
Sample records for bean ricinus communis

  1. EFFECT OF CASTOR BEAN (Ricinus communis L.) AQUEOUS ...

    African Journals Online (AJOL)


    EFFECT OF CASTOR BEAN (Ricinus communis L.) AQUEOUS. EXTRACTS ON THE PERFORMANCE OF ROOT-KNOT. NEMATODES (Meloidogyne spp.) ON TOMATO. (Solanum lycopersicum L.) J. Adomako1 and C. K. Kwoseh2. 1. Plant Health Division, CSIR-Crops Research Institute, Fumesua, Kumasi. 2. Department ...

  2. Discovery and Characterization of Novel Signatures from the Ricinus communis L. (Castor Bean) Genome

    National Research Council Canada - National Science Library

    O'Connell, Kevin P; Skowronski, Evan W; Dretchen, Kenneth L; Leshin, Jonathan A; Weeks, Andrea


    Given the infamous toxicity of ricin and the industrial usefulness of castor oil, there is a surprising lack of information about the genetic diversity of the species that produces both, the castor bean plant (Ricinus communis L...

  3. Effect of copper on castor bean (Ricinus communis L.) growth

    Energy Technology Data Exchange (ETDEWEB)

    Chaves, Lucia Helena Garofalo; Cunha, Tassio Cavalcanti da Silva; Lima, Vinicius Mota; Cabral, Paulo Cesar Pinto; Barros Junior, Genival; Lacerda, Rogerio Dantas de [Universidade Federal de Campina Grande (UAEAg/UFCG), PB (Brazil). Unidade Academica de Engenharia Agricola


    Castor beans crop (Ricinus communis L.) is raising attention as an alternative crop for oil and biodiesel production. Despite the mineral fertilization is an important factor for increasing castor yield, few research has been made on this issue, mainly on the use de copper. In order to evaluate the effects of copper on growth of this plant an experiment was carried out in a greenhouse, in Campina Grande, Paraiba State, Brazil, from July to December 2007. The substrate for the pot plants was a 6 mm-sieved surface soil (Neossolo Quartzarenico). The experimental design was a completely randomized with three replications. The treatments were composed of five levels of Cu (0; 1; 2; 3 and 4 mg dm{sup -3}), which were applied at the time of planting. One plant of castor bean, cultivar BRS 188 - Paraguacu, was grown per pot after thinning and was irrigated whenever necessary. Data on plant height, number and length of leaves and stem diameter were measured at 21, 34, 77 and 103 days after planting. Copper levels used, in general, did not affect the plant height, stem diameter and leaf area, however they influenced the leaves and shoot biomass dry mass and the quadratic trend was the best to show the behavior of these. (author)

  4. Chemical Investigations of the Castor Bean Plant Ricinus communis (United States)


    Storage Proteins TSP 3-(trimethylsilyl)-2,2,3,3-d4- propionic acid UV Unit Variance VIP Variable Importance in the Projection UNCLASSIFIED...probe head. Each sample was freeze dried and resuspended in D2O [with 0.01% (trimethylsilyl)-2,2,3,3-d4- propionic acid (TSP) and 2% d4-acetic acid ] at...analysing the 2% acidic R. communis extracts was not readily applicable to IRMS and ICPMS techniques due to interference from residual acetic acid

  5. Apis mellifera pollination improves agronomic productivity of anemophilous castor bean (Ricinus communis). (United States)

    Rizzardo, Rômulo A G; Milfont, Marcelo O; Silva, Eva M S da; Freitas, Breno M


    Castor bean (Ricinus communis L.) is cultivated mainly for biodiesel production because of its oil-rich seeds; it is assumed to be an anemophylous species. But pollination deficit can lead to low productivity often attributed to other reasons. In this paper, we investigated pollination requirements, pollination mechanism, occurrence of pollination deficit, and the role of biotic pollinators in a large commercial plantation of castor bean. Our results show that R. communis bears a mixed breeding system favoring selfing by geitonogamy, although the wind promotes mostly outcrossing. We also found that the honey bee (Apis mellifera L.) foraging on castor bean can both transfer pollen from male to female flowers within the same raceme and boost the release of airborne pollen by male flowers. Both situations increase geitonogamy rates, raising significantly fruit set and seed yield. This is the first report of an animal foraging activity increasing seed yield in an anemophilous and geitonogamous crop and elucidates the role of biotic pollinators in castor bean reproduction.

  6. Radiographic analysis in castor bean seeds (Ricinus communis L.)


    Carvalho, Maria Laene Moreira de; Alves, Renato Augusto; Oliveira, Luciana Magda De.


    Castor bean cropping has great social and economic value, but its production has been affected by factors such as low quality seeds used for sowing. The quick and precise evaluation of seed quality by x-ray test is known as an effective method to evaluate seed lots, but little is known about the interpretation between of the type of radiographic image and the seed quality correlation. The potential of x-ray analysis as a marker of seed physiological quality and as an initial process for the i...

  7. ARTICLE - Inbreeding depression in castor bean (Ricinus communis L. progenies

    Directory of Open Access Journals (Sweden)

    Milton Krieger


    Full Text Available The purpose of this study was to investigate inbreeding depression (DE in castor bean. From a population derived from the Guarani cultivar, 60 mother plants were sampled. Three types of progenies were obtained from each one: from self-pollination (AU, from crosses (CR and from open pollination (PL. Grain yield of the progenies was evaluated in two locations. There was a strong interaction of progenies x locations, which led to obtaining estimates within each location. Broad variation was observed in inbreeding depression, with mean values of 6.7% and 13.4%, comparing AU progenies with PL progenies. It was observed that the population has high potential for selecting promising inbred lines. The frequency of mother plants generating progenies with simultaneous high general combination capacity and low inbreeding depression was low. Recurrent selection will increase the occurrence of parent plants associating these two properties, which is necessary for obtaining superior synthetic varieties.

  8. Apis mellifera pollination improves agronomic productivity of anemophilous castor bean (Ricinus communis

    Directory of Open Access Journals (Sweden)

    Rômulo A.G. Rizzardo


    Full Text Available Castor bean (Ricinus communis L. is cultivated mainly for biodiesel production because of its oil-rich seeds; it is assumed to be an anemophylous species. But pollination deficit can lead to low productivity often attributed to other reasons. In this paper, we investigated pollination requirements, pollination mechanism, occurrence of pollination deficit, and the role of biotic pollinators in a large commercial plantation of castor bean. Our results show that R. communis bears a mixed breeding system favoring selfing by geitonogamy, although the wind promotes mostly outcrossing. We also found that the honey bee (Apis mellifera L. foraging on castor bean can both transfer pollen from male to female flowers within the same raceme and boost the release of airborne pollen by male flowers. Both situations increase geitonogamy rates, raising significantly fruit set and seed yield. This is the first report of an animal foraging activity increasing seed yield in an anemophilous and geitonogamous crop and elucidates the role of biotic pollinators in castor bean reproduction.A mamoneira (Ricinus communis L. é cultivada principalmente para produção de biodiesel devido ao alto teor de óleo de suas sementes e considerada como sendo de polinização anemófila. Mas déficits de polinização podem levar a baixos índices de produtividade geralmente atribuídos a outros fatores. Neste trabalho foram investigados os requerimentos, mecanismos e déficit de polinização e o papel dos polinizadores bióticos em um monocultivo comercial de mamona. Os resultados mostram que R. communis possui um sistema de polinização misto, favorecendo a autopolinização por geitonogamia, embora o vento normalmente promova polinização cruzada. Observou-se também que a abelha melífera (Apis mellifera L. forrageando na mamoneira pode tanto transferir pólen das flores estaminadas para as pistiladas do mesmo racemo, quanto aumentar consideravelmente a liberação de p

  9. In-vitro regeneration of castor bean (ricinus communis, L) and physic nut (jatropha curcas, L.)

    International Nuclear Information System (INIS)

    Afful, N. T.


    Investigations were conducted on in vitro regeneration of physic nut (Jatropha curcas, 1.) and castor bean (Ricinus communis, 1.) using zygotic embryo culture, shoot tip and meristem culture as well as somatic embryogenesis. Zygotic embryos from different stages of fruit maturity cultured on Murashige and Skoog (MS) medium supplemented with benzylaminopurine (BAP), kinetin and 2-isopentyl (2iP) produced vigorous seedlings with roots. However the optimal concentration of cytokinin for seedling development depended on the type cytokinin as well as the maturity stage of the fruit. Embryos from yellow fruits of Jatropha had the highest germination (100%) on an MS medium supplemented with 0.5 mg/L kinetin or 1 mg/L BAP while in Ricinus embryos from black fruits had the highest percentage germination (97%) on an MS medium modified with I mg/L 2iP or 0.5 or I mg/L BAP. Decrease in embryo viability especially in Jatropha as the seed matured may be due to high oil content in matured (black) fruit. Oil content in both Jatropha and Ricinus increased as the fruit matured from green to black and this may have effect on germination of zygotic embryos. In vitro culture response of shoot tip or meristem was significantly influenced by the concentration of growth regulators in the culture medium as well as the plant species. In both plant species, 2iP resulted in highest percentage shoot regeneration. The optimal concentration of 2iP was 0.5 mg/L for Ricinus shoot tip and 1.5 or 2.0 mg/L for Jatropha, indicating genotypic difference between the species. However excessive callus formation and browning in Ricinus led to the loss of all the regenerants. Shoot regeneration from meristem explants was also influenced by growth regulators with 2iP again being the best. Cultures of cotyledon and leaf lobe explants on MS medium supplemented with 2, 4-D and picloram resulted in callus induction with the exception of cotyledons obtained from black fruits. However transfer of calli onto fresh

  10. Single nucleotide polymorphisms for assessing genetic diversity in castor bean (Ricinus communis

    Directory of Open Access Journals (Sweden)

    Rabinowicz Pablo D


    Full Text Available Abstract Background Castor bean (Ricinus communis is an agricultural crop and garden ornamental that is widely cultivated and has been introduced worldwide. Understanding population structure and the distribution of castor bean cultivars has been challenging because of limited genetic variability. We analyzed the population genetics of R. communis in a worldwide collection of plants from germplasm and from naturalized populations in Florida, U.S. To assess genetic diversity we conducted survey sequencing of the genomes of seven diverse cultivars and compared the data to a reference genome assembly of a widespread cultivar (Hale. We determined the population genetic structure of 676 samples using single nucleotide polymorphisms (SNPs at 48 loci. Results Bayesian clustering indicated five main groups worldwide and a repeated pattern of mixed genotypes in most countries. High levels of population differentiation occurred between most populations but this structure was not geographically based. Most molecular variance occurred within populations (74% followed by 22% among populations, and 4% among continents. Samples from naturalized populations in Florida indicated significant population structuring consistent with local demes. There was significant population differentiation for 56 of 78 comparisons in Florida (pairwise population ϕPT values, p Conclusion Low levels of genetic diversity and mixing of genotypes have led to minimal geographic structuring of castor bean populations worldwide. Relatively few lineages occur and these are widely distributed. Our approach of determining population genetic structure using SNPs from genome-wide comparisons constitutes a framework for high-throughput analyses of genetic diversity in plants, particularly in species with limited genetic diversity.

  11. Potential of castor bean (Ricinus communis L.) for phytoremediation of mine tailings and oil production. (United States)

    Ruiz Olivares, Alejandro; Carrillo-González, Rogelio; González-Chávez, Ma del Carmen A; Soto Hernández, Ramón Marcos


    Bioenergy production combined with phytoremediation has been suggested to help in solving two critical world problems: the gradual reduction of fossil fuels and soil contamination. The aim of this research was to investigate the potential for the use of Ricinus communis L. (castor oil plant) as an energy crop and plant species to remediate metal-polluted sites. This study was performed in mine tailings containing high concentrations of Cu, Zn, Mn, Pb and Cd. Physico-chemical characterization, total, DTPA-extractable and water-soluble metals in rhizospheric tailings heap samples were carried. Metal concentrations in plant tissues and translocation factors (TFs) were also determined. The Ricinus seed-oil content was high between 41 and 64%, seeds from San Francisco site 6 had the highest oil content, while these from site 7 had the lowest. No trend between oil yield vs seed origin site was observed. Seed-oil content was negatively correlated with root concentration of Cu, Zn, Pb and Cd, but no correlation was observed with the extractable-metals. According to its shoot metal concentrations and TFs, castor bean is not a metal accumulator plant. This primary colonizing plant is well suited to cope with the local toxic conditions and can be useful for the stabilization of these residues, and for then decreasing metal bioavailability, dispersion and human health risks on these barren tailings heaps and in the surrounding area. Our work is the first report regarding combined oil production and a phytostabilization role for Ricinus plants in metal mine tailings and may give a new value to suitable metal-polluted areas. Copyright © 2012 Elsevier Ltd. All rights reserved.

  12. Evaluation of the cadmium and lead phytoextraction by castor bean (Ricinus communis L.) in hydroponics (United States)

    Niu, Z. X.; Sun, L. N.


    Phytoextraction has been considered as an innovative method to remove toxic metals from soil; higher biomass plants such as castor bean (Ricinus communis L.) have already been considered as a hyperaccumulating candidate. In the present study, castor bean was used to accumulate the cadmium and lead in hydroponic culture, and the root exudates and biomass changes were analyzed. Results demonstrated that ratios of aerial biomass/ root biomass (AW/RW) in treatments declined with concentrations of Cd or Pb. Optical density (OD) at 190 nm and 280 nm of root exudates observed in Cd and Pb treatments were lower than the control. In single Cd or Pb treatments, bioconcentration factors (BCF) of Cd or Pb increased with time and decreased with concentrations, the highest BCFs appeared in Cd5 (14.36) and Pb50 (6.48), respectively. Cd-BCF or Pb-BCF showed positive correlations with AW/RW ratios and OD values, and they were negative correlated with Cd and Pb concentration. Results in this study may supply useful information for phytoremediation of soil contaminated with cadmium and lead in situ.

  13. Activity of Ricinus communis (Euphorbiaceae) against Spodoptera ...

    African Journals Online (AJOL)

    One of the most studied plant species with insecticidal properties is the castor bean Ricinus communis. However, its activity against Spodoptera frugiperda is unclear. Therefore, to determinate the insecticidal and insectistatic activities of methanol, hexane and ethyl acetate extracts of the seeds and leaves of R. communis, ...

  14. Discovery and Characterization of Novel Signatures from the Ricinus communis L. (Castor Bean) Genome (United States)


    2006 2. REPORT TYPE N/A 3. DATES COVERED - 4. TITLE AND SUBTITLE Discovery And Characterization Of Novel Signatures From The Ricinus Communis...pressed herbarium specimens prepared from sequenced plants.) Lane 2, PI167112; lane 3, 167287; lane 4, 167342; lane 5, 170684; lane 6, 170686; lane

  15. Effects of Oganic and Biofertilizers on Growth Indices of Castor Bean (Ricinus communis L.

    Directory of Open Access Journals (Sweden)

    A Amin Ghafori


    Full Text Available Introduction Castor plant, Ricinus communis L. is a species of flowering plant in the spurge family; Euphorbiaceae, which contains a vast number of plants mostly native to the tropics. It belongs to a monotypic genus Ricinus. The name Ricinus is a latin word for tick. The plant is probably named because its seed has markings and a dump at the end that resemble certain ticks (NCRI, 2014. Castorbean is an industrial oil seed crop containing about 45-58 percent oil, which has tremendous application in petrochemicals, pharmaceuticals, cosmetics, textiles, chemicals, soap, leather, paints, varnishes, ink, nylon and plastic. Castor oil is traditionally associated with medicine and veterinary use in the fields of obstetrics, dermatology. It is also used as laxative. Presently, its utilization as bio-diesel has magnified its importance. Its oil does not freeze even at high altitudes and it is one the best lubricants for jet engines. This 100% castor-based product, has numerous applications in industry such as rotating glass car-wipers, ski boots fixatives, and for use in air-brake systems on trucks. Many new uses, based on the biodegradability of castor oil derived products, are expected in the future (Labalette et al., 1996. The shell of the castor bean is used as an organic termite control agent and its seed cake as manure in the soil. Medicinal plants are valuable resources in a wide range of natural resources that scientific identification, cultivation, development and proper utilization of them can have an important role in community health, employment and non-petrol exports. Quality of medicinal plants is more important than other crops. One of the most important factors determining the yield of castor bean is fertility. Integrated supply of nutrient to plants through combinations of organic and inorganic sources is becoming an increasingly important aspect of environmentally sound agriculture. Reports showed that the application of manure on bean

  16. Effects of Oganic and Biofertilizers on Growth Indices of Castor Bean (Ricinus communis L.

    Directory of Open Access Journals (Sweden)

    A Amin Ghafori


    Full Text Available Introduction Castor plant, Ricinus communis L. is a species of flowering plant in the spurge family; Euphorbiaceae, which contains a vast number of plants mostly native to the tropics. It belongs to a monotypic genus Ricinus. The name Ricinus is a latin word for tick. The plant is probably named because its seed has markings and a dump at the end that resemble certain ticks (NCRI, 2014. Castorbean is an industrial oil seed crop containing about 45-58 percent oil, which has tremendous application in petrochemicals, pharmaceuticals, cosmetics, textiles, chemicals, soap, leather, paints, varnishes, ink, nylon and plastic. Castor oil is traditionally associated with medicine and veterinary use in the fields of obstetrics, dermatology. It is also used as laxative. Presently, its utilization as bio-diesel has magnified its importance. Its oil does not freeze even at high altitudes and it is one the best lubricants for jet engines. This 100% castor-based product, has numerous applications in industry such as rotating glass car-wipers, ski boots fixatives, and for use in air-brake systems on trucks. Many new uses, based on the biodegradability of castor oil derived products, are expected in the future (Labalette et al., 1996. The shell of the castor bean is used as an organic termite control agent and its seed cake as manure in the soil. Medicinal plants are valuable resources in a wide range of natural resources that scientific identification, cultivation, development and proper utilization of them can have an important role in community health, employment and non-petrol exports. Quality of medicinal plants is more important than other crops. One of the most important factors determining the yield of castor bean is fertility. Integrated supply of nutrient to plants through combinations of organic and inorganic sources is becoming an increasingly important aspect of environmentally sound agriculture. Reports showed that the application of manure on bean

  17. Energy flow in castor bean (Ricinus communis L. production systems Fluxos de energia em sistemas de produção de mamona (Ricinus communis L.

    Directory of Open Access Journals (Sweden)

    Adilson Nunes da Silva


    Full Text Available Although energy analysis is a way to evaluate the sustainability of production systems, this practice is not often used in the agribusiness. In this context, the castor bean (Ricinus communis L is an agricultural crop not yet well studied despite its great potential in the Brazilian energetic scenario. This article aimed to evaluate the productive potential of the castor bean oil, using an energetic view applied to two management systems: low (System 1 and medium (System 2 technologies. The quantification of the used material fluxes was made converting these factors in energy units. The input energy fluxes were 3,170.6 MJ ha¹ and 10,366.0 MJ ha¹ for Systems 1 and 2, respectively. The energy balance of System 1 was 11,938.2 MJ ha¹ and that of System 2 16,296.5 MJ ha¹. The net energetic gain or the energy gain over the invested energy (EROI of System 1 was 3.8 and of System 2, 2.6. Although presenting a greater energy demand and a lower EROI, System 2 had a greater energy balance, demonstrating a better viability of this cultivation system for the production of castor bean oil.A análise energética é uma forma de se avaliar a sustentabilidade de um sistema produtivo, apesar de ainda pouco utilizada no setor agropecuário. Inserida neste setor encontra-se a produção da mamoneira (Ricinus communis L., cultura ainda pouco estudada e que apresenta grande importância para o agronegócio brasileiro. Avaliou-se sob a ótica energética a produção potencial de óleo de mamona em dois sistemas de cultivo: com baixa (Sistema 1 e média (Sistema 2 tecnologias. Foi realizada a quantificação dos fluxos de materiais empregados nos dois sistemas de produção e conversão destes fatores em unidades de energia. Os fluxos de energia de entrada foram de 3.170,6 MJ ha¹ e 10.366 MJ ha¹ para os sistemas 1 e 2, respectivamente. O balanço de energia foi de 11.938,2 MJ ha¹ no sistema 1 e 16.296,5 MJ ha¹ no sistema 2. A lucratividade energética, retorno

  18. Exploiting EST databases for the development and characterization of EST-SSR markers in castor bean (Ricinus communis L.

    Directory of Open Access Journals (Sweden)

    Yang Jun-Bo


    Full Text Available Abstract Background The castor bean (Ricinus communis L., a monotypic species in the spurge family (Euphorbiaceae, 2n = 20, is an important non-edible oilseed crop widely cultivated in tropical, sub-tropical and temperate countries for its high economic value. Because of the high level of ricinoleic acid (over 85% in its seed oil, the castor bean seed derivatives are often used in aviation oil, lubricants, nylon, dyes, inks, soaps, adhesive and biodiesel. Due to lack of efficient molecular markers, little is known about the population genetic diversity and the genetic relationships among castor bean germplasm. Efficient and robust molecular markers are increasingly needed for breeding and improving varieties in castor bean. The advent of modern genomics has produced large amounts of publicly available DNA sequence data. In particular, expressed sequence tags (ESTs provide valuable resources to develop gene-associated SSR markers. Results In total, 18,928 publicly available non-redundant castor bean EST sequences, representing approximately 17.03 Mb, were evaluated and 7732 SSR sites in 5,122 ESTs were identified by data mining. Castor bean exhibited considerably high frequency of EST-SSRs. We developed and characterized 118 polymorphic EST-SSR markers from 379 primer pairs flanking repeats by screening 24 castor bean samples collected from different countries. A total of 350 alleles were identified from 118 polymorphic SSR loci, ranging from 2-6 per locus (A with an average of 2.97. The EST-SSR markers developed displayed moderate gene diversity (He with an average of 0.41. Genetic relationships among 24 germplasms were investigated using the genotypes of 350 alleles, showing geographic pattern of genotypes across genetic diversity centers of castor bean. Conclusion Castor bean EST sequences exhibited considerably high frequency of SSR sites, and were rich resources for developing EST-SSR markers. These EST-SSR markers would be particularly

  19. Proteomic profile of the nucellus of castor bean (Ricinus communis L.) seeds during development. (United States)

    Nogueira, Fábio C S; Palmisano, Giuseppe; Soares, Emanoella L; Shah, Mohibullah; Soares, Arlete A; Roepstorff, Peter; Campos, Francisco A P; Domont, Gilberto B


    In this study, we performed a proteomic analysis of nucellus from two developmental stages of Ricinus communis seeds by a GeLC-MS/MS approach, using of a high resolution orbitrap mass spectrometer, which resulted in the identification of a total of 766 proteins that were grouped into 553 protein groups. The distribution of the identified proteins in stages III and IV into different Gene Ontology categories was similar, with a remarkable abundance of proteins associated with the protein synthesis machinery of cells, as well as several classes of proteins involved in protein degradation, particularly of peptidases associated with programmed cell death. Consistent with the role of the nucellus in mediating nutrient transfer from maternal tissues to the endosperm and embryo, a significant proportion of the identified proteins are related to amino acid metabolism, but none of the identified proteins are known to have a role as storage proteins. Moreover for the first time, ricin isoforms were identified in tissues other than seed endosperm. Results are discussed in the context of the spatial and temporal distribution of the identified proteins within the nucellar cell layers. Copyright © 2012 Elsevier B.V. All rights reserved.

  20. Physicochemical characteristics of seeds from wild and cultivated castor bean plants (Ricinus communis L.

    Directory of Open Access Journals (Sweden)

    Jose Daniel Mosquera


    Full Text Available The castor (Ricinus communis L. is an oilseed plant whose main features are its drought resistance, and its adaptation to eroded, polluted, and low fertility soils. Its oil has a great demand in the industrial sector and it has recently attracted considerable interest for its use in the production of biodiesel and jet fuel. In this study, morphological, physical and chemical characterizations were performed to ascertain the quality of wild (VQ-1 and under cultivation (VQ-7 oil castor seeds. The results showed that there are differences in the morphological and physicochemical characteristics regarding oil content (44,95 vs 33,84%, ash (3,20 vs 2,42%, and 100-seed-weight (45,87 vs 54,23g; similar behavior was recorded when characterizing the oil: kinematic viscosity (269,67 vs 266,44mm2 /s, density (0,9389 vs 0,9465g/cm3 , and acidity index (0,9918 vs 0,5440mg KOH/g for VQ-1 and VQ-7, respectively. Growing conditions to which castor plants were subjected may influence both the final quality of seeds and chemical properties of the oil.

  1. Genotyping and Bioforensics of Ricinus communis

    Energy Technology Data Exchange (ETDEWEB)

    Hinckley, Aubree Christine [Univ. of California, Davis, CA (United States)


    The castor bean plant (Ricinus communis) is a member of the family Euphorbiaceae. In spite of its common name, the castor plant is not a true bean (i.e., leguminous plants belonging to the family, Fabaceae). Ricinus communis is native to tropical Africa, but because the plant was recognized for its production of oil with many desirable properties, it has been introduced and cultivated in warm temperate regions throughout the world (Armstrong 1999 and Brown 2005). Castor bean plants have also been valued by gardeners as an ornamental plant and, historically, as a natural rodenticide. Today, escaped plants grow like weeds throughout much of the southwestern United States, and castor seeds are even widely available to the public for order through the Internet. In this study, multiple loci of chloroplast noncoding sequence data and a few nuclear noncoding regions were examined to identify DNA polymorphisms present among representatives from a geographically diverse panel of Ricinus communis cultivated varieties. The primary objectives for this research were (1) to successfully cultivate castor plants and extract sufficient yields of high quality DNA from an assortment of castor cultivated varieties, (2) to use PCR and sequencing to screen available universal oligos against a small panel of castor cultivars, (3) to identify DNA polymorphisms within the amplified regions, and (4) to evaluate these DNA polymorphisms as appropriate candidates for assay development (see Figure 1). Additional goals were to design, test and optimize assays targeting any DNA polymorphisms that were discovered and to rapidly screen many castor cultivars to determine the amount of diversity present at that particular locus. Ultimately, the goal of this study was to construct a phylogeographic tree representing the genetic relationships present among Ricinus communis cultivars from diverse geographic regions. These research objectives were designed to test the hypothesis that cultivated varieties

  2. Balanço energético para a produção de biodiesel pela cultura da mamona (Ricinus communis L. Energy balance for biodiesel production by the castor bean crop (Ricinus communis L.

    Directory of Open Access Journals (Sweden)

    Rodolfo Glauber Chechetto


    Full Text Available A cultura da mamona (Ricinus communis L. adquiriu prestígio ao interesse da indústria pela qualidade de seu óleo e, recentemente, pela busca de novas fontes de energias. O experimento que serviu como base para os dados utilizados nesse trabalho foi realizado na Fazenda Experimental Lageado, FCA - UNESP, no município de Botucatu - SP, no ano de 2008. O objetivo deste trabalho foi avaliar a viabilidade energética da cultura através do balanço e da eficiência energética, desde a implantação até a produção de biodiesel, utilizando parâmetros de consumo operacional no manejo para instalação e manutenção da cultura, colheita e processamento de óleo. As operações de manejo de solo, semeadura e colheita consumiramo total de 266,20 MJ ha-1, que juntamente com fertilizantes, agrotóxicos, combustíveis e lubrificantes, mão-de-obra, sementes e processamento industrial totalizaram uma entrada de energia de 56.808,10 MJ ha-1. A produção de energia foi de 72.814,00 MJ ha-1. O setor ainda carece de estudos que contribuiriam para o levantamento de dados e coeficientes energéticos mais específicos. A cultura da mamona foi considerada eficiente, permitindo ganho de 15.983,44 MJ ha-1, equivalente a aproximadamente 415 L de óleo diesel.The castor bean crop (Ricinus communis L. has acquired prestige due to industries interest in the oil quality and recently for new sources of energy demand. The experiment that served as basis for the data used in this study was conducted at the Lageado Experimental Farm, in Botucatu - SP, 2008. This study aimed to avaluate the crop viability through energy balance and energy efficiency since the implantation until biodiesel production using parameters of consumption in operational management for installation and maintenance of culture harvest and oil production. The soil management operations, sow and harvest consumed the total of 266.20 MJ ha-1, gathering with the fertilizers, pesticides, fuels

  3. Allelopatic effect of different caster bean organs (Ricinus communis L. on reducing germination and growth of dodder (Cuscuta campestris Yuncker

    Directory of Open Access Journals (Sweden)

    S.M Seyyedi


    Full Text Available Introduction Dodder (Cascuta campestris Yuncker is an annual parasitic plant from the Convolvulaceae family (Mishra et al., 2007. It wraps around many adjacent dicot and a few monocot plants, penetrates in their vascular tissue and exploits photosynthates, nutrients and water (Lanini & Kogan, 2005. Consequently, the growth, vigor and production of the host plant will be severely reduced (Nadler-Hasasr & Rubin, 2003. Dodder is not able to complete its cycle, if it is not attached to a host. Therefore, it is entirely dependent on its host for supplying water, assimilates and minerals (Mishra et al., 2007. Considering the nature of dodder habit, it is rarely possible to completely control dodder by using different chemical herbicides (Lanini & Kogan, 2005. In addition, because of increasing the environmental concerns caused by applying synthetic herbicides, there is considerable attention to alternative strategies for weeds management (Batish et al., 2002; Bowmik & Inderjit, 2003. In recent years, allelopathic plants, an alternative strategy for weed management, have received massive attention (Narwal, 2010; Jamil et al., 2009. Due to the importance of dodder as a parasitic weed, this research was conducted with the purpose of studying the allelopathic effects of aqueous extracts and decay durations of caster bean (Ricinus communis L. organs on germination and emergence of dodder. Materials and methods The current study was conducted based on three separate experiments using a completely randomized design (CRD with factorial arrangement with three replications. The first experiment was conducted in petri dishes and consisted of caster bean organs at four levels (root, stem, leaf and total plant without inflorescence and their aqueous extract concentrations at 11 levels (0, 1, 2, 3, 4, 5, 6, 7, 8, 9 and 10%. The second experiment was conducted in pots and factors were caster bean organs at 4 levels (root, stem, leaf and total plant without

  4. Semeadura do híbrido Lyra de mamona (Ricinus communis L. sob plantio direto Seeding of castor bean (Ricinus communis L. hybrid Lyra in no-tillage system

    Directory of Open Access Journals (Sweden)

    Nilza Patrícia Ramos


    Full Text Available A semeadura mecanizada da mamona (Ricinus communis L. pode reduzir o tempo de operação e os custos associados à mão-de-obra, porém a escassez de informações nesta área tem prejudicado a adoção correta desta tecnologia. Assim, objetivou-se com esse trabalho verificar a regularidade da distribuição longitudinal de sementes do híbrido Lyra de mamona, em área de plantio direto e sua relação com rendimento de grãos; bem como a viabilidade da aplicação de cartas de controle para a avaliação do processo de semeadura, nesta cultura. O ensaio foi conduzido em área comercial de produção de grãos de mamona sob plantio direto, sendo avaliadas: distribuição longitudinal, porcentagens de espaçamentos normais, falhos e duplos na linha, número de planta por metro linear, altura de plantas, altura e comprimento do racemo primário e rendimento de grãos. Utilizou-se a estatística descritiva, a análise de correlações e as cartas de controle para a avaliação dos parâmetros propostos. Há necessidade de refinamento nas regulagens de semeadoras-adubadoras de precisão para a semeadura do híbrido Lyra de mamona, em áreas de plantio direto; a distribuição longitudinal de sementes de mamona influencia vários parâmetros fitotécnicos, incluindo o rendimento de grãos; a aplicação da carta de controle é uma ferramenta eficiente para a avaliação do processo de semeadura da mamona.The mechanized sowing of castor bean (Ricinus communis L. can reduce the operation time and the costs associated to labor, however the privation of information in this area have damaged the correct adoption of this technology. Thus, the research had as an aim to verify the regularity of longitudinal distribution of hybrid Lyra castor bean seeds, in a no-tillage system area, and its relationship with yield; and the viability of control charts for evaluation of sowing in this crop. The essay was carded out in a commercial area of grain production in no

  5. Escala diagramática para avaliação de mofo cinzento (Amphobotrys ricini da mamoneira (Ricinus communis L. Diagramatic scale to assess gray mold (Amphobotyrs ricini in castor bean (Ricinus communis L.

    Directory of Open Access Journals (Sweden)

    Haroldo Antunes Chagas


    Full Text Available O objetivo do trabalho foi a elaboração de uma escala diagramática para avaliação de mofo cinzento causado por Amphobotrys ricini (Buchw. em mamoneira (Ricinus communis L.. Utilizaram 59 cachos, que foram desinfestados em solução de hipoclorito de sódio a 2% por 30 segundos e em água destilada e esterilizada. Depois foram acondicionados em bandejas com espuma umedecida, onde receberam discos de micélio de 5mm do patógeno, permanecendo em câmara climática a 25ºC e UR de 80%. Observou-se a evolução da doença e foram obtidos fotos dos cachos doentes diariamente. Para a determinação da porcentagem de severidade dos cachos, os frutos infectados e sadios foram contados, estimando-se dessa forma a porcentagem da área lesionada e elaborando uma escala diagramática com seis níveis de severidade. A adoção da escala proposta, melhorou a acurácia (R²=0,94, com valores de "a" não significativamente diferentes de zero (0 e os valores de "b" não diferentes de um (1.The aim of the present study was to develop a diagrammatic scale to assess gray mold caused by Amphobotrys ricini in castor bean (Ricinus communis L.. The experiment included 59 clusters, which were disinfected in solution of sodium hypochlorite to 2% for 30 seconds and distilled water and sterilized. Then, they were packed in moistened foam trays which received 5mm mycelial discs, and were kept in a climatic chamber at 25º C and 80%. RH. The disease evolution was observed daily pictures of the clusters diseased. To determine the severity percentage of the bunches, infected and healthy fruits were counted, estimating thus the percentage of the injured area, and developing a diagrammatic scale with six severity levels. The adoption of the proposed scale, improved the accuracy (R² = 0,94 "a" values were not significantly different from zero (0 and "b" values were not significantly different from one (1.

