composition of the clay organics, remobilized the metals after sorption onto clay and the sorption can be inhibited by NOM. Due to the reduced metal sorption onto Opalinus clay by NOM, a migration through the clay may be possible.

  11. Toward Reanalysis of the Tight-Pitch HCLWR-PROTEUS Phase II Experiments

    Directory of Open Access Journals (Sweden)

    Perret Grégory

    2016-01-01

    Spectral index predictions using the three nuclear data libraries agreed within two standard deviations with the measured values. The only exception is the Pu-242-capture-to-Pu-239-fission ratio, which was overestimated with all libraries by more than four standard deviations, i.e. 13%, in the non-moderated configuration. In this configuration, Pu-242 captures are few since the flux spectrum in the Pu-242 capture resonance region (between 1eV and 1keV is small making this spectral index hard to measure. Sensitivity coefficient predictions with both MCNP6 and SERPENT2 were in good agreement.

  12. Dicty_cDB: Contig-U12270-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available quences producing significant alignments: (bits) Value N ( C90879 ) Dictyostelium discoideum slug cDNA, clon...e SSJ262. 226 2e-82 5 ( AU038542 ) Dictyostelium discoideum slug cDNA, clone SSH848. 242 3e-79 3 ( C93805 ) ...Dictyostelium discoideum slug cDNA, clone SSL738. 242 3e-79 3 ( AU038033 ) Dictyostelium discoideum slug cDN...A, clone SSH182. 244 5e-77 3 ( C92024 ) Dictyostelium discoideum slug cDNA, clone... SSC175. 242 9e-77 3 ( C89806 ) Dictyostelium discoideum slug cDNA, clone SSG177. 226 1e-75 4 ( AU037712 ) D

  13. Detection of serological biomarkers by proximity extension assay for detection of colorectal neoplasias in symptomatic individuals

    DEFF Research Database (Denmark)

    Buch Thorsen, Stine; Lundberg, Martin; Villablanca, Andrea;

    2013-01-01

    characteristic (ROC) curve of Carcinoembryonic antigen (CEA), Transferrin Receptor-1 (TFRC), Macrophage migration inhibitory factor (MIF), Osteopontin (OPN/SPP1) and cancer antigen 242 (CA242) showed additive effect. This biomarker panel identified CRC patients with a sensitivity of 56% at 90% specificity and...... thus the performance is sufficiently high to further investigate this combination of five proteins as serological biomarkers for detection of CRC. Furthermore, when applying the indicators to identify early-stage CRC a combination of CEA, TFRC and CA242 resulted in a ROC curve with an area under the...

  14. Ale nám Písmo ukazuje tajemství. Biblické aluze v cyklu Truchlivý Jana Amose Komenského

    Czech Academy of Sciences Publication Activity Database

    Havelka, Tomáš

    2013-01-01

    Roč. 5, č. 2 (2013), s. 225-242. ISSN 1804-1132 Institutional support: RVO:67985955 Keywords : Bible * Johan Amos Comenius * quotations * Czech consolatory writings * Truchlivý * Mournful Subject RIV: AA - Philosophy ; Religion

  15. Testing of models of stomatal ozone fluxes with field measurements in a mixed Mediterranean forest

    Czech Academy of Sciences Publication Activity Database

    Fares, S.; Matteucci, G.; Mugnozza, S.; Morani, A.; Calfapietra, Carlo; Salvatori, E.; Fusaro, L.; Manes, F.; Loreto, F.

    2013-01-01

    Roč. 67, MAR (2013), s. 242-251. ISSN 1352-2310 Institutional support: RVO:67179843 Keywords : Ozone fluxes * Stomatal conductance models * GPP * Mediterranean forest Subject RIV: EH - Ecology, Behaviour Impact factor: 3.062, year: 2013

  16. Désir et représentation: quelques remarques sur Sade et Thomas Hardy

    Czech Academy of Sciences Publication Activity Database

    Fulka, Josef

    Clermont-Ferrand: Universite Blaise Pascal, 2013 - (Couyault, S.), s. 231-242 ISBN 978-2-84516-618-9 Institutional support: RVO:67985955 Keywords : desire * psychoanalysis * literary theory Subject RIV: AA - Philosophy ; Religion

  17. Contextual Word Prominence

    Czech Academy of Sciences Publication Activity Database

    Hřebíček, Luděk

    Berlin : de Gruyter, 2006 - (Grzybek, P.; Köhler, R.), s. 235-242 ISBN 978-3-11-019354-1. - (Quantitative linguistics . 62) Institutional research plan: CEZ:AV0Z90210515 Keywords : Gabriel Altmann Subject RIV: AI - Linguistics

  18. Význam práva a barev na korouhvích

    Czech Academy of Sciences Publication Activity Database

    Lojek, Antonín

    Ostrava-Přívoz : KEY Publishing, 2015 - (Schelle, K.; Tauchen, J.), s. 28-46 ISBN 978-80-7418-242-6 Institutional support: RVO:68378122 Keywords : law history * banners and standards * legal symbolism Subject RIV: AG - Legal Sciences

  19. Purification, crystallization and preliminary X-ray characterization of Bacillus cereus arylamine N-­acetyltransferase 3 [(BACCR)NAT3

    OpenAIRE

    Kubiak, Xavier; Pluvinage, Benjamin; Li de la Sierra-Gallay, Inès; Weber, Patrick; Haouz, Ahmed; Dupret, Jean-Marie; Rodrigues-Lima, Fernando

    2012-01-01

    B. cereus arylamine N-acetyltransferase 3 was expressed, purified and crystallized. X-ray diffraction data were collected to 2.42 Å resolution and the crystals belonged to the monoclinic space group C121.