  6. Eficiência da seleção recorrente para redução da estatura de plantas em mamoneira (Ricinus communis L. Recurrent selection efficiency for stature reduction of castor bean (Ricinus communis L. plants

    Directory of Open Access Journals (Sweden)

    Inocencio Junior de Oliveira


    Full Text Available Realizou-se, o presente trabalho, com o objetivo de avaliar a eficiência da seleção recorrente para a redução da estatura de plantas de mamona da cultivar Guarani (Ricinus communis L., tornando-a com porte adequado para facilitar a colheita manual e/ou mecânica. Foram realizados quatro ciclos de seleção recorrente com a utilização de progênies autofecundadas na cultivar Guarani para redução da estatura das plantas, nas condições edafoclimáticas dos municípios de São Manuel - SP, Botucatu - SP e Penápolis - SP. As avaliações de estatura das plantas e de produtividade de grãos (kg.ha-1, dos quatro ciclos de seleção e do ciclo original foram realizadas nos municípios de São Manuel - SP, Botucatu - SP e Penápolis - SP na safra 2005/2006, sob um delineamento de blocos casualizados com cinco repetições e parcela útil de 30 m². A análise de variância para as características avaliadas foi feita separadamente para cada local e conjuntamente para os três locais e, posteriormente, realizada a comparação das médias pelo teste de Tukey, a 5%. Foram estimados, para as três localidades, por análise de regressão, os ganhos genéticos dos quatros ciclos de seleção para estatura de plantas. A partir dos resultados obtidos pôde-se concluir que a seleção recorrente foi eficiente para a redução da estatura de plantas e que a cultivar de mamona Guarani apresenta variabilidade genética para essa característica e que a produtividade não foi influenciada pela redução da estatura de plantas.The aim of this work was to evaluate the recurrent selection efficiency for reduction of stature of the castor bean plants of the Guarani cultivar (Ricinus communis L., turning it with appropriate strucuture to facilitate the manual and/or mechanic harvest. Four cycles of recurrent selection were accomplished through the utilization of self-pollinated progenies in the Guarani cultivar for reduction of plants stature, in

  7. Mining whole genomes and transcriptomes of Jatropha (Jatropha curcas) and Castor bean (Ricinus communis) for NBS-LRR genes and defense response associated transcription factors. (United States)

    Sood, Archit; Jaiswal, Varun; Chanumolu, Sree Krishna; Malhotra, Nikhil; Pal, Tarun; Chauhan, Rajinder Singh


    Jatropha (Jatropha curcas L.) and Castor bean (Ricinus communis) are oilseed crops of family Euphorbiaceae with the potential of producing high quality biodiesel and having industrial value. Both the bioenergy plants are becoming susceptible to various biotic stresses directly affecting the oil quality and content. No report exists as of today on analysis of Nucleotide Binding Site-Leucine Rich Repeat (NBS-LRR) gene repertoire and defense response transcription factors in both the plant species. In silico analysis of whole genomes and transcriptomes identified 47 new NBS-LRR genes in both the species and 122 and 318 defense response related transcription factors in Jatropha and Castor bean, respectively. The identified NBS-LRR genes and defense response transcription factors were mapped onto the respective genomes. Common and unique NBS-LRR genes and defense related transcription factors were identified in both the plant species. All NBS-LRR genes in both the species were characterized into Toll/interleukin-1 receptor NBS-LRRs (TNLs) and coiled-coil NBS-LRRs (CNLs), position on contigs, gene clusters and motifs and domains distribution. Transcript abundance or expression values were measured for all NBS-LRR genes and defense response transcription factors, suggesting their functional role. The current study provides a repertoire of NBS-LRR genes and transcription factors which can be used in not only dissecting the molecular basis of disease resistance phenotype but also in developing disease resistant genotypes in Jatropha and Castor bean through transgenic or molecular breeding approaches.

  8. Ricinus communis L. (castor bean) as a potential candidate for revegetating industrial waste contaminated sites in peri-urban Greater Hyderabad: remarks on seed oil. (United States)

    Boda, Ravi Kiran; Majeti, Narasimha Vara Prasad; Suthari, Sateesh


    Ricinus communis L. (castor bean or castor oil plant) was found growing on metal-contaminated sites (4) of peri-urban Greater Hyderabad comprises of erstwhile industrial areas viz Bollaram, Patancheru, Bharatnagar, and Kattedan industrial areas. During 2013-2017, about 60 research papers have appeared focusing the role of castor bean in phytoremediation of co-contaminated soils, co-generation of biomaterials, and environmental cleanup, as bioenergy crop and sustainable development. The present study is focused on its use as a multipurpose phytoremediation crop for phytostabilization and revegetation of waste disposed peri-urban contaminated soils. To determine the plant tolerance level, metal accumulation, chlorophyll, protein, proline, lipid peroxidation, oil content, and soil properties were characterized. It was noticed that the castor plant and soils have high concentration of metals such as cadmium (Cd), lead (Pb), iron (Fe), manganese (Mn), and zinc (Zn). The soils have high phosphorous (P), adequate nitrogen (N), and low concentration of potassium (K). Iron (Fe) concentrations ranged from1672±50.91 to 2166±155.78 mg kg -1 in the soil. The trend of metal accumulation Fe>Zn>Mn>Pb>Cd was found in different plant parts at polluted sites. The translocation of Cd and Pb showed values more than one in industrial areas viz Bollaram, Kattedan, and Bharatnagar indicating the plants resistance to metal toxicity. Chlorophyll and protein content reduced while proline and malondialdehyde increased due to its tolerance level under metal exposure. The content of ricinoleic acid was higher, and the fatty acids composition of polluted areas was almost similar to that of the control area. Thus, R. communis L. can be employed for reclamation of heavy metal contaminated soils.

  9. Irrigation of Castor Bean (Ricinus communis L. and Sunflower (Helianthus annus L. Plant Species with Municipal Wastewater Effluent: Impacts on Soil Properties and Seed Yield

    Directory of Open Access Journals (Sweden)

    Vasileios A. Tzanakakis


    Full Text Available The effects of plant species (castor bean (Ricinus communis L. versus sunflower (Helianthus annus L. and irrigation regime (freshwater versus secondary treated municipal wastewater on soil properties and on seed and biodiesel yield were studied in a three year pot trial. Plant species were irrigated at rates according to their water requirements with either freshwater or wastewater effluent. Pots irrigated with freshwater received commercial fertilizer, containing N, P, and K, applied at the beginning of each irrigation period. The results obtained in this study showed that irrigation with effluent did not result in significant changes in soil pH, soil organic matter (SOM, total kjeldahl nitrogen (TKN, and dehydrogenase activity, whereas soil available P was found to increase in the upper soil layer. Soil salinity varied slightly throughout the experiment in effluent irrigated pots but no change was detected at the end of the experiment compared to the initial value, suggesting sufficient salt leaching. Pots irrigated with effluent had higher soil salinity, P, and dehydrogenase activity but lower SOM and TKN than freshwater irrigated pots. Sunflower showed greater SOM and TKN values than castor bean suggesting differences between plant species in the microorganisms carrying out C and N mineralization in the soil. Plant species irrigated with freshwater achieved higher seed yield compared to those irrigated with effluent probably reflecting the lower level of soil salinity in freshwater irrigated pots. Castor bean achieved greater seed yield than sunflower. Biodiesel production followed the pattern of seed yield. The findings of this study suggest that wastewater effluent can constitute an important source of irrigation water and nutrients for bioenergy crop cultivations with minor adverse impacts on soil properties and seed yield. Plant species play an important role with regard to the changes in soil properties and to the related factors of

  10. Life history of Neoseiulus californicus (McGregor, 1954 (Acari: Phytoseiidae fed with castor bean (Ricinus communisL. pollen in laboratory conditions

    Directory of Open Access Journals (Sweden)

    PP Marafeli

    Full Text Available The predatory mite, Neoseiulus californicus(McGregor, 1954 (Acari: Phytoseiidae is one of the principal natural enemies of tetranychid mites in several countries, promoting efficient control of those mites in several food and ornamental crops. Pest attacks such as that of the spider mite, Tetranychus urticaeKoch, 1836 (Acari: Tetranychidae, is one of the problems faced by farmers, especially in the greenhouse, due to the difficulty of its control with the use of chemicals because of the development of fast resistance making it hard to control it. The objective of this work was to study the life history of the predatory mite N. californicus as a contribution to its mass laboratory rearing, having castor bean plant [Ricinus communis L. (Euphorbiaceae] pollen as food, for its subsequent use as a natural enemy of T. urticae on a cultivation of greenhouse rosebushes. The studies were carried out in the laboratory, at 25 ± 2°C of temperature, 70 ± 10% RH and a 14 hour photophase. The biological aspects and the fertility life table were appraised. Longevity of 32.9 days was verified for adult females and 40.4 days for males. The intrinsic rate of increase (rm was 0.2 and the mean generation time (T was 17.2 days. The population doubled every 4.1 days. The results obtained were similar to those in which the predatory mite N. californicus fed on T. urticae.

  11. Immunogenic Properties of Ricinus Communis Var Minor Seed on ...

    African Journals Online (AJOL)

    Prof. Ogunji

    Abstract. The immunogenic properties of Ricinus communis var minor seed was determined after feeding 7 healthy virgin albino white rabbits with varying doses of 0.5g – 0.9g dried ground. Ricinus communis var minor seed included in their feed (5g/100g body weight). Booster doses of the same weight were further ...

  12. Immunogenic Properties of Ricinus Communis Var Minor Seed on ...

    African Journals Online (AJOL)

    The immunogenic properties of Ricinus communis var minor seed was determined after feeding 7 healthy virgin albino white rabbits with varying doses of 0.5g – 0.9g dried ground Ricinus communis var minor seed included in their feed (5g/100g body weight). Booster doses of the same weight were further administered ...

  13. Spontaneous poisoning by Ricinus communis (Euphorbiaceae in cattle

    Directory of Open Access Journals (Sweden)

    Samuel S.C. Albuquerque


    Full Text Available The aim of this study is to report cases of spontaneous poisoning of cattle by Ricinus communis (castor beans in Paraíba, a semiarid region of northeastern Brazil. The cases were observed in 2 herds on neighboring properties in 2013. Clinical signs developed within 6-24 h and consisted of weakness, tachycardia, dyspnea, profuse watery diarrhea, dehydration, depression, instability, cramps, permanent lateral recumbency and death within 48-72 h. Of the 60 cattle at risk, 19 were affected and 14 died. Five fully recovered after the course of 12 days. Three animals were necropsied. The main gross lesions were hemopericardium, hemothorax, pulmonary edema, petechial hemorrhages in the epicardium and endocardium, ecchymoses at the papillary muscles and suffusions on the intercostal muscles. Hemorrhages were also observed in the abdominal cavity, spleen and mucosa of the abomasum and small intestine. The rumen content was liquid with a large amount of castor bean seeds. There were circular, whitish and focally diffuse areas in the liver parenchyma. The main microscopic lesions consisted of multifocal coagulative myocardial necrosis with the presence of mononuclear cell infiltration and varying degrees of bleeding between cardiac muscle fibers. The abomasum and small intestine mucosae and submucosa had mild edema and mononuclear and polymorphonuclear inflammatory cell infiltration. The diagnosis of R. communis was based on the history of plant consumption, clinical signs, pathology of the disease and the presence of large amounts of castor bean seeds in the forestomachs.

  14. Exogenous glutamine increases lipid accumulation in developing seeds of castor bean (Ricinus communis L. cultured in vitro

    Directory of Open Access Journals (Sweden)

    Zhang Yang


    Full Text Available This report describes biomass production and compositional changes of developing castor seeds in response to change in the nitrogen resource (glutamine of the medium. During the early developmental period (24-36 days after pollination, oil was found to initially accumulate in the developing seeds. Carbohydrates and oil were inversely related after glutamine provision (35 mM, in the culture medium. [U-14C] sucrose labeling was used to investigate the effect of metabolic fluxes among different storage materials. Addition of glutamine led to a 7% increase of labeling in lipids and an inverse decrease of labeling in carbohydrates. It was postulated that changes in the glutamine concentration in the medium are likely to influence the partitioning of resources between the various storage products, especially carbohydrates and oil. These observations will contribute to a better understanding of assimilate partitioning in developing castor seeds and the development of molecular strategies to improve castor bean seed quality and plant breeding studies.

  15. Effects of sowing dates and different fertilizers on yield, yield components, and oil percentage of castor bean (Ricinus communis L.

    Directory of Open Access Journals (Sweden)

    parviz rezvani moghadam


    Full Text Available In order to study the effects of sowing dates and different fertilizers on yield, yield components, and oil percentage of castor bean, an experiment was conducted at Experimental station, College of Agriculture, Ferdowsi University of Mashhad, Iran in years 2004-2005. The experimental treatments comprised all combinations of four sowing dates (11 April, 25 April, 8 May and 22 May and three different fertilizers (cow manure (30 tons/ha, compost (30 tons/ha, chemical fertilizers (100 kg/ha N and 250 kg/ha of super phosphate and no fertilizer as control. Different characteristics such as plant height, main inflorescence height, number of inflorescence per plant, number of secondary stems per plant, number of capsules per plant, number of grain per plant, grain weight per plant, 100 seed weight, grain yield, oil percentage and oil yield were recorded. A factorial arrangement based on a randomized complete block design with three replications was used. The results showed by delaying sowing date grain yield, seed oil percentage and oil yield were decreased, but there was no significant differences between 25 April, 8 May and 22 May sowing dates. Harvest index and 100 seed weight did not affect by neither sowing dates nor fertilizer treatments. The highest number of branches per plant, number of fertile inflorescences per plant, number of fertile capsules per plant, number of grain per plant, grain weight per plant and biological yield were obtained at 8 May sowing date on chemical fertilizer. Percentage of seed oil, grain yield and oil yield was higher at the first sowing date (11 April in compost and chemical fertilizer treatments. Keywords: Castor bean, sowing date, fertilizer, grain yield, oil percentage.

  16. Antibacterial profile of fermented seed extracts of ricinus communis ...

    African Journals Online (AJOL)

    The study was carried out to ascertain the antibacterial properties inherent in fermented seed extracts of Ricinus communis. Dry seeds of R. communis (Castor oil plant) were deshelled, grounded to powder, fermented, and then extracted both with alcohol and water using Soxhlet machine. Different concentrations of the ...

  17. Testes de vigor para avaliação do potencial fisiológico de sementes de mamona (Ricinus communis L. Vigor test for the evaluation of the physiology potencial of castor bean (Ricinus communis L. seeds

    Directory of Open Access Journals (Sweden)

    Rita de Cássia Mendes


    Full Text Available A qualidade de sementes de mamona tem sido avaliada rotineiramente pelo teste de germinação, cujos resultados, muitas vezes, não são confirmados em campo. Nesse contexto, os testes de vigor são essenciais, pois retratam o comportamento das sementes sob maior amplitude de ambiente. Neste trabalho, objetivou-se avaliar a eficiência de métodos para determinar o potencial fisiológico de sementes de mamona. Para tanto, foram utilizados sete lotes de sementes de mamona, cultivar AL-Guarany, apresentando teor de água de aproximadamente 7% , que foram submetidos aos seguintes testes: germinação, primeira contagem de germinação, frio (a 10ºC/7 dias e a 25ºC/5 dias, porcentagem e velocidade de emergência de plântulas, envelhecimento acelerado a 41ºC e 45ºC e 100% UR, por 48, 72 e 96 horas e condutividade elétrica (25 sementes embebidas em 75 e 100mL de água destilada, a 25ºC, por 2, 4, 6, 8, 24, 48 e 72 horas. Os testes de frio e de envelhecimento acelerado (41ºC/72 horas e 100% UR foram eficientes para avaliação do potencial fisiológico de sementes de mamona, permitindo classificação de lotes quanto ao vigor semelhante à emergência de plântulas em solo. O teste de condutividade elétrica não se mostrou adequado para avaliação do potencial fisiológico das sementes de mamona.This work had the objective to determine the efficiency of different tests for the evaluation of physiological potential of castor bean seeds. Seven seed lots of AL-Guarany cultivar were submitted to the following tests: seed moisture content, standard germination, first count, cold test (10ºC/7 days followed by germination at 25ºC/5 days, seedling emergence, speed emergence index, accelerated aging (at 41ºC and 45ºC and 100% RH, for 48, 72, and 96h and electrical conductivity (25 seeds soaked into 75 and 100mL of distilled water, at 25ºC, for 2, 4, 6, 8, 24, 48, and 72 h. The trial was conducted in randomized completely design, with four

  18. Growth response of Ricinus communis L (castor oil) in spent ...

    African Journals Online (AJOL)

    The growth response of castor oil plant, Ricinus communis, in spent lubricating oil (SLO) was investigated using 1-6% w/w SLO and a control. The result showed that highest percent germination of approximately 92, was obtained in control and the least in 5% w/w. The early germination obtained in this study was significant ...

  19. Development of a bioassay to quantify the ricin toxin content of castor bean (Ricinus communis L. seeds=Desenvolvimento de um bioensaio para quantificar o teor da toxina ricina em sementes de mamona (Ricinus communis L.

    Directory of Open Access Journals (Sweden)

    Dick Auld


    Full Text Available In this study, we developed a bioassay to quantify the ricin toxin content of castor bean seeds. Existing quantification methods do not always reflect actual toxicity of the seeds analyzed, which may present lower ricin content even though they are more toxic than seeds presenting a higher content of ricin. This is because these methods actually measure the addition of ricin RCA, which is a compound less toxic than pure ricin. We decided to use in this study, the nematode Caenorhabditis elegans, which has been widely used by the pharmaceutical industry. We tested two strains of C. elegans using different methods in 8 experiments. We examined 4 methods of extracting the ricin complex and 3 methods of exposing the nematodes. Among the nematode strains and ricin extraction methods tested, we concluded that the best strain for testing ricin toxicity was the strain called N2 and that the best method for ricin extraction was a rotating bath followed by centrifugation and exposing the nematodes in 24 well plates with a solution of nematodes extracted from the media with destilated waterexposing the nematodes in 24-well plates This method is inexpensive, quick and adequate for the selection of offspring with lower RIP content.Foi desenvolvido um bioensaio para quantificar o teor de ricina nas sementes de mamona. Os métodos de quantificação existentes não refletem a toxidez real das sementes analizadas, que pode mostrar um resultado de menor teor de ricina e ainda assim ser mais toxico do que as sementes que apresentaram teores maiores. Isto ocorre por que estes métodos medem alem da ricina a RCA, que é um composto menos tóxico que a ricina pura. Foi decidido utilizar neste estudo o nematoide Caenorhabditis elegans, que tem sido amplamente utilizado na industria farmacêutica. Foram testadas duas estirpes de C.elegans usadas em diferentes métodos contando com 8 experimentos distintos. nós examinamos 4 métodos de extração de ricina e 3 m

  20. Phytochemical and Pharmacological Investigations of Ricinus communis Linn.

    Directory of Open Access Journals (Sweden)

    Ram Singh


    Full Text Available Medicinal plants have always played a vital role for the healthy human life. The family Euphorbiaceous is a family of flowering plants and contains nearly about 300 genera and 7,500 species. Amongst all, the species Ricinus communis or castor plant has high traditional and modern medicinal values. The individual parts of the plant like the seed, seed oil, leaves and the roots showed their importance in pharmacology. Traditionally, the plant has been used for the treatment of various diseases in traditional or folk remedies throughout the world. In modern pharmacology, this plant is reported to possess antioxidant, anti-inflammatory, anti-diabetic, central analgesic, antitumor, anti-nociceptive, antiasthmatic activity and other medicinal properties. These activities of the plant are due to the presence of important phytochemical constituents like flavonoids, glycosides, alkaloids, steroids, terpenoids etc. The aim of present article is to explore the chemical constituents, their structures and medicinal importance of Ricinus communis.

  1. IMUNIDADE CRUZADA PELAS SEMENTES DE Abrus precatorius E Ricinus communis EM BOVINOS Crossimmunity by the seeds of Abrus precatorius and Ricinus communis in cattle

    Directory of Open Access Journals (Sweden)

    Carlos Hubinger Tokarnia


    ão imunizados, demonstrando que a imunidade conferida pela ricina não inibe a ação da ricinina, o principio tóxico das folhas e do pericarpo.Five bovines immunized against the toxicity of the seeds of Abrus precatorius L. (jequiriti bean did not get poisoned or only slightly so when the seeds of Ricinus communis L. (castor bean were given in amounts that in bovines, which never before ingested the seeds of A. precatorius or R. communis, caused moderate to severe poisoning or even death. A sixth bovine, which was not well immunized against the toxic action of the seeds of A. precatorius, was severely poisoned when given a high dose of the seeds of R. communis. On the other side, from five bovines immunized against the toxic action of the seeds of R. communis four were severely poisoned and the fifth one moderately when the seeds of A. precatorius were given in doses that in bovines, which never before ingested seeds of R. communis or A. precatorius, caused slight to severe poisoning. It is concluded that bovines immunized against the toxic action of the seeds of A. precatorius are resistant to the toxic action of the seeds of R. communis, but that the contrary is not the case; this is, bovines immunized against the toxic action of the seeds of R. communis were not protected against the poisoning by A. precatorius. Earlier studies by other authors had shown that the toxalbumins of the seeds of A. precatorius and R. communis, respectively abrin and ricin, are different as to their antigenic properties. A possible explanation for the difference in results can be.that in the present study polygastric animals were used which received the seeds orally, but in the earlier studies monogastric animals received the seeds or toxins by parenteral route. The administration of the fresh leaves or the pericarp of the fruits R. communis to bovines, which had been immunized against the action of the seeds of the plant, had the same toxic effect as to not immunized animals, showing that the

  2. Synthesis of Estolide 2-ethylhexyl Ester from Ricinus communis

    International Nuclear Information System (INIS)

    Nazrizawati Ahmad Tajuddin; Nor Habibah Rosli


    Estolide 2-ethylhexyl ester synthesized through condensation reaction between ricinoleic acid from castor oil (Ricinus communis) and lauric acid, and then capped with 2-ethylhexyl alcohol. The reaction was continuously conducted under vacuum for 24 hours. Product of 2-ethylhexyl ester was characterized by using Fourier Transform Infrared (FTIR) to determine functional group and Nuclear Magnetic Resonans (NMR) for structure's determination. The presence of ester group at 1738.23 cm -1 wavenumber indicates that the formation of estolide ester has occurred. The vibration peak of C-O at 1174.60 cm -1 and 1117.10 cm -1 support the formation of ester. The presence of CH 2 bending indicated the long-chain compound. The ester methine signal at 3.8669 ppm indicated the estolide linkage in the 1 H-NMR spectrum while the 13 C-NMR showed two carbonyl signals at 173.41 ppm for acid and 173.56 ppm for ester. (author)

  3. Forensic Applications of Light-Element Stable Isotope Ratios of Ricinus communis Seeds and Ricin Preparations

    Energy Technology Data Exchange (ETDEWEB)

    Kreuzer, Helen W.; West, Jason B.; Ehleringer, James


    Seeds of the castor plant Ricinus communis, also known as castor beans, are of forensic interest because they are the source of the poison ricin. We have tested whether stable isotope ratios of castor seeds and ricin prepared by various methods can be used as a forensic signature. We collected over 300 castor seed samples from locations around the world and measured the C, N, O, and H stable isotope ratios of the whole seeds, oil, and three types of ricin preparations. Our results demonstrate that N isotope ratios can be used to correlate ricin prepared by any of these methods to source seeds. Further, stable isotope ratios distinguished >99% of crude and purified ricin protein samples in pair-wise comparison tests. Stable isotope ratios therefore constitute a valuable forensic signature for ricin preparations.

  4. Production, optimization and quality assessment of biodiesel from Ricinus communis L. oil

    Directory of Open Access Journals (Sweden)

    Maryam Ijaz


    Full Text Available At present, biodiesel is gaining tremendous attention due to its eco-friendly nature and is possible substitute for diesel fuel. Biodiesel as renewable energy source can be produced from edible and non-edible feedstock. Non-edible resources are preferred to circumvent for food competition. In the present study FAME was produced from Ricinus communis L. oil by transesterification with methanol and ethanol in the presence of potassium hydroxide. The practical optimal condition for the production of biodiesel from castor bean was found to be: methanol/oil molar ratio, 6:1; temperature, 60 °C; time, 45 min; catalyst concentration 0.32 g. Quality assessment of biodiesel showed comparable results with ASTM standards. The values of specific gravity (SG were 0.5, kinematic viscosity 2.45 cSt, acid values 0.13 mg KOH/g, carbon residue 0.03%, flash point 119 °C, fire point 125 °C, cloud point −10 °C and pour point −20 °C of Ricinus FAME, respectively. Based on our data, it is suggested that to overcome prevailing energy crisis this non-edible plant is useful for production of biodiesel, which is an alternate to fossil fuel and may be used alone or in blend with HSD in engine combustion.

  5. Effect of powdered castor oil seed ( Ricinus communis L.) on some ...

    African Journals Online (AJOL)

    Effect of powdered castor oil seed ( Ricinus communis L.) on some internal organs of albino rat. ... Four feed formulations were used; powdered castor oil seed and commercial rat feed mixed in ratio 1:1, 1:2, 1:5, 1:10 and ordinary commercial rat feed, which serves as the control.These formulations were given to four ...

  6. In vitro antimicrobial and larvicidal properties of wild Ricinus communis L. in Mauritius

    Directory of Open Access Journals (Sweden)

    Sillma Rampadarath


    Conclusions: Ricinus communis (castor plant extracts possess larvicidal properties providing an effective eco-friendly control for fruit flies. The antimicrobial results justify the use of this plant in traditional medicine and the practice of supplementing decoctions/concoctions with conventional antibiotics.

  7. Toxic effects of Ricinus communis non-protein trypsin inhibitor on ...

    African Journals Online (AJOL)

    In the study reported herein, we aimed to isolate a trypsin inhibitor from Ricinus communis leaves through chromatographic and spectrometric techniques and evaluate its toxic effects on the development of Spodoptera frugiperda larvae. Plant extracts were submitted to fractionation in adsorption column. The fraction 10 ...

  8. Influência da concentração de NaCl e pH na extração de ricina em torta de mamona (Ricinus communis L. e sua caracterização por eletroforese Influence of NaCl and pH concentration on the extraction of ricin in castor bean (Ricinus communis L. and its characterization by electrophoresis

    Directory of Open Access Journals (Sweden)

    Bárbara Amorim Silva


    Full Text Available A mamoneira (Ricinus communis L. é uma oleaginosa de alto valor econômico pelo fato de apresentar um mercado bem definido para o óleo extraído de suas sementes. A torta, que é um resíduo desta extração, se destaca pelo alto teor em proteínas. Dentre as proteínas encontradas na torta destaca-se a ricina, uma citotoxina, que inviabiliza sua utilização como fonte protéica alternativa para alimentação animal. O presente trabalho tem como objetivo identificar um melhor tratamento experimental para a extração de ricina da torta de mamona, visando futuros estudos de perda de integridade da ricina, o que garantiria a inocuidade do produto. Para tanto, buscou-se identificar a solução de maior capacidade de extração de proteínas, empregando a metodologia de superfície de resposta. Um delineamento composto central rotacional foi elaborado a fim de verificar o melhor pH e concentração de NaCl para a extração. Dos cinco diferentes valores de pH (4,0; 4,6; 6,0; 7,4; 8,0 e concentração de NaCl (0,0M; 0,3M; 1,0M; 1,7M; 2,0M utilizados, o tratamento associando fosfato de potássio 0,2M/NaCl 1,7M pH 7,4 foi escolhido como o melhor. A concentração de proteína extraída neste tratamento chegou a valores quatro vezes maiores que o encontrado no de mínima extração de proteína. Pela evidenciação do gel de eletroforese não houve extração preferencial de ricina nos tratamentos testados, entretanto etapas de purificação usando diálise e precipitação com sulfato de amônio, permitiram uma evidenciação melhor das duas cadeias polipeptídicas de ricina.Castor bean (Ricinus communis L. is an oilseed crop of high economic value due to the fact of presenting a clearly defined market for the oil extracted from its seeds. Castor cake, which is a residue of oil extraction, is at the moment receiving special attention because of its high protein content. However, among the proteins found in this cake it is observed the presence of

  9. Recognition factors of Ricinus communis agglutinin 1 (RCA(1)). (United States)

    Wu, Albert M; Wu, June H; Singh, Tanuja; Lai, Li-Ju; Yang, Zhangung; Herp, Anthony


    Ricinus communis agglutinin (RCA1) is one of the most important applied lectins that has been widely used as a tool to study cell surfaces and to purify glycans. Although the carbohydrate specificity of RCA1 has been described, the information obtained was mainly focused on inhibition of simple Galbeta1-related oligosaccharides and simple clusters. Here, all possible recognition factors of RCA1 of glycan binding were examined by enzyme-linked lectinosorbent (ELLSA) and inhibition assays, using known mammalian Gal/GalNAc carbohydrate structural units and natural polyvalent glycans. Among the glycoproteins (gps) tested and expressed as 50% nanogram inhibition, the high-density polyvalent Galbeta1-4GlcNAc (II) glycotopes occurring in natural gps, such as Pneumococcus type 14 capsular polysaccharide which is composed of repeating poly II residues, resulted in 9.0 x 10(4), 1.5 x 10(5), 2.3 x 10(4) and 2.1 x 10(4)-fold higher affinities to RCA1 than the monomeric Gal, linear I/II and Tri-antennary-II (Tri-II). Of the ligands tested and expressed as nanomoles of 50% inhibition, Tri-II was the best, being about 2, 4, 25.6 and 33.3 times better inhibitor than Di-II, II, I (Galbeta1-3GlcNAc) and Gal, respectively. From the results of this study, it is concluded that: (a) Galbeta1-4GlcNAc and other Galbeta1-related oligosaccharides are essential for lectin binding and their polyvalent form in macromolecules should be the most important recognition factor for RCA1; (b) the combining site of RCA1 may be a groove type, recognizing Galbeta1-4GlcNAc (II) as the major binding site; (c) its combining size may be large enough to accommodate a tetrasaccharide of beta-anomeric Gal at the non-reducing end and most complementary to human blood group I Ma active trisaccharide (Galbeta1-4GlcNAcbeta1-6Gal) and lacto-N-neotetraose (Galbeta1-4GlcNAcbeta1-3Galbeta1-4Glc); (d) RCA1 has a preference for the beta-anomer of Gal oligosaccharides with a Galbeta1-4 linkage > Galbeta1-6 > or = Galbeta

  10. Essential oil of the leaves of Ricinus communis L.: in vitro cytotoxicity and antimicrobial properties. (United States)

    Zarai, Zied; Ben Chobba, Ines; Ben Mansour, Riadh; Békir, Ahmed; Gharsallah, Néji; Kadri, Adel


    The aim of the present study was to appraise the antimicrobial activity of Ricinus communis L. essential oil against different pathogenic microorganisms and the cytotoxic activity against HeLa cell lines. The agar disk diffusion method was used to study the antibacterial activity of Ricinus communis L. essential oil against 12 bacterial and 4 fungi strains. The disc diameters of zone of inhibition (DD), the minimum inhibitory concentrations (MIC) and the concentration inhibiting 50% (IC50) were investigated to characterize the antimicrobial activities of this essential oil. The in vitro cytotoxicity of Ricinus communis L. essential oil was examined using a modified MTT assay; the viability and the IC50 were used to evaluate this test. The essential oil from the leaves of Ricinus communis L. was analyzed by GC-MS and bioassays were carried out. Five constituents of the oil were identified by GC-MS. The antimicrobial activity of the oil was investigated in order to evaluate its efficacy against twelve bacteria and four fungi species, using disc diffusion and minimum inhibitory concentration methods. The essential oil showed strong antimicrobial activity against all microorganisms tested with higher sensitivity for Bacillus subtilis, Staphylococcus aureus and Enterobacter cloacae. The cytotoxic and apoptotic effects of the essential oil on HeLa cell lines were examined by MTT assay. The cytotoxicity of the oil was quite strong with IC50 values less than 2.63 mg/ml for both cell lines. The present study showed the potential antimicrobial and anticarcinogenic properties of the essential oil of Ricinus communis L., indicating the possibilities of its potential use in the formula of natural remedies for the topical treatment of infections.

  11. Biochemical, physiological and molecular responses of Ricinus communis seeds and seedlings to different temperatures: a multi-omics approach


    Ribeiro de Jesus, P.R.


    Biochemical, physiological and molecular responses of Ricinus communis seeds and seedlings to different temperatures: a multi-omics approach by Paulo Roberto Ribeiro de Jesus The main objective of this thesis was to provide a detailed analysis of physiological, biochemical and molecular-genetic responses of Ricinus communis to temperature during seed germination and seedling establishment. In Chapter 2, I describe the assessment of 17 candidate reference genes across a diverse set of samples,...

  12. Three flavonol glycosides from Ricinus communis | Aqil | Bulletin of ...

    African Journals Online (AJOL)

    Bulletin of the Chemical Society of Ethiopia. Journal Home · ABOUT THIS JOURNAL · Advanced Search · Current Issue · Archives · Journal Home > Vol 11, No 1 (1997) >. Log in or Register to get access to full text downloads. Username, Password, Remember me, or Register. Three flavonol glycosides from Ricinus ...

  13. Use of Energy Crop (Ricinus communis L.) for Phytoextraction of Heavy Metals Assisted with Citric Acid. (United States)

    Zhang, Hui; Chen, Xueping; He, Chiquan; Liang, Xia; Oh, Kokyo; Liu, Xiaoyan; Lei, Yanru


    Ricinus communis L. is a bioenergetic crop with high-biomass production and tolerance to cadmium (Cd) and lead (Pb), thus, the plant is a candidate crop for phytoremediation. Pot experiments were performed to study the effects of citric acid in enhancing phytoextraction of Cd/Pb by Ricinus communis L. Citric acid increased Cd and Pb contents in plant shoots in all treatments by about 78% and 18-45%, respectively, at the dosage of 10 mM kg(-1) soil without affecting aboveground biomass production. Addition of citric acid reduced CEC, weakened soil adsorption of heavy metals and activated Cd and Pb in soil solutions. The acid-exchangeable fraction (BCR-1) of Pb remained lower than 7% and significantly increased with citric acid amendment. Respective increases in soil evaluation index induces by 14% and 19% under the Cd1Pb50 and Cd1Pb250 treatments upon addition of citric acid resulted in soil quality improvement. Ricinus communis L. has great potential in citric acid-assisted phytoextraction for Cd and Pb remediation.

  14. Survey of the castor bean production (Ricinus communis L. in a collection of producers from five counties of Bahia State. = Levantamento da produção de mamona (Ricinus communis L. em uma amostra de produtores em cinco municípios do Estado da Bahia.

    Directory of Open Access Journals (Sweden)

    Vicente de Paula Queiroga


    Full Text Available The objective of this study was to verify the situation of the culture of castor bean from a collection of producers located in five counties of Bahia state, highlighting the technical conditions of production and commercialization of the product, beyond its social aspects. Twenty-five castor bean producers were interviewed during the 2005 agricultural year by a team of researchers from the Embrapa Cotton. A present questionnaire with 15 variable questions pertaining to agro-economic and social-economic was applied to producers with the objective to diagnose the agricultural social-economic profiles of theproducers of castor bean that are used for the production of berries to be used within the energy market of the Program of Biodiesel and Ricin chemistry. Data analysis concluded that the family farmers of Bahia have the culture of castor oil as, a major source of income, but the cultivation techniques, promising cultivars, and oil content are underutilized. It was shown that a technology gap can be solved by a adopting a differential pricing policy that is based on a feasibility comprehensive recovery program that increases the ricin culture productivity throughout the production chain, reduce costs, and increase the oil content of cultivars.ResumoObjetivou-se com este estudo verificar a situação da cultura da mamona em uma amostra de produtores levantados em cinco municípios localizados no noroeste do estado da Bahia (São Gabriel, Irecê, Lapão, Ibititá e Cafarnaum, destacando-se as condições técnicas de produção e de comercialização do produto, além dos seus aspectos sociais. Um total de 25 produtores de mamona foi entrevistado no ano agrícola de 2005, por uma equipe de pesquisadores da Embrapa Algodão. Um questionário preestabelecido com 15 variáveis agronômicas e socioecononômicas foi aplicado junto aos produtores, visando o diagnóstico do perfil agrossocioeconômico dos produtores de mamona que estão destinando sua

  15. Toxic effects of Ricinus communis non proteic trypsin inhibitor for ...

    African Journals Online (AJOL)

    Marcelo Haro


    Oct 21, 2015 ... studies of alternative and sustainable control methods for lepidopteran pest species. Key words: Castor beans, enzymatic inhibition, integrated pest management, plant defense against herbivory. INTRODUCTION. The fall armyworm .... inhibition in vitro testing. Inhibitor activity was determined as described ...

  16. Effect of experimental Ricinus communis solution for denture cleaning on the properties of acrylic resin teeth. (United States)

    Pisani, Marina Xavier; Macedo, Ana Paula; Paranhos, Helena de Freitas Oliveira; Silva, Cláudia Helena Lovato da


    This study evaluated Knoop hardness, surface roughness and color alteration of artificial teeth for dentures after immersion in water, 1% sodium hypochlorite and an experimental solution of 2% Ricinus communis (RC). Thirty specimens of Vipi, Biolux and Trilux were analyzed. Tests of Knoop hardness, surface roughness and color alteration were conducted immediately after specimen preparation (T0) and after two immersion protocols for 15 days (ΔT(15)) and 183 days (ΔT(183)). Data variation (ΔT) were subjected to ANOVA and Tukey's test (pproperties. Both immersion protocols caused alterations on the analyzed properties.

  17. Can adaptive modulation of traits to urban environments facilitate Ricinus communis L. invasiveness? (United States)

    Goyal, Neha; Pardha-Saradhi, P; Sharma, Gyan P


    This paper addresses the phenotypic variation among Ricinus communis L. populations in four urban habitat types (road verges, garbage dumps, construction debris, and natural area) in Delhi, India, by evaluating important traits such as plant height, basal circumference, seeds per plant, seed size, seed weight, specific leaf area, and reproductive index. An important biochemical marker, proline, considered as a good plant performance indicator under stress was also quantified in leaves of R. communis to evaluate its response in different habitats. Interestingly, the species showed significant variation in plant height, specific leaf area, seed size, seed weight, and leaf proline content in different habitat types. Leaf proline content was positively related to plant height, specific leaf area, and seed size while negatively related to the total number of seeds/plant. Interestingly, reproductive index, calculated as a ratio of the total number of seeds to the plant height also showed a negative relation with leaf proline content. Results indicated that R. communis exhibits adaptive modulation of growth, reproductive traits, and leaf proline content in various urban habitats which contributes to invasiveness, range expansion, and establishment of the species. The study also gives evidence of how morphological and physiological traits could directly affect invasiveness of R. communis.

  18. Evaluation of Ricinus communis L. for the Phytoremediation of Polluted Soil with Organochlorine Pesticides

    Directory of Open Access Journals (Sweden)

    Sandra Regina Rissato


    Full Text Available Phytoremediation is an attractive alternative to conventional treatments of soil due to advantages such as low cost, large application areas, and the possibility of in situ treatment. This study presents the assessment of phytoremediation processes conducted under controlled experimental conditions to evaluate the ability of Ricinus communis L., tropical plant species, to promote the degradation of 15 persistent organic pollutants (POPs, in a 66-day period. The contaminants tested were hexachlorocyclohexane (HCH, DDT, heptachlor, aldrin, and others. Measurements made in rhizosphere soil indicate that the roots of the studied species reduce the concentration of pesticides. Results obtained during this study indicated that the higher the hydrophobicity of the organic compound and its molecular interaction with soil or root matrix the greater its tendency to concentrate in root tissues and the research showed the following trend: HCHs < diclofop-methyl < chlorpyrifos < methoxychlor < heptachlor epoxide < endrin < o,p′-DDE < heptachlor < dieldrin < aldrin < o,p′-DDT < p,p′-DDT by increasing order of log Kow values. The experimental results confirm the importance of vegetation in removing pollutants, obtaining remediation from 25% to 70%, and demonstrated that Ricinus communis L. can be used for the phytoremediation of such compounds.

  19. Effet comparé des poudres de Nicotiana tabacum L, Cymbopogon citratus (D.C. Stapf et de l'huile de Ricinus communis L sur la conservation des graines de Vigna unguiculata (L Walp

    Directory of Open Access Journals (Sweden)

    Gakuru, S.


    Full Text Available Compared Effect of Nicotiana tabacum L, Cymbopogon citratus (D.C. Stapf Powders and Castor Oil Ricinus communis L. on Conservation of Cowpea Vigna Unguiculata (L. Walp Grains. The effect of powder of tobacco Nicotiana tabacum L. and citronella grass Cymbopogon citratus (D.C. Stapf and castor oil Ricinus communis L. on conservation of cowpea Vigna unguiculata (L. Walp. grains was investigated in Kisangani, Zaire. After 5 months of conservation, infestation rates by bean weevil Acanthoscelides obtectus Say were 72.5 %, 74.5 %, 49.5 % and 5 % respectively for the check, the samples treated by 1 % of citronella grass and tobacco powder and 1 % of castor oil. The powder dose of 7.5 % did not give more interesting results.

  20. Biochemical, physiological and molecular responses of Ricinus communis seeds and seedlings to different temperatures: a multi-omics approach

    NARCIS (Netherlands)

    Ribeiro de Jesus, P.R.


    Biochemical, physiological and molecular responses of Ricinus communis seeds and seedlings to different temperatures: a multi-omics approach by Paulo Roberto Ribeiro de Jesus The main objective of this thesis was to provide a detailed analysis of physiological,

  1. Biochemical, physiological and molecular responses of Ricinus communis seeds and seedlings to different temperatures: a multi-omics approach

    NARCIS (Netherlands)

    Ribeiro de Jesus, P.R.


    Biochemical, physiological and molecular responses of Ricinus communis seeds and seedlings to different temperatures: a multi-omics approach

    by Paulo Roberto Ribeiro de Jesus

    The main objective of this thesis was to provide a detailed

  2. Effect of temperature on biomass allocation in seedlings of two contrasting genotypes of the oilseed crop Ricinus communis

    NARCIS (Netherlands)

    Ribeiro de Jesus, P.R.; Zanotti, R.F.; Deflers, C.; Fernandez, L.G.; Castro, De R.D.; Ligterink, W.; Hilhorst, H.W.M.


    Ricinus communis is becoming an important crop for oil production, and studying the physiological and biochemical aspects of seedling development may aid in the improvement of crop quality and yield. The objective of this study was to assess the effect of temperature on biomass allocation in two R.

  3. Selective response of Ricinus communis seedlings to soil borne rhizoctonia infection

    Directory of Open Access Journals (Sweden)

    Andras Bittsanszky


    Full Text Available Seedlings of Ricinus communis tolerated soil-borne Rhizoctonia infection in strain dependent manner. There was no connection revealed between pathogenicity of strains and their origin or taxonomic position, however, the castor plant proved to be susceptible to most strains highly pathogenic to other host plants as well. Rhizoctonia zeae (teleomorph: Waitea circinata, a species new for European flora, was less aggressive to R. communis as the most potent R. solani strains. The effect of Rhizoctonia infection on mass accumulation of hypocotyls was more prominent than that on cotyledons. The protein content and glutathione S-transferase (GST activity increased in parallel with evolution of disease syndrome. Metalaxyl, an acetanilide type systemic anti-omycete fungicide induced locally the GST activity in R. communis cotyledons with 24 hours lag phase, and this induction was altered in the seedlings grown in Rhizoctonia infested soil by strain dependent manner. It might be concluded, that the stress response related detoxication mechanisms of plants in tolerant host/parasite pairs take effect at higher level than in highly susceptible relationships.

  4. Ricinus communis L. A Value Added Crop for Remediation of Cadmium Contaminated Soil. (United States)

    Bauddh, Kuldeep; Singh, Kripal; Singh, Rana P


    Heavy metal pollution of soil is a global environmental problem and therefore its remediation is of paramount importance. Cadmium (Cd) is a potential toxicant to living organisms and even at very low concentrations. This study was aimed to assess the effectiveness of Ricinus communis for remediation of Cd contaminated soils. For this, growth and biomass of R. communis and Cd accumulation, translocation and partitioning in different plant parts were investigated after 8 months of plant growth in Cd contaminated soil (17.50 mg Cd kg−1 soil). Eight months old plants stabilized 51 % Cd in its roots and rest of the metal was transferred to the stem and leaves. There were no significant differences in growth, biomass and yield between control and Cd treated plants, except fresh weight of shoots. The seed yield per plant was reduced only by 5 % of Cd contaminated plants than control. The amount of Cd translocated to the castor seeds was nominal i.e. 0.007 µg Cd g−1 seeds. The bioconcentration factor reduced significantly in shoots and seeds in comparison to roots. The data indicates that R. communis is highly tolerant to Cd contamination and can be used for remediation of heavy metal polluted sites.

  5. Local Perceptions about the Effects of Jatropha (Jatropha curcas and Castor (Ricinus communis Plantations on Households in Ghana and Ethiopia

    Directory of Open Access Journals (Sweden)

    Joleen A. Timko


    Full Text Available Biofuel plantations have been hyped as a means to reinvigorate Africa’s rural areas. Yet there is still apprehension about the negative environmental and social impacts of large-scale commercial biofuel production around rising food prices, land grabbing, ecological damage, and disruption of rural livelihoods. Given the extent of Jatropha curcas production in Ghana and Ethiopia and Castor bean (Ricinus communis in Ethiopia, this paper presents the results of a study that assessed the socio-economic implications of industrial Jatropha plantations on local livelihoods in Ghana, and of industrial Jatropha and Castor plantations on local livelihoods in Ethiopia. This study used primary data collected from 234 households in Ghana and 165 in Ethiopia. The cultivation of Jatropha and Castor has had several important effects on local livelihoods in the study sites, most notably decreases in household landholdings due to the arrival of industrial Jatropha or Castor plantations; and the resulting changes these plantations have caused in household socio-economic status, food security, fallow periods, and fodder availability. We consider how a lack of meaningful consultation between local people, their traditional authorities and the biofuel company managers, along with shortcomings in each country’s broader land acquisition process and poor land use information, may have contributed to these overall negative effects on local livelihoods. We conclude by suggesting several ways that emerging biofuel industries could be improved from the perspective of local people and their livelihoods.

  6. Castor (Ricinus communis L. and Pigweed (Amaranthus retroflexus L. Growth Indices in Terms of Interference

    Directory of Open Access Journals (Sweden)

    naser jafarzadeh


    Full Text Available Introduction Growth analysis has been widely used in breeding programs to identify the important plant developmental phases and components related to higher yield under a particular set of environmental conditions. Castor bean (Ricinus communis L. is an important commercial crop. Castor oil based by products is used in manufacturing of several commercially important commodities like surfactants, coatings, greases, pharmaceuticals, cosmetics, polyesters, polymers, etc. Interference (Interactive effects among species on inter-species populations is one of the main issues on the eco-physiology of plant populations where weeds impose negative effects by approaching the plant to compete in light, water and nutrient elements availability and results in reduced growth and yield (Shinggu et al., 2011. Growth indices are useful for interpreting plant reactions to the crop and weed density. Various reasons have been attributed for the low productivity among the most important is weed competition (Radosevich, 1987. The aim of the present experiment was evaluating the interference effects of redroot pigweed on growth indices of castor bean in northwest of Iran. Materials and methods This experiment was conducted in Urmia, Iran (Agricultural Research of West Azarbayjan, Saatlo Station (37°44´18״ N Latitude and 45° 10´ 53״ E Longitude, at 1338 m above sea level in 2012. The soil of the experimental field was sandy - loam, with pH of 7.2. Competitive pattern of experiment was in two-factor based on a randomized complete block design (RCBD with three replications arranged in four castor plant densities (3, 4, 5 and 6 plants.m-2 and four redroot pigweed densities (0, 5, 10 and 15 plants.m-2. Redroot pigweed and castor seeds were simultaneously directly planted on the 22th May in 2012. Redroot pigweed plants were weeded at the times related to the treatments level. Irrigation and intercultural operations were performed whenever necessary. Plots were 3m×5m

  7. Expression of Ricinus communis receptors on epithelial cells in oral carcinomas and oral wounds. (United States)

    Dabelsteen, E; Mackenzie, I C


    The histological distribution of receptors for Ricinus communis Fraction 1 (RCA1) in oral carcinomas and in oral epithelial cells during wound healing has been studied by use of fluorescein-tagged RCA1. Biopsies from 15 human oral carcinomas and adjacent normal mucosa showed RCA1 receptors at the cell membranes in the basal and spinous layer of the normal epithelium, whereas receptors could not be demonstrated in invading islands of the tumors. In healing oral wounds from eight humans and three monkeys, RCA1 receptors were demonstrated both in normal epithelium adjacent to the wounds and in the epithelial outgrowth from the wound margin. Titrations, however, showed that the epithelial outgrowth reacted more weakly than did the normal adjacent epithelium. These results support previous in vitro studies showing changes in carbohydrate composition of moving normal cells and of malignant cells, a finding that may be of interest in relation to formation of metastases.


    Directory of Open Access Journals (Sweden)

    Yolimar Fernández


    Full Text Available A batch reactor was constructed to obtain biodiesel from 5 liters of extracted from the seed of Ricinus communis. The reactor is made of stainless steel, 29cm length, 15.24 cm of inner diameter and a conical base of 20cm long, wall thickness of 0.2 cm, 1000 W tubular resistance and 110 volt motor. It is extracted and compared with the respective norms the physical and chemical properties of crude oil. Preliminary tests catalyzed transesterification of the oil with NaOH to verify the feasibility of the reaction and define the performed operational conditions. Obtained biodiesel was characterized and compared with references. The results showed that it is possible to obtain the biofuel in the batch reactor with a conversion 88%, confirming its application in transesterification reactions in a basic medium.

  9. Green synthesis of silver nanoparticles by Ricinus communis var. carmencita leaf extract and its antibacterial study (United States)

    Ojha, Sunita; Sett, Arghya; Bora, Utpal


    In this study, we report synthesis of silver nanoparticles (RcAgNPs) from silver nitrate solution using methanolic leaf extract of Ricinus communis var. carmencita. The polyphenols present in the leaves reduce Ag++ ions to Ag0 followed by a color change. Silver nanoparticle formation was ensured by surface plasmon resonance between 400 nm to 500 nm. Crystallinity of the synthesized nanoparticles was confirmed by UHRTEM, SAED and XRD analysis. The capping of phytochemicals and thermal stability of RcAgNPs were assessed by FTIR spectra and TGA analysis, respectively. It also showed antibacterial activity against both gram positive and gram negative strains. RcAgNPs were non-toxic against normal cell line (mouse fibroblast cell line L929) at lower concentrations (80 µg ml-1).

  10. Isotope labeling-based quantitative proteomics of developing seeds of castor oil seed (Ricinus communis L.)

    DEFF Research Database (Denmark)

    Nogueira, Fábio C S; Palmisano, Giuseppe; Schwämmle, Veit


    In this study, we used a mass spectrometry-based quantification approach employing isotopic (ICPL) and isobaric (iTRAQ) labeling to investigate the pattern of protein deposition during castor oil seed (Ricinus communis L.) development, including that of proteins involved in fatty acid metabolism...... give important insights into certain aspects of the biology of castor oil seed development such as carbon flow, anabolism, and catabolism of fatty acid and the pattern of deposition of SSPs, toxins, and allergens such as ricin and 2S albumins. We also found, for the first time, some genes of SSP...... could be mapped to extant castor gene models, considerably expanding the number of proteins so far identified from developing castor seeds. Cluster validation and statistical analysis resulted in 975 protein trend patterns and the relative abundance of 618 proteins. The results presented in this work...

  11. The phytoremediation potential of bioenergy crop Ricinus communis for DDTs and cadmium co-contaminated soil. (United States)

    Huang, Huagang; Yu, Ning; Wang, Lijun; Gupta, D K; He, Zhenli; Wang, Kai; Zhu, Zhiqiang; Yan, Xingchu; Li, Tingqiang; Yang, Xiao-e


    Cadmium (Cd) and dichlorodiphenyltrichloroethane (DDT) or its metabolite residues are frequently detected in agricultural soils and food, posing a threat to human health. The objective of this study was to compare the ability of 23 genotypes of Ricinus communis in mobilizing and uptake of Cd and DDTs (p,p'-DDT, o,p'-DDT, p,p'-DDD and p,p'-DDE) in the co-contaminated soil. The plant genotypes varied largely in the uptake and accumulation of DDTs and Cd, with mean concentrations of 0.37, 0.43 and 70.51 for DDTs, and 1.22, 2.27 and 37.63 mg kg(-1) dw for Cd in leaf, stem and root, respectively. The total uptake of DDTs and Cd varied from 83.1 to 267.8 and 66.0 to 155.1 μg per pot, respectively. These results indicate that R. communis has great potential for removing DDTs and Cd from contaminated soils attributed to its fast growth, high biomass, strong absorption and accumulation for both DDTs and Cd. Copyright © 2011 Elsevier Ltd. All rights reserved.

  12. [Inhibition by cysteine of the carbohydrate-binding activity of lectins from Ricinus communis, Canavalia ensiformis and Euonymus europaeus]. (United States)

    Dvorkin, V M


    Precipitation induced by different lectins has been studied in the presence of some aminoacids. It was shown that precipitates formed by lectins from Ricinus communis (RCA1), Canavalia ensiformis (Con A), Euonymus europaeus (Eel) in the presence of appropriate carbohydrate-containing molecules disappeared after cysteine addition, like after addition of specific carbohydrate precipitation inhibitors. It is assumed that cysteine residues of RCA1, Con A and Eel lectins are essential for their carbohydrate binding activity.

  13. Hasil Biji dan Kadar Minyak Jarak Kepyar Lokal Beaq Amor (Ricinus communis L. pada Berbagai Umur Pemangkasan Batang Utama

    Directory of Open Access Journals (Sweden)

    Bambang Budi Santoso


    Full Text Available ABSTRACTSuccessful castor (Ricinus communis L. cropping depends on the reliability of production technique. Branching is a useful agronomic trait because infloresence developed at each branch’s terminal. Pruning is considered as an important technique for branching stimulation. This study attempted to elucidate the effect of main stem pruning on the yield of Beaq Amor local variety of castor (Ricinus communis L. with short cultivation system. The experiment was conducted on dry land area of Amor-Amor, North Lombok, West Nusa Tenggara during February-July 2011 and was arranged in a single-factor randomized complete block design with three replications. The treatments were four types of pruning (i.e. no pruning, main stem pruning at 30 days after planting, 45 days after planting, and 60 days after planting. The results showed that the effect of pruning was significant on dry seed yield and was not significant on kernel oil content. Pruning at 30 days old and 45 days old plant yielded in the highest dry seed weight (374.9-387.8 g tree-1 or 943.0-974.3 kg ha-1 with oil content of 62.2%.Keywords: branching, canopy, dry seed, Ricinus communis L.

  14. Eficiencia del extracto de Ricinus communis para el control del mosquito Culex

    Directory of Open Access Journals (Sweden)

    Diego Tomás Corradine Mora


    Full Text Available Este artículo evaluó el efecto insecticida del extracto de Ricinus communis sobre larvas de mosquitos Culex. A las 24 h la mortalidad es de 8.33 % con dosis de 1 mL del extracto en una concentración de 500 ppm; 35 % en dosis de 1 mL de una concentración de 1000 ppm; 65 % en dosis de 5 mL de una concentración de 1000 ppm; 98.33 % con 10 mL en concentración de 1000 ppm; testigos 3.3 %. Cuando se evaluó el efecto insecticida del extracto aplicado por aspersión en concentraciones de 500, 750 y 1000 ppm, se consiguieron mortalidades de 18.33, 36.66 y 48.32 %, respectivamente. Ninguna de las concentraciones evaluadas alcanzó el cien por ciento de letalidad. En la prueba de semicampo, solo se logró una mortalidad de 9 %. Se evidenció que el extracto tiene un mejor efecto insecticida para el control de ejemplares inmaduros en estado larvario que sobre los adultos.

  15. Evaluation of experimental cleanser solution of Ricinus communis: effect on soft denture liner properties. (United States)

    Pisani, Marina Xavier; da Silva, Cláudia Helena Lovato; Paranhos, Helena Freitas Oliveira; Souza, Raphael Freitas; Macedo, Ana Paula


    This study evaluated colour stability, hardness and roughness of soft denture liners after immersion in various cleansers. Thirty specimens (14 mm × 4 mm) of Elite Soft Relining (ES) and Mucopren Soft (MS) were randomly immersed in distilled water at 37°C, sodium hypochlorite 1%, and an experimental Ricinus communis solution (RC) for 7, 15 and 183 continuous days. anova (p < 0.05) and Tukey's test indicated that after T7 (μ =8.79 ± 7.36); T15 (μ = 4.23 ± 2.62) and T183 (μ = 8.78 ± 3.16), MS presented a higher increase in hardness than ES. After T7, MS underwent an increase in roughness (μ = 0.09 ± 0.80); ES underwent a decrease (μ = -0.08 ± 0.16). RC caused the smallest variation in roughness. After T15, both materials presented an increase in roughness. After T183, ES (μ = -0.30 ± 0.48) presented a higher roughness variation than MS (μ = -0.07 ± 0.32). Hypochlorite caused an increase in roughness (μ = 0.02 ± 0.19). After all periods ES presented higher colour alteration than MS; highest colour alteration was caused by hypochlorite. Both materials were more stable after immersion in RC. © 2010 The Gerodontology Society and John Wiley & Sons A/S.

  16. Physicochemical characterization of seven Mexican Ricinus communis L. seeds and oil contents

    International Nuclear Information System (INIS)

    Perdomo, Felipe A.; Acosta-Osorio, Andrés A.; Herrera, G.; Vasco-Leal, José F.; Mosquera-Artamonov, José D.; Millan-Malo, Beatriz; Rodriguez-Garcia, Mario E.


    This paper presents a rigorous study and characterization of seven Mexican Ricinus communis L. seeds and its respective extracted oil. Several physical–chemical properties were measured in order to know moisture, total lipid content, fiber content, starch presence, morphology, acidity, free fatty acid profile, ricinoleic acid content, viscosity and crude oil density. Three different methodologies were implemented for the oil extraction in each variety (extraction with chemical solvents and mechanical compression heated and non-heated). The yield percentage of the oil extraction was evaluated as well as the extraction method influence over the oil's nature. -- Highlights: ► We characterized seven different Castor seeds and oils from semi deserted region. ► We evaluate the performance of three different methods to obtain Castor Oils. ► It was found that the density and fatty acid profile depend on the method of extraction. ► According to x-ray diffraction experiments no crystalline compounds were found in the defatted mass. ► The viscosity of the Castor Oils was strongly influence by the extractive method


    Directory of Open Access Journals (Sweden)

    Teresa Cabra Cendales


    Full Text Available El objetivo de este artículo fue aislar e identificar los microorganismos presentes en los residuos de fruto y  torta de higuerilla (Ricinus communis. Se utilizaron medios de cultivo selectivos para la caracterización morfológica y bioquímica y para la identificación molecular se usó la técnica de PCR con oligonucleótidos universales RM y RB del gen 16S para bacterias y secuencias intergénicas ITS1 e ITS4 para hongos y levaduras. Las secuencias fueron analizadas identificándose nueve especies de hongos, siendo Penicillium brevicompactum predominante; 12 especies de bacterias, donde el género más recurrente fue Bacillus sp. y dos especies de levaduras, Rhodosporidium paludigenum y Pichia burtonni. La identificación de la microbiota nativa presente en los residuos de higuerilla es muy promisoria, aportando un amplio conocimiento sobre la versatilidad metabólica de cada una de las cepas aisladas. El mayor número de aislamientos se obtuvieron de la torta probablemente debido al alto contenido de nutrientes presentes en este residuo.


    Directory of Open Access Journals (Sweden)

    Noor Fitri


    Full Text Available A capillary electrophoretic (CE analysis with ultra-violet (UV detection was performed for further separation of low-molecular-mass (LMM calcium species in phloem sap of Ricinus communis L. Two different background electrolytes (BGE were used for the separation; these are (1 hydrogen phosphate/dihydrogen phosphate buffer containing cetyltrimethylammonium bromide (CTAB as an electro-osmotic flow (EOF modifier, and (2 boric acid buffer containing CTAB. Various parameters affecting the analysis, including the composition and pH of the BGE were systematically studied. The sensitivity, resolution, baseline noise, migration time of the species peaks, and reproducibility of the method were evaluated under optimised condition. At least 13 UV-active species were optimally separated within about ten minutes. The optimised measurement condition was also achieved using 10 mM hydrogen phosphate/10 mM dihydrogen phosphate containing 0.5 mM CTAB at pH 8.0 as BGE, and by applying voltage of ‑20 kV and temperature of 14°C. Evidently, the analytical method was successfully used for the separation of LMM calcium species in phloem sap of R. communis L.   Keywords: capillary electrophoresis, calcium species, phloem sap, Ricinus communis

  19. Isolamento do alcalóide ricinina das folhas de Ricinus communis (Euphorbiaceae através de cromatografias em contracorrente Isolation of the alkaloid ricinine from the leaves of Ricinus communis (Euphorbiaceae through counter-current chromatography

    Directory of Open Access Journals (Sweden)

    Ana Cristina Leite


    Full Text Available Droplet counter-current chromatography, rotation locular counter-current chromatography and high-speed counter-current chromatography were applied to the preparative separation of the alkaloid ricinine from the dichloromethane extracts of Ricinus communis leaves. The solvent system used was composed of dichloromethane-methanol-water (93:35:72 v/v/v and all techniques led to the isolation of large amounts of the alkaloid. The best result was obtained through HSCCC, since the ricinine yield was respectively 50% and 30% higher than when using RLCCC or DCCC.

  20. Collection of castor-oil plant germoplasm (Ricinus communis L. in two municipalities of Arauca, Colombia

    Directory of Open Access Journals (Sweden)

    Carlos Iván Cardozo Conde


    Full Text Available Ricinus communis L., commonly known as the castor-oil plant, is important for its use in biofuels production. With the objective of learning about its current status, in 40 villages influential to the oil complex of Caricare (municipality of Arauquita and Caño Limón (municipality of Arauca in Arauca, Colombia (where five years earlier the crop had been established, a collection of sexual seed was carried out between December 2011 and January 2012. The variables studied include passport data as a collection resource, local name, relief, and soil type among others. A Garmin map76CSx was used in order to identify the transects and record data such as geographic location and elevation. Simple descriptive statistics were used to identify the variables of greatest variation. Using the qualitative variables of greatest importance, a contingency table analysis with a significance level of 5%, a multiple correspondence analysis (MCA and principal component analysis (PCA were performed for quantitative and qualitative variables, in addition to a classification analysis through a similarity matrix. The castor-oil plant was found in 25% of the villages visited. 12 introductions were collected, four from Caricare and eight from Caño Limón. Although the environmental conditions were favo­rable for its cultivation, there are no castor-oil plant crops in the locations visited. The absence of grain commercialization and oil extraction equipment is the main limiting factor. A garden was established using collected materials for the purpose of research, breeding and propagation.

  1. In Vitro Assessment of Cytotoxicity, Antioxidant, and Anti-Inflammatory Activities of Ricinus communis (Euphorbiaceae Leaf Extracts

    Directory of Open Access Journals (Sweden)

    Vhutshilo Nemudzivhadi


    Full Text Available Ricinus communis has been utilized traditionally as medicine to treat inflammatory related diseases including wounds, sores, and boils. The leaves of R. communis were sequentially extracted with n-hexane, dichloromethane, acetone, and methanol using serial exhaustive extraction method. Antioxidant activity of all crude extracts was quantitatively measured against 2,2′-azino-bis (3-ethylbenzothiazoline-6-sulphonic acid free radical molecules using ABTS+ assay. Cytotoxic effect and anti-inflammatory activity of R. communis leaves extracts were evaluated on Human Caucasian skin fibroblast and Raw 264.7 macrophage cell lines, respectively. Methanol extract had the highest percentage free radical (ABTS+ scavenging activity of 95% at 2.50 mg/mL, acetone 91%, dichloromethane 62%, and hexane the least (50%. Percentage scavenging activity of ABTS+ free radical molecules increases with increase in concentrations of the plant extracts. Hexane and dichloromethane extracts had more than 90% cell viability at 100 µg/mL after 24 and 48 hours of exposure. Methanol extract had LC50 of 784 µg/mL after 24-hour exposure, hexane had 629.3 µg/mL and dichloromethane 573.6 µg/mL, and 544.6 µg/mL was the lowest with acetone extract. The study present the first report on the scavenging activity of R. communis leaf extracts against ABTS+ radicals and cytotoxic effects on human Caucasian skin fibroblast cell lines.

  2. Repellent activity of Cnidoscolus phyllacanthus Mart. and Ricinus communis L. extracts against Aedes aegypti L. oviposition behavior

    Directory of Open Access Journals (Sweden)

    Lafayette Pereira Candido


    Full Text Available Female Aedes aegypti lay their eggs on nearly any moist substrate. Methods with potential to repel oviposition may reduce infestation, thereby contributing to control of epidemics. We evaluated the influence of Cnidoscolus phyllacanthus and Ricinus communis plant extracts on the oviposition behavior of A. aegypti. Lethal concentrations were first determined in experiments with larvae after 24 h of exposure, after which LC50 and LC90 were used to test oviposition repellency. The experiment consisted of an oviposition preference test based multiple-choice and no-choice assays. The Oviposition Activity Indices (OAIs from the multiple-choice test using both R. communis and C. phyllacanthus were negative, suggesting oviposition repellent and deterrent activity. The LC90 of both plant extracts deterred oviposition by this vector, as demonstrated by an OAI = value of -1. In the choice study, mean oviposition values were significantly different between R. communis and C. phyllacanthus. In the absence of choice, mosquitoes laid eggs independent of the substrate. In conclusion, our OAI values indicate that all substrates used repelled oviposition by A. aegypti.

  3. In vitro effect of Aloe vera, Coriandrum sativum and Ricinus communis fractions on Leishmania infantum and on murine monocytic cells. (United States)

    Rondon, Fernanda C M; Bevilaqua, Claudia M L; Accioly, Marina P; Morais, Selene M; Andrade-Junior, Heitor F; Machado, Lyeghyna K A; Cardoso, Roselaine P A; Almeida, Camila A; Queiroz-Junior, Eudson M; Rodrigues, Ana Caroline M


    In South America, visceral leishmaniasis is a zoonosis caused by the protozoan species Leishmania infantum (syn. L. chagasi) and is primarily transmitted through the bite of the female Lutzomyia longipalpis. Its main reservoir in urban areas is the dog. The application of control measures recommended by health agencies have not achieved significant results in reducing the incidence of human cases, and the lack of effective drugs to treat dogs resulted in the prohibition of this course of action in Brazil. Therefore, it is necessary to search new alternatives for the treatment of canine and human visceral leishmaniasis. The objectives of this study were to evaluate the in vitro effect of fractions from Aloe vera (aloe), Coriandrum sativum (coriander), and Ricinus communis (castor) on promastigotes and amastigotes of L. infantum and to analyze the toxicity against the murine monocytic cells RAW 264.7. To determine the viability of these substances on 50% parasites (IC50), we used a tetrazolium dye (MTT) colorimetric assay (bromide 3-4.5-dimethylthiazol-2-yl-2,5-dephenyltetrazolium), and on amastigotes we performed an in situ ELISA. All fractions were effective against L. infantum promastigotes and did not differ from the positive control pentamidine (p>0.05). However, the R. communis ethyl acetate and chloroform fractions, as well as the C. sativum methanol fraction, were the most effective against amastigotes and did not differ from the positive control amphotericin B (p>0.05). The R. communis ethyl acetate fraction was the least toxic, presenting 83.5% viability of RAW 264.7 cells, which was similar to the results obtained with amphotericin B (p>0.05). Based on these results, we intend to undertake in vivo studies with R. communis ethyl acetate fractions due the high effectiveness against amastigotes and promastigotes of L. infantum and the low cytotoxicity towards murine monocytic cells. Copyright © 2011 Elsevier B.V. All rights reserved.

  4. Family of Ricinus communis Monosaccharide Transporters and RcSTP1 in Promoting the Uptake of a Glucose-Fipronil Conjugate. (United States)

    Mao, Gen-Lin; Yan, Yin; Chen, Yan; Wang, Bing-Feng; Xu, Fei-Fei; Zhang, Zhi-Xiang; Lin, Fei; Xu, Han-Hong


    Enhancing the systemic distribution of a bioactive compound by exploiting the vascular transport system of a plant presents a means of reducing both the volume and frequency of pesticide/fungicide application. The foliar uptake of the glucose-fipronil conjugate N-[3-cyano-1-[2,6-dichloro-4-(trifluoromethyl)phenyl]-4-[(trifluoromethyl)sulfinyl]-1H-pyrazol-5-yl]-1-(β-d-glucopyranosyl)-1H-1,2,3-triazole-4-methanamine (GTF) achieved in castor bean (Ricinus communis) and its transport via the phloem are known to be mediated by monosaccharide transporter(s) [MST(s)], although neither the identity of the key MST(s) involved nor the mechanistic basis of its movement have yet to be described. On the basis of homology with Arabidopsis thaliana sugar transporters, the castor bean genome was concluded to harbor 53 genes encoding a sugar transporter, falling into the eight previously defined subfamilies INT, PMT, VGT, STP, ERD6, pGlucT, TMT, and SUT. Transcriptional profiling identified the product of RcSTP1 as a candidate for mediating GTF uptake, because this gene was induced by exposure of the plant to GTF. When RcSTP1 was transiently expressed in onion epidermis cells, the site of RcSTP1 deposition was shown to be the plasma membrane. A functional analysis based on RcSTP1 expression in Xenopus laevis oocytes demonstrated that its product has a high affinity for GTF. The long-distance root-to-shoot transport of GTF was enhanced in a transgenic soybean chimera constitutively expressing RcSTP1.