  20. Posthuman Metamorphosis: Narrative and Systems, New

    Directory of Open Access Journals (Sweden)

    Elke D'hoker

    2009-10-01

    Full Text Available Review of Bruce Clarke, Posthuman Metamorphosis: Narrative and Systems, New
    York: Fordham University Press, 2008. 242 pages.
    978-0-8232-2580-8 (hardback
    978-0-8232-2581-5 (paperback

  1. Forms of Becoming: The Evolutionary Biology of Development

    OpenAIRE

    Raymond Pierotti

    2012-01-01

    Review of Forms of Becoming: The Evolutionary Biology of Development. Alessandro Minelli. 2009. Princeton University Press, Princeton and London. Pp. 242, 17 line drawings. US$29.95 (cloth). ISBN 9780691135687.

  2. 78 FR 38956 - Army Education Advisory Subcommittee; Meeting Notice

    Science.gov (United States)

    2013-06-28

    ... Designated Federal Officer: ATFL- APO, Monterey, CA, 93944, Robert.Savukinas@us.army.mil , (831) 242-5828..., Conference Room, Monterey, CA 93944. Purpose of the Meeting: The purpose of the meeting is to provide...

  3. 77 FR 29454 - Application for Special Permits

    Science.gov (United States)

    2012-05-17

    ..., LLC ), 175.501(e)(3). commerce of brass-lined Riverside, CA. filament wound cylinders identified as..., Texarkana, TX. 173.242. sale and use of multiple non-DOT specification containers, manifolded...

  4. 76 FR 67396 - Revisions to the California State Implementation Plan, Placer County Air Pollution Control District

    Science.gov (United States)

    2011-11-01

    ... Hawthorne Street, San Francisco, CA 94105-3901. Instructions: All comments will be included in the public... Commercial Boiler, Steam Generator and Process Heaters, Rule 242, Stationary Internal Combustion...

  5. Developmental silencing of the AtTERT gene is associated with increased H3K27me3 loading and maintenance of its euchromatic environment

    Czech Academy of Sciences Publication Activity Database

    Ogrocká, A.; Sýkorová, Eva; Fajkus, Jiří; Fojtová, M.

    2012-01-01

    Roč. 63, č. 11 (2012), s. 4233-4241. ISSN 0022-0957 Institutional support: RVO:68081707 Keywords : TELOMERASE REVERSE-TRANSCRIPTASE * ARABIDOPSIS-THALIANA * DNA METHYLATION Subject RIV: BO - Biophysics Impact factor: 5.242, year: 2012

  6. Evidence for an Intermediate in the Methylation of CB11H12- with Methyl Triflate: Comparison of Electrophilic Substitution in Cage Boranes and in Arenes

    Czech Academy of Sciences Publication Activity Database

    Kaleta, Jiří; Akdag, Akin; Crespo, R.; Piqueras, M. C.; Michl, Josef

    2013-01-01

    Roč. 78, č. 9 (2013), s. 1174-1183. ISSN 2192-6506 Institutional support: RVO:61388963 Keywords : alkylation * boranes * carboranes * electrophilic substitution * hydrogen scrambling Subject RIV: CC - Organic Chemistry Impact factor: 3.242, year: 2013

  7. Alcohol and Pregnancy

    Medline Plus

    Full Text Available ... baby to be born with both physical and mental birth defects. Learn about the dangers of drinking ... fit 2:42 How to use your family health history 2:22 Trending donate sign-up sign- ...

  8. A numerical study of two different specimen fixtures for the modified compact tension test – their influence on concrete fracture parameters

    Czech Academy of Sciences Publication Activity Database

    Holušová, Táňa; Seitl, Stanislav; Cifuentes, H.; Canteli, A.

    2016-01-01

    Roč. 10, č. 35 (2016), s. 242-249. ISSN 1971-8993 Institutional support: RVO:68081723 Keywords : Modified Compact Tension Test * Fracture Parameters * Cementitious Composites * FEM Subject RIV: JL - Materials Fatigue, Friction Mechanics

  9. Specialists leave fewer descendants within a region than generalists

    Czech Academy of Sciences Publication Activity Database

    Ozinga, W.A.; Colles, A.; Bartish, Igor V.; Hennion, F.; Hennekens, S.M.; Pavoine, S.; Poschlod, P.; Hermant, S. M.; Schaminée, J.H.J.; Prinzing, A.