    Directory of Open Access Journals (Sweden)

    Brito Marilene de Farias


    Full Text Available As sementes trituradas de Ricinus communis, administradas em doses únicas por sonda intragástrica a coelhos causou graves sintomas de intoxicação com êxito letal nos três coelhos que receberam a dose de 2 g/kg e em um dos quatro que receberam 1 g/kg. Os outros três coelhos que receberam 1g/kg desenvolveram sintomas discretos a moderados e se recuperaram, e os três que receberam 0,5g/kg só mostraram sintomas discretos. O período entre a administração das sementes e a morte ou recuperação variou de 12h47min a 68h08min, e de 3 a 6 dias, respectivamente. Os primeiros sintomas após a administração das sementes, foram observados dentro de cerca 8 horas nos casos letais e nos animais que adoeceram moderadamente, e dentro de cerca 24 horas nos casos com sintomatogia discreta. A evolução da intoxicação variou de 4 a 56 horas nos casos letais e de 2 a 5 meio dias nos casos de recuperação. A sintomatologia consistiu principalmente de perturbações digestivas. Os animais apresentaram inapetência até anorexia. As fezes geralmente eram escassas, com forma e tamanho das síbalas alteradas, eram escuras, às vezes pastosas, com muco. Havia nítidas manifestações de cólica. Os achados de necropsia mais evidentes foram constatados no intestino delgado e ceco. O conteúdo destes segmentos do intestino era líquido. A parede do intestino delgado apresentou congestão e edema e havia fibrina recobrindo a mucosa sob forma de pseudomembranas, ou na luz intestinal sob forma de flocos e/ou filamentos. No ceco havia edema da mucosa como também congestão da parede e fibrina aderida à mucosa ou encontrada em flocos e/ou filamentos no conteúdo. As alterações histológicas mais importantes foram verificadas no intestino delgado e ceco. No intestino delgado observou-se necrose de coagulação associada a congestão/hemorragias na mucosa. Havia ainda congestão/hemorragias e edema na submucosa. Lesões semelhantes foram vistas no ceco onde

  6. Effect of temperature on biomass allocation in seedlings of two contrasting genotypes of the oilseed crop Ricinus communis. (United States)

    Ribeiro, Paulo R; Zanotti, Rafael F; Deflers, Carole; Fernandez, Luzimar G; Castro, Renato D de; Ligterink, Wilco; Hilhorst, Henk W M


    Ricinus communis is becoming an important crop for oil production, and studying the physiological and biochemical aspects of seedling development may aid in the improvement of crop quality and yield. The objective of this study was to assess the effect of temperature on biomass allocation in two R. communis genotypes. Biomass allocation was assessed by measuring dry weight of roots, stems, and cotyledons of seedlings grown at three different temperatures. Root length of each seedling was measured. Biomass allocation was strongly affected by temperature. Seedlings grown at 25°C and 35°C showed greater biomass than seedlings grown at 20°C. Cotyledon and stem dry weight increased for both genotypes with increasing temperature, whereas root biomass allocation showed a genotype-dependent behavior. Genotype MPA11 showed a continuous increase in root dry weight with increasing temperature, while genotype IAC80 was not able to sustain further root growth at higher temperatures. Based on metabolite and gene expression profiles, genotype MPA11 increases its level of osmoprotectant molecules and transcripts of genes encoding for antioxidant enzymes and heat shock proteins to a higher extent than genotype IAC80. This might be causal for the ability to maintain homeostasis and support root growth at elevated temperatures in genotype MPA11. Copyright © 2015 Elsevier GmbH. All rights reserved.

  7. Estudio Químico, Micrográfico y Morfológico del Ricinus communis L., y su Aplicación en Pulpa Blanqueable


    Teófilo Escoto García; José Guadalupe Rutiaga Quiñones; Rocío Orihuela Equihua; Antonio Rodríguez Rivas; José de Jesús Rivera Prado


    México posee una gran gama de especies vegetales no maderables o arbustivos, de los cuales se sabe muy poco, y para el caso del Ricinus communis L., existen trabajos sobre el uso de la semilla en biocombustibles y en la obtención de celulosa a partir del tallo. Con estos antecedentes se recolectó un espécimen de Ricinus communis , se descortezó y astilló para llevar a cabo los análisis de composición química, micrográfico y morfológico del tejido leñoso; aplicando además un proceso químico a ...

  8. Light and electron microscopic observations in connection with the developing pistil and seed-appendix (caruncle of Ricinus communis L.

    Directory of Open Access Journals (Sweden)

    Katherine Liszt


    Full Text Available The development of the particularly organized stigma and obturator, their fine structure, their function as well as the histological differentiation and the role of the seed-appendix i.e. the caruncle of Ricinus communis L. have been investigated in several developmental phases from the so called "gynoecial primordium" state to the ripe state, 'using the terminology introduced by S a t t 1 e r (1974. The stigma cells are characterized by dens cytoplasm, numerous vesicles mostly of ER origin, ribosomes and negatively stained mitochondria. Dilatation of ER, the appearance of electron opaque substances in it and between the plasmamembran and cell wall are frequent. The degenerating process of some stigma cells will start before the pollination because of autolysis. In the cells of the obturator and young caruncle however dictyosomes can be found more frequently than in stigma cells and the starch content of the ;plastids is remarkable. The thickening of the cell wall is connected with the function of these tissues.

  9. Efficacy of vegetable oils against dry bean beetles Acanthoscelides ...

    African Journals Online (AJOL)

    Acanthoscelides obtectus (Say) is a major pest of stored dry beans (Phaseolus vulgaris L.) and other legumes world wide. The objective of this study was to assess the efficacy of castor (Ricinus communis L.) and cottonseed (Gossypium hirsutum) oils against A. obtectus on stored dry beans under laboratory conditions.

  10. Screening of spontaneous castor bean accesses for genetic ...

    African Journals Online (AJOL)

    ... discriminant power between the castor bean accesses, being the multivariate analysis efficient in this process. The castor bean accesses ACS-001 CRSP and ACS-001-MASP are promising for introduction in genetic improvement programs of this culture. Keywords: Ricinus communis L., genotype, multivariate statistics, ...

  11. Screening of spontaneous castor bean accesses for genetic ...

    African Journals Online (AJOL)

    Tuoyo Aghomotsegin


    Oct 5, 2016 ... castor bean accesses, being the multivariate analysis efficient in this process. The castor bean accesses ACS-001-CRSP and ACS-001-MASP are promising for introduction in genetic improvement programs of this culture. Key words: Ricinus communis L., genotype, multivariate statistics, bioenergy.

  12. Accumulation, selection and covariation of amino acids in sieve tube sap of tansy (Tanacetum vulgare) and castor bean (Ricinus communis): evidence for the function of a basic amino acid transporter and the absence of a γ-amino butyric acid transporter. (United States)

    Bauer, Susanne N; Nowak, Heike; Keller, Frank; Kallarackal, Jose; Hajirezaei, Mohamad-Reza; Komor, Ewald


    Sieve tube sap was obtained from Tanacetum by aphid stylectomy and from Ricinus after apical bud decapitation. The amino acids in sieve tube sap were analyzed and compared with those from leaves. Arginine and lysine accumulated in the sieve tube sap of Tanacetum more than 10-fold compared to the leaf extracts and they were, together with asparagine and serine, preferably selected into the sieve tube sap, whereas glycine, methionine/tryptophan and γ-amino butyric acid were partially or completely excluded. The two basic amino acids also showed a close covariation in sieve tube sap. The acidic amino acids also grouped together, but antagonistic to the other amino acids. The accumulation ratios between sieve tube sap and leaf extracts were smaller in Ricinus than in Tanacetum. Arginine, histidine, lysine and glutamine were enriched and preferentially loaded into the phloem, together with isoleucine and valine. In contrast, glycine and methionine/tryptophan were partially and γ-amino butyric acid almost completely excluded from sieve tube sap. The covariation analysis grouped arginine together with several neutral amino acids. The acidic amino acids were loaded under competition with neutral amino acids. It is concluded from comparison with the substrate specificities of already characterized plant amino acid transporters, that an AtCAT1-like transporter functions in phloem loading of basic amino acids, whereas a transporter like AtGAT1 is absent in phloem. Although Tanacetum and Ricinus have different minor vein architecture, their phloem loading specificities for amino acids are relatively similar. © 2014 Scandinavian Plant Physiology Society.

  13. Caracterización morfológica y agroproductiva de procedencias de Ricinus communis L. para la producción de aceite Morphological and agroproductive characterization of Ricinus communis L. provenances for oil production

    Directory of Open Access Journals (Sweden)

    R Machado


    Full Text Available El objetivo de este trabajo fue caracterizar dos procedencias introducidas desde Suramérica (Planta-2 y Planta-3 y tres colectadas en Cuba (SSCS-5, Colón-1 y Las Tunas, de Ricinus communis L. Para ello se consideraron indicadores morfológicos y agroproductivos. Se utilizaron parcelas de 40 m² (área vital, con diez plantas. El diseño fue totalmente aleatorizado y los datos se analizaron a partir de estadígrafos descriptivos. Planta-2 alcanzó la mayor velocidad de crecimiento (2,98 cm/día y, a los 17 meses, fue superior en cuanto a: el grosor del tallo (17,5 cm; el número de ramas primarias (45, secundarias (41 y terciarias (20; y el grosor de las ramas primarias (5,9 cm. SSCS-5, Colón-1 y Las Tunas mostraron racimos más largos, con un mayor número de frutos; pero fueron superadas por Planta-3 y Planta-2 en el peso de los frutos por racimo (134,9 y 139,0 g, respectivamente, con frutos y semillas más grandes. Las lesiones producidas por insectos y el grado de infestación por microorganismos patógenos no fueron representativos. El mayor rendimiento de semilla (95,1 kg, el de frutos por planta (5,28 kg y por área (4 398 kg/ha y el estimado de aceite por unidad de área (1 130,2 kg/ha se detectaron en Planta-2. Se concluye que estas procedencias poseen características morfoproductivas que las diferencian, y mostraron particularidades relevantes para la producción de aceite, el cual se destina no solo a la producción de biodiesel, sino a múltiples usos a partir de sus derivados. Se recomienda profundizar en estudios sobre la fitotecnia de R. communis, de forma particular en Planta-2; así como introducir tipos medianos que faciliten su cosecha.The objective of this work was to characterize two provenances introduced from South America (Planta-2 and Planta-3 and three provenances collected in Cuba (SSCS-5, Colón-1 and Las Tunas, of Ricinus communis L. For such purpose, morphological and agroproductive indicators were considered

  14. Immunochemical studies on the N-acetyllactosamine beta-(1----6)-linked trisaccharide specificity of Ricinus communis agglutinin. (United States)

    Wu, A M; Sugii, S; Gruezo, F G; Kabat, E A


    The combining site of Ricinus communis agglutinin (RCA1) was studied by quantitative precipitin and precipitin inhibition assays. Of 31 complex carbohydrates tested, all except active and inactive antifreeze glycoproteins, Streptococcus group C polysaccharide, and native rat salivary glycoprotein, reacted strongly, and 22 completely precipitated the lectin, indicating that RCA1 has both a broad range of affinity and a low solubility of its carbohydrate-bound complex. Of the monosaccharides and glycosides tested for inhibition of precipitation, p-nitrophenyl beta-D-galactopyranoside was the best. It was about 6.4 times better than methyl beta-D-galactopyranoside. The beta anomer of glycosides of D-galactose was much more potent than the corresponding alpha anomer. Among the oligosaccharides tested, beta-D-Galp-(1----4)-beta-D-GlcpNAc-(1----6)-D-Gal was the best inhibitor, which was approximately 2/3 as active as p-nitrophenyl beta-D-galactopyranoside. It was approximately 1.4 times as active as beta-D-Gal-(1----4)-D-GlcNAc (N-acetyllactosamine), twice as active as beta-D-Gal-(1----3)-D-GlcNAc, and 4.5 times more active than lacto-N-tetraose. From the results, it can be concluded that; (a) hydrophobic interaction is important for binding; (b) the combining site of this lectin is at least as large as a trisaccharide; and (c) of the compounds studied, the trisaccharide beta-D-Galp-(1----4)-beta-D-GlcpNAc-(1----6)-D-Gal was the most complementary to the human blood group I Ma determinant beta-D-Galp-(1----4)-beta-D-GlcpNAc-(1----6)-D-Gal.

  15. Phloem sap proteins from Cucurbita maxima and Ricinus communis have the capacity to traffic cell to cell through plasmodesmata (United States)

    Balachandran, Suchandra; Xiang, Yu; Schobert, Christian; Thompson, Gary A.; Lucas, William J.


    In angiosperms, the functional enucleate sieve tube system of the phloem appears to be maintained by the surrounding companion cells. In this study, we tested the hypothesis that polypeptides present within the phloem sap traffic cell to cell from the companion cells, where they are synthesized, into the sieve tube via plasmodesmata. Coinjection of fluorescently labeled dextrans along with size-fractionated Cucurbita maxima phloem proteins, ranging in size from 10 to 200 kDa, as well as injection of individual fluorescently labeled phloem proteins, provided unambiguous evidence that these proteins have the capacity to interact with mesophyll plasmodesmata in cucurbit cotyledons to induce an increase in size exclusion limit and traffic cell to cell. Plasmodesmal size exclusion limit increased to greater than 20 kDa, but less than 40 kDa, irrespective of the size of the injected protein, indicating that partial protein unfolding may be a requirement for transport. A threshold concentration in the 20–100 nM range was required for cell-to-cell transport indicating that phloem proteins have a high affinity for the mesophyll plasmodesmal binding site(s). Parallel experiments with glutaredoxin and cystatin, phloem sap proteins from Ricinus communis, established that these proteins can also traffic through cucurbit mesophyll plasmodesmata. These results are discussed in terms of the requirements for regulated protein trafficking between companion cells and the sieve tube system. As the threshold value for plasmodesmal transport of phloem sap proteins falls within the same range as many plant hormones, the possibility is discussed that some of these proteins may act as long-distance signaling molecules. PMID:9391168

  16. Phloem sap proteins from Cucurbita maxima and Ricinus communis have the capacity to traffic cell to cell through plasmodesmata. (United States)

    Balachandran, S; Xiang, Y; Schobert, C; Thompson, G A; Lucas, W J


    In angiosperms, the functional enucleate sieve tube system of the phloem appears to be maintained by the surrounding companion cells. In this study, we tested the hypothesis that polypeptides present within the phloem sap traffic cell to cell from the companion cells, where they are synthesized, into the sieve tube via plasmodesmata. Coinjection of fluorescently labeled dextrans along with size-fractionated Cucurbita maxima phloem proteins, ranging in size from 10 to 200 kDa, as well as injection of individual fluorescently labeled phloem proteins, provided unambiguous evidence that these proteins have the capacity to interact with mesophyll plasmodesmata in cucurbit cotyledons to induce an increase in size exclusion limit and traffic cell to cell. Plasmodesmal size exclusion limit increased to greater than 20 kDa, but less than 40 kDa, irrespective of the size of the injected protein, indicating that partial protein unfolding may be a requirement for transport. A threshold concentration in the 20-100 nM range was required for cell-to-cell transport indicating that phloem proteins have a high affinity for the mesophyll plasmodesmal binding site(s). Parallel experiments with glutaredoxin and cystatin, phloem sap proteins from Ricinus communis, established that these proteins can also traffic through cucurbit mesophyll plasmodesmata. These results are discussed in terms of the requirements for regulated protein trafficking between companion cells and the sieve tube system. As the threshold value for plasmodesmal transport of phloem sap proteins falls within the same range as many plant hormones, the possibility is discussed that some of these proteins may act as long-distance signaling molecules.

  17. Alternatif Pembuatan Biodiesel Melalui Transesterifikasi Minyak Castor (Ricinus communis Menggunakan Katalis Campuran Cangkang Telur Ayam dan Kaolin

    Directory of Open Access Journals (Sweden)

    Soni - Setiadji


    Full Text Available Biodiesel was produced by transesterification of castor oil (Ricinus communis using a catalyst of CaO and kaolin (CaO / kaolin had been performed. CaO was obtained from the calcination of eggshell. Castor oil is selected as biodiesel feedstock because it belongs to non-food oil and easy to cultivate. In general, the research method aims to comprise the CaO / Kaolin catalysts with a ratio of 15 mmol CaO per 1 gram of kaolin activated using impregnation method and biodiesel produced through transesterification of castor oil using the catalyst at 65 ºC for 8 hours with ratio of castor oil: methanol: catalyst (1: 15: 5% w / w. The reaction is carried out on the reflux system. The XRD analysis show the presence of silica and potassium aluminum silicate hydroxide in the catalyst. The EDS results show the catalyst-forming components CaO and silica. The FTIR analysis results show the absorption peak in the functional group forming the methyl ester compound. Based on the characterization of GC-MS, the largest methyl ester components contained in biodiesel are methyl risinoleate, methyl elaidat, methyl stearate, methyl linoleate, and methyl palmitate. The overall conversion of castor oil to methyl ester using CaO / kaolin catalyst is 97.36%. The largest component in castor oil is risinoleic acid, has been successfully converted to methyl risinoleate by 74.75%.DOI:


    Directory of Open Access Journals (Sweden)



    Full Text Available Se ha comprobado que los fertilizantes y controladores biológicos a base de microorganismos benéficos productores de metabolitos de interés, inducen el crecimiento vegetal y actúan contra microorganismos patógenos y plagas que afectan los agroecosistemas. Por lo tanto, su uso constituye una práctica eficiente de producción limpia que ayuda a reducir el impacto ambiental causado por el uso de agroquímicos. En este trabajo se evaluó la capacidad antagónica y quitinolítica de 15 cepas bacterianas y una levaduriforme, aisladas de residuos lignocelulósicos de higuerilla (Ricinus communis. La actividad antagónica de cada cepa se determinó por la capacidad de inhibir el crecimiento del hongo fitopatógeno Fusarium equiseti, en medio de cultivo PDA. Solamente la bacteria Bacillus subtilis, presentó una inhibición significativa del crecimiento del hongo equivalente al 76,08%. Por lo tanto se demuestra que la cepa de Bacillus subtilis puede ser empleada en la formulación de inoculantes microbianos. La capacidad quitinolítica de las cepas se definió por el crecimiento del microorganismo y por la formación de halos de hidrólisis alrededor de las colonias sobre el medio de cultivo suplementado con quitina coloidal. Ninguna de las cepas evaluadas mostró capacidad para degradar quitina.

  19. Synthesis and characterization of dialkanolamides from castor oil (Ricinus communis) as nonionic surfactant (United States)

    Anwar, M.; Wahyuningsih, T. D.


    Nonionic surfactant of dialkanolamide derivates was synthesized and characterized from castor oil (Ricinus comunnis). Ricinoleic acid was isolated from castor oil by hydrolysis in alkaline (KOH) condition at 65 °C. Oxidation of ricinoleic acid by dilute potassium permanganate (KMnO4) in alkaline condition at 75-90 °C gave dicarboxylic acid which was then reacted with ethanolamine at 140-160 °C for 6 hours. The product was recrystallized with isopropanol, and the structure elucidation was performed by FTIR, 1HNMR spectrometer, and GC-MS with silylation method. Characterization of surfactants was carried out by surface tension measurement (capillary rise method), Critical Micelle Concentration (CMC) based on turbidity method and calculation of Hydrophilic-Lipophilic Balance (HLB) value with Griffin method and Bancroft rule. The result showed that ricinoleic acid in castor oil is 86.19 % and it is oxidation give an azelaic acid and octanedioic acid in 53.25 %. Amidation of a dicarboxylic acid and ethanolamine at 140-160 °C for 6 hours yielded of N1,N9-bis(2-hydroxyethyl)nona diamide in 49.35 %. Surfactant characterization indicates that dialkanolamide derivates can be used as a surfactant due to its ability to reduce the surface tension of ethanol with CMC at 1.2 g/L, HLB value is 5.58 and can be used as emulsifier water in oil (W/O).

  20. Cadmium tolerance and its phytoremediation by two oil yielding plants Ricinus communis (L.) and Brassica juncea (L.) from the contaminated soil. (United States)

    Bauddh, Kuldeep; Singh, Rana P


    The effect of increasing level of cadmium in soil was investigated on biomass production, antioxidants, Cd bioaccumulation and translocation in Ricinus communis vis-à-vis a commonly studied oil crop Brassica juncea. The plants were exposed to 25, 50, 75, 100, and 150 mg Cd/Kg soil for up to 60 days. It was found that R. communis produced higher biomass at all the contamination levels than that of B. juncea. Proline and malondialdehyde in the leaves increased with increase in Cd level in both the species, whereas soluble protein decreased. The bioaccumulation of Cd was higher in B. juncea on the basis of the per unit biomass, total metal accumulation per plant was higher in R. communis. The translocation of Cdfrom roots to shoot was also higher in B. juncea at all Cd concentrations. R. communis appeared more tolerant and capable to clean Cd contaminated soil for longer period in one sowing than B. juncea and the former can grow in wasteland soil also in which later cannot be cultivated.

  1. Acute Toxicity of Castor Oil Bean Extract and Tolerance Level of ...

    African Journals Online (AJOL)

    The experiment was carried out to determine the acute toxicity of raw castor oil bean (Ricinus communis) extract and the tolerance level of raw castor oil bean by broilers. The seeds were ground, defatted with petroleum ether and the residue was subjected to extraction with phosphate-buffered saline. The extract volume ...

  2. Growth and carbon assimilation limitations in Ricinus communis (Euphorbiaceae under soil water stress conditions Crescimento e limitações à assimilação de carbono em Ricinus communis (Euphorbiaceae sob condições de estresse hídrico do solo

    Directory of Open Access Journals (Sweden)

    Tanise Luisa Sausen


    Full Text Available Water availability may influence plant carbon gain and growth, with large impacts on plant yield. Ricinus communis (L., a drought resistant species, is a crop with increasing economic importance in Brazil, due to its use in chemical industry and for the production of biofuels. Some of the mechanisms involved in this drought resistance were analyzed in this study by imposing progressive water stress to pot-grown plants under glasshouse conditions. Water withholding for 53 days decreased soil water gravimetric content and the leaf water potential. Plant growth was negatively and significantly reduced by increasing soil water deficits. With irrigation suspension, carbon assimilation and transpiration were reduced and remained mostly constant throughout the day. Analysis of A/Ci curves showed increased stomatal limitation, indicating that limitation imposed by stomatal closure is the main factor responsible for photosynthesis reduction. Carboxylation efficiency and electron transport rate were not affected by water stress up to 15 days after withholding water. Drought resistance of castor bean seems to be related to a pronounced, early growth response, an efficient stomatal control and the capacity to keep high net CO2 fixation rates under water stress conditions.A disponibilidade hídrica pode influenciar o ganho de carbono e o crescimento, com grande impacto na produtividade das plantas. Ricinus communis (L., uma espécie resistente à seca, é uma cultura de grande importância econômica no Brasil, devido ao seu uso na indústria química e para a produção de biocombustíveis. Alguns dos mecanismos envolvidos na resistência à seca desta espécie foram analisados através de um progressivo estresse hídrico em plantas cultivadas em vasos sob condições de casa de vegetação. A suspensão da irrigação por 53 dias decresceu o conteúdo gravimétrico de água no solo e o potencial hídrico das folhas. O crescimento das plantas foi

  3. Growth, tolerance efficiency and phytoremediation potential of Ricinus communis (L.) and Brassica juncea (L.) in salinity and drought affected cadmium contaminated soil. (United States)

    Bauddh, Kuldeep; Singh, Rana P


    We have previously reported that Ricinus communis (castor) is more tolerant to soil cadmium (Cd) and more efficient for Cd phytoremediation than Brassica juncea (Indian mustard) (Bauddh and Singh, 2012). In the present study, R. communis was found more tolerant to salinity and drought in presence of Cd and removed more Cd in a given time than Indian mustard. R. communis produced 23 and twelve folds higher biomass in terms of fresh weight and dry weight, respectively than that in B. juncea during three months when grown in Cd contaminated soil in presence of 100mM NaCl salinity and ten day water withdrawal based drought at 90 day after sowing (DAS). Castor plants showed stronger self-protection ability in form of proline bioaccumulation (r(2)=0.949) than Indian mustard (r(2)=0.932), whereas a lower r(2) for malondialdehyde (MDA) and total soluble protein in R. communis (r(2)=0.914 and r(2)=0.915, respectively) than that of B. juncea (r(2)=0.947 and r(2)=0.927, respectively) indicated a greater damage to cell membrane in Indian mustard during the multiple stress conditions. Though, the amount of Cd accumulated in the roots and shoots of Indian mustard was higher as per unit biomass than that in castor, total removal of the metal from soil was much higher in castor on per plant basis in the same period in presence of the stresses. R. communis accumulated about seventeen and 1.5 fold higher Cd in their roots and shoots, respectively than that of B. juncea in 90 DAS under the multiple stresses. Salinity alone enhanced Cd uptake, whereas drought stress reduced its uptake in both the plants. Copyright © 2012 Elsevier Inc. All rights reserved.

  4. Control of papaya fruits anthracnose by essential oil of Ricinus communis

    Directory of Open Access Journals (Sweden)

    César Luis Siqueira Júnior


    Full Text Available The aim of this work was to investigate the potential of castor oil for the control of papaya diseases caused by the fungus Colletotrichum gloeosporioides and the bacterium Pseudomonas caricapapayae. The treatment with 1% castor oil did not significantly affect the fungal growth. The effectiveness of castor oil for the control of anthracnose was shown when 5% and 10% (v/v were used in the assays resulting in reduced mycelial growth. Fungal sporulation was strongly inhibited at 10% (v/v concentration of essential oil. The studies with the fresh fruits treated with 5% (v/v castor oil in aqueous emulsions resulted in effective reduction of pathogen spread in these fruits. No lesion was found in the fruits treated with oil, when compared to the control fruits. Castor oil showed no effect against the P. caricapapayae when tested in vitro. These results suggested the potential use of the castor bean essential oil and its fatty acids constituents for the control of anthracnose in papaya fruits.

  5. A sheep hydatid cyst glycoprotein as receptors for three toxic lectins, as well as Abrus precatorius and Ricinus communis agglutinins. (United States)

    Wu, A M; Song, S C; Wu, J H; Pfüller, U; Chow, L P; Lin, J Y


    The binding properties of a glycoprotein with blood group P1 specificity isolated from sheep hydatid cyst fluid with Gal and GalNAc specific lectins was investigated by quantitative precipitin and precipitin inhibition assays. The glycoprotein completely precipitated Ricinus communis agglutinin (RCA1), Abrus precatorius agglutinin (APA) and Mistletoe toxic lectin-I (ML-I). Only 1.0 microgram of P1 glycoprotein was required to precipitate 50% of 5.1 micrograms ML-I nitrogen. It also reacted well with abrin-a and ricin, precipitating over 73% of the lectin nitrogen added, but poorly or weakly with Dolichos biflorus (DBL), Vicia villosa (VVL, a mixture of A4, A2B2 and B4), VVL-B4, Arachis hypogaea (PNA), Maclura pomifera (MPL), Bauchinia purpurea alba (BPL) and Wistaria floribunda (WFL) lectins. When an inhibition assay in the range of 5.1 micrograms N to 5.9 micrograms N of lectins (ML-I, abrin-a; ricin, RCA1, and APA, and 10 micrograms P1 active glycoprotein interaction was performed; from 76 to 100% of the precipitations were inhibited by 0.44 and 0.52 mumol of Gal alpha 1-->4Gal and Gal beta 1-->4GlcNAc, respectively, but not or insignificantly with 1.72 mumol of GlcNAc. The Gal alpha 1-->4Gal disaccharide found in this P1 active glycoprotein is a frequently occurring sequence of many glycosphingolipids located at the surface of mammalian cell membranes, especially human erythrocytes and intestinal cells for ligand binding and microbial toxin attachment. The present finding suggests that the Gal alpha 1-->4Gal beta 1-->4GlcNAc sequence in this P1 active glycoprotein is one of the best glycoprotein receptors for three toxic lectins (ricin, abrin-a, and ML-I) as well as for APA, and RCA1, and the result of inhibition assay implies that these lectins are recognizing part or all of the Gal alpha 1-->4Gal beta 1-->4GlcNAc sequence in the P1 active glycoprotein.

  6. Antimicrobial activity of complete denture cleanser solutions based on sodium hypochlorite and Ricinus communis – a randomized clinical study

    Directory of Open Access Journals (Sweden)

    Marcela Moreira SALLES


    Full Text Available ABSTRACT To preserve oral health and to maintain the prosthetic devices, it is important not only to improve the properties of commonly known hygiene products, but also to investigate new materials with antimicrobial action. Objectives This study evaluated the antimicrobial activity of sodium hypochlorite (0.25% and 0.50% and 10% Ricinus communis’ solutions against specific microorganisms. Material and Methods Sixty four maxillary complete denture wearers were instructed to brush their dentures three times a day and to soak them (20 min/day in the solutions: SH1: 0.25% sodium hypochlorite; SH2: 0.5% sodium hypochlorite; RC: 10% R. communis oil; and C: 0.85% saline (control. The solutions were used for 7 days in a randomized sequence. Following each period of use, there was a 1-week washout period. Antimicrobial activity was determined by Colony Forming Units (CFU counts of Streptococcus mutans, Candida spp., and gram-negative microorganisms. For collecting biofilm, the internal surface of maxillary dentures was brushed with saline solution, and biofilm suspension obtained. After dilutions (100 - 10-3, aliquots were seeded in Mitis salivarius, CHROMagar Candida®, and MacConkey agar for detecting S. mutans, Candida spp., or gram-negative microorganisms, respectively. After incubation, colonies were counted, and CFU/mL values were calculated. Then, transformation - log10 (CFU+1 - data were analyzed using the Friedman test (α=0.05. Results showed significant differences between the solutions (p<0.001. Results All three solutions showed antimicrobial activity against S. mutans. Against Candida spp., RC and SH1 solutions showed similar effect while SH2 showed superior activity. SH1 and SH2 solutions showed antimicrobial action against gram-negative microorganisms. The Candida species most frequently isolated was C. albicans, followed by C. tropicalis and C. glabrata. Conclusions The 0.5% sodium hypochlorite solution was the most effective and


    Directory of Open Access Journals (Sweden)

    Anita Lima


    Full Text Available Os estudos de novas formas para o tratamento de efluentes domésticos e industriais vêm aumentando gradativamente no Brasil, neste contexto destacam-se as correntes que defendem a atenuação natural e a biorremediação. Por essas razões, em anos recentes, passou-se a dar preferência a métodos in situ, os quais são mais econômicos e perturbam menos o ambiente. Uma técnica de remediação natural é a fitorremediação que, aplica-se à utilização de vegetação (árvores, arbustos, plantas rasteiras e aquáticas e de sua microbiota com o fim de remover, degradar ou isolar substâncias tóxicas ao ambiente. O presente trabalho teve como objetivo testar o capacidade de fitorremediação da mamona (Ricinus Communis L. na redução das concentrações de chumbo presente em efluente sintético, cujas características simulam aquelas encontradas em um dos principais efluentes da indústria de exploração do petróleo, a água de produção tratada. O delineamento experimental utilizado no estudo foi o de blocos inteiramente casualizado com a variação das concentrações de chumbo distribuídas em quatro tratamentos: 0 µg/L (T1, 250 µg/L (T2, 500 µg/L (T3, 1000 µg/L (T4. Na análise dos dados foi aplicado o teste estatístico ANOVA para a comparação das médias nos tratamentos. A avaliação realizada nas concentrações de chumbo no lixiviado indicou que ocorreram remoções máximas de 67,42%, 87,34% e 94,74% para os tratamentos T2, T3 e T4, respectivamente. A retenção do chumbo nos tecidos (sistema radicular, caule e folhas da mamona indicou que a planta apresentou boa capacidade de bioacumular o chumbo. PALAVRAS-CHAVE: Fitorremediação, Chumbo, Mamona.

  8. Jatropha curcas and Ricinus communis differentially affect arbuscular mycorrhizal fungi diversity in soil when cultivated for biofuel production in a Guantanamo (Cuba) tropical system. (United States)

    Alguacil, M. M.; Torrecillas, E.; Hernández, G.; Torres, P.; Roldán, A.


    The arbuscular mycorrhizal fungi (AMF) are a key, integral component of the stability, sustainability and functioning of ecosystems. In this study, we characterised the AMF biodiversity in a control soil and in a soil cultivated with Jatropha curcas or Ricinus communis, in a tropical system in Guantanamo (Cuba), in order to verify if a change of land use to biofuel plant production had any effect on the AMF communities. We also asses whether some soil properties related with the soil fertility (total N, Organic C, microbial biomass C, aggregate stability percentage, pH and electrical conductivity) were changed with the cultivation of both crop species. The AM fungal small sub-unit (SSU) rRNA genes were subjected to PCR, cloning, sequencing and phylogenetic analyses. Twenty AM fungal sequence types were identified: 19 belong to the Glomeraceae and one to the Paraglomeraceae. Two AMF sequence types related to cultured AMF species (Glo G3 for Glomus sinuosum and Glo G6 for Glomus intraradices-G. fasciculatum-G. irregulare) disappeared in the soil cultivated with J. curcas and R. communis. The soil properties (total N, Organic C and microbial biomass C) were improved by the cultivation of the two plant species. The diversity of the AMF community decreased in the soil of both crops, with respect to the control soil, and varied significantly depending on the crop species planted. Thus, R. communis soil showed higher AMF diversity than J. curcas soil. In conclusion, R. communis could be more suitable in long-term conservation and sustainable management of these tropical ecosystems.

  9. Ricinus communis biocompatibility histological study in the nose of Cebus apella monkeys Avaliação histológica da biocompatibilidade do polímero da mamona no dorso nasal de macacos-pregos (Cebus apella

    Directory of Open Access Journals (Sweden)

    Paulo Cesar de Jesus Dias


    Full Text Available Bone tissue lesions can be caused by congenital and acquired factors, and result in nasal deformities with cosmetic and functional repercussion. Surgical treatment in these cases frequently requires complex reconstructions and the use of biomaterials. The polyurethane derived from castor beans (Ricinus communis has a favorable formulation in terms of ease of processing, flexibility, no emission of toxic vapors and low cost. Nonetheless, despite favorable results, studies about the use of castor beam polymer (Ricinus communis assessing tissue reaction on the nasal dorsum are still missing in the literature. AIM: the goal of the present investigation is to histologically assess the Ricinus communis polymer implant biocompatibility with the nasal dorsum. STUDY DESING: experimental. MATERIALS AND METHODS: we used four Cebus appela monkeys, in which we created a nasal dorsal defect in all the animals and there we placed the aforementioned implant. The animals were sacrificed 270 days after surgery and the samples were submitted to histological study. RESULTS: in the histology analysis we did not observe the presence of foreign body granulomas or phagocytic cells. We also observed a progressive bone formation and maturation. CONCLUSION: macroscopic and microscopic results showed that the castor oil polymer implant was biocompatible.Lesões do tecido ósseo podem ser causadas por fatores congênitos e adquiridos e resultar em deformidade nasal com repercussão estética e funcional. O tratamento cirúrgico desses casos requer reconstruções complexas e frequentemente o uso de biomateriais. O poliuretano derivado do óleo da mamona apresenta uma fórmula com aspectos favoráveis de processabilidade, flexibilidade de formulação, ausência de emissão de vapores tóxicos e baixo custo. Entretanto, a despeito dos resultados favoráveis, estudos referentes ao uso do polímero de mamona, avaliando a reação tecidual no dorso nasal, ainda não foram

  10. Poliuretana de mamona (Ricinus communis para desvio da crista tibial no cão Polyurethane resins derived from castor oil (Ricinus communis for tibial crest deviation in dogs

    Directory of Open Access Journals (Sweden)

    Patricia Popak Maria


    Full Text Available A luxação medial de patela é uma das principais afecções ortopédicas que afetam cães de raças de pequeno porte. Tendo como princípio que o desvio da crista tibial é uma das alterações anatômicas encontradas, este estudo objetivou avaliar o efeito da poliuretana de mamona (Ricinus communis aplicada em defeitos produzidos experimentalmente na porção proximal medial da tíbia de cães normais em fase de crescimento. Para isto, foram utilizados 12 cães subdivididos aleatoriamente em 3 grupos de igual número, com mesmo tratamento, mas com análise histopatológica aos 30 (GI, 60 (GII e 90 (GIII dias. O estudo constou de avaliações clínica, radiográfica, macroscópica, histopatológica, tomográfica e análise estatística. Avaliação clínica demonstrou não haver rejeição do implante. A análise radiográfica revelou intensa reação periosteal e neoformações ósseas no local da implantação. Macroscopicamente observou-se espessamento da crista tibial, neoformações ósseas e desvio lateral da crista. Os achados à microscopia óptica revelaram presença de tecido conjuntivo fibroso ao redor da poliuretana, ausência de proliferação óssea em direção ao implante e proliferação de periósteo na face medial das tíbias. A tomografia computadorizada revelou desvio lateral da crista em 11 animais e estes desvios foram estatisticamente significantes em nível de 5% por meio do teste t pareado.Medial patellar luxation is one of the most common orthopedic problems in small breeds of dogs and tibial crest deviation is a frequent accompaining anatomical abnormality. For that reason, the purpose of this study was to evaluate the behavior of castor oil derived polyurethane implants when apllied to experimental defects created on the medial side of the proximal tibia of normal puppies. Twelve dogs were randomly divided in 3 groups of 4 animals and were submitted to the same treatment. Histopathological study was performed

  11. Synthesis of amides and sulfonamides of {beta}-D- galactopyranosylamine and {beta}-lactosylamine and evaluation of their interactions with the lectins from Erythrina cristagalli and Ricinus communis; Sintese de amidas e sulfonamidas de {beta}-D-galactopiranosilamina e {beta}-lactosilamina e avaliacao de suas interacoes com lectinas de Erythrina cristagalli e de Ricinus communis

    Energy Technology Data Exchange (ETDEWEB)

    Butera, Anna Paola; Souza Filho, Jose Dias de [Universidade Federal de Minas Gerais, Belo Horizonte, MG (Brazil). Dept. de Quimica; Carvalho, Diogo Teixeira; Figueiredo, Rute Cunha; Faria, Luiz Carlos Alves de; Nunes, Maria Angelica; Prado, Maria Auxiliadora Fontes; Alves, Ricardo Jose [Universidade Federal de Minas Gerais (UFMG), Belo Horizonte, MG (Brazil). Faculdade de Farmacia. Dept. de Produtos Farmaceuticos]. E-mail:; Andrade, Milton Hercules Guerra de; Silva, Karina Taciana Santos [Universidade Federal de Ouro Preto (UFOP), MG (Brazil). Inst. de Ciencias Exatas e Biologicas. Dept. de Ciencias Biologicas


    We report herein the synthesis of some {beta}-D-galactopyranosylamine and {beta}-lactosylamine amides and sulfonamides. The interactions of these compounds with lectins from the seeds of Erythrina cristagalli (LEC) and Ricinus communis (RCA120) were evaluated in a hemagglutination inhibitory activity assay. D-Galactose and lactose were used as reference compounds. The {beta}-lactosylamine amides and sulfonamides were nearly as active as lactose in inhibiting LEC mediated hemagglutination and were less active against RCA120 agglutinin. The {beta}-D-galactopyranosylamine amides and sulfonamides were, with one exception, considerably less active than D-galactose in the assay with both lectins. (author)

  12. Carboxypeptidase of Castor Bean Endosperm during Germination


    山本, 知子; 下田, 忠久; 船津, 軍喜; Yamamoto, Tomoko; Shimoda, Tadahisa; Funatsu, Gunki


    Carboxypeptidase (CPase) in the endosperm of castor bean (Ricinus communis L.) showed high activity at day 4 and 7 on germination. From the behavior of CPases on CM-cellulose column chromatography, the early stage CPases, which appeared before 4 day germination, were different from the later stage CPases which appeared after 6 day. Probably the former arised from ungerminated seeds and the latter was synthesized during the germination. The early stage endosperm of small grain castor bean cont...

  13. Optimization of Preparation of Activated Carbon from Ricinus communis Leaves by Microwave-Assisted Zinc Chloride Chemical Activation: Competitive Adsorption of Ni2+ Ions from Aqueous Solution

    Directory of Open Access Journals (Sweden)

    M. Makeswari


    Full Text Available The preparation of activated carbon (AC from Ricinus communis leaves was investigated in this paper. Orthogonal array experimental design method was used to optimize the preparation of AC using microwave assisted zinc chloride. Optimized parameters were radiation power of 100 W, radiation time of 8 min, concentration of zinc chloride of 30% by volume, and impregnation time of 24 h, respectively. The surface characteristics of the AC prepared under optimized conditions were examined by pHZPC, SEM-EDAX, XRD, and FTIR. Competitive adsorption of Ni2+ ions on Ricinus communis leaves by microwave assisted zinc chloride chemical activation (ZLRC present in binary and ternary mixture was compared with the single metal solution. The effects of the presence of one metal ion on the adsorption of the other metal ion were investigated. The experimental results indicated that the uptake capacity of one metal ion was reduced by the presence of the other metal ion. The extent of adsorption capacity of the binary and ternary metal ions tested on ZLRC was low (48–69% as compared to single metal ions. Comparisons with the biosorption of Ni2+ ions by the biomass of ZLRC in the binary (48.98–68.41%-~Ni-Cu and 69.76–66.29%-~Ni-Cr and ternary solution (67.32–57.07%-~Ni–Cu and Cr could lead to the conclusion that biosorption of Ni2+ ions was reduced by the influence of Cu2+ and Cr3+ ions. The equilibrium data of the adsorption was well fitted to the Langmuir isotherm. The adsorption process follows the pseudo-second-order kinetic model.

  14. Allelopathic effect of aqueous extract of fresh leaf castor beans ...

    African Journals Online (AJOL)

    Allelopathy defines the production of specific biomolecules (allelochemical) by a plant that can induce positive or negative impacts on another culture. The crop of castor beans (Ricinus communis L.) is being economically valued and receiving attention, mainly by the biodiesel production, castor oil and animal feeding.

  15. Allelopathic effect of aqueous extract of fresh leaf castor beans ...

    African Journals Online (AJOL)

    Rukevwe S. Abraka


    Dec 7, 2016 ... Allelopathy defines the production of specific biomolecules (allelochemical) by a plant that can induce positive or negative impacts on another culture. The crop of castor beans (Ricinus communis L.) is being economically valued and receiving attention, mainly by the biodiesel production, castor oil and.

  16. Proteomic profile of the nucellus of castor bean (Ricinus communis L.) seeds during development

    DEFF Research Database (Denmark)

    Nogueira, Fábio C S; Palmisano, Giuseppe; Soares, Emanoella L


    groups. The distribution of the identified proteins in stages III and IV into different Gene Ontology categories was similar, with a remarkable abundance of proteins associated with the protein synthesis machinery of cells, as well as several classes of proteins involved in protein degradation......, particularly of peptidases associated with programmed cell death. Consistent with the role of the nucellus in mediating nutrient transfer from maternal tissues to the endosperm and embryo, a significant proportion of the identified proteins are related to amino acid metabolism, but none of the identified...... proteins are known to have a role as storage proteins. Moreover for the first time, ricin isoforms were identified in tissues other than seed endosperm. Results are discussed in the context of the spatial and temporal distribution of the identified proteins within the nucellar cell layers....

  17. A case of massive infestation of a male green lizard Lacerta viridis/bilineata by castor bean tick Ixodes ricinus (Linnaeus, 1758):


    Carretero, Miguel A.; Gomes, Veronika; Žagar, Anamarija


    Infestation by ticks affects several vertebrate groups, including reptiles. Castor bean tick Ixodes ricinus is the most widespread tick species. Here we report an impressive tick infestation of a male green lizard Lacerta viridis/bilineata found in 2012 in the vicinity of Bilpa cave in the Kolpa valley, Slovenia. Lizards as tick hosts can play an important role in the life cycle of I. ricinus and may also be potential vectors of Lyme disease. Zaprarazitiranost s klopi je pogost pojav pri v...

  18. Toxic and repellent activity of selected monoterpenoids (thymol, carvacrol and linalool) against the castor bean tick, Ixodes ricinus (Acari: Ixodidae). (United States)

    Tabari, Mohaddeseh Abouhosseini; Youssefi, Mohammad Reza; Maggi, Filippo; Benelli, Giovanni


    The castor bean tick, Ixodes ricinus, is a species of medical and veterinary importance. The use of synthetic acaricides for tick control has led to development of resistance, residues in the environment and animal products, and public health concerns. In this regard, plant essential oils and their main constituents represent an appealing alternative strategy to combat ticks. The phenols thymol and carvacrol and the alcohol linalool are monoterpenoids occurring in essential oils of several aromatic and medicinal plants, such as thyme, oregano, savory, lavender and coriander. Recent studies have shown toxicity of these monoterpenoids against selected mosquito vectors and other arthropod pests. However, information on their bioactivity on I. ricinus is not available. On this basis, here we evaluated the ovicidal, larvicidal and repellency effects of these compounds against I. ricinus. Concentrations of 0.25, 0.5, 1, 2 and 5% were sprayed on the egg masses, then hatching rates were noted. Larvicidal assays were conducted on unengorged larvae, following the larval packet technique. The repellency was determined by measuring the vertical migration behavior of ticks in laboratory conditions. Carvacrol and thymol at all concentrations tested led to a significant hatching decrease, showing an efficacy higher than permethrin, whereas linalool did not cause any significant effect. In the larvae treated with carvacrol and thymol (1, 2 and 5%), mortality rates reached 100% after 24h, showing a larvicidal efficacy higher than permethrin, whereas no effect was seen in the larval groups treated with linalool. Carvacrol and thymol at all concentrations tested showed >90% repellency on I. ricinus. Linalool was scarcely effective (50.24% repellency) only at the concentration of 5%. Overall, based on these results, the phenols carvacrol and thymol can be considered as candidate ingredients for the development of novel acaricidal formulations to control the populations of I. ricinus

  19. Effects of graded levels of dehulled and cooked caster oil bean ...

    African Journals Online (AJOL)

    Anak strain) were used in an experiment to investigate the effects of dehulled and cooked castor oil bean (Ricinus communis L) meal supplemented with L-lysine on growth performance and certain blood parameters of broiler finishers. The birds ...

  20. Effect of the extract of Ricinus communis L. on the osmotic fragility, labeling of red blood cells with Technetium-99m and morphology of the cells

    Directory of Open Access Journals (Sweden)

    Kristiana Cerqueira Mousinho


    Full Text Available The aim of this study was to evaluate the influence of the proteic extract of R. communis on the cell physiology by the osmotic fragility, labeling of the blood elements with the 99mTc and cell morphology. To evaluate the osmotic fragility, the blood samples of the Wistar rats were incubated with the concentrations of R. communis and with the solutions of NaCl (0.4; 0.7; 0.9%. In the labeling of the blood elements procedure, the rat blood was treated with a solution of Tc-99m and TCA at 5%, determining the rate of radioactivity (%ATI in the plasma (P and in the red blood cells (RBC. The soluble and insoluble fractions of the plasma were also evaluated. The cells morphology submitted to the extract was evaluated by the optical microscopy (x40. The results indicated that the rate of the hemolysis increased in the presence of 0.125 mg/mL of the extract. There was a decay of 49.69% in the rate of ATI in the insoluble fraction of the cells, with the morphological alterations in the red blood cells. These results suggested that the extract changed the capability of binding of the red blood cells due to the stannous ion oxidation, modifying the cells structure.Produtos naturais são usados freqüentemente por muitas pessoas no tratamento do câncer. O Ricinus communis L é uma Euforbiaceae que apresenta propriedades laxativas, purgativas e antitumorais. O objetivo deste trabalho é estudar a influência da fração protéica do extrato hidroalcoólico de R. communis L. na fisiologia celular através da fragilidade osmótica, da marcação de elementos sanguíneo com 99mTc e da morfologia celular. Para avaliar a fragilidade osmótica, amostras de sangue de ratos Wistar foram incubadas com concentrações de R. communis e com soluções de NaCl (0,4; 0,7; 0,9%. No procedimento de marcação de elementos sanguíneos, as amostras de sangue foram tratadas com solução de Tc-99m e TCA à 5%, determinando o percentual de radioatividade (%ATI no plasma (P e


    Directory of Open Access Journals (Sweden)

    Yolimar Fernández


    Full Text Available Se construyó un reactor discontinuo para obtener biodiesel a partir de 5 litros de extracto obtenido de la semilla de Ricinus communis. El reactor es de acero inoxidable, con longitud de 29 cm; diámetro interno de 15,24 cm y fondo cónico de 20cm de largo, espesor de la pared de 0,2cm, resistencia tubular de 1000 W y motor de 110 volt. Se extrajo y se comparó con las normas respectivas las propiedades físicas y químicas del aceite crudo. Se realizaron pruebas preliminares de transesterificación del aceite catalizadas con NaOH para constatar la viabilidad de la reacción y definir las condiciones operacionales. El biodiesel obtenido fue caracterizado y comparado con referencias presentes en la literatura. Los resultaron mostraron que es posible obtener el biocombustible en el reactor discontinuo con un grado de conversión 88%; confirmando su aplicación en reacciones de transesterificación en medio básico.

  2. Acyl-ACP thioesterases from castor (Ricinus communis L.): an enzymatic system appropriate for high rates of oil synthesis and accumulation. (United States)

    Sánchez-García, Alicia; Moreno-Pérez, Antonio J; Muro-Pastor, Alicia M; Salas, Joaquín J; Garcés, Rafael; Martínez-Force, Enrique


    Acyl-acyl carrier protein (ACP) thioesterases are enzymes that terminate the intraplastidial fatty acid synthesis in plants by hydrolyzing the acyl-ACP intermediates and releasing free fatty acids to be incorporated into glycerolipids. These enzymes are classified in two families, FatA and FatB, which differ in amino acid sequence and substrate specificity. In the present work, both FatA and FatB thioesterases were cloned, sequenced and characterized from castor (Ricinus communis) seeds, a crop of high interest in oleochemistry. Single copies of FatA and FatB were found in castor resulting to be closely related with those of Jatropha curcas. The corresponding mature proteins were heterologously expressed in Escherichia coli for biochemical characterization after purification, resulting in high catalytic efficiency of RcFatA on oleoyl-ACP and palmitoleoyl-ACP and high efficiencies of RcFatB for oleoyl-ACP and palmitoyl-ACP. The expression profile of these genes displayed the highest levels in expanding tissues that typically are very active in lipid biosynthesis such as developing seed endosperm and young expanding leaves. The contribution of these two enzymes to the synthesis of castor oil is discussed. Copyright 2010 Elsevier Ltd. All rights reserved.

  3. Rendimento e Características Físicas dos Óleos de Nim (Azadirachta indica e Mamona (Ricinus communis

    Directory of Open Access Journals (Sweden)

    Juarez Benigno Paes

    Full Text Available A pesquisa objetivou avaliar o rendimento e a viscosidade de óleos de nim (Azadirachta indica e mamona (Ricinus communis. Os frutos de nim foram coletados no Núcleo de Pesquisa do Semiárido, em Patos, Paraíba, e os de mamona, às margens do Rio Espinharas, Patos e em Igaracy, Paraíba. Os frutos foram beneficiados no Laboratório de Tecnologia de Produtos Florestais, em Patos. Foram retiradas amostras de sementes para a determinação do teor de umidade e do rendimento em óleos. Os óleos foram extraídos com álcool etílico absoluto e empregados no preparo de soluções com os óleos de nim e mamona. Determinaram-se a densidade e a viscosidade das soluções. A mamona teve menor teor de umidade e rendimento em óleo que o nim. A densidade e a viscosidade do óleo de nim foram menores que o da mamona. Uma maior quantidade de óleos de mamona proporcionou aumento na densidade e na viscosidade das soluções preparadas.

  4. Molybdenum (Mo) increases endogenous phenolics, proline and photosynthetic pigments and the phytoremediation potential of the industrially important plant Ricinus communis L. for removal of cadmium from contaminated soil. (United States)

    Hadi, Fazal; Ali, Nasir; Fuller, Michael Paul


    Cadmium (Cd) in agricultural soil negatively affects crops yield and compromises food safety. Remediation of polluted soil is necessary for the re-establishment of sustainable agriculture and to prevent hazards to human health and environmental pollution. Phytoremediation is a promising technology for decontamination of polluted soil. The present study investigated the effect of molybdenum (Mo) (0.5, 1.0 and 2.0 ppm) on endogenous production of total phenolics and free proline, plant biomass and photosynthetic pigments in Ricinus communis plants grown in Cd (25, 50 and 100 ppm) contaminated soils and the potential for Cd phytoextraction. Mo was applied via seed soaking, soil addition and foliar spray. Foliar sprays significantly increased plant biomass, Cd accumulation and bioconcentration. Phenolic concentrations showed significantly positive correlations with Cd accumulation in roots (R 2  = 0.793, 0.807 and 0.739) and leaves (R 2  = 0.707, 721 and 0.866). Similarly, proline was significantly positively correlated with Cd accumulation in roots (R 2  = 0.668, 0.694 and 0.673) and leaves (R 2  = 0.831, 0.964 and 0.930). Foliar application was found to be the most effective way to deliver Mo in terms of increase in plant growth, Cd accumulation and production of phenolics and proline.

  5. Tableros de partículas de bambú (Bambusa vulgaris Schrad y resina poliuretana a base de aceite de rícino (Ricinus communis L.

    Directory of Open Access Journals (Sweden)

    Flávio Januário José

    Full Text Available Esta investigación tiene como objetivo la elaboración y la evaluación de tableros de partículas homogéneas aglomeradas, utilizándose dos materiales alternativos en la búsqueda de la sustentabilidad del proceso productivo. Fueron utilizadas partículas de Bambusa vulgaris Schrad por la rapidez del ciclo de producción de esta especie de bambú. Como pegante fue utilizada la resina poliuretana a base de aceite de ricino (Ricinus communis L., por su origen parcialmente renovable, y por ser considerada no tóxica. Para la caracterización del material, fueron fabricadas, en escala de laboratorio, tableros de partículas de bambú con dimensiones inferiores al 2.4 mm, combinadas con 5%, 10% y 15% de resina en relación a la masa de partículas de bambú. Probetas fueron evaluadas de acuerdo con las especificaciones de la norma NBR 14810 - Tableros de madera aglomerada. Antes de los ensayos de compresión las probetas fueron evaluadas por medio del ensayo no destructivo por ultra-sonido. Los resultados obtenidos indicaron que los tableros con el contenido de 10% de resina no fue estadísticamente diferente al contenido de 15%, siendo ambos superiores al contenido de 5%. La mayoría de las propiedades de los tableros fueron inferiores a aquellas de los tableros comerciales. No fue posible correlacionar la velocidad del pulso de ultra-sonido con la resistencia a la compresión longitudinal.

  6. Tissue-specific expression and post-translational modifications of plant- and bacterial-type phosphoenolpyruvate carboxylase isozymes of the castor oil plant, Ricinus communis L. (United States)

    O’Leary, Brendan; Fedosejevs, Eric T.; Hill, Allyson T.; Bettridge, James; Park, Joonho; Rao, Srinath K.; Leach, Craig A.; Plaxton, William C.


    This study employs transcript profiling together with immunoblotting and co-immunopurification to assess the tissue-specific expression, protein:protein interactions, and post-translational modifications (PTMs) of plant- and bacterial-type phosphoenolpyruvate carboxylase (PEPC) isozymes (PTPC and BTPC, respectively) in the castor plant, Ricinus communis. Previous studies established that the Class-1 PEPC (PTPC homotetramer) of castor oil seeds (COS) is activated by phosphorylation at Ser-11 and inhibited by monoubiquitination at Lys-628 during endosperm development and germination, respectively. Elimination of photosynthate supply to developing COS by depodding caused the PTPC of the endosperm and cotyledon to be dephosphorylated, and then subsequently monoubiquitinated in vivo. PTPC monoubiquitination rather than phosphorylation is widespread throughout the castor plant and appears to be the predominant PTM of Class-1 PEPC that occurs in planta. The distinctive developmental patterns of PTPC phosphorylation versus monoubiquitination indicates that these two PTMs are mutually exclusive. By contrast, the BTPC: (i) is abundant in the inner integument, cotyledon, and endosperm of developing COS, but occurs at low levels in roots and cotyledons of germinated COS, (ii) shows a unique developmental pattern in leaves such that it is present in leaf buds and young expanding leaves, but undetectable in fully expanded leaves, and (iii) tightly interacts with co-expressed PTPC to form the novel and allosterically-desensitized Class-2 PEPC heteromeric complex. BTPC and thus Class-2 PEPC up-regulation appears to be a distinctive feature of rapidly growing and/or biosynthetically active tissues that require a large anaplerotic flux from phosphoenolpyruvate to replenish tricarboxylic acid cycle C-skeletons being withdrawn for anabolism. PMID:21841182


    Directory of Open Access Journals (Sweden)

    María Antonieta Goytia-Jiménez


    Full Text Available Ciento cincuenta y un accesiones de higuerilla (Ricinus communis L., colectadas en el estado de Chiapas, México, fueron caracterizadas por contenido de aceite, forma, tamaño y peso de la semilla, con el objetivo de generar información que pueda servir de base en un programa de mejoramiento para esta especie, que podría ser una opción rentable para la producción de biodiesel y bioturbosina. De acuerdo con su distribución, se establecieron las cuatro siguientes zonas climáticas: Región 1 clima Lluvioso tropical sin estación seca; Región 2 Sabana tropical con inviernos secos; Región 3 Sabana tropical con inviernos menos secos que la Región 2, y Región 4 Lluvioso Tropical. Se encontró una amplia variación en tamaño (de 0.05 a 2.49 cm2, color, peso (desde 7 hasta 123.9 g por cada 100 semillas y contenido de aceite (desde 12.20 a 64.84 %. Las asociaciones que se establecieron entre el tamaño y peso de 100 semillas con temperatura y precipitación fueron negativas, y significativas sólo en las regiones 3 y 4. No hubo significancia para las asociaciones del contenido de aceite con temperatura y precipitación, pero la tendencia fue a ser positivas en las regiones 1 y 4, las de mayor humedad de las cuatro regiones, y negativas en las regiones 2 y 3. Se concluye que los individuos de esta especie presentan una gran adaptación a diferentes entornos y crean fenotipos especiales para cada lugar en donde se desarrollan.

  8. Síntese de amidas e sulfonamidas de beta-D-galactopiranosilamina e beta-lactosilamina e avaliação de suas interações com lectinas de Erythrina cristagalli e de Ricinus communis Synthesis of amides and sulfonamides of beta-D- galactopyranosylamine and beta-lactosylamine and evaluation of their interactions with the lectins from Erythrina cristagalli and Ricinus communis

    Directory of Open Access Journals (Sweden)

    Anna Paola Butera


    Full Text Available We report herein the synthesis of some beta-D-galactopyranosylamine and beta-lactosylamine amides and sulfonamides. The interactions of these compounds with lectins from the seeds of Erythrina cristagalli (LEC and Ricinus communis (RCA120 were evaluated in a hemagglutination inhibitory activity assay. D-Galactose and lactose were used as reference compounds. The beta-lactosylamine amides and sulfonamides were nearly as active as lactose in inhibiting LEC mediated hemagglutination and were less active against RCA120 agglutinin. The beta-D-galactopyranosylamine amides and sulfonamides were, with one exception, considerably less active than D-galactose in the assay with both lectins.

  9. Secondary seed dispersal of Ricinus communis Linnaeus (Euphorbiaceae by ants in secondary growth vegetation in Minas Gerais Dispersão secundária de sementes de Ricinus communis Linnaeus (Euphorbiaceae por formigas em vegetação secundária em Minas Gerais

    Directory of Open Access Journals (Sweden)

    Mário Marcos do Espírito Santo


    Full Text Available In this study, I tested the efficacy of ants as secondary seed dispersers of Ricinus communis in southeastern Brazil. In a natural population of 143 individuals, I determined the ballistic dispersal distance for 62 seeds and 100 additional seeds were experimentally offered to ants in groups of ten seeds along a transect of 50 m. Fifty-three seeds were removed by ants, mainly by the leafcutter Atta sexdens (90.4%. The dispersal distance by ants was high, compared to the global average (4.38 m ± 0.74 m vs. 0.96 m, but was lower than the ballistic distance (7.27 m ± 0.13 m. Ants increased the total dispersal distance (8.66 m ± 0.60 m, but the main benefit for the plant was the directed dispersal, with seed deposition on the enriched soil of ant nests.Este estudo testou a eficiência de formigas como dispersores secundários de Ricinus communis no Brasil. Em uma população natural de 143 indivíduos, a distância de dispersão balística foi determinada para 62 sementes. Além disso, 100 sementes adicionais foram oferecidas a formigas em grupos de 10, ao longo de um transecto de 50 m. Cinqüenta e três sementes foram removidas por formigas, principalmente pela formiga-cortadeira Atta sexdens (90,4%. A distância de dispersão por formigas foi alta se comparada à média global (4,38m ± 0,74 m vs. 0,96 m, porém menor que a distância de dispersão balística (7,27 m ± 0,13 m. As formigas aumentaram a distância de dispersão total (8,66 m ± 0,60 m, mas o principal benefício para a planta foi a dispersão direcionada, com a deposição das sementes no solo enriquecido encontrado nos ninhos das formigas.

  10. Outbreaks of Chrysodeixis includens (Walker (Lepidoptera: Noctuidae in common bean and castor bean in São Paulo State, Brazil

    Directory of Open Access Journals (Sweden)

    Edson Luiz Lopes Baldin


    Full Text Available Since 2009, increasing populations of Chrysodeixis includens (Walker (Lepidoptera: Noctuidae have been observed in cultivated common bean (Phaseolus vulgaris L. and castor bean (Ricinus communis L. at the Lageado Experimental Farm, belonging to the FCA/UNESP, Botucatu, São Paulo State, Brazil. Defoliations around 80% and 50% were observed in the common bean cv. Pérola and castor bean cv. IAC-2028, respectively. Samples of individuals (caterpillars and pupae were collected in the field, and kept in laboratory until adult emergence aiming to confirm the species. These are new observations for common bean in São Paulo State and, in the case of castor bean, unpublished in Brazil. It suggests that C. includens has adapted to attack other agricultural crops, demanding attention of common bean and castor bean producers.

  11. Insight into the sialome of the castor bean tick, Ixodes ricinus

    Czech Academy of Sciences Publication Activity Database

    Chmelař, Jindřich; Anderson, J. M.; Mu, J.; Jochim, R. C.; Valenzuela, J. G.; Kopecký, Jan


    Roč. 9, č. 233 (2008), s. 1-21 ISSN 1471-2164 R&D Projects: GA MŠk(CZ) LC06009; GA ČR GA524/05/0811 Institutional research plan: CEZ:AV0Z60220518 Keywords : Ixodes ricinus * cDNA libraries * bioinformatics * tick feeding Subject RIV: EC - Immunology Impact factor: 3.926, year: 2008

  12. Ricinus communis agglutinin-mediated agglutination and fusion of glycolipid-containing phospholipid vesicles: effect of carbohydrate head group size, calcium ions, and spermine. (United States)

    Hoekstra, D; Düzgüneş, N


    The glycolipids galactosylcerebroside (GalCer), lactosylceramide (LacCer), and trihexosylceramide (Gb3) were inserted into phospholipid vesicles, consisting of phosphatidylethanolamine and phosphatidic acid. The extent to which their carbohydrate head groups protruded beyond the vesicle surface and their interference with membrane approach were examined by determining vesicle susceptibility toward type I Ricinus communis agglutinin (RCA1) induced agglutination and Ca2+- and spermine-induced aggregation and fusion either in the presence or in the absence of the lectin. The initial agglutination rates increased in the order GalCer much less than LacCer less than Gb3, while a reversed order was obtained for Ca2+- and spermine-induced aggregation and fusion, indicating an enhanced steric interference on close approach of bilayers with increasing head group size. The lectin-mediated agglutination rates for LacCer- and Gb3-containing vesicles increased by an order of magnitude when Ca2+ was also included in the medium, at a concentration that did not induce aggregation per se. Charge neutralization could not account for this observation as the polyvalent cation spermine did not display this synergistic effect with RCA1. Addition of Ca2+ to preagglutinated vesicles substantially reduced the threshold cation concentration for fusion (micromolar vs. millimolar). Quantitatively, this concentration decreased with decreasing carbohydrate head group size, indicating that the head group protrusion determined the interbilayer distance within the vesicle aggregate. The distinct behavior of Ca2+ vs. spermine on RCA1-induced agglutination on the one hand and fusion on the other indicated that Ca2+ regulates the steric orientation of the carbohydrate head group, which appears to be related to its ability to dehydrate the bilayer. As a result, lectin agglutinability becomes enhanced while fusion will be interrupted as the interbilayer distance increases, the threshold head group size

  13. Caracterização de Amphobotrys ricini, agente causal do mofo-cinzento da mamoneira (Ricinus communis L.), avaliação de genótipos, controle químico e alternativo


    Chagas, Haroldo Antunes [UNESP


    A mamoneira (Ricinus communis L.) é uma espécie oleaginosa tropical, cujo principal produto é o óleo extraído de suas sementes, sendo um dos mais versáteis da natureza e com muitas aplicações na indústria. Mesmo considerada uma planta rústica, a mamoneira está sujeita a doenças, dentre elas destacamos o mofo-cinzento, causada pelo fungo Amphobotrys ricini. Apesar de não ter relato no Brasil, o mofo-cinzento causado, também, pelo fungo Botrytis cinerea em mamoneira já foi descrito na Coréia do...

  14. PurificaÃÃo, caracterizaÃÃo bioquÃmica e atividade biolÃgica de um inibidor de tripsina da torta da mamona (Ricinus communis L.)


    Rodolpho Glauber Guedes Silva


    A cultura da mamoneira (Ricinus communis L.) à de grande importÃncia socioeconÃmica devido Ãs suas sementes, que sÃo utilizadas, principalmente, na produÃÃo do Ãleo que pode ser empregado para diversos fins industriais. A extraÃÃo do Ãleo gera um subproduto de alto valor nutricional, conhecido como torta da mamona. PorÃm, a presenÃa de compostos tÃxicos e alergÃnicos dificulta utilizaÃÃo desse resÃduo como fonte de alimentaÃÃo animal. Outra forma de agregar valor à torta da mamona seria busca...

  15. Avaliação de fungicidas, óleos essenciais e agentes biológicos no controle de Amphobotrys ricini em mamoneira (Ricinus communis L.

    Directory of Open Access Journals (Sweden)

    Haroldo Antunes Chagas


    Full Text Available A mamoneira (Ricinus communis L. é uma espécie oleaginosa tropical, sendo o óleo extraído de suas sementes um dos mais versáteis da natureza e com inúmeras aplicações industriais. Embora ainda seja uma espécie rústica, ela está sujeita a diversas doenças, dentre elas o mofo-cinzento, causada pelo fungo Amphobotrys ricini. O melhoramento genético seria a melhor alternativa para o controle da doença, mas demanda tempo para se obter cultivares resistentes. Dessa maneira, o uso de métodos de controle baseado em métodos químicos, alternativos ou biológicos mostra-se viável no curto prazo. O objetivo do trabalho foi estudar a eficiência do controle do mofo-cinzento, na cultura da mamoneira, utilizando-se de métodos químico, alternativo e biológico. Assim, procurou-se avaliar, tanto in vitro, quanto in vivo a eficiência de controle do patógenos utilizando-se de fungicidas, óleos essenciais e agentes de controle biológico. Quanto a inibição do crescimento micelial do patógeno in vitro os melhores tratamentos com os óleos essenciais foram os com a base de Cymbopogon martini e Cynnamomum zeylanicum, nas cinco concentrações testadas. Em ambos os óleos, o diâmetro médio das colônias ficou em 0,7 cm contra a média de 4,79 cm da testemunha. Com os fungicidas, nas quatro concentrações testadas, os mais eficientes foram os ingredientes ativos tiofanato metílico, carbendazim, tebuconazole e iprodione. O ED50 destes fungicidas ficou < 1uL/L, atestando 100% de inibição do crescimento micelial em todas as concentrações. Quanto à inibição da germinação dos conídios de A. ricini, os fungicidas tebuconazole e clorotalonil foram os melhores em todas as concentrações testadas, sendo a média dos conídios germinados destes fungicidas de 0,0 e 0,15%, respectivamente, contra 100% da testemunha. No campo, o tratamento com o fungicida iprodione foi o melhor quanto ao controle da doença quando comparados com os

  16. A review of nutritional and toxicological implications of castor bean (Ricinus communis L.) meal in animal feeding systems. (United States)

    Akande, T O; Odunsi, A A; Akinfala, E O


    The nutrient-rich defatted castor meal has been tested as a potential source of protein in diets of many livestock species but has limitation due to challenges of toxins. This review was conducted to compile the relevant research information on advances in the use of raw and differently processed castor seed meal in animal feed. In this article, distribution and uses of castor and its products were identified. Research findings on the nutrients profile, principal toxins, various detoxification strategies, nutritional value and toxicity on common livestock species were compiled and reviewed. The defatted seed meal had crude protein range of 32-48%, gross energy of about 3200 kcal/kg. Ricin content was 9.3 mg/g seed, and the average RCA content was 9.9 mg/g. The meal had high activity of lectin, which produced agglutination at about 4.70 mg/ml minimum assays. Reports of detoxification strategies showed varying degrees of success but high pH, moist heating and microbial techniques appeared to exert greater effect on deactivating ricin. Detoxification strategy for the allergen component is inconclusive. Tannins and the phenolic contents were present at trace level and did not constitute notable threat. It was concluded that castor seed holds great potential as feedstuff when upgraded but such upgrading must be safe, cost-effective and labour efficient for commercial acceptability. Journal of Animal Physiology and Animal Nutrition © 2015 Blackwell Verlag GmbH.