    2013-01-01

    Roč. 22, č. 2 (2013), s. 213-222. ISSN 1466-822X Institutional support: RVO:67985939 Keywords : divrsification * life-history traits * microevolution Subject RIV: EF - Botanics Impact factor: 7.242, year: 2013

  10. Operational test procedure for pumping and instrumentation control skid SALW-6001B monitor and control system

    International Nuclear Information System (INIS)

    This OTP shall verify and document that the monitor and control system comprised of PICS SALW-6001B PLC, 242S PLC, Operator Control Station, and communication network is functioning per operational requirements

  11. Appendix: Zvířecí nálezy z laténských objektů ve Velkém a Malém Zboží

    Czech Academy of Sciences Publication Activity Database

    Kyselý, René

    2015-01-01

    Roč. 19, č. 1 (2015), s. 242. ISSN 1214-3553 Institutional support: RVO:67985912 Keywords : archaeozoology * cattle horn core * pathology * yoke Subject RIV: AC - Archeology, Anthropology, Ethnology

  12. Incidence vrozených srdečních vad v České republice - aktuální data

    Czech Academy of Sciences Publication Activity Database

    Šípek, A.; Gregor, V.; Šípek jr., A.; Hudáková, J.; Horáček, J.; Klaschka, Jan; Skibová, J.; Langhammer, P.; Petržílková, L.; Klímová, B.; Peřinová, B.; Wiesnerová, J.

    2010-01-01

    Roč. 75, č. 3 (2010), s. 221-242. ISSN 1210-7832 Institutional research plan: CEZ:AV0Z10300504 Keywords : congenital heart defect * incidence * prenatal diagnostics * Czech Republic Subject RIV: FK - Gynaecology, Childbirth

  13. Pediatric Palliative Care: A Personal Story

    Medline Plus

    Full Text Available ... count__/__total__ Find out why Close Pediatric Palliative Care: A Personal Story NINRnews Subscribe Subscribed Unsubscribe 242 ... and her family. The story demonstrates how palliative care can positively influence a patient's and family's experience ...

  14. Gravity Data for the State of New Mexico

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The gravity station data (21,242 records) were compiled by the University of Texas at El Paso. This data base was received in October 1984. Principal gravity...

  15. Effect of soil moisture content on the metal concentration measured by diffusive gradients in thin films technique (DGT)

    Czech Academy of Sciences Publication Activity Database

    Dočekal, Bohumil; Dočekalová, H.; Mládková, Z.; Pešková, Květa

    Gdańsk : Gdańsk University of Technology, 2008 - (Namieśnik, J.). s. 242-242 ISBN 978-83-925754-4-3. [International Symposium of Environmental Analytical Chemistry /35./. 22.06.2008-26.06.2008, Gdańsk] Institutional research plan: CEZ:AV0Z40310501 Keywords : DGT * soil * soil moisture Subject RIV: CB - Analytical Chemistry , Separation

  16. Method for fabricating an artificial compound eye

    OpenAIRE

    Duparré, Jacques; Brückner, Andreas; Wippermann, Frank; Zufferey, Jean-Christophe; Floreano, Dario; Franceschini, Nicolas; Viollet, Stéphane; Ruffier, Franck

    2011-01-01

    A method for fabricating an imaging system, the method comprising providing a flexible substrate (200), a first layer (220) comprising a plurality of microlenses (232) and a second layer (240) comprising a plurality of image sensors (242). The method further comprises stacking the first and the second layer (220; 240) onto the flexible substrate (200) by attaching the plurality of image sensors (242) to the flexible substrate, such that each of the plurality of microlenses (232) and image sen...

  17. Endothelial function is unaffected by changing between carvedilol and metoprolol in patients with heart failure--a randomized study

    DEFF Research Database (Denmark)

    Falskov, Britt; Hermann, Thomas Steffen; Raunsø, Jakob; Christiansen, Buris; Rask-Madsen, Christian; Major-Pedersen, Atheline; Køber, Lars; Torp-Pedersen, Christian; Dominguez, Helena

    2011-01-01

    metoprolol tartrate or metoprolol succinate. The relative forearm blood flow at the highest dose of serotonin was 2.42 ± 0.33 in the carvedilol group at baseline and 2.14 ± 0.24 after two months continuation of carvedilol (P = 0.34); 2.57 ± 0.33 before metoprolol tartrate treatment and 2.42 ± 0.55 after...

  18. Male Hypogonadism and Germ Cell Loss Caused by a Mutation in Polo-Like Kinase 4

    OpenAIRE

    Harris, Rebecca M.; Weiss, Jeffrey; Jameson, J. Larry

    2011-01-01

    The genetic etiologies of male infertility remain largely unknown. To identify genes potentially involved in spermatogenesis and male infertility, we performed genome-wide mutagenesis in mice with N-ethyl-N-nitrosourea and identified a line with dominant hypogonadism and patchy germ cell loss. Genomic mapping and DNA sequence analysis identified a novel heterozygous missense mutation in the kinase domain of Polo-like kinase 4 (Plk4), altering an isoleucine to asparagine at residue 242 (I242N)...

  19. AcEST: BP914589 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000060_F12 590 Adiantum capillus-veneris mRNA. clone: YMU001_000060_F12. BP914589 - Show ... IPTKDKEIRAFLGLTGYYRKFIPNYADIAKPMTSCLKKRTKIDTQKLEYIEAFE KLKAL 492 Query: 316 XXXXXXXXXXNVCSPFEVQSNACGDCLELF ... (65%) Frame = +2 Query: 242 ICCPLHDLTKKNVKYSWTAKVQEAFE ... 319 + PL+ LTK++ ++W + Q AFE ... Sbjct: 438 LAAPLYALTKE ... STPFTWQTEHQLAFE ... 463 >sp|P31792|POL_FENV1 Pol polyprotein (Fragment ... (65%) Frame = +2 Query: 242 ICCPLHDLTKKNVKYSWTAKVQEAFE ... 319 + PL+ LTK++ ++W K Q AFE ... Sbjct: 295 LAAPLYALTKE ...

  20. Improving the thermostability and enhancing the Ca(2+) binding of the maltohexaose-forming α-amylase from Bacillus stearothermophilus.

    Science.gov (United States)

    Li, Zhu; Duan, Xuguo; Wu, Jing

    2016-03-20

    The thermostability of the maltohexaose-forming α-amylase from Bacillus stearothermophilus (AmyMH) without added Ca(2+) was improved through structure-based rational design in this study. Through comparison of a homologous model structure of AmyMH with the crystal structure of the thermostable α-amylase from Bacillus licheniformis, Ser242, which located at the beginning of fourth α-helix of the central (β/α)8 barrel was selected for mutation to improve thermostability. In addition, an amide-containing side chain (Asn193) and a loop in domain B (ΔIG mutation), which have been proven to be important for thermostability in corresponding position of other α-amylases, were also investigated. Five mutants carrying the mutations ΔIG, N193F, S242A, ΔIG/N193F, and ΔIG/N193F/S242A were generated and their proteins characterized. The most thermostable mutant protein, ΔIG/N193F/S242A, exhibited a 26-fold improvement in half-life at 95°C compared to the wild-type enzyme without added Ca(2+). Mutant ΔIG/N193F/S242A also exhibited substantially better activity and stability in the presence of the chelator EDTA, demonstrating enhanced Ca(2+) binding. These results suggest that mutant ΔIG/N193F/S242A has potential for use in the industrial liquefaction of starch. PMID:26869314

  1. Minor Actinide Burning in Thermal Reactors. A Report by the Working Party on Scientific Issues of Reactor Systems

    International Nuclear Information System (INIS)

    The actinides (or actinoids) are those elements in the periodic table from actinium upwards. Uranium (U) and plutonium (Pu) are two of the principal elements in nuclear fuel that could be classed as major actinides. The minor actinides are normally taken to be the triad of neptunium (Np), americium (Am) and curium (Cm). The combined masses of the remaining actinides (i.e. actinium, thorium, protactinium, berkelium, californium, einsteinium and fermium) are small enough to be regarded as very minor trace contaminants in nuclear fuel. Those elements above uranium in the periodic table are known collectively as the transuranics (TRUs). The operation of a nuclear reactor produces large quantities of irradiated fuel (sometimes referred to as spent fuel), which is either stored prior to eventual deep geological disposal or reprocessed to enable actinide recycling. A modern light water reactor (LWR) of 1 GWe capacity will typically discharge about 20-25 tonnes of irradiated fuel per year of operation. About 93-94% of the mass of uranium oxide irradiated fuel is comprised of uranium (mostly 238U), with about 4-5% fission products and ∼1% plutonium. About 0.1-0.2% of the mass is comprised of neptunium, americium and curium. These latter elements accumulate in nuclear fuel because of neutron captures, and they contribute significantly to decay heat loading and neutron output, as well as to the overall radio-toxic hazard of spent fuel. Although the total minor actinide mass is relatively small - approximately 20-25 kg per year from a 1 GWe LWR - it has a disproportionate impact on spent fuel disposal, and thus the longstanding interest in transmuting these actinides either by fission (to fission products) or neutron capture in order to reduce their impact on the back end of the fuel cycle. The combined masses of the trace actinides actinium, thorium, protactinium, berkelium and californium in irradiated LWR fuel are only about 2 parts per billion, which is far too low for

  2. Radiological safety considerations in the design and operation of the Oak Ridge National Laboratory Transuranium Research Laboratory (TRL)

    International Nuclear Information System (INIS)

    The Transuranium Research Laboratory (TRL) is the central facility at Oak Ridge National Laboratory (ORNL) for chemical and physical research involving transuranium elements. Transuranium Research Laboratory investigations are about equally divided between studies of inorganic and structural chemistry of the heavy elements and nuclear structure and properties of their isotopes. Elements studied include neptunium, plutonium, americium, curium, berkelium, californium, and einsteinium, each in microgram-to-gram quantities depending upon availability and experimental requirements. This paper describes an eight-step safety procedure that is followed in planning and approving individual research projects. This procedure should provide an ''optimum margin of safety'' and should permit the accomplishment of successful research. Steps in the procedure are as follows: (1) Evaluate the external and internal exposure radioactivity hazards. (2) Establish any concurrent conventional industrial safety risks that may be encountered in the operation. (3) Consider, in the proper perspective, the potential consequences of possible interactions of radioactivity risks with associated industrial safety risks and problems, applying the concepts of credibility and probability. (4) Design equipment, develop operating procedures, and ensure the proficiency of operating personnel to provide necessary safeguards to accomplish programme objectives with minimum risks and minimum operational constraints. (5) Ensure that necessary safeguards are, in fact, incorporated in equipment and procedures before actual work is begun. (6) Ensure that appropriate monitoring instrumentation, surveillance, and other necessary protective technical and craft support are available and are used during operation. (7) Make certain that appropriate measures exist to manage credible radiation accidents and other emergencies properly. (8) Inform others, in sufficient detail, of the success or deficiency of design

  3. Transuranium Processing Plant semiannual report of production, status, and plans for period ending December 31, 1975

    Energy Technology Data Exchange (ETDEWEB)

    King, L.J.; Bigelow, J.E.; Collins, E.D.