  17. Evaluation préliminaire de l'activité larvicide des extraits aqueux des feuilles du ricin (Ricinus communis L. et du bois de thuya (Tetraclinis articulata (Vahl Mast. sur les larves de quatre moustiques culicidés : Culex pipiens (Linné, Aedes caspius (Pallas, Culiseta longiareolata (Aitken et Anopheles maculipennis (Meigen

    Directory of Open Access Journals (Sweden)

    Mahari S.


    Full Text Available Preliminary evaluation of larvicidal activity of aqueous extracts from leaves of Ricinus communis L. and from wood of Tetraclinis articulata (Vahl Mast. on the larvae of four mosquito species: Culex pipiens (Linné, Aedes caspius (Pallas, Culiseta longiareolata (Aitken and Anopheles maculipennis (Meigen. Aqueous extracts of Ricinus communis leaves and Tetraclinis articulata wood showed strong toxic activity against larvae of several mosquitoes. In this study, insecticide effects of these plant extracts have been investigated on 2nd and 4th instars larvae of Culicidae insects, Culex pipiens (Linné, Aedes caspius (Pallas, Culiseta longiareolata (Aitken and Anopheles maculipennis (Meigen. After 24 hours of exposition, bioassays revealed low lethal concentrations LC50. To control mosquitoes, these plant extracts might be used as natural biocides.

  18. Estudo experimental do poliuretano de óleo de mamona (Ricinus communis como substituto parcial do tendão calcâneo comum em coelhos (Oryctolagus cuniculus An experimental study of polyurethane of castor-oil plant (Ricinus communis as a partial substitute of the common calcaneous tendon in rabbits (Oryctogalus cuniculus

    Directory of Open Access Journals (Sweden)

    C.M.F. Rezende


    Full Text Available Com o objetivo de avaliar a eficiência da prótese de poliuretano de mamona como substituto parcial do tendão calcâneo comum, foram utilizadas 30 coelhas da raça Nova Zelândia, entre dois e três meses de idade e peso médio de 2kg. Após anestesia geral, o procedimento cirúrgico em ambos os membros constou de incisão caudo-lateral no sentido longitudinal do terço médio ao distal da tíbia e exposição do tendão calcâneo comum. Após a tenectomia do tendão do músculo gastrocnêmio, a prótese de poliuretano de cerca de 0,5cm de extensão por 0,5cm de diâmetro foi fixada aos cotos proximal e distal do tendão, empregando-se o fio de polipropileno monofilamentar 4-0, conforme técnica modificada de Kessler. A prótese de poliuretano na forma elastomérica revelou propriedades como textura e flexibilidade semelhantes à do tecido tendinoso, pode ser confeccionada na forma e no tamanho almejados e permite ser moldada, cortada e esterilizada por calor úmido. Todos os animais apoiaram os membros operados imediatamente após o retorno anestésico. Não se observaram sinais clínicos de infecção e não ocorreu deiscência de ferida. Percebeu-se aumento de volume local devido ao edema, evidente na primeira semana pós-cirúrgica, que gradualmente desapareceu . À palpação foi possível delimitar com facilidade a prótese que se conservou fixa no local e intacta. Clinicamente o poliuretano de mamona não induziu reação desfavorável que comprometesse a cicatrização tendínea, podendo ser indicado como substituto temporário de tendão.With the goal of evaluating the efficiency of a prosthesis of castor-oil plant (Ricinus communis polyurethane as a partial substitute for common calcaneous tendon, 30 New Zealand female rabbits, aging between two to three months, weighting about 2kg were used. After general anesthesia, the surgical procedure in both members consisted of rear lateral longitudinal incision, in the medium third of the

  19. Cálculo del balance de energía para higuerilla (Ricinus communis L. desde las etapas de producción en campo hasta el valor energético de cada componente de la planta

    Directory of Open Access Journals (Sweden)

    Hipólito Ortíz-Laurel


    Full Text Available Introducción : Pruebas de balance de energía permiten redirigir los insumos desde las etapas de producción de un cultivo, e igualmente, precesar la cantidad de energía utilizada para cada proceso y así, verificar la eficiencia al transformar la energía contenida en el cultivo cuando debe cumplir con una función deseada. Método : la planta de higuerilla (Ricinus communis L. con propósitos de cultivo energético fue sembrada en campo y sometida a procesos de mantenimiento de l cultivo y en la cosecha, la planta completa fue colectada para análisis energético, donde cada una de sus partes inclu i das las semillas fueron evaluadas en función de su contenido de energía. Así, para determinar el balance de energía; los valores de la energía biológica de la planta fueron comparados con la energía aplicada en cada uno de los procesos técnicos y físicos para la producción del cult i vo y en su procesamiento . Resultados : La energía aplicada para producir el cultivo r esulta un 28% superior a la energía a obtener de la planta. Asimismo, la biomasa de la planta completa de higuerilla, sin contar las semillas genera el doble de energía comparado con el aceite de las semillas, por lo que, conviene utilizar toda la planta e n términos de energía . Conclusión : Es recomendable utilizar el aceite de las seillas como biomaterial, ya que el b a lance es positivo en un 15%.

  20. Seeds' physicochemical traits and mucilage protection against aluminum effect during germination and root elongation as important factors in a biofuel seed crop (Ricinus communis). (United States)

    Silva, Giovanni Eustáquio Alves; Ramos, Flávia Toledo; de Faria, Ana Paula; França, Marcel Giovanni Costa


    We determined the length, volume, dry biomass, and density in seeds of five castor bean cultivars and verified notable physicochemical trait differences. Seeds were then subjected to different toxic aluminum (Al) concentrations to evaluate germination, relative root elongation, and the role of root apices' rhizosphere mucilage layer. Seeds' physicochemical traits were associated with Al toxicity responses, and the absence of Al in cotyledons near to the embryo was revealed by Al-hematoxylin staining, indicating that Al did not induce significant germination reduction rates between cultivars. However, in the more sensitive cultivar, Al was found around the embryo, contributing to subsequent growth inhibition. After this, to investigate the role of mucilage in Al tolerance, an assay was conducted using NH4Cl to remove root mucilage before or after exposure to different Al concentrations. Sequentially, the roots were stained with hematoxylin and a quantitative analysis of staining intensity was obtained. These results revealed the significant contribution of the mucilage layer to Al toxicity responses in castor bean seedlings. Root growth elongation under Al toxicity confirmed the role of the mucilage layer, which jointly indicated the differential Al tolerance between cultivars and an efficient Al-exclusion mechanism in the tolerant cultivar.

  1. Jatropha curcasand Ricinus communisdisplay contrasting photosynthetic mechanisms in response to environmental conditions

    Directory of Open Access Journals (Sweden)

    Milton Costa Lima Neto


    Full Text Available Higher plants display different adaptive strategies in photosynthesis to cope with abiotic stress. In this study, photosynthetic mechanisms and water relationships displayed byJatropha curcasL. (physic nuts andRicinus communisL. (castor bean, in response to variations in environmental conditions, were assessed.R. communis showed higher CO2 assimilation, stomatal and mesophyll conductance thanJ. curcas as light intensity and intercellular CO2 pressure increased. On the other hand,R. communis was less effective in stomatal control in response to adverse environmental factors such as high temperature, water deficit and vapor pressure deficit, indicating lower water use efficiency. Conversely,J. curcas exhibited higher photosynthetic efficiency (gas exchange and photochemistry and water use efficiency under these adverse environmental conditions.R. communisdisplayed higher potential photosynthesis, but exhibited a lowerin vivo Rubisco carboxylation rate (Vcmax and maximum electron transport rate (Jmax. During the course of a typical day, in a semiarid environment, with high irradiation, high temperature and high vapor pressure deficit, but exposed to well-watered conditions, the two studied species presented similar photosynthesis. Losing potential photosynthesis, but maintaining favorable water status and increasing non-photochemical quenching to avoid photoinhibition, are important acclimation mechanisms developed byJ. curcas to cope with dry and hot conditions. We suggest thatJ. curcas is more tolerant to hot and dry environments thanR. communis but the latter species displays higher photosynthetic efficiency under well-watered and non-stressful conditions.

  2. Effect of plant growth promoting rhizobacteria, Nitroxin and sulfur on quantity and quality of caster bean (Ricinus Commines L. in Sistan region

    Directory of Open Access Journals (Sweden)

    S. Ghasemi


    Full Text Available The caster bean oil is high value in industry around of world. Plant nutrition and plant growth promoting rhizobacteria (PGPR are important for crop production. An experiment was set up to investigate the effect of nitrogen (N, sulfur (S fertilizers and PGPR on seed yield production of Ricinus commines L. This experiment was carry out in factorial layout based on complete randomize block design with three replicates at Research Center of University of Zabol during growing season of 2011-2012. The treatments were PGPR with three types of bacteria (control, Nitroxin , and Super Nitroplas 2 L.ha-1, three levels of nitrogen (0, 150 and 200 kg.ha-1 and two levels of sulfur fertilizer (0 and 300 kg.ha-1. The results showed that grain weight, 1000-seed weight, number of capsule and number of seed per plant were not affected by studied treatments. The highest effect of PGPR was on dry weight of capsule, plant height, number of leaf per plant, oil percentage and amount of seed protein. Number of inflorescence just affected by sulfur treatments and most of studied plant characters affected by N fertilizers. The highest and the lowest oil percentage were related to Nitroxin and Super Nitroplas 51.89 and 47.85, respectively. Also the highest and the lowest plant height were related to Nitroxin and control treatments 82.29 and 53.33, respectively.

  3. Castor bean response to zinc fertilization

    Energy Technology Data Exchange (ETDEWEB)

    Chaves, Lucia Helena Garofalo; Cunha, Tassio Henrique Cavalcanti da Silva; Lima, Vinicius Mota; Cabral, Paulo Cesar Pinto; Barros Junior, Genival; Lacerda, Rogerio Dantas de [Universidade Federal de Campina Grande (UAEAg/UFCG), PB (Brazil). Unidade Academica de Engenharia Agricola


    Zinc is a trace element and it is absolutely essential for the normal healthy growth of plants. This element plays a part of several enzyme systems and other metabolic functions in the plants. Castor beans (Ricinus communis L.) crop is raising attention as an alternative crop for oil and biodiesel production. Despite the mineral fertilization is an important factor for increasing castor beans yield, few researches has been made on this issue, mainly on the use of zinc. In order to evaluate the effects of zinc on growth of this plant an experiment was carried out in a greenhouse, in Campina Grande, Paraiba State, Brazil, from July to December 2007. The substrate for the pot plants was a 6 mm-sieved surface soil (Neossolo Quartzarenico). The experimental design was a completely randomized with three replications. The treatments were composed of five levels of Zn (0; 2; 4; 6 and 8 mg dm{sup -3}), which were applied at the time of planting. One plant of castor bean, cultivar BRS 188 - Paraguacu, was grown per pot after thinning and was irrigated whenever necessary. Data on plant height, number and length of leaves and stem diameter were measured at 21, 34, 77 and 103 days after planting. Under conditions that the experiment was carried out the results showed that the Zn levels used, did not affect the castor bean plants growth. (author)


    Directory of Open Access Journals (Sweden)

    Juarez Benigno Paes


    Full Text Available The research aimed to evaluate the efficiency of neem (Azadirachta indica and castor oil plant (Ricinus communis oils for the improvement of Ceiba pentandra wood resistance to xilophagous fungi in soil bed condition (field simulator. The neem and castor oil plant oils were extracted with absolute ethyl alcohol and employed in the preparation of oil solutions. Wood samples with dimensions of 1.5 x 0.5 x 15 cm (radial x tangential x longitudinal were treated to reach a nominal retention of 10 to 16 kg of solution/m³ of wood. The samples were submitted to the action of natural micro-flora of three soils; forest, agricultural use and natural pasture soils, for 180 days. Among the tested soils, the agricultural presented greater biological activity, which damaged the samples even more. Among the tested solutions, the pure neem oil provided increased protection to samples. The prepared solutions using neem and castor oil plant oils did not protect the wood from the attack of xylophagous fungi existing in the ground.

  5. Genome-Wide Identification, Evolutionary Analysis, and Stress Responses of the GRAS Gene Family in Castor Beans

    Directory of Open Access Journals (Sweden)

    Wei Xu


    Full Text Available Plant-specific GRAS transcription factors play important roles in regulating growth, development, and stress responses. Castor beans (Ricinus communis are important non-edible oilseed plants, cultivated worldwide for its seed oils and its adaptability to growth conditions. In this study, we identified and characterized a total of 48 GRAS genes based on the castor bean genome. Combined with phylogenetic analysis, the castor bean GRAS members were divided into 13 distinct groups. Functional divergence analysis revealed the presence of mostly Type-I functional divergence. The gene structures and conserved motifs, both within and outside the GRAS domain, were characterized. Gene expression analysis, performed in various tissues and under a range of abiotic stress conditions, uncovered the potential functions of GRAS members in regulating plant growth development and stress responses. The results obtained from this study provide valuable information toward understanding the potential molecular mechanisms of GRAS proteins in castor beans. These findings also serve as a resource for identifying the genes that allow castor beans to grow in stressful conditions and to enable further breeding and genetic improvements in agriculture.

  6. Defining carbohydrate specificity of Ricinus communis agglutinin as Gal beta 1-->4GlcNAc (II) > Gal beta 1-->3GlcNAc (I) > Gal alpha 1-->3Gal (B) > Gal beta 1-->3GalNAc (T). (United States)

    Wu, J H; Herp, A; Wu, A M


    To define carbohydrate specificity of Ricinus communis agglutinin (RCA1), the combining site of RCA1 was further characterized by quantitative precipitin (QPA) and precipitin-inhibition assays (QPIA). Among the oligosaccharides tested for QPIA, Gal beta 1-->4GlcNAc (II, human blood group type II precursor sequence) was found to be 7.1 times more active than Gal beta 1-->3GalNAc (T, Thomsen-Friedenreich sequence) and about 1.7 times more active than the other three disaccharides tested--Gal beta 1-->4Man, Gal beta 1-->3DAra and Gal beta 1-->6GalNAc. Gal alpha 1-->4Gal, the receptor of the uropathogenic E. coli ligand was 3.6 times less active than the II sequence. These results indicate that the beta 1-->4 linkage of the terminal Gal to subterminal GlcNAc is important as this beta 1-->4GlcNAc sequence is at least 1.6 times more active than other types of disaccharides. Among the glycoproteins examined for QPA, native and desialized bovine submandibular glycoproteins, native and desialized human plasma alpha 1-acid glycoproteins, as well as crude hog stomach mucin and its three mild acid hydrolyzed products reacted well with the lectin. These glycoproteins precipitated over 75% of the lectin nitrogen added indicating that RCA1 has the ability to recognize Gal beta 1-->4/3GlcNAc and/or the related residues at the non-reducing ends and at positions in the interior of the chains. However, Tn (GalNAc alpha 1-->Ser/Thr sequence) rich glycoproteins such as desialized ovine submandibular glycoprotein and desialized armadillo salivary glycoprotein, in which over 90% of the carbohydrate side chains are Tn determinants with none or only a trace of I/II or T determinants, precipitated poorly with RCA1. From the present and previous results obtained, the carbohydrate specificity of RCA1 can be constructed and summarized in decreasing order by lectin determinants as follows: II (Gal beta 1-->4GlcNAc) > I (Gal beta 1-->3GlcNAc) > E (Gal alpha 1-->4Gal) and B (Gal alpha 1-->3Gal

  7. Amelioration of Anti-Nutritive Effects of Castor Oil Seed ( Ricinus ...

    African Journals Online (AJOL)

    Three hundred and twenty (320) day old male broilers were used to investigate the amelioration of anti-nutritive effects of castor oil seed (Ricinus communis) meal in broilers' ration using natural fermentation and DL-Methionine supplementation. The experimental designed was a 4 × 2 factorial arrangement of dietary ...

  8. Criblage in vitro des graines d'accessions locales de ricin ( Ricinus ...

    African Journals Online (AJOL)

    Le ricin (Ricinus communis L.) est une plante peu exigeante dont la culture offre d'énormes potentialités économiques pour les exploitants agricoles sénégalais. L'identification de génotypes performants avec des rendements acceptables en conditions de stress salin constitue une des solutions pour promouvoir cette ...


    African Journals Online (AJOL)

    Adeyinka Odunsi

    A study was carried out at the Toxicology laboratory of the Department of Crop and Environmental protection,. Ladoke Akintola University of Technology Ogbomoso, to determine the effects of powdered castor oil seed. (Ricinus communis L.Euphorbiaceae) on kidney, liver, spleen of albino rats. The rats were in five groups, ...


    African Journals Online (AJOL)

    Adeyinka Odunsi

    Ricinus communis, are poisonous to people, animals and insects. One of the main toxic proteins is "ricin", named by ... whereas RCA is a weak cytotoxin and a powerful hemagglutinin. Poisoning by exposure to castor oil seed .... Both red and the white pulps are distinguishable and numerous small vascular channels are ...

  11. Crioconservação de sementes de mamona das variedades nordestina e pernambucana Cryoconservation of nordestina and pernambucana varieties of castor bean seeds

    Directory of Open Access Journals (Sweden)

    Francisco de A. C. Almeida


    Full Text Available É grande a importância da mamoneira (Ricinus communis L. para a economia do semi-árido nordestino, que é responsável por 80% da produção nacional, no entanto durante 1970 e 2000, a produção líquida dessa oleaginosa foi reduzida na mesma percentagem. Registrou-se também a existência de aproximadamente 90 tipos diferentes de sementes empregadas no cultivo desta Euforbiaceae. Devido a este problema, o trabalho desenvolvido no Laboratório de Processamento e Armazenamento de Produtos Agrícolas do DEAg/UFPB, objetivou desenvolver técnicas de crioconservação para duas variedades de Ricinus communis, com vistas a uma armazenagem segura e por tempo indefinido. O delineamento experimental utilizado foi o inteiramente casualizado, com os dados obtidos nos 7º e 14º dias depois da semeadura, dispostos em um arranjo fatorial 2 x 3 x 2 x 2 (duas variedades, três períodos de crioconservação, duas temperaturas de crioconservação e dois tipos de acondicionamento com oito repetições de vinte e cinco sementes cada uma. Os dados obtidos foram submetidos à análise de variância e as médias dos fatores qualitativos comparadas pelo teste de Tukey, a 5% de probabilidade. Com os resultados obtidos concluiu-se que: o nível máximo de umidade para a crioconservação das sementes das duas variedades de Ricinus communis (nordestina e pernambucana encontra-se entre 4 e 10% base úmida; os melhores resultados de qualidade fisiológica foram obtidos aos 30 dias da crioconservação, podendo essas sementes serem crioconservadas tanto no vapor (-176 ºC como na imersão (-196 ºC em nitrogênio líquido; o canister de alumínio utilizado para acondicionar as sementes mostrou-se superior ao de PVC.The castor bean (Ricinus communis L. has great importance for the economy of the semi-arid region of the northeast of Brazil, responsible for 80% of the national production, but during 1970 and 2000, the net production of this oil crop was reduced

  12. Effects of Foliar Applications of Sulfur, Nitrogen and Phosphorus on Castor Bean (Ricinus cmmunis L. Seed Yield and its Components under Water Deficit Conditions

    Directory of Open Access Journals (Sweden)

    M. Mosavi


    Full Text Available To determine the effects of foliar applications of some macroelements on castor seed yield and its components under drought stress conditions, an experiment was conducted at the Agricultural Research Center of East Azerbaijan province. A factorial experiment, based on randomized complete block design with three replications, was carried out during 2013 growing season. Treatment factors consisted of irrigations with two levels (no water deficit and water deficit during grain filling stage and of foliar applications of macroelements with four levels [control, wettable sulfur (0.2 percent, nitrogen (urea: 0.6 percent and phosphor (super phosphate triple: 0.4 percent. Traits studied were: plant height, number of inflorescence, number of lateral branches, number of leaves, leaf temperature, relative water content, number of seeds per plant, 1000-kernal weight and seed yield. All traits, except number of inflorescence, were affected significantly by drought stress. Water deficit reduced plant height, number of leaves, number of seeds per plant, 1000-kernal weight, seed yield, relative water content, while it increased leaf temperature. Number of lateral branches was affected significantly by interaction between factors. Maximum latral branches (1.86 were obtained under non-stress treatment with nitrogen foliar application. Moderate drought stress had significant effect on leaf temperature and relative water content. It seems that, these traits can be used in determination of water deficit effects on castor bean.

  13. Intraspecific DNA methylation polymorphism in the non-edible oilseed plant castor bean

    Directory of Open Access Journals (Sweden)

    Shan He


    Full Text Available Investigation of the relationships of phenotypic and epigenetic variations might be a good way to dissect the genetic or molecular basis of phenotypic variation and plasticity in plants. Castor bean (Ricinus communis L., an important non-edible oilseed crop, is a mono-species genus plant in the family Euphorbiaceae. Since it displays rich phenotypic variations with low genetic diversity, castor bean is a good model to investigate the molecular basis of phenotypic and epigenetic variations. Cytosine DNA methylation represents a major molecular mechanism of epigenetic occurrence. In this study, epigenetic diversity of sixty landrace accessions collected worldwide was investigated using the methylation-sensitive amplification polymorphism (MSAP technique. Results showed that the epigenetic diversity (based on the polymorphism of DNA methylated loci exhibited a medium variation (Ne = 1.395, He = 0.242, I = 0.366 at the population level though the variation was great, ranging from 3.80% to 34.31% among accessions. Both population structure analysis and the phylogenetic construction (using the neighbor-joining criteria revealed that the two main clades were identified, but they did not display a distinct geographic structure. After inspecting the location of polymorphic methylated loci on genome we identified that the polymorphic methylated loci occur widely in nuclear and organelle genomes. This study provides new data to understand phenotypic and epigenetic variations in castor bean.


    Directory of Open Access Journals (Sweden)

    Ciro de Miranda Pinto


    Full Text Available An experiment field was carried in the agricultural seasons 2008, 2009 and 2010, with aim of studying the response of castorbean (Ricinus communis L. intercropping with sunflower (Helianthus annus L. in row arrangement in the dryland farming conditions. In addition, it was evaluated the biological efficiency of plants in intercropping systems.The design used in the experiment was randomized block with seven treatement and four replications. The treatments were represented by rows of castor oil (Ma and sunflower (Gi listed below: 1Ma:1Gi; 1Ma:2Gi; 1Ma:3Gi; 2Ma:2Gi; 2Ma:3Gi; castor and sunflower in the monoculture. The efficiency of intercropping was measured by LER, ATER, LEC, average between LER and ATER, SPI and CoR. The grain yield of castor bean and sunflower were reduced in intercropped row arrangements. The row arrangement 1Ma:2Gi showed the smallest reduction of average productivity of castor beans and sunflower in the evaluation period of the experiment. The castor bean was the dominant crop in relation to sunflower.

  15. VARIATIONS IN SEED TRAITS OF CASTOR (Ricinus communis ...

    African Journals Online (AJOL)

    The sizes of castor seed have been reported to vary from a few millimeters long to about 20 mm in the giant species (Weiss, 2000). The seed weight varies. For instance, seeds found in Nigeria and Kenya has been reported to weigh. 69.3 and 59.2 g, respectively (Li et al., 2008). The typical fatty acid composition of castor oil.

  16. Variations in seed traits of castor ( Ricinus communis ) accessions ...

    African Journals Online (AJOL)

    The physicochemical analysis showed that castor seed and oil had saponification value of 182.9 mg/g, moisture content of 4.4%, acid value of 3.085 mg/g, viscosity of 110.41 cP, pH of 6.11, iodine value of 8.46 mg/g, specific gravity of 0.962 and refractive index of 1.477˚C. The proximate analysis showed that moisture ...

  17. Diversity of castor ( Ricinus communis L.) in Ethiopia | Alemaw ...

    African Journals Online (AJOL)

    An experiment was carried out to assess the diversity of castor germplasm in Ethiopia. A total of 102 accessions, one elite genotype and two standard varieties were characterized at Melkassa and Arsi Negelle, in the Central Rift Valley of Ethiopia using 12 traits for one during 2013 main season. Analysis of variance ...

  18. Three flavonol glycosides from Ricinus communis | Aqil | Bulletin of ...

    African Journals Online (AJOL)

    The PDF file you selected should load here if your Web browser has a PDF reader plug-in installed (for example, a recent version of Adobe Acrobat Reader). If you would like more information about how to print, save, and work with PDFs, Highwire Press provides a helpful Frequently Asked Questions about PDFs.

  19. The Effect Of Ricinus Communis Variety Minor On Reproductive ...

    African Journals Online (AJOL)

    Thee estrous cycle of the rats were distorted. Furthermore, this seed extract induced changes in the ovarian and uterine histology, which may be due partly to alteration in the estrogen/ progesterone balance, as well as direct effect on these reproductive organs. Hematological indices were not affected in women volunteers ...

  20. Analysis of active ricin and castor bean proteins in a ricin preparation, castor bean extract, and surface swabs from a public health investigation. (United States)

    Schieltz, David M; McGrath, Sara C; McWilliams, Lisa G; Rees, Jon; Bowen, Michael D; Kools, John J; Dauphin, Leslie A; Gomez-Saladin, Eduardo; Newton, Bruce N; Stang, Heather L; Vick, Michael J; Thomas, Jerry; Pirkle, James L; Barr, John R


    In late February 2008, law enforcement officials in Las Vegas, Nevada, discovered in a hotel room, a copy of The Anarchist Cookbook, suspected castor beans and a "white powder" thought to be a preparation of ricin. Ricin is a deadly toxin from the seed of the castor bean plant (Ricinus communis). The United States regulates the possession, use, and transfer of ricin and it is the only substance considered a warfare agent in both the Chemical and the Biological Weapons Conventions. Six samples obtained from the hotel room were analyzed by laboratories at the Centers for Disease Control and Prevention using a panel of biological and mass spectrometric assays. The biological assays (real time-PCR, time resolved fluorescence and cytotoxicity) provided presumptive evidence of active ricin in each of the samples. This initial screen was followed by an in-depth analysis using a novel, state-of-the-art mass spectrometry-based ricin functional assay and high sensitivity tandem mass spectrometry for protein identification. Mass spectrometric analysis positively identified ricin and confirmed that in each of the samples it was enzymatically active. The tandem mass spectrometry analysis used here is the most selective method available to detect ricin toxin. In each sample, ricin was unequivocally identified along with other R. communis plant proteins, including the highly homologous protein RCA120. Although database searches using tandem mass spectra acquired from the samples indicated that additional controlled substances were not present in these samples, the mass spectrometric results did provide extensive detail about the sample contents. To the best of our knowledge following a review of the available literature, this report describes the most detailed analysis of a white powder for a public health or forensic investigation involving ricin. Published by Elsevier Ireland Ltd.

  1. Morphology and viability of castor bean genotypes pollen grains

    Directory of Open Access Journals (Sweden)

    Maria Selma Alves Silva Diamantino


    Full Text Available The objective of this work was to characterize the morphology and viability of the pollen of 15 genotypes of castor bean (Ricinus communis L. and to generate information that can assist in the selection of highly promising male parents for future use in genetic improvement programs aimed at producing seeds for oil extraction. Acetolysis and scanning electron microscopy was used to characterize the morphology of the pollen. The viability of the pollen grains was estimated by in vitro germination and colorimetric analysis (acetocarmine 2% and 2, 3, 5-triphenyltetrazolium chloride 1%. For the in vitro germination, pollen grains were grown in 10 types of solidified culture medium consisting of different concentrations of sucrose, boric acid, calcium nitrate, magnesium sulfate and potassium nitrate. The pollen grains had the following characteristics: medium size, isopolar and subspheroidal shape, radial symmetry, circular ambit, 3-colporate, elongated endoapertures, tectate exine and granulated sexine. The acetocarmine dye overestimated pollen viability. The media M5 and M8 were the most efficient at promoting the germination of pollen grains. The studied genotypes had high levels of viability and can therefore be used as male parents in genetic improvement programs.

  2. Analysis of castor bean ribosome-inactivating proteins and their gene expression during seed development

    Directory of Open Access Journals (Sweden)

    Guilherme Loss-Morais


    Full Text Available Ribosome-inactivating proteins (RIPs are enzymes that inhibit protein synthesis after depurination of a specific adenine in rRNA. The RIP family members are classified as type I RIPs that contain an RNA-N-glycosidase domain and type II RIPs that contain a lectin domain (B chain in addition to the glycosidase domain (A chain. In this work, we identified 30 new plant RIPs and characterized 18 Ricinus communis RIPs. Phylogenetic and functional divergence analyses indicated that the emergence of type I and II RIPs probably occurred before the monocot/eudicot split. We also report the expression profiles of 18 castor bean genes, including those for ricin and agglutinin, in five seed stages as assessed by quantitative PCR. Ricin and agglutinin were the most expressed RIPs in developing seeds although eight other RIPs were also expressed. All of the RIP genes were most highly expressed in the stages in which the endosperm was fully expanded. Although the reason for the large expansion of RIP genes in castor beans remains to be established, the differential expression patterns of the type I and type II members reinforce the existence of biological functions other than defense against predators and herbivory.

  3. Characterization of Ricin and R. communis Agglutinin Reference Materials

    Directory of Open Access Journals (Sweden)

    Sylvia Worbs


    Full Text Available Ricinus communis intoxications have been known for centuries and were attributed to the toxic protein ricin. Due to its toxicity, availability, ease of preparation, and the lack of medical countermeasures, ricin attracted interest as a potential biological warfare agent. While different technologies for ricin analysis have been established, hardly any universally agreed-upon “gold standards” are available. Expert laboratories currently use differently purified in-house materials, making any comparison of accuracy and sensitivity of different methods nearly impossible. Technically challenging is the discrimination of ricin from R. communis agglutinin (RCA120, a less toxic but highly homologous protein also contained in R. communis. Here, we established both highly pure ricin and RCA120 reference materials which were extensively characterized by gel electrophoresis, liquid chromatography-electrospray ionization-tandem mass spectrometry (LC-ESI MS/MS, and matrix-assisted laser desorption ionization–time of flight approaches as well as immunological and functional techniques. Purity reached >97% for ricin and >99% for RCA120. Different isoforms of ricin and RCA120 were identified unambiguously and distinguished by LC-ESI MS/MS. In terms of function, a real-time cytotoxicity assay showed that ricin is approximately 300-fold more toxic than RCA120. The highly pure ricin and RCA120 reference materials were used to conduct an international proficiency test.

  4. Characterization of Ricin and R. communis Agglutinin Reference Materials (United States)

    Worbs, Sylvia; Skiba, Martin; Söderström, Martin; Rapinoja, Marja-Leena; Zeleny, Reinhard; Russmann, Heiko; Schimmel, Heinz; Vanninen, Paula; Fredriksson, Sten-Åke; Dorner, Brigitte G.


    Ricinus communis intoxications have been known for centuries and were attributed to the toxic protein ricin. Due to its toxicity, availability, ease of preparation, and the lack of medical countermeasures, ricin attracted interest as a potential biological warfare agent. While different technologies for ricin analysis have been established, hardly any universally agreed-upon “gold standards” are available. Expert laboratories currently use differently purified in-house materials, making any comparison of accuracy and sensitivity of different methods nearly impossible. Technically challenging is the discrimination of ricin from R. communis agglutinin (RCA120), a less toxic but highly homologous protein also contained in R. communis. Here, we established both highly pure ricin and RCA120 reference materials which were extensively characterized by gel electrophoresis, liquid chromatography-electrospray ionization-tandem mass spectrometry (LC-ESI MS/MS), and matrix-assisted laser desorption ionization–time of flight approaches as well as immunological and functional techniques. Purity reached >97% for ricin and >99% for RCA120. Different isoforms of ricin and RCA120 were identified unambiguously and distinguished by LC-ESI MS/MS. In terms of function, a real-time cytotoxicity assay showed that ricin is approximately 300-fold more toxic than RCA120. The highly pure ricin and RCA120 reference materials were used to conduct an international proficiency test. PMID:26703723

  5. Lipase Activity in Fermented Oil Seeds of Africa Locust Bean ...

    African Journals Online (AJOL)


    Lipase Activity in Fermented Oil Seeds of Africa Locust Bean, (Parkia Biglobosa),. Castor Seeds (Ricinu Communis) and African Oil Bean (Pentaclethra Macrophylla). A.A. Liman*, P. Egwin, M.A. Vunchi and C. Ayansi. Department of Science Laboratory Technology, School of Applied Arts and Sciences. Federal Polytechnic ...

  6. Genome-wide comparative analysis of papain-like cysteine protease family genes in castor bean and physic nut. (United States)

    Zou, Zhi; Huang, Qixing; Xie, Guishui; Yang, Lifu


    Papain-like cysteine proteases (PLCPs) are a class of proteolytic enzymes involved in many plant processes. Compared with the extensive research in Arabidopsis thaliana, little is known in castor bean (Ricinus communis) and physic nut (Jatropha curcas), two Euphorbiaceous plants without any recent whole-genome duplication. In this study, a total of 26 or 23 PLCP genes were identified from the genomes of castor bean and physic nut respectively, which can be divided into nine subfamilies based on the phylogenetic analysis: RD21, CEP, XCP, XBCP3, THI, SAG12, RD19, ALP and CTB. Although most of them harbor orthologs in Arabidopsis, several members in subfamilies RD21, CEP, XBCP3 and SAG12 form new groups or subgroups as observed in other species, suggesting specific gene loss occurred in Arabidopsis. Recent gene duplicates were also identified in these two species, but they are limited to the SAG12 subfamily and were all derived from local duplication. Expression profiling revealed diverse patterns of different family members over various tissues. Furthermore, the evolution characteristics of PLCP genes were also compared and discussed. Our findings provide a useful reference to characterize PLCP genes and investigate the family evolution in Euphorbiaceae and species beyond.