    1976-10-01

    Between July 1, 1975, and December 31, 1975, maintenance was conducted at TRU for a period of three months, 295 g of curium oxide (enough for approximately 26 HFIR targets) were prepared, 100 mg of high-purity /sup 248/Cm, were separated from /sup 252/Cf that had been purified during earlier periods, 11 HFIR targets were fabricated, and 28 product shipments were made. No changes were made in the chemical processing flowsheets normally used at TRU during this report period. However, three equipment racks were replaced (with two new racks) during this time. In Cubicle 6, the equipment replaced was that used to decontaminate the transplutonium elements from rare earth fission products and to separate curium from the heavier elements by means of the LiCl-based anion-exchange process. In Cubicle 5, the equipment used to separate the transcurium elements by high-pressure ion exchange and to purify berkelium by batch solvent extraction was replaced. Two neutron sources were fabricated, bringing the total fabricated to 79. One source that had been used in a completed project was returned to the TRU inventory and is available for reissue. Three sources, for which no further use was foreseen, were processed to isolate and recover the ingrown /sup 248/Cm and the residual /sup 252/Cf. Eight pellets, each containing 100 ..mu..g of high-purity /sup 248/Cm were prepared for irradiation in HFIR to study the production of /sup 250/Cm. The values currently being used for transuranium element decay data and for cross-section data in planning irradiation-processing cycles, calculating production forecasts, and assaying products are tabulated.

  4. Paul Scherrer Institute Scientific Report 1999. Volume I: Particles and Matter

    Energy Technology Data Exchange (ETDEWEB)

    Gobrecht, J.; Gaeggeler, H.; Herlach, D.; Junker, K.; Kettle, P.-R.; Kubik, P.; Zehnder, A. [eds.

    2000-07-01

    lthough originally planned for fundamental research in nuclear physics, the particle beams of pions, muons, protons and neutrons are now used in a large variety of disciplines in both natural science and medicine. The beams at PSI have the world's highest intensities and therefore allow certain experiments to be performed, which would not be possible elsewhere. The highlight of research this year was the first-ever determination of the chemical properties of the superheavy element {sup 107} Bohrium. This was undertaken, by an international team led by H. Gaeggeler of PSI's Laboratory for Radiochemistry. Bohrium was produced by bombarding a Berkelium target with Neon ions from the Injector I cyclotron and six atoms were detected after having passed through an online gas chromatography device. At the Laboratory for Particle Physics the focus has shifted from nuclear physics to elementary particle physics with about a fifty-fifty split between investigations of rare processes or particle decays using the high intensity muon, pion and recently also polarized neutron beams of PSI, and research at the highest energy frontier at CERN (Geneva) and DESY (Hamburg). Important space instrumentation has been contributed by the Laboratory for Astrophysics to the European Space Agency and NASA satellite programmes. The Laboratory for Micro and Nanotechnology continued to focus on research into molecular nanotechnology and SiGeC nanostructures, the latter with the aim of producing silicon based optoelectronics. Progress in 1999 in these topical areas is described in this report. A list of scientific publications in 1999 is also provided.

  5. Actinide production in the reaction of heavy ions with curium-248

    International Nuclear Information System (INIS)

    Chemical experiments were performed to examine the usefulness of heavy ion transfer reactions in producing new, neutron-rich actinide nuclides. A general quasi-elastic to deep-inelastic mechanism is proposed, and the utility of this method as opposed to other methods (e.g. complete fusion) is discussed. The relative merits of various techniques of actinide target synthesis are discussed. A description is given of a target system designed to remove the large amounts of heat generated by the passage of a heavy ion beam through matter, thereby maximizing the beam intensity which can be safely used in an experiment. Also described is a general separation scheme for the actinide elements from protactinium (Z=91) to mendelevium (Z=101), and fast specific procedures for plutonium, americium and berkelium. The cross sections for the production of several nuclides from the bombardment of 248Cm with 18O, 86Kr and 136Xe projectiles at several energies near and below the Coulomb barrier were determined. The results are compared with yields from 48Ca and 238U bombardments of 248Cm. Simple extrapolation of the product yields into unknown regions of charge and mass indicates that the use of heavy ion transfer reactions to produce new, neutron-rich above-target species is limited. The substantial production of neutron-rich below-target species, however, indicates that with very heavy ions like 136Xe and 238U the new species 248Am, 249Am and 247Pu should be produced with large cross sections from a 248Cm target. A preliminary, unsuccessful attempt to isolate 247Pu is outlined. The failure is probably due to the half life of the decay, which is calculated to be less than 3 minutes. The absolute gamma ray intensities from 251Bk decay, necessary for calculating the 251Bk cross section, are also determined

  6. ATP-site binding inhibitor effectively targets mTORC1 and mTORC2 complexes in glioblastoma.

    Science.gov (United States)

    Neil, Jayson; Shannon, Craig; Mohan, Avinash; Laurent, Dimitri; Murali, Raj; Jhanwar-Uniyal, Meena

    2016-03-01

    The PI3K-AKT-mTOR signaling axis is central to the transformed phenotype of glioblastoma (GBM) cells, due to frequent loss of tumor suppressor PTEN (phosphatase and tensin homolog deleted on chromosome 10). The mechanistic target of rapamycin (mTOR) kinase is present in two cellular multi-protein complexes, mTORC1 and mTORC2, which have distinct subunit composition, substrates and mechanisms of action. Targeting the mTOR protein is a promising strategy for GBM therapy. However, neither of these complexes is fully inhibited by the allosteric inhibitor of mTOR, rapamycin or its analogs. Herein, we provide evidence that the combined inhibition of mTORC1/2, using the ATP-competitive binding inhibitor PP242, would effectively suppress GBM growth and dissemination as compared to an allosteric binding inhibitor of mTOR. GBM cells treated with PP242 demonstrated significantly decreased activation of mTORC1 and mTORC2, as shown by reduced phosphorylation of their substrate levels, p70 S6KThr389 and AKTSer473, respectively, in a dose-dependent manner. Furthermore, insulin induced activation of these kinases was abrogated by pretreatment with PP242 as compared with rapamycin. Unlike rapamycin, PP242 modestly activates extracellular regulated kinase (ERK1/2), as shown by expression of pERKThr202/Tyr204. Cell proliferation and S-phase entry of GBM cells was significantly suppressed by PP242, which was more pronounced compared to rapamycin treatment. Lastly, PP242 significantly suppressed the migration of GBM cells, which was associated with a change in cellular behavior rather than cytoskeleton loss. In conclusion, these results underscore the potential therapeutic use of the PP242, a novel ATP-competitive binding inhibitor of mTORC1/2 kinase, in suppression of GBM growth and dissemination. PMID:26719046

  7. Anti-inflammatory and anti-amyloidogenic effects of a small molecule, 2,4-bis(p-hydroxyphenyl-2-butenal in Tg2576 Alzheimer’s disease mice model

    Directory of Open Access Journals (Sweden)

    Jin Peng

    2013-01-01

    Full Text Available Abstract Background Alzheimer’s disease (AD is pathologically characterized by excessive accumulation of amyloid-beta (Aβ fibrils within the brain and activation of astrocytes and microglial cells. In this study, we examined anti-inflammatory and anti-amyloidogenic effects of 2,4-bis(p-hydroxyphenyl-2-butenal (HPB242, an anti-inflammatory compound produced by the tyrosine-fructose Maillard reaction. Methods 12-month-old Tg2576 mice were treated with HPB242 (5 mg/kg for 1 month and then cognitive function was assessed by the Morris water maze test and passive avoidance test. In addition, western blot analysis, Gel electromobility shift assay, immunostaining, immunofluorescence staining, ELISA and enzyme activity assays were used to examine the degree of Aβ deposition in the brains of Tg2576 mice. The Morris water maze task was analyzed using two-way ANOVA with repeated measures. Otherwise were analyzed by one-way ANOVA followed by Dunnett’s post hoc test. Results Treatment of HPB242 (5 mg/kg for 1 month significantly attenuated cognitive impairments in Tg2576 transgenic mice. HPB242 also prevented amyloidogenesis in Tg2576 transgenic mice brains. This can be evidenced by Aβ accumulation, BACE1, APP and C99 expression and β-secretase activity. In addition, HPB242 suppresses the expression of inducible nitric oxide synthase (iNOS and cyclooxygenase-2 (COX-2 as well as activation of astrocytes and microglial cells. Furthermore, activation of nuclear factor-kappaB (NF-κB and signal transducer and activator of transcription 1/3 (STAT1/3 in the brain was potently inhibited by HPB242. Conclusions Thus, these results suggest that HPB242 might be useful to intervene in development or progression of neurodegeneration in AD through its anti-inflammatory and anti-amyloidogenic effects.

  8. Measurement of mass yields from the 241Am(2nth,f reaction at the Lohengrin Spectrometer

    Directory of Open Access Journals (Sweden)

    Köster U.

    2013-03-01

    Full Text Available The study of fission yields has a major impact on the characterization and understanding of the fission process and is mandatory for reactor applications. While the yields are known for the major actinides (235U, 239Pu in the thermal neutron-induced fission, only few measurements have been performed on 242Am. The interest of 242Am concerns the reduction of radiotoxicity of 241Am in nuclear wastes using transmutation reactions. This paper presents the measurement of the fission mass yields from the reaction 241Am(2nth,f performed at the Lohengrin mass spectrometer (ILL, France for both the light and the heavy peaks: a total of 41 mass yields have been measured. The experiment was also meant to determine whether there is a difference in mass yields between the isomeric state and the ground state as it exists in fission and capture cross sections. The method used to address this question is based on a repeated measurement of a set of fission mass yields as a function of the ratio between the 242gAm and the 242mAm fission rates. The presented experiment is also a first step towards the measurement of the isotopic fission yields of 242Am.