  7. Building Supply Systems from Scratch: The Case of the Castor Bean for Biodiesel Chain in Minas Gerais, Brazil

    Directory of Open Access Journals (Sweden)

    Kassia Watanabe


    Full Text Available The present study contributes to identifying obstacles to the development of a local biodiesel agro-industrial system (AGS in the state of Minas Gerais, Brazil. The research questions are: “How do local social characteristics influence the organizational effectiveness of agents involved in the joint production effort?”; and “How can the institutional arrangement of biodiesel production be described?” The method adopted is the case study, focused on family farmers served by the Family Farmers Rural Extension and Technical Assistance Company (EMATER. This state organization introduced castor beans (Ricinus communis L. to family farmers as an alternative crop to supply a processing plant (Darcy Ribeiro Biodiesel Plant—DRBP in northern Minas Gerais state, Brazil. These family farmers are not horizontally organized, and sign individual contracts with DRBP. The paper concludes that the primary obstacle to developing the biodiesel AGS with castor beans in Minas Gerais is the lack of horizontal organization among family farmers.

  8. Computational identification and phylogenetic analysis of the oil-body structural proteins, oleosin and caleosin, in castor bean and flax. (United States)

    Hyun, Tae Kyung; Kumar, Dhinesh; Cho, Young-Yeol; Hyun, Hae-Nam; Kim, Ju-Sung


    Oil bodies (OBs) are the intracellular particles derived from oilseeds. These OBs store lipids as a carbon resource, and have been exploited for a variety of industrial applications including biofuels. Oleosin and caleosin are the common OB structural proteins which are enabling biotechnological enhancement of oil content and OB-based pharmaceutical formations via stabilizing OBs. Although the draft whole genome sequence information for Ricinus communis L. (castor bean) and Linum usitatissimum L. (flax), important oil seed plants, is available in public database, OB-structural proteins in these plants are poorly indentified. Therefore, in this study, we performed a comprehensive bioinformatic analysis including analysis of the genome sequence, conserved domains and phylogenetic relationships to identify OB structural proteins in castor bean and flax genomes. Using comprehensive analysis, we have identified 6 and 15 OB-structural proteins from castor bean and flax, respectively. A complete overview of this gene family in castor bean and flax is presented, including the gene structures, phylogeny and conserved motifs, resulting in the presence of central hydrophobic regions with proline knot motif, providing an evolutionary proof that this central hydrophobic region had evolved from duplications in the primitive eukaryotes. In addition, expression analysis of L-oleosin and caleosin genes using quantitative real-time PCR demonstrated that seed contained their maximum expression, except that RcCLO-1 expressed maximum in cotyledon. Thus, our comparative genomics analysis of oleosin and caleosin genes and their putatively encoded proteins in two non-model plant species provides insights into the prospective usage of gene resources for improving OB-stability. Copyright © 2012 Elsevier B.V. All rights reserved.

  9. Identification and functional expression of a type 2 acyl-CoA:diacylglycerol acyltransferase (DGAT2) in developing castor bean seeds which has high homology to the major triglyceride biosynthetic enzyme of fungi and animals. (United States)

    Kroon, Johan T M; Wei, Wenxue; Simon, William J; Slabas, Antoni R


    Seed oil from castor bean (Ricinus communis) contains high amounts of hydroxy fatty acid rich triacylglycerols (TAGs) that can serve as raw material for production of bio-based products such as nylon, cosmetics, lubricants, foams, and surfactants. Diacylglycerol acyltransferase (DGAT) catalyses the terminal reaction in the acyl-CoA dependent Kennedy pathway of triglyceride biosynthesis. There is still some debate whether there are three or four enzymes in yeast that have DGAT activity and catalyse the synthesis of TAG but of these the DGAT2 homologue Dga1 contributes in a major way to TAG biosynthesis. Here we report on the cloning of a cDNA for DGAT2 from castor bean and prove its biological activity following expression in yeast and enzymatic assays using diricinolein as the acceptor and ricinoleoyl-CoA as the donor. Previous reports of DGAT in castor have focussed on DGAT1 which has little amino acid sequence homology to DGAT2. Expressional studies demonstrate that DGAT2 is 18-fold more highly expressed in seeds than in leaves and shows temporal specific expression during seed development. In contrast, DGAT1 shows little difference in expression in seeds versus leaves. We conclude that in castor bean DGAT2 is more likely to play a major role in seed TAG biosynthesis than DGAT1.

  10. Bayesian integration of isotope ratio for geographic sourcing of castor beans. (United States)

    Webb-Robertson, Bobbie-Jo; Kreuzer, Helen; Hart, Garret; Ehleringer, James; West, Jason; Gill, Gary; Duckworth, Douglas


    Recent years have seen an increase in the forensic interest associated with the poison ricin, which is extracted from the seeds of the Ricinus communis plant. Both light element (C, N, O, and H) and strontium (Sr) isotope ratios have previously been used to associate organic material with geographic regions of origin. We present a Bayesian integration methodology that can more accurately predict the region of origin for a castor bean than individual models developed independently for light element stable isotopes or Sr isotope ratios. Our results demonstrate a clear improvement in the ability to correctly classify regions based on the integrated model with a class accuracy of 60.9 ± 2.1% versus 55.9 ± 2.1% and 40.2 ± 1.8% for the light element and strontium (Sr) isotope ratios, respectively. In addition, we show graphically the strengths and weaknesses of each dataset in respect to class prediction and how the integration of these datasets strengthens the overall model.

  11. Bayesian Integration of Isotope Ratio for Geographic Sourcing of Castor Beans

    Directory of Open Access Journals (Sweden)

    Bobbie-Jo Webb-Robertson


    Full Text Available Recent years have seen an increase in the forensic interest associated with the poison ricin, which is extracted from the seeds of the Ricinus communis plant. Both light element (C, N, O, and H and strontium (Sr isotope ratios have previously been used to associate organic material with geographic regions of origin. We present a Bayesian integration methodology that can more accurately predict the region of origin for a castor bean than individual models developed independently for light element stable isotopes or Sr isotope ratios. Our results demonstrate a clear improvement in the ability to correctly classify regions based on the integrated model with a class accuracy of 60.9±2.1% versus 55.9±2.1% and 40.2±1.8% for the light element and strontium (Sr isotope ratios, respectively. In addition, we show graphically the strengths and weaknesses of each dataset in respect to class prediction and how the integration of these datasets strengthens the overall model.

  12. Ectopic overexpression of castor bean LEAFY COTYLEDON2 (LEC2) in Arabidopsis triggers the expression of genes that encode regulators of seed maturation and oil body proteins in vegetative tissues. (United States)

    Kim, Hyun Uk; Jung, Su-Jin; Lee, Kyeong-Ryeol; Kim, Eun Ha; Lee, Sang-Min; Roh, Kyung Hee; Kim, Jong-Bum


    The LEAFY COTYLEDON2 (LEC2) gene plays critically important regulatory roles during both early and late embryonic development. Here, we report the identification of the LEC2 gene from the castor bean plant (Ricinus communis), and characterize the effects of its overexpression on gene regulation and lipid metabolism in transgenic Arabidopsis plants. LEC2 exists as a single-copy gene in castor bean, is expressed predominantly in embryos, and encodes a protein with a conserved B3 domain, but different N- and C-terminal domains to those found in LEC2 from Arabidopsis. Ectopic overexpression of LEC2 from castor bean under the control of the cauliflower mosaic virus (CaMV) 35S promoter in Arabidopsis plants induces the accumulation of transcripts that encodes five major transcription factors (the LEAFY COTYLEDON1 (LEC1), LEAFY COTYLEDON1-LIKE (L1L), FUSCA3 (FUS3), and ABSCISIC ACID INSENSITIVE 3 (ABI3) transcripts for seed maturation, and WRINKELED1 (WRI1) transcripts for fatty acid biosynthesis), as well as OLEOSIN transcripts for the formation of oil bodies in vegetative tissues. Transgenic Arabidopsis plants that express the LEC2 gene from castor bean show a range of dose-dependent morphological phenotypes and effects on the expression of LEC2-regulated genes during seedling establishment and vegetative growth. Expression of castor bean LEC2 in Arabidopsis increased the expression of fatty acid elongase 1 (FAE1) and induced the accumulation of triacylglycerols, especially those containing the seed-specific fatty acid, eicosenoic acid (20:1(Δ11)), in vegetative tissues.

  13. Ectopic overexpression of castor bean LEAFY COTYLEDON2 (LEC2) in Arabidopsis triggers the expression of genes that encode regulators of seed maturation and oil body proteins in vegetative tissues☆ (United States)

    Kim, Hyun Uk; Jung, Su-Jin; Lee, Kyeong-Ryeol; Kim, Eun Ha; Lee, Sang-Min; Roh, Kyung Hee; Kim, Jong-Bum


    The LEAFY COTYLEDON2 (LEC2) gene plays critically important regulatory roles during both early and late embryonic development. Here, we report the identification of the LEC2 gene from the castor bean plant (Ricinus communis), and characterize the effects of its overexpression on gene regulation and lipid metabolism in transgenic Arabidopsis plants. LEC2 exists as a single-copy gene in castor bean, is expressed predominantly in embryos, and encodes a protein with a conserved B3 domain, but different N- and C-terminal domains to those found in LEC2 from Arabidopsis. Ectopic overexpression of LEC2 from castor bean under the control of the cauliflower mosaic virus (CaMV) 35S promoter in Arabidopsis plants induces the accumulation of transcripts that encodes five major transcription factors (the LEAFY COTYLEDON1 (LEC1), LEAFY COTYLEDON1-LIKE (L1L), FUSCA3 (FUS3), and ABSCISIC ACID INSENSITIVE 3 (ABI3) transcripts for seed maturation, and WRINKELED1 (WRI1) transcripts for fatty acid biosynthesis), as well as OLEOSIN transcripts for the formation of oil bodies in vegetative tissues. Transgenic Arabidopsis plants that express the LEC2 gene from castor bean show a range of dose-dependent morphological phenotypes and effects on the expression of LEC2-regulated genes during seedling establishment and vegetative growth. Expression of castor bean LEC2 in Arabidopsis increased the expression of fatty acid elongase 1 (FAE1) and induced the accumulation of triacylglycerols, especially those containing the seed-specific fatty acid, eicosenoic acid (20:1Δ11), in vegetative tissues. PMID:24363987

  14. Antifungal Efficacy of Myrtus communis Linn


    Sadeghi Nejad; Erfani Nejad; Yusef Naanaie; Zarrin


    Background The ethanolic extract of Myrtus communis Linn. leaves was assayed in vitro as a growth inhibitor against opportunistic fungi such as Candida and Aspergillus species. Myrtus communis Linn. (Family, Myrtaceae) is an aromatic evergreen shrub or small tree. It is native to the Mediterranean region. Objectives This study aimed to assess antifungal activity (in vitro) of the ethanolic extracts of Myrtus communis leaves as a g...

  15. Green Beans


    Sherwood, Brianne; Inman, Elizabeth


    Green beans are thought to have originated in Peru and spread through South and Central America by Indian tribes. Spanish explorers introduced them into Europe in the 16th century. Surveys indicate that 60% of commercially grown green beans are produced in the United States. Particularly, Illinois, Michigan, New York, and Wisconsin produce the greatest amount of green beans in the United States.

  16. Genomic DNA Methylation Analyses Reveal the Distinct Profiles in Castor Bean Seeds with Persistent Endosperms1 (United States)

    Yang, Tianquan; Dong, Xue; Li, De-Zhu


    Investigations of genomic DNA methylation in seeds have been restricted to a few model plants. The endosperm genomic DNA hypomethylation has been identified in angiosperm, but it is difficult to dissect the mechanism of how this hypomethylation is established and maintained because endosperm is ephemeral and disappears with seed development in most dicots. Castor bean (Ricinus communis), unlike Arabidopsis (Arabidopsis thaliana), endosperm is persistent throughout seed development, providing an excellent model in which to dissect the mechanism of endosperm genomic hypomethylation in dicots. We characterized the DNA methylation-related genes encoding DNA methyltransferases and demethylases and analyzed their expression profiles in different tissues. We examined genomic methylation including CG, CHG, and CHH contexts in endosperm and embryo tissues using bisulfite sequencing and revealed that the CHH methylation extent in endosperm and embryo was, unexpectedly, substantially higher than in previously studied plants, irrespective of the CHH percentage in their genomes. In particular, we found that the endosperm exhibited a global reduction in CG and CHG methylation extents relative to the embryo, markedly switching global gene expression. However, CHH methylation occurring in endosperm did not exhibit a significant reduction. Combining with the expression of 24-nucleotide small interfering RNAs (siRNAs) mapped within transposable element (TE) regions and genes involved in the RNA-directed DNA methylation pathway, we demonstrate that the 24-nucleotide siRNAs played a critical role in maintaining CHH methylation and repressing the activation of TEs in persistent endosperm development. This study discovered a novel genomic DNA methylation pattern and proposes the potential mechanism occurring in dicot seeds with persistent endosperm. PMID:27208275

  17. Deficiências de macronutrientes no estado nutricional da mamoneira cultivar Iris Deficiencies of macronutrients on nutritional status of castor bean cultivar Iris

    Directory of Open Access Journals (Sweden)

    José Lavres Junior


    Full Text Available Os objetivos deste trabalho foram avaliar o efeito da deficiência dos macronutrientes no crescimento e estado nutricional da mamoneira (Ricinus communis L. e a obtenção do quadro sintomatológico das deficiências de N, P, K, Ca, Mg e S. Cultivou-se Ricinus communis L. cultivar Iris em solução nutritiva, tendo como tratamentos soluções completa e deficientes em N, P, K, Ca, Mg e S. Foram determinadas a concentração indireta de clorofila, a atividade da redutase do nitrato, os teores solúveis de N (NO3-, P (H2PO4- e K+ e realizados testes rápidos para N, P e K. As deficiências de N, Ca, S e Mg foram as que mais restringiram a produção de massa de matéria seca, na ordem decrescente: N>Ca>S>Mg>K>P. Os maiores acúmulos de macronutrientes, no tratamento completo, foram observados nas raízes e no limbo das folhas inferiores. As concentrações críticas para N e Ca, ambas no limbo das folhas superiores e, Mg, no pecíolo das inferiores foram, respectivamente, 46,7, 13,8 e 6,5 g kg-1. As deficiências influenciaram as leituras do clorofilômetro. A atividade da redutase do nitrato guardou relação direta com a determinação da clorofila. Os teores de N (NO3-, P (H2PO4- e K+ foram menores nas folhas deficientes em N, P e K, respectivamente, o mesmo acontecendo quando avaliadas pela análise de toque.The objectives of this work were to evaluate the effect of macronutrient deficiencies on growth and on nutritional status of castor beans (Ricinus communis L., and to obtain the symptoms of the lack of N, P, K, Ca, Mg and S. Nutrient solutions containing all macronutrients and those from which one of these elements was omitted were the treatments used. The following determinations were made: chlorophyll (indirectly, nitrate reductase activity, NO3--N, H2PO4--P and K+, both on soluble fractions, and by spot tests. Deficiencies of N, Ca, S and Mg were the most limiting for dry matter production, followed in decreasing order by those of K and

  18. Secondary metabolites and bioactivities of Myrtus communis


    Mahmoud I Nassar; El-Sayed A Aboutabl; Rania F Ahmed; Ezzel-Din A El-Khrisy; Khaled M Ibrahim; Amany A Sleem


    Background: Myrtus species are characterized by the presence of phenolic acids, flavonoids, tannins, volatile oils and fatty acids. They are remedies for variety of ailments. This study therefore investigated medicinal effects of Myrtus communis L. Methods: Bioactivity studies of Myrtus communis L. leaves were carried out on volatile oil, 7% methanol and aqueous extracts and the isolated compounds myricetin 3-O-β-glucopyranoside, myricetin 3-O-∝-rhamnopyranoside and gallic acid. Results: Dete...

  19. Antifungal Efficacy of Myrtus communis Linn

    Directory of Open Access Journals (Sweden)

    Sadeghi Nejad


    Full Text Available Background The ethanolic extract of Myrtus communis Linn. leaves was assayed in vitro as a growth inhibitor against opportunistic fungi such as Candida and Aspergillus species. Myrtus communis Linn. (Family, Myrtaceae is an aromatic evergreen shrub or small tree. It is native to the Mediterranean region. Objectives This study aimed to assess antifungal activity (in vitro of the ethanolic extracts of Myrtus communis leaves as a growth inhibitor against 24 clinical isolates of Candida, including C. albicans, C. glabrata, and C. tropicalis also three species of Aspergillus, including A. niger, A. flavus, and A. terreus. Materials and Methods The ethanolic extract of myrtle leaves was prepared by maceration method and minimal inhibitory concentration (MIC of Myrtus communis leaves extract was determined by agar-well diffusion technique. Amphotericin B and clotrimazole were used as the positive control in this assay. Results The minimal inhibitory concentration (MICs values of Myrtus communis leaves extract ranged 0.625-5.0 µg/µL and 5-40 µg/µL against tested Candida spp. and Aspergillus spp., respectively. Conclusions Results revealed that the ethanolic extract of Myrtus communis leaves have antifungal potency against both pathogenic tested fungi, and it can be used as a natural antifungal agent.

  20. Protein (Viridiplantae): 389551 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)


  1. Metal concentration in plant tissues of Ricinus communis L. (Castor oil)

    African Journals Online (AJOL)

    SLO) contaminated soil at concentrations of 1-6% (w/w, oil/soil). Plant height and stem girth were depressed by spent lubricating oil at concentrations of 2% (w/w) and above. One percent (1%) spent lubricating oil in soil promoted growth of ...

  2. Neuroprotective effect of undecylenic acid extracted from Ricinus communis L. through inhibition of μ-calpain. (United States)

    Lee, Eunyoung; Eom, Ji-Eun; Kim, Hye-Lin; Kang, Da-Hye; Jun, Kyu-Yeon; Jung, Duk Sang; Kwon, Youngjoo


    The key neuropathological features of Alzheimer's disease are abnormal deposition of Aβ plaques and insoluble Aβ peptides in extracellular brain and intracellular neurofibril tangles induced by abnormal tau hyperphosphorylation. μ-Calpain is one of the factors that bridge these Aβ- and hyperphosphorylated tau-mediated pathological pathways. Undecylenic acid (UDA), a naturally occurring unsaturated fatty acid, was discovered as a μ-calpain inhibitor by screening a chemical library using a substrate specific μ-calpain assay method. UDA inhibited Aβ oligomerization and Aβ fibrillation and reversed Aβ-induced neuronal cell death. In addition, UDA scavenged ROS and reversed the levels of proapoptotic proteins induced by ROS in SH-SY5Y cells. UDA inhibited μ-calpain activity with better potency than the known peptide-like μ-calpain inhibitor, MDL28170, in SH-SY5Y and HEK293T cells transfected with the catalytic subunit of μ-calpain. These results suggest that UDA is a novel non-peptide-like μ-calpain inhibitor with good cell permeability and potent neuroprotective effect. Copyright © 2012 Elsevier B.V. All rights reserved.

  3. Accumulation of Heavy Metals in Ricinus communis L. from Mn Contaminated Area

    Directory of Open Access Journals (Sweden)

    YI Xin-yu


    Full Text Available Xiangbi No. 1 and Zibi No. 7 were planted in the Mn contaminated soils to explore its potential of ecological remediation and ener-gy utilization in the areas of Mn contaminated site. The major nutrient elements and the concentrations of heavy metals(Mn, Pb, Zn, Cu and Cr in different parts(root, branch and leaf and topsoil samples were detected after entering into the period of reproductive growth.The results showed that the average content of Mn was as high as 7 884.96 mg·kg-1,which exceeded 6.5 times of national soil environmental quality standard(level 2.The mean level of Mn in tissues of Xiangbi No. 1 was found to be in the sequence of root>leaf>branch,whereas,the mean level of Mn in different parts of Zibi No. 7 was found to be in the order of leaf>fruit>branchroot respectively. The average concentration of Mn in the leaf reached the peak value(765.43 mg·kg-1,which was higher than Xiangbi No.1 about 79.53%.The leaf/root ratios of Pb, Cu, Cr contents in Zibi No. 7 were higher than those of Xiangbi No. 1 samples.The accumulation and translocation in plants was affect-ed by different heavy metal elements in soils.The results demonstrated that Zibi No. 7 had a better uptake and translocation capacity of Mn,Pb,Cu and Cr, meanwhile,plants of two species had differences in accumulation and translocation ability and were proved to possess good Mn-tolerance ability for remediation of heavy metal contaminated soils.

  4. Rhipicephalus sanguineus (Acari: Ixodidae) female ticks exposed to castor oil (Ricinus communis): an ultrastructural overview. (United States)

    Sampieri, B R; Furquim, K C S; Nunes, P H; Camargo-Mathias, M I


    Tick control has been accomplished through the use of synthetic acaricides, which has created resistant individuals, as well as contaminating the environment and nontarget organisms. Substances of plant origin, such as oils and extracts of eucalyptus and neem leaves, have been researched as an alternative to replace the synthetic acaricides. Ricinoleic acid esters from castor oil have recently been shown as a promising alternative in eliminating bacterial contamination during ethanol fermentation, by acting as an effective biocide. The same positive results have been observed when these esters are added to the food given to tick-infested rabbits. This study tested the effect of these substance on the reproductive system of Rhipicephalus sanguineus females, added to rabbit food, more specifically on oogenesis. For this, four groups were established: four control groups (CG1, CG2, CG3, and CG4) and four treatment groups (TG1, TG2, TG3, and TG4) with one rabbit in each (New Zealand White), used as hosts. After full 4 days feeding (semi-engorgement), the females were collected and had their ovaries extracted. In this study, it was observed that R. sanguineus females exposed to esters had their ovaries modified, which was demonstrated through transmission electron microscopy techniques. The addition of ricinoleic esters to the diet of tick-infested rabbits revealed how toxic such substances are for the cytoplasmic organelles of oocytes and pedicel cells. These compounds can change the morphophysiology of germ and somatic cells, consequently influencing their viability and, therefore, confirming that the ricinoleic acid esters from castor oil are a promising substance in the control of R. sanguineus.

  5. Diversity of Castor (Ricinus communis L.) in Ethiopia አህፅርኦት ...

    African Journals Online (AJOL)

    In Ethiopia, Castor grows as annual in the low lands to small tree perennial in the high lands. India, china, Brazil and USA are the major castor producers globally. Castor bears seeds that containing highly valuable industrial oil. Castor oil is unique among vegetable oil because it is the only commercial source of a ...

  6. Polyurethane resins derived from castor oil (Ricinus communis) for tibial crest deviation in dogs

    International Nuclear Information System (INIS)

    Maria, P.P.; Padilha Filho, J.G.; Canola, J.C.; Castro, M.B.


    Medial patellar luxation is one of the most common orthopedic problems in small breeds of dogs and tibial crest deviation is a frequent accompaining anatomical abnormality. For that reason, the purpose of this study was to evaluate the behavior of castor oil derived polyurethane implants when apllied to experimental defects created on the medial side of the proximal tibia of normal puppies. Twelve dogs were randomly divided in 3 groups of 4 animals and were submitted to the same treatment. Histopathological study was performed respectively at 30 (GI), 60 (GII) and 90 (GIII) days post-surgery. Evaluations methods included clinical assessment, radiology, gross and macroscopic study, tomography and statistical analysis. Clinically, there were no signs of implant rejection. Radiology revealed intense periosteal reaction and new bone formation. On gross examination, there was thickening and lateral deviation of the tibial crest and new bone neoformation. On microscopic examination, there was fibrous tissue around the polyurethane, periosteal proliferation on the medial side of the tibia and no bone proliferation towards the implant. Cat scans reveled lateral deviation of the tibial crest in eleven animals, which was statistically significant (p [pt

  7. Structural and Spectroscopic Properties of the Peroxodiferric Intermediate of Ricinus communis Soluble Delta(9) Desaturase

    Czech Academy of Sciences Publication Activity Database

    Srnec, Martin; Rokob, Tibor András; Schwartz, J. K.; Kwak, Y.; Rulíšek, Lubomír; Solomon, E. I.


    Roč. 51, č. 5 (2012), s. 2806-2820 ISSN 0020-1669 R&D Projects: GA MŠk LC512 Institutional research plan: CEZ:AV0Z40550506 Keywords : diferrous non-heme iron enzyme * QM/MM calculations * delta-9 * desaturase * reaction mechanism Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 4.593, year: 2012

  8. Effects The N-Hexane Extract Of Castor ( Ricinus Communis ) Seeds ...

    African Journals Online (AJOL)

    Materials and methods: The seeds of Castor plant were obtained, dried, pulverized, and exhaustively soxhlex extracted in N-hexane at 750C for 72 hours. This was dissolved in appropriate volumes of corn oil to make a concentration of 20mg/ml. The extract was administered to twenty –five (25) adult wistar rats at a dose of ...

  9. Entomopathogenic fungi associated with Ixodes ricinus ticks

    DEFF Research Database (Denmark)

    Kalsbeek, Vibeke; Frandsen, F.; Steenberg, Tove


    The objective of this study was to demonstrate the occurrence of entomopathogenic fungi on Ixodes ricinus ticks in relation to the tick stage, engorgement and season. Ticks were collected from the vegetation, from small rodents and from deer. All entomopathogenic fungi found belonged to the Hypho......The objective of this study was to demonstrate the occurrence of entomopathogenic fungi on Ixodes ricinus ticks in relation to the tick stage, engorgement and season. Ticks were collected from the vegetation, from small rodents and from deer. All entomopathogenic fungi found belonged....... ricinus population, since females were the most frequently infected stage....

  10. Produtividade da mamona irrigada com esgoto doméstico tratado Productivity of castor bean irrigated with treated domestic sewage

    Directory of Open Access Journals (Sweden)

    Neyliane C. de Souza


    Full Text Available A mamoneira (Ricinus communis L., oleaginosa de relevante importância econômica e social no Nordeste, apresenta-se como alternativa para a produção do biodiesel. O experimento objetivou avaliar, em escala real, os aspectos produtivos da cultura da mamona irrigada com esgoto doméstico tratado. Empregou-se o sistema de microaspersão; a delimitação experimental foi de quatro repetições e quatro tratamentos: T1: água do poço e adubação recomendada; T2: esgoto doméstico tratado e adubação recomendada; T3: somente esgoto doméstico tratado e T4: esgoto doméstico tratado e metade da adubação recomendada. Verificou-se que as unidades irrigadas com esgoto tratado superaram as irrigadas com água, em quase todas as variáveis analisadas. A produtividade foi maior nos tratamentos irrigados com esgoto e adubação (T2 e (T4, alcançando produtividade de 1.986 e 1.412 kg ha-1, respectivamente. O teor de óleo contido nas sementes foi analisado e não apresentou nenhuma diferença significativa entre os tratamentos com adubação (T1, T2 e T4, sendo que o tratamento com esgoto tratado (T3 forneceu baixíssimos teores de óleo na semente.The castor bean (Ricinus communis L., an oil crop of economic and social importance for the Northeast region of Brazil, can be used for biodiesel production. The experiment aimed to evaluate, at a realistic scale, the productive aspects of the castor bean irrigated with treated sewage. Microsprinkler irrigation method was selected, and the experimental set-up consisted of four repetitions and four different treatments: well water and recommended fertilization (T1; treated wastewater and recommended fertilization (T2; treated wastewater without external recommended fertilization (T3; and treated wastewater and half of recommended fertilization (T4. It was found that units irrigated with treated sewage exceeded the ones irrigated with well water in almost all variables. The highest productivities were in the

  11. Acquisition through common slave (servus communis

    Directory of Open Access Journals (Sweden)

    Bogunović Mirjana B.


    Full Text Available Common slave (servus communis is a slave who belongs to two masters. Both masters may entirely dispose with the slave because their joint ownership allows it. However, acquisitions through common slave (servus communis is not that clear. Does a slave evenly oblige co-masters or only the master on whose behalf he has acted? Is it possible for a slave to work in the interest of one master and oblige another? Who does the unconscientious slave correspond to, the third party or a betrayed master? This paper will analyze the opinions of two Roman iurists, which will partly solve doubts that this institute causes.

  12. Volatile Constituents of Ferula communis L. subsp. communis Growing Spontaneously in Greece

    Directory of Open Access Journals (Sweden)

    Stavroula Manolakou


    Full Text Available The essential oils of Greek Ferula communis subsp. communis from different plant parts were obtained by hydrodistillation and analyzed by means of GC and GC-MS. Ninety three compounds were identified in the total essential oils. Sesqui terpenes were the most dominant class of compounds in the leaves and inflorescences oils, while infructescences oils were rich in monoterpenes with α-pinene (35.2-40.6% being the dominant component.

  13. Simulación de los cambios de carbono orgánico del suelo en sistema de cultivo con higuerilla por el modelo RothC Simulation of soil organic carbon changes in crop systems with castor bean using the RothC model

    Directory of Open Access Journals (Sweden)

    Lucila González Molina


    Full Text Available El objetivo del presente trabajo fue la simulación de los cambios del carbono orgánico del suelo (COS, por el modelo RothC, en razón del cambio de uso de suelo del sistema tradicional - asociación maíz-calabaza (TMC - a sistemas con higuerilla (Ricinus communis: multiestratos (MUL, callejones (CALL y monocultivo de higuerilla (HIG. Las simulaciones del COS se hicieron para las profundidades de suelo 0-20 y 0-40 cm, para el periodo de 1980-2040, considerándose como línea base al sistema TMC. Las tasas de cambio de COS estimadas con el RothC, en ambas profundidades de suelo, estuvieron en 0,5-1,2, 0,4-0,8, 0,3-0,5 y 0,04-0,1 Mg ha-1 de C por año en los sistemas HIG, MUL, CALL y TMC, respectivamente, y fueron consistentes con las reportadas en la literatura. El desempeño del RothC tuvo 89% de eficiencia (EF, con R²=0,9, lo que muestra que este modelo puede usarse con información temporal del COS escasa, información de la historia de uso de suelo y mediciones de la entrada de residuos vegetales aéreos y subterráneos en el suelo.The objective of this work was to simulate, by the RothC model, the changes in soil organic carbon (SOC caused by changes of land use - from the traditional maize-squash (TMC association to systems with castor bean (Ricinus communis: multilayer (MUL, alleys (CALL and monoculture (HIG. SOC simulations were performed for 0-20 and 0-40 cm soil depths, for the period 1980-2040, considering the TMC system as the base line. SOC change rates estimated with RothC, for both soil depths, were 0.5-1.2, 0.4-0.8, 0.3-0.5 and 0.04-0.1 Mg ha-1 C per year in the HIG, MUL, CALL and TMC systems, respectively, and were consistent with those reported in the literature. RothC perfomance had 89% efficiency (EF and R² = 0.9, which shows that this model can be used with scarce SOC temporal information, information on the history of land use, and with input measurements of aerial and underground plant residues in the soil.

  14. Pré-condicionamento das sementes de mamoneira para o teste de tetrazólio = Preconditioning of castor bean seeds for the tetrazolium test

    Directory of Open Access Journals (Sweden)

    Carolina Maria Gaspar-Oliveira


    Full Text Available O objetivo do trabalho foi padronizar a metodologia de pré-condicionamento das sementes de mamoneira (Ricinus communis L. para a avaliação do potencial fisiológico pelo teste de tetrazólio. Testaram-se os seguintes métodos de pré-condicionamento: sementes com tegumento entre papel umedecido a 30, 35 e 40ºC por 6, 8, 10, 12, 14, 16 e 18h; sementes sem tegumento entre papel umedecido e sementes com tegumento imersas em água a 25, 30, 35 e 40º C por 1, 2, 3, 4, 5 e 6h. Após o pré-condicionamento, removeu-se o tegumento das sementes, que foram cortadas no sentido do comprimento e imersas na solução de tetrazólio a 0,2%, por 120 min., a 35ºC. Avaliaram-se a porcentagem de germinação das sementes, o teor de água, antes e após a embebição, e a uniformidade na coloração das sementes após o teste de tetrazólio. O delineamento experimental foi inteiramente casualizado, e a comparação de médias realizada pelo teste de Tukey a 5% de probabilidade. Concluiu-se que o pré-condicionamento para o teste detetrazólio deve ser realizado nas sementes de mamoneira com tegumento, entre papel toalha umedecido, a 35ºC por 12h para que os resultados desse teste assemelhem-se aos obtidos no teste de germinação.This research had the objective of standardizing the methodology for preconditioning of castor bean (Ricinus communis L. seeds for the evaluation of their physiological potential by the tetrazolium test. The evaluated seed preconditioning methods were: seeds with coatbetween moist paper towel at 30, 35 and 40ºC for 6, 8, 10, 12, 14, 16 and 18 hours; and seeds without coat between moist paper towel; and seeds with coat immersed in water, at 25, 30, 35 and 40ºC for 1, 2, 3, 4, 5 and 6 hours. After preconditioning, the seed coat was removed, the seeds were cut lengthwise, and immersed in tetrazolium solution at a concentration of 0.2% for 120 minutes at 35ºC. The seeds’ germination percentage, moisture content before and after

  15. Crescimento e produção de bagas da mamoneira irrigada com água residuária doméstica Growth and production of seeds of castor bean crop irrigated with domestic wastewater

    Directory of Open Access Journals (Sweden)

    Luis N. Rodrigues


    Full Text Available Objetivou-se avaliar os efeitos da irrigação com água de esgoto doméstico sobre o crescimento e a produção de bagas da mamoneira (Ricinus communis L, em ambiente protegido. A pesquisa foi desenvolvida entre novembro/2005 e maio/2006, no Centro de Tecnologia e Recursos Naturais (CTRN da UFCG-PB. Foram estudados 5 níveis de reposição da evapotranspiração da cultura - ETc, (0,60, 0,75, 0,90, 1,05 e 1,20 em duas cultivares de mamoneira (BRS Nordestina e BRS Paraguaçu, constituindo um fatorial 5 x 2, com três repetições, no delineamento estatístico de blocos ao acaso. Avaliaram-se altura de planta, diâmetro caulinar, número de folhas e área foliar aos 48, 90, 132 e 174 dias após a semeadura (DAS. A produção de sementes foi avaliada na última data. A mamoneira irrigada com 0,60 ETc, em relação a 1,05 da ETc, aos 174 DAS, teve a altura de planta, o diâmetro caulinar, o número de folhas, a área foliar e produção de sementes reduzidos em 23,45, 16,14, 26,23, 44,06 e 50,59%, respectivamente. O crescimento em altura da cultivar BRS Paraguaçu foi significativamente maior, ao longo do ensaio, enquanto a BRS Nordestina se destacou em área foliar, no início do ciclo. A produção de bagas foi semelhante nas duas cultivares Não houve interação significativa entre os fatores estudados.The objective of this study was to evaluate the impacts of irrigation with domestic wastewater on growth and production of seeds of castor bean (Ricinus communis L in greenhouse. The research was carried out between November, 2005 and May, 2006, at Centro de Tecnologia e Recursos Naturais (CTRN of UFCG - PB. A randomized block design was used, with 5 x 2 scheme of factorial analysis with three replications, testing 5 levels of replacement of crop evapotranspiration - ETc (0.60, 0.75, 0.90, 1.05 and 1.20 ETc and 2 cultivars of castor bean (BRS Nordestina and BRS Paraguaçu. Plant height, stem diameter, number of leaves and leaf area were evaluated

  16. In vitro micropropagation of almond (Amygdalus communis L. cv ...

    African Journals Online (AJOL)



    Jun 17, 2008 ... This method here in described will be useful for the rapid multiplication of almond (A. communis L. cv. Nonpareil) in commercial exploitation. Key words: Amygdalus communis Nonpareil, micropropagation, zygotic embryos, in vitro. INTRODUCTION. The almond (Prunus dulcis, syn. Prunus amygdalus ...

  17. Exotic Rickettsiae in Ixodes ricinus: fact or artifact?

    NARCIS (Netherlands)

    Tijsse-Klasen, E.; Fonville, M.; Overbeek, van L.S.; Reimerink, J.H.J.; Sprong, H.


    Several pathogenic Rickettsia species can be transmitted via Ixodes ricinus ticks to humans and animals. Surveys of I. ricinus for the presence of Rickettsiae using part of its 16S rRNA gene yield a plethora of new and different Rickettsia sequences. Interpreting these data is sometimes difficult

  18. Efeito de deficiência de micronutrientes no estado nutricional da mamoneira cultivar Iris Micronutrient deficiency effect on the nutritional status of the castor bean cultivar Iris

    Directory of Open Access Journals (Sweden)

    Anderson Lange


    Full Text Available Os objetivos deste trabalho foram caracterizar os sintomas visuais de deficiência de micronutrientes e avaliar efeitos desses micronutrientes no estado nutricional da mamoeira. O experimento foi realizado em casa de vegetação utilizando-se solução nutritiva, de fevereiro a junho de 2003. Foram utilizadas plantas de mamoneira (Ricinus communis L. do híbrido comercial Íris. Os tratamentos foram: completo, omissão de B, omissão de Cu, omissão de Fe, omissão de Mn, omissão de Mo e omissão de Zn. A omissão de B, Fe e Mn resultou em sintomas característicos de deficiência. Os sintomas se desenvolveram primeiramente em plantas deficientes em Fe ou Mn, seguidas das deficientes em boro. A produção de matéria seca foi afetada na seguinte ordem: Fe>Mn>B. Tanto as folhas superiores como as inferiores refletem o estado nutricional da mamoneira em relação a B, Cu, Fe, Mn, Mo e Zn. O teor de clorofila nas folhas, medido em unidades SPAD, foi influenciado pela omissão dos micronutrientes.The objectives of this work were to characterize the visual symptoms of micronutrient deficiencies, and their effects on nutricional status of castor beans. A greenhouse experiment with nutrient solutions was carried out from February to June, 2003. The commercial hybrid "Iris" was used. Treatments were as follows: complete, minus B, minus Cu, minus Fe, minus Mn, minus Mo, and minus Zn. Symptoms of deficiency were observed in the treatments with omission of B, Fe, and Mn. The symptoms firstly developed when either Fe or Mn was deficient, and they were followed by those deficient in boron. Dry matter yield was affected in the decreasing order: Fe>Mn>B. Both upper and lower leaves reflect the nutritional status of the castor bean with respect to B, Cu, Fe, Mn, Mo and Zn. Leaf chlorophyll, as measured in units SPAD, was influenced by the treatments.

  19. Germination of beans and snap beans seed

    Directory of Open Access Journals (Sweden)

    Zdravković Milan


    Full Text Available The aim of this study was to investigate germination of good bean seed of the variety Galeb and the bad bean seed of the same variety. We were also interested in germination of bean and snap bean seed damaged by grain weevil, and in germination of the seed treated by freezing which was aimed at controlling grain weevil by cold. We also recorded the differences between bean and snap bean seed, which was or was not treated by freezing in laboratory conditions. This investigation was carried out by applying the two factorial block system. The obtained results were evaluated by the variance analysis and x2 test These results suggest that the bean seed of a bad fraction had low levels of germination, but still it was present. Although the seed of good appearance was carefully selected, germination was slightly lower than it should have been. The seed with the large amount of grain weevils performed a high level germination in laboratory conditions. There were no differences in germination between the seed injured by grain weevil either in beans or in snap beans. As for the seed treated or untreated by freezing, there also were no differences between beans and snap beans. .

  20. A Density Map of the Tick-Borne Encephalitis and Lyme Borreliosis Vector Ixodes ricinus (Acari: Ixodidae) for Germany. (United States)

    Brugger, Katharina; Boehnke, Denise; Petney, Trevor; Dobler, Gerhard; Pfeffer, Martin; Silaghi, Cornelia; Schaub, Günter A; Pinior, Beate; Dautel, Hans; Kahl, Olaf; Pfister, Kurt; Süss, Jochen; Rubel, Franz


    The castor bean tick Ixodes ricinus (L.) is the principal vector for a variety of viral, bacterial, and protozoan pathogens causing a growing public-health issue over the past decades. However, a national density map of I. ricinus is still missing. Here, I. ricinus nymphs in Germany were investigated by compiling a high-resolution map depicting the mean annually accumulated nymphal density, as observed by monthly flagging an area of 100 m 2 Input data comprise ticks collected at 69 sampling sites. The model domain covers an area of about 357,000 km 2 (regional scale). Two negative binomial regression models were fitted to the data to interpolate the tick densities to unsampled locations using bioclimatic variables and land cover, which were selected according to their significance by the Akaike information criterion (AIC). The default model was fitted to the complete dataset resulting in AIC = 842. An optimized model resulted in a significantly better value of AIC = 732. Tick densities are very low in urban (green) areas. Maximum annual densities up to 1,000 nymphs per 100 m 2 are observed in broad-leaved forests. The tick maps were verified by leave-one-out cross-validation. Root mean square errors of RMSE = 137 and RMSE = 126 nymphs per 100 m 2 were estimated for the two models, respectively. These errors are of the order of the interannual variation of the tick densities. The compilation of a high-resolution density map of unfed nymphal I. ricinus for Germany provides a novel, nationwide insight into the distribution of an important disease vector. © The Authors 2016. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email:

  1. Desenvolvimento e produção de duas cultivares de mamoneira sob estresse salino Growth and production of two cultivars of castor bean under saline stress

    Directory of Open Access Journals (Sweden)

    Sérvulo M. S. Silva


    Full Text Available Visando estudar o comportamento de duas cultivares BRS Paraguaçu e BRS Energia de mamoneira (Ricinus communis L., irrigadas com quatro níveis de condutividade elétrica da água de irrigação (CEa: 0,7; 2,7; 4,7 e 6,7 dS m-1, a 25 °C, conduziu-se um experimento no delineamento inteiramente casualizado, com 3 repetições, em esquema fatorial 4 x 2. As variáveis avaliadas foram altura de planta, diâmetro de caule, número de folhas, área foliar e consumo diário de água pela planta aos 80 e 100 dias após semeadura, número de dias para 1ª inflorescência, altura do 1º racemo aos 100 dias após semeadura, dias para colheita, número de frutos no 1º cacho, peso dos frutos, das sementes e de 10 sementes aos 150 DAS. A salinidade da água de irrigação interferiu na altura de planta, diâmetro do caule, número de folhas, área foliar e consumo de água, a partir de 4,7 dS m-1 aos 80 e 100 DAS, nas duas cultivares. Verificou-se, na cultivar BRS Energia maior precocidade na emissão da 1ª inflorescência e maior altura do racemo, enquanto na cultivar BRS Paraguaçu se obteve menor produção de frutos e de sementes e maior peso de 10 sementes.With the objective of studying the behavior of two cultivars BRS Paraguaçu and BRS Energy of castor bean (Ricinus communis L., irrigated with four levels of electrical conductivity of irrigation water (ECw: 0.7; 2.7; 4.7 and 6.7 dS m-1, at 25 °C, an experiment was conducted in a randomized design with 3 replications, in a factorial scheme of 4 x 2. The variables measured were: plant height, stem diameter, leaf area, number of leaves and water consumption by plant at 80 and 100 days after sowing (DAS, number of days for emission of first inflorence and height of first cluster at 100 DAS, days to harvest, number of fruits in the 1st cluster, weight of fruits, and 10 seeds at 150 DAS. The salinity of the irrigation water significantly affected the plant height, stem diameter, number of leaves, leaf

  2. Energetic potential of the vegetable oil of Canton Tosagua ricinus comunnis

    International Nuclear Information System (INIS)

    Brito Sauvanell, Angel Luis; Saltos Giler, Manuel; Lopez Vera, Mario Rene; Rodriguez Moreira, Marat


    The plantation of Higuerilla (Ricinus communis L.) can be considered as an alternative of high energy, economic and social importance for the climatic conditions of the Ecuador's coastal area, due to its easy cultivation, the resistance to the drought is being considered as a plant generator for rent and work for small farmers in the geography of Tosagua, Rocafuerte and other towns in the vicinity to Manabi province. The castor oil is a xerofila and heliofila plantation in other words , adapted to arid atmospheres and sun loving. The paper shows a characterization carried out to higuerilla seeds in the biotechnology laboratory of to the Polytechnic High School of Calceta (ESPAM). The seeds collected in different villages near Tosagua, let us estimate the energy potential of the Higuerilla plantation like energy source for the Manabi province. The industrialization of the product obtained from Higuerilla plantation would have as advantage the pure vegetable oil (PVO) as main by-product, besides it can obtain a cake rich in protein. The castor oil cake can be used to restore out lands; also, it contains products that can be used for the control of nematodes of the ground, due to the high toxicity that confers it toxic protein denominated ricine. (author)

  3. O hodowli in vitro wycinków z łodygi rącznika (Ricinus communis L. i wilczomlecza tyrlicza (Euphorbia lathyris L. [In vitro culture of segment from shoots of Ricinus communis L. and Euphorbia lathyris L.

    Directory of Open Access Journals (Sweden)

    B. Wojciechowska


    Full Text Available The influence of certain factors on the growth and differentiation of the material investigated was analysed. Histo- and organogenesis are discussed together with the anatomy of the coalescence of the segments.

  4. Descriptores botánicos para caracterizar germoplasmas de Ricinus communis de diferentes zonas de Costa Rica

    Directory of Open Access Journals (Sweden)

    Paola Solera-Steller


    Los resultados mostraron valores significativos para la longitud del racimo y el número de frutos por racimo, la razón largo/ancho del fruto, peso del fruto, la razón del largo/ancho de la semilla y el peso de la semilla, con correlaciones superiores a un 45%. Sin embargo, el ACP mostró que existe una alta variabilidad entre los datos, algo muy común entre individuos silvestres, debido principalmente a su forma de dispersión y a la gran cantidad de zonas de vida muestreadas. Para la CJA, se pudieron observar tres grupos ordenados principalmente por las correlaciones entre el tamaño del racimo y el número de frutos, la razón largo/ancho y el peso del fruto y la razón largo/ancho y peso de la semilla, los cuales pueden usarse como indicadores para la caracterización morfológica de la higuerilla proveniente de todo el país.

  5. Phloem flow and sugar transport in Ricinus communis L. is inhibited under anoxic conditions of shoot or roots

    NARCIS (Netherlands)

    Peuke, A.D.; Gessler, A.; Trumbore, S.; Windt, C.W.; Homan, N.; Gerkema, E.; As, van H.


    Anoxic conditions should hamper the transport of sugar in the phloem, as this is an active process. The canopy is a carbohydrate source and the roots are carbohydrate sinks.By fumigating the shoot with N2 or flooding the rhizosphere, anoxic conditions in the source or sink, respectively, were

  6. High-yield production of biodiesel by non-catalytic supercritical methanol transesterification of crude castor oil (Ricinus communis)

    International Nuclear Information System (INIS)

    Román-Figueroa, Celián; Olivares-Carrillo, Pilar; Paneque, Manuel; Palacios-Nereo, Francisco Javier; Quesada-Medina, Joaquín


    The synthesis of biodiesel from crude castor oil in a catalyst-free process using supercritical methanol in a batch reactor was investigated, studying the evolution of intermediate products as well as the conversion of triglycerides and the yield of FAMEs (fatty acid methyl esters) (biodiesel). Experiments were carried out in a temperature range of 250–350 °C (10–43 MPa) at reaction times of 15–90 min for a methanol-to-oil molar ratio of 43:1. Maintaining thermal stability of biodiesel is one of the most important concerns in high-yield supercritical biodiesel production. Hence, thermal decomposition degree of FAMEs was also investigated in different reaction conditions. The maximum yield of FAMEs (96.5%) was obtained at 300 °C (21 MPa) and 90 min. Under these conditions, the conversion of triglycerides was complete, the yield of intermediate products was low (3.29 and 1.41% for monoglycerides and diglycerides, respectively), and thermal decomposition of FAMEs did not occur. The maximum degree of thermal decomposition (80.9%) was produced at 350 °C (43 MPa) and 90 min. Methyl ricinoleate, whose fatty acid chain was the most abundant (88.09 mol%) in castor oil, was very unstable above 300 °C and 60 min, leading to low yields of FAMEs under these conditions. - Highlights: • Supercritical synthesis of biodiesel from crude castor oil was investigated. • Supercritical methanolysis of crude castor oil reached a high yield of FAMEs. • Ricinoleic acid methyl ester was very unstable above 300 °C and 60 min reaction.

  7. Toxicity of six plant extracts and two pyridine alkaloids from Ricinus communis against the malaria vector Anopheles gambiae (United States)

    The African malaria vector, Anopheles gambiae s.s., is known to feed selectively on certain plants for sugar sources. However, the adaptive significance of this behavior especially on how the extracts of such plants impact on the fitness of this vector has not been explored. This study determined th...

  8. Produção de fitomassa e acúmulo de nutrientes por plantas de cobertura e cultivo da mamona em sucessão no sistema plantio direto Cover crops phytomass and nutrient accumulation and castor bean grown in succession under no-tillage system

    Directory of Open Access Journals (Sweden)

    André Godoy da Silva


    Full Text Available Objetivou-se avaliar a produção de matéria seca (MS e o acúmulo de nutrientes pela crotalária (Crotalaria juncea L. e pelo milheto (Pennisetum glaucum (L. R. Brown, em cultivos isolado e consorciado, e o efeito do manejo mecânico da palhada no desempenho da cultura da mamona (Ricinus communis L., em sucessão, na fase de implantação do sistema plantio direto. O experimento foi instalado em um Nitossolo Vermelho (Rhodic Kandiudox, em Botucatu, São Paulo (SP (22°58'S, 48°23'W e 765m de altitude. O delineamento utilizado foi o de blocos casualizados, em parcelas subdivididas, com quatro repetições. As parcelas foram constituídas por três coberturas vegetais: crotalária - cultivar 'IAC-KR1'; milheto - cultivar 'BN 2'; e consórcio crotalária + milheto. As subparcelas foram constituídas pela ausência e presença do manejo mecânico da palhada com triturador horizontal 20 dias após o manejo químico. O milheto produziu maior quantidade de MS e apresentou maiores teores de K, Mg e S na parte aérea, enquanto a crotalária apresentou maiores teores de N e Ca. O milheto acumulou mais N, P, K, Mg e S na parte aérea, enquanto a crotalária acumulou maior quantidade de Ca. A produtividade de grãos da mamoneira foi maior em sucessão ao consórcio crotálaria + milheto e na ausência do manejo mecânico da palhada.The objective of this study was to evaluate aboveground matter production and nutrients accumulation by sunnhemp (Crotalaria juncea L. and pearl millet (Pennisetum glaucum (L. R. Brown, in sole crop and intercropped, and the effect of straw mulch mechanical management on castor bean (Ricinus communis L. performance, in notillage system establishment. The experiment was carried out on a Rhodic Kandiudox, in Botucatu, SP, Brazil (22°58'S, 48°23'W and 765m above sea level. A randomized block design, in a splitplot scheme, with four replications, was used. The plots were composed by three cover crops: sunnhemp - cv. 'IAC-KR1

  9. Babesia species in questing Ixodes ricinus, Sweden. (United States)

    Karlsson, Maria E; Andersson, Martin O


    Babesiosis is an emerging tick-transmitted zoonosis in large parts of the world. In Sweden, the occurrence and diversity of Babesia species is largely unknown. In order to estimate the exposure to Babesia from infected ticks, we collected questing Ixodes ricinus from several sites across southern Sweden during two consecutive field seasons and investigated the occurrence of Babesia species. We report for the first time the occurrence of the zoonotic species Babesia venatorum in Swedish ticks, with a prevalence of 1%. We also detected B. microti (prevalence 3.2%) and B. divergens (prevalence 0.2%). The incidence of Babesia in questing ticks is substantially lower than that of several other tick-borne diseases in Sweden. Nevertheless, babesiosis should not be neglected as a possible diagnosis following tick bites in humans and animals in Sweden. Copyright © 2015 Elsevier GmbH. All rights reserved.

  10. Divergência genética entre acessos e cultivares de mamoneira por meio de estatística multivariada Genetic divergence on castor bean accesses and cultivars through multivariate analysis

    Directory of Open Access Journals (Sweden)

    Mauro Nóbrega da Costa


    Full Text Available O objetivo deste trabalho foi avaliar a divergência genética entre acessos e cultivares de mamoneira (Ricinus communis L. e utilizá-la como critério na escolha de genitores que viabilizem, a partir de hibridações, a formação de populações segregantes. Os tratamentos foram representados pelos acessos BRA 4871, BRA 2968, BRA 5550 e BRA 7722 Papo-de-gia, e as cultivares BRS 188 Paraguaçu, BRS 149 Nordestina, IAC-80, Mirante-10 e Pernambucana Melhorada. As características analisadas foram: início do florescimento (FR, número de racemos por planta (NRP, comprimento efetivo do racemo primário (CR, altura de planta (AP, potencial produtivo (PP e teor de óleo nas sementes (TO. A divergência genética foi estimada por meio de estatística multivariada, com base em variáveis canônicas e análise de agrupamento, tendo-se empregado a distância euclidiana média. Houve a formação de dois grupos: o grupo I formado por oito genótipos e o grupo II por apenas um genótipo, a cultivar Mirante-10. Apesar de a cultivar Mirante-10 ter sido a mais divergente, não deve ser recomendada para hibridação, por sua baixa média de desempenho. As demais cultivares também apresentam restrições para hibridação, por serem bastante similares. As variáveis que mais contribuíram para a divergência genética foram FR, AP, TO e CR.This work aimed to evaluate genetic divergence among castor bean (Ricinus communis L. cultivars, in order to enable the choice of parents which make the formation of segregating populations possible. Accesses BRA 4871, BRA 2968, BRA 5550 and BRA 7722 Papo-de-gia, and cultivars BRS 188 Paraguaçu, BRS 149 Nordestina, IAC-80, Mirante-10 and Pernambucana Melhorada were evaluated. Characteristics analyzed were: days to flowering, number of racemes per plant, length of pistillate region of main raceme, plant height, potential yield, and seed oil content. The genetic divergence among accesses and cultivars was studied by

  11. Evaluation of Anti-Acetylcholinesterase Activity and Antioxidant Potential of Ricinine (a Central Nervous System Stimulant) Isolated from Ricinius communis

    International Nuclear Information System (INIS)

    Khan, B.; Rasheed, A.; Yasin, K.A.; Ahmed, M.N.; Ghous, T.; Andleeb, S.


    In the current research, an attempt has been made to isolate ricinine (an alkaloid) from the leaves of Ricinus communis L. for its possible applications in the prevention and treatment of Alzheimer's disease. The anti-acetylcholinesterase (anti-AChE) and antioxidant activity of ricinine was determined. Antioxidant and metal chelating activity was evaluated by 2,2-azinobis-(3-ethylbenzothiazoline-6-sulfonic acid) radical cation (ABTS./sup +/) decolorisation and ferrozine metal chelating assays. Screening of the AChE inhibitory activity by flow injection method showed significant inhibitory action with IC/sub 50/ values of 54.5 μg/ml. The stronger ABTS.+ scavenging potential (IC/sub 50/ 63.80μg/ml) as well as metal chelating potential (IC/sub 50/ 31.27 μg/ml) of ricinine was observed. We conclude that because of high yield (4mg/200g of dried material), the compound may be considered as a promising cognition-enhancing drug for the treatment and prevention of human dementia. (author)

  12. Antimicrobial activity of the essential oil of Myrtus Communis L ...

    African Journals Online (AJOL)

    The development of microbial resistance to antibiotics is a global concern. The present study was carried out to determine the composition and the antimicrobial potential of the essential oil of Myrtus communis L. against 13 pathogenic strains responsible of many infections. The results show that levels of MIC observed ...

  13. Spatiotemporal features of microsporogenesis in the cycad species Macrozamia communis. (United States)

    Yan, Xiaodong; Bai, Mei; Ning, Xiping; Ouyang, Haibo; Zhang, Shouzhou; Yang, Ming; Wu, Hong


    • Spatiotemporal features of microsporogenesis may provide important clues about the evolution of microsporogenesis in seed plants. One cellular feature that attracts special attention is advance cell wall ingrowths (ACWIs) at future cytokinetic sites in microsporocytes since they have been found only in species of an ancient lineage of angiosperms, Magnolia, and in much less detail, of an ancient lineage of gymnosperms, cycads. Further investigation into microsporogenesis in a cycad species may yield knowledge critical to understanding the establishment of ACWIs as an important feature for comparative studies of microsporogenesis in seed plants.• Bright-field and epifluorescence microscopy, confocal laser scanning microscopy, and transmission electron microscopy were used to investigate the microsporogenic process in Macrozamia communis, a species in the Zamiaceae family of cycads.• In prophase-II microsporocytes in M. communis, ACWIs form as a callose ring between the newly formed nuclei and are not accompanied by cytokinetic apparatuses such as mini-phragmoplasts, wide tubules, or wide tubular networks. Shortly after the second nuclear division, new ACWIs, albeit thinner than the previous ACWIs, form between the newly formed nuclei. Subsequent cell plate formation in the planes of the ACWIs typically results in tetragonal tetrads.• Cytokinesis at the cell periphery is initiated earlier than cell plate formation in the cell interior in microsporogenesis in M. communis. The cellular features uncovered in M. communis may serve as useful reference features for comparative studies of microsporogenesis in plants. © 2015 Botanical Society of America, Inc.

  14. Essential oil composition and antioxidant activity of two Juniperus communis L. varieties growing wild in Serbia

    Directory of Open Access Journals (Sweden)

    Rajčević Nemanja F.


    Full Text Available The genus Juniperus L. (Cupressaceae consists of ca. 67 species and 34 varieties. Juniperus communis L. grows on dry hills or mountainous tracts and is widely distributed in the northern hemisphere. A typical variety J. communis L. var. communis was collected in Deliblatska peščara (Deliblato Sands and variety J. communis L. var. saxatilis Pall. in Kopaonik Mountain. Needle essential oils were obtained using Clevenger apparatus and analyzed using GC/MS and GC/FID. Antioxidant activity of essential oils was evaluated using DPPH assay. A total of 78 compounds were detected and identified. Both oils are characterized by high abundance of monoterpenes. The main constituents of J. communis var. communis essential oil were sabinene (39.4%, α-pinene (13.3%, myrcene (4.7% and terpinen-4-ol (3.7%, while J. communis var. saxatilis essential oil had α-pinene (34.9%, sabinene (20.3%, δ-3-carene (6.4% and germacrene B (6.3% as the most abundant components. DPPH test showed IC50 values 0.66 mg/ml for J. communis var. communis and 0.32 mg/ml for J. communis var. saxatilis. Although antioxidant activity was weaker than used standards (BHT and L-ascorbic acid it is still significant.

  15. The extensible alloscutal cuticle of the tick, Ixodes ricinus

    DEFF Research Database (Denmark)

    Andersen, Svend Olav; Roepstorff, Peter


    The proteins in the distensible alloscutal cuticle of the blood-feeding tick, Ixodes ricinus, have been characterized by electrophoresis and chromatography, two of the proteins were purified and their total amino acid sequence determined. They show sequence similarity to cuticular proteins from...

  16. Rickettsiae in questing Ixodes ricinus ticks in the Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Venclíková, Kristýna; Rudolf, Ivo; Mendel, Jan; Betášová, Lenka; Hubálek, Zdeněk


    Roč. 5, č. 2 (2014), s. 135-138 ISSN 1877-959X Institutional support: RVO:68081766 Keywords : Ixodes ricinus * Anaplasma phagocytophilum * Rickettsia spp. * Rickettsia helvetica * Rickettsia monacensis * Candidatus Neoehrlichia mikurensis Subject RIV: EE - Microbiology, Virology Impact factor: 2.718, year: 2014

  17. Identification of Salp15 homologues in Ixodes ricinus ticks

    NARCIS (Netherlands)

    Hovius, J. W. R.; Ramamoorthi, N.; van't Veer, C.; de Groot, K. A.; Nijhof, A. M.; Jongejan, F.; van Dam, A. P.; Fikrig, E.


    The 15-kDa Ixodes scapularis salivary gland protein Salp15 protects Borrelia burgdorferi sensu stricto from antibody-mediated killing and facilitates infection of the mammalian host. In addition, Salp 15 has been shown to inhibit T-cell activation. We determined whether Ixodes ricinus, the major

  18. Características agronômicas de cultivares de mamona em função do local de cultivo e da época de semeadura no Rio Grande do Sul Characteristics of castor bean cultivars according to the environmental crop and sowing season in Rio Grande do Sul State, Brazil

    Directory of Open Access Journals (Sweden)

    Jacson Zuchi


    Full Text Available A mamona (Ricinus communis L. é uma planta oleaginosa anual e, ocasionalmente, bienal em regiões tropicais, com ciclo médio de 150 dias para a maioria das cultivares anuais e de 120 a 130 dias para cultivares anuais precoces. O objetivo deste trabalho foi avaliar características agronômicas de cultivares das mamonas 'Al Guarany 2002', 'IAC 80', 'IAC 226' e 'BRS 188 Paraguaçu'em função do ambiente de cultivo e da época de semeadura. As cultivares foram semeadas entre o primeiro e o quinto dia dos meses de novembro e dezembro, na Embrapa Clima Temperado, em Pelotas, Rio Grande do Sul. Cada época teve 12 unidades experimentais em três blocos casualizados. A emergência, a altura de planta e de inserção do primeiro cacho, o período de florescimento e colheita e o ataque de pragas e doenças foram avaliados e analisados com o programa WinStat Versão 2.0. O comportamento entre as cultivares diferiu entre locais de cultivo e época de semeadura. A inserção do cacho foi mais alta, e as florações e colheitas foram mais tardias em plantas da segunda época de semeadura. Danos por pragas e doenças e os descritores morfológicos da planta de mamona apresentaram diferenças entre os locais de cultivo.Castor bean (Ricinus communis L. is an oleaginous plant with annual cycle and occasionally biennial cycle in tropical areas, with mean cycle of 150 days for the majority of annual cultivars and 120 to 130 days for annual early cultivars. The objective of this study was to evaluate the agronomic characteristics of castor cultivars according to environmental crop and sowing season. The experiment was conduced at Embrapa Clima Temperado - Pelotas/RS, in two places. The castor cultivars used in this research were 'Al Guarany 2002', 'IAC 80', 'IAC 226' and 'BRS 188 Paraguaçu', which were sown in two sowing times: the first was in early November (between 1st and 5st and the second was in early December (between 1st and 5st. Each sowing season was

  19. Truncus arteriosus communis in combination with cor triatriatum sinsitrum. (United States)

    Klusmeier, Elmar; Haas, Nikolaus A; Sandica, Eugen


    Truncus arteriosus communis is a rare CHD, accounting for only 1% of all congenital cardiac abnormalities. It has been associated with other malformations of the heart, mainly truncal valve (bicuspid/quadricuspid) and aortic arch abnormalities such as right, interrupted, and hypoplastic aortic arch. Cor tratriatrum sinistrum is another rare CHD, and it has been associated with other cardiac defects such as anomalous pulmonary venous drainage, ventricular septal defect, coarctation of the aorta, and tetralogy of Fallot. The combination of truncus arteriosus communis and cor tratriatrum sinistrum has not been reported so far. This case study describes the diagnosis of a unique case, including these two very rare cardiac defects and the successful surgical treatment thereafter.

  20. Diversity of Babesia in Ixodes ricinus ticks in Poland. (United States)

    Welc-Falęciak, R; Bajer, A; Paziewska-Harris, A; Baumann-Popczyk, A; Siński, E


    The aims of this study were: (1) to estimate Babesia prevalence in the most common species of tick in Poland, Ixodes ricinus, in two recreational areas (Urwitałt in the Mazury Lake District and Bielański Forest in Warsaw), and (2) to evaluate the molecular diversity of Babesia isolates in questing I. ricinus in Poland. Questing ticks were collected from vegetation in forest areas in Urwitałt near Mikołajki and in Bielański Forest (Warsaw). Purified genomic DNA was used with specific primers to amplify a fragment of the Babesia spp. 18S rRNA gene. Tick-drag indices for I. ricinus were high in both study areas, reaching somewhat higher values in Urwitałt than in Bielański Forest. The overall prevalence of Babesia spp. in examined ticks was 1.6%. In Urwitałt, two strains of B. microti were identified using rRNA sequences: the enzootic Munich strain and an isolate close to the zoonotic Jena strain. The proportion of infections due to these two strains in questing ticks reversed over a six-year period. During 3 years of study in Bielański Forest, all Babesia isolates obtained from I. ricinus were identical to Babesia sp. EU1 (B. venatorum), previously recognized as an agent of human babesiosis. This study has confirmed the presence of enzoonotic and zoonotic Babesia species/strains in the abundant human-biting tick I. ricinus in recreational areas in Poland. It has also shown that the distribution of different genotypes has changed over time, however the reasons for these fluctuations still remain to be investigated.

  1. MRI in soils: determination of water concent changes due to root water uptake by means of a multi-slice-multi-echo sequence (MSME)

    NARCIS (Netherlands)

    Pohlmeier, A.; Vergeldt, F.; Gerkema, E.; As, van H.; Dusschoten, van D.; Vereecken, H.


    Root water uptake by ricinus communis (castor bean) in fine sand was investigated using MRI with multiecho sampling. Before starting the experiments the plants germinated and grew for 3 weeks in a cylindrical container with a diameter of 9 cm. Immediately before the MRI experiments started, the

  2. Evaluation of the safety and efficacy of Lesquerella fendleri seed and oils as poultry feed additives (United States)

    Lesquerella (Lesquerella fendleri (Gray) Wats) is an oil seed plant capable of growth over a large geographic area of the southwestern U.S. The seed oil contains hydroxyfatty acids, useful in a variety of industrial products, and can replace imported castor bean oil (Ricinus communis L.). Lesquere...

  3. Nutritive value and biochemical changes in broiler chickens fed ...

    African Journals Online (AJOL)

    Castor bean (Ricinus communis Linn.) is an important oilseed rich in protein but rarely used as livestock feed due to antinutritional factors. Castor seed was detoxified using combined processing techniques of moist heating and fermentation (5 and 7- day) or lye treatment and fed to150 day-old Anak 2000 broiler chicks at ...

  4. Pancreatic lipase

    African Journals Online (AJOL)



    Dec 5, 2011 ... bean ”glyoxysomes” (Ricinus communis) have been characterized and have respectively a molecular weight of 65 and 62 kDa (Lin and Huang, 1984; Maeshima and. Beevers, 1985). However, and despite several studies, our knowledge about these plant enzymes is still in-. *Corresponding author.

  5. Effects of Defatted Jack Bean Flour and Jack Bean Protein ...

    African Journals Online (AJOL)

    This study evaluated the effects of substituting wheat flour with defatted Jack bean flour and Jack bean protein concentrate on bread quality. Jack bean flour milled from the seed nibs was defatted with n-hexane and part of the defatted flour (DJF) extracted in acid medium (pH; 4.5) for protein concentrate (JPC). Both the DJF ...

  6. Borreliae in Ixodes ricinus ticks feeding on humans

    Czech Academy of Sciences Publication Activity Database

    Hubálek, Zdeněk; Halouzka, Jiří; Juřicová, Zina


    Roč. 18, č. 3 (2004), s. 228-231 ISSN 0269-283X R&D Projects: GA ČR GA206/03/0726; GA AV ČR IBS6093007 Institutional research plan: CEZ:AV0Z6093917 Keywords : Borrelia burgdorferi * Ixodes ricinus * Lyme disease Subject RIV: FN - Epidemiology, Contagious Diseases ; Clinical Immunology Impact factor: 1.405, year: 2004

  7. Longitudinal surveillance of the tick Ixodes ricinus for borreliae

    Czech Academy of Sciences Publication Activity Database

    Hubálek, Zdeněk; Halouzka, Jiří; Juřicová, Zina


    Roč. 17, č. 1 (2003), s. 46-51 ISSN 0269-283X R&D Projects: GA ČR GA206/00/1204; GA AV ČR IBS6093007 Institutional research plan: CEZ:AV0Z6093917 Keywords : Borrelia burgdorferi * Ixodes ricinus * Lyme disease Subject RIV: FN - Epidemiology, Contagious Diseases ; Clinical Immunology Impact factor: 1.040, year: 2003

  8. Ixodes ricinus defensins attack distantly-related pathogens

    Czech Academy of Sciences Publication Activity Database

    Tonk, M.; Cabezas-Cruz, A.; Valdés, James J.; Rego, Ryan O. M.; Grubhoffer, Libor; Estrada--Pena, A.; Vilcinskas, A.; Kotsyfakis, Michalis; Rahnamaeian, M.


    Roč. 53, č. 2 (2015), s. 358-365 ISSN 0145-305X R&D Projects: GA MŠk(CZ