  9. Sensitivity analysis for actinide production and depletion in fast reactors

    International Nuclear Information System (INIS)

    In sensitivity analysis of the actinide production and depletion in fast reactors, a mathematical method of calculating sensitivity coefficients is improved and simplified by combining the time-dependent generalized perturbation technique with the eigenvalue method. Numerical calculations show that the eigenvalue method is well applicable in solving the nuclide chain equation and its adjoint equation and the cylic chains in the decay scheme of the actinides can be interpreted by means of complex eigenvalues. The sensitivity coefficients of actinide production and depletion in a 1000 MWe fast reactor are strongly dependent on the type of Pu fuel used, i.e. Pu fuel from BWR or Pu fuel from the blanket of FBR. The sensitivity coefficients due to variations of capture cross sections, σsub(n,2n) of 238U, lambda sub(β) of 241Pu and lambda sub(α) of 242Cm are especially large. Sensitivity analyses for the 1000 MWe fast reactors show that higher priorily should be given to decay constants of 241Pu and 242Cm, capture cross sections of 237Np, 241Am, 243Am and 242Pu, and fission cross sections of 237Np, 242Pu, 241Am and sup(242m)Am. (author)

  10. CLINICAL USE OF COMBINED DETECTION WITH TUMOR MARKERS FOR PANCREATIC CANCER

    Institute of Scientific and Technical Information of China (English)

    2001-01-01

    Objective To explore the value of clinical use of combined detection with tumor markers for pancreatic cancer. Methods Tumor markers CA242,CA19-9 and CA50 in serum of 32 patinets with pancreatic cancer;26 patients with non-pancreatic digestive tract cancers and 24 patietns with benign pancreatic or biliary tract diseases were measured by immunoradiometric assay (IRMA). Results The levels of three markers in serum and positive rates of patients with pancreatic cancer were higher than those of other patients. The effect of measurement combining CA242 with CA19-9 was the best. The sensitivity ,specificity and accuracy of diagnosis for pancreatic cancer were 92.6%, 73.8% and 81.2% respectively. The levels of CA242 and CA19-9 were positively relative to burden of pancreatic cancer, and serum levels of these two markers of patients with resectable pancreatic cancer were lower than those with unresectable, but on difference was observed for CA50. Conclusion Combined detection of serum CA242 and CA19-9 could prove the effectual indicator for finding the patients with pancreatic cancer in high risk population or for resectable pancreatic cancer. Pre-operative measurement of serum levels of CA242 and CA19-9 is helpful to evaluate the burden of the tumors and possiblity of resect for pancreatic cancers.

  11. Dicty_cDB: Contig-U10996-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ermophila putative mismatch repair ... 52 6e-13 5 ( M84170 ) S.cerevisiae homologue of bacterial MutS protei...111( CP001357 |pid:none) Brachyspira hyodysenteriae WA1,... 232 7e-59 CP001321_1328( CP001321 |pid:none) Haemophilus paras...82972_1( EU682972 |pid:none) Francisella philomiragia subsp. no... 211 1e-52 (B5XV49) RecName: Full=DNA mismatch repair... 242 5e-62 (Q8K5J5) RecName: Full=DNA mismatch repair protein mutS; &AE014... 242 5e-62 CU468135_2694( CU468135 |pid:none) Erwinia... tasmaniensis strain ET1... 242 5e-62 (Q48QT6) RecName: Full=DNA mismatch repair prote

  12. Generation of an actinide isotopes cross section set for fast reactor calculations using data from ENDL and ENDF/B-IV

    International Nuclear Information System (INIS)

    A Bondarenko format 25-group cross section set of actinide isotopes was generated for the fuel cycle evaluation and the incineration study in fast reactor systems. Evaluated Nuclear Data Library of Lawrence Livermore Laboratory (U.S.) was used as the source data. The actinide isotopes treated are the following 28: Th-232, U-233, U-234, U-235, U-236, U-237, Pu-238, Pu-239, Pu-240, Pu-241, Pu-242, Pu-243, Am-241, Am-242, Am-243, Cm-242, Cm-243, Cm-245, Cm-246, Cm-247, Cm-248, Bk-249, Cf-249, Cf-250, Cf-251, Cf-252 and a pseudo-fission product. ENDF/B-IV was used for U-238. The set was then collapsed to one energy group using a large LMFBR core spectrum for the comparison with other one-group sets. (author)

  13. Neutron-induced Fission Cross Section of 240242Pu up to En = 3 MeV

    Science.gov (United States)

    Salvador-Castiñeira, P.; Bryś, T.; Hambsch, F.-J.; Oberstedt, S.; Pretel, C.; Vidali, M.

    2014-05-01

    The neutron-induced fission cross sections of 240,242Pu have been measured at JRC-IRMM with incident neutron energy from 0.2 MeV up to 3 MeV. A Twin-Frisch Grid Ionization Chamber (TFGIC) has been used in a back-to-back geometry. The measurements have been performed using the secondary standards 237Np and 238U as a reference. The purity of the plutonium samples was 99.89% for 240Pu and 99.97% for 242Pu. The results obtained follow the ENDF/B-VII.1 evaluation for 240Pu, but some discrepancies are visible around E/n = 1 MeV for 242Pu. In addition, the spontaneous fission half-life has been measured for both isotopes.

  14. A study on the short-term metabolism of curium and its removal with DTPA in the rat

    International Nuclear Information System (INIS)

    The contents of 242Cm in the plasma, liver, skeleton and kidneys were determined from 22.5 minutes to 16 days after the intravenous injection of 242Cm citrate to the rat. The 242Cm injected disappeared from the plasma rapidly and deposited mainly in the liver and skeleton. By analyzing the relationship between the disappearance from the plasma and the accumulation in the organs of injected curium, the initial distribution space, or the actual site of transfer compartment used for dose calculation in the ICRP Publ.30, of curium was identified as the extracellular fluid (ECF). The calculation showed that the difference between the radiation dose to bone surface or red bone marrow from short-lived curium isotopes evaluated under the current ICRP assumption, on one hand, and the same radiation dose, evaluated under the assumption that the actual site of transfer compartment is ECF, on the other, is not negligible. The effect of administration of CaDTPA or ZnDTPA on the retention of 242Cm in organs was studied by changing the time interval between the 242Cm injection and DTPA administration and the amount of DTPA administered. The results obtained showed that 1) DTPA treatment of a person who has incorporated curium into the body should be started as early as possible, 2) the first single prompt DTPA should be administered as Ca salt, and the following multiple delayed DTPA, as the less toxic Zn salt, and 3) the dose of first CaDTPA should be as large as possible within the range not producing its side effect. The study on the mixture of 242Cm and 238Pu showed that these two radioelements are metabolized and removed with DTPA independently. (author)

  15. Nail-patella syndrome—a novel mutation in the LMX1B gene

    OpenAIRE

    Nair, Rajesh R.; Unni, Vavullipathy N.; Indu, Kadevalappil N.; Nampoothiri, Sheela; Mathew, Anil; Kurian, George; Vimala, Avadaiammal

    2013-01-01

    Nail-patella syndrome (NPS) is an autosomal-dominant pleiotropic disorder characterized by dyplasia of finger nails, skeletal anomalies and frequently renal disease. In the reported case, genetic analysis revealed a new missense mutation in the homeodomain of LMX1B, presumed to abolish DNA binding (c.725T>C, p.Val242Ala). A missense mutation at codon 725 was identified, where thymine was replaced by cytosine which led to the replacement of valine by alanine at position 242. It was not detecte...

  16. Structural Characterization of Heme Environmental Mutants of CgHmuT that Shuttles Heme Molecules to Heme Transporters

    OpenAIRE

    Norifumi Muraki; Chihiro Kitatsuji; Mariko Ogura; Takeshi Uchida; Koichiro Ishimori; Shigetoshi Aono

    2016-01-01

    Corynebacteria contain a heme uptake system encoded in hmuTUV genes, in which HmuT protein acts as a heme binding protein to transport heme to the cognate transporter HmuUV. The crystal structure of HmuT from Corynebacterium glutamicum (CgHmuT) reveals that heme is accommodated in the central cleft with His141 and Tyr240 as the axial ligands and that Tyr240 forms a hydrogen bond with Arg242. In this work, the crystal structures of H141A, Y240A, and R242A mutants were determined to understand ...

  17. Study on burn-up credit and minor actinide in post-irradiation analysis

    International Nuclear Information System (INIS)

    Accuracy of burnup calculation for actinide is very important as to the study of burn-up credit. For minor-actinides such as Am243 and Cm244, however, typical burnup calculation codes are not accurate enough. The accuracy for both nuclides was studied by using the SWAT code. The study showed that the C/E values of both nuclides could be improved at the same time by changing the cross section of Pu242. A study of burnup calculation related to the cross section of Pu242 should be performed to improve the accuracy for both nuclides. (author)

  18. Production and certification of an equal atom plutonium isotopic standard - the New Brunswick Laboratory certified reference material (CRM) No. 128

    International Nuclear Information System (INIS)

    The US Department of Energy (DOE), New Brunswick Laboratory (NBL) has produced an equal atom 239Pu/242Pu isotopic standard, NBL CRM No. 128. Provisional certification of this standard relative to uranium was completed in 1984 and the material made available for distribution to the nuclear community. Certification of the 239Pu/242Pu ratio on an absolute basis has now been accomplished using highly accurate and precise chemical and mass spectrometric measurement techniques. The absolute certification of NBL CRM No. 128 has established it as the primary reference for calibrating the measurement of plutonium isotopic ratios

  19. Transuranium element production. II. Chemical processing of targets

    International Nuclear Information System (INIS)

    The chemical processing described concerns small experimental targets irradiated in OSIRIS or EL-III and industrial targets irradiated in the CELESTIN reactors. In view of the difficulties encountered when processing highly irradiated targets (760MWd.kg-1) by liquid-liquid extraction (interface sludges leading to stable emulsion) the new processes developed are based on inverse phase chromatography. This technique applied to targets of americium 241, plutonium 239 and a plutonium mixture rich in isotope 242 has given tens of milligrams of curium 242, grams of americium 243 and curium 244 and micrograms of californium 252

  20. Variation of the McKusick-Kaufman gene and studies of relationships with common forms of obesity

    DEFF Research Database (Denmark)

    Andersen, Kirstine Lynge; Echwald, Søren Morgenthaler; Larsen, Lesli Hingstrup;

    2005-01-01

    performing mutation analysis of the coding region in 60 Danish white men with juvenile-onset obesity. Five variants were identified, including two synonymous mutations (Pro(39)Pro and Ile(178)Ile) and three nonsynonymous variants (Ala(242)Ser, Arg(517)Cys, and Gly(532)Val). Furthermore, the rare Ala(242)Ser...... was identified in two families and showed partial cosegregation with obesity. The Pro(39)Pro, Ile(178)Ile, and Arg(517)Cys variants are in complete linkage disequilibrium and defined a prevalent haplotype. In a case-control study, the Arg(517)Cys polymorphism allele prevalence was 11.4% [95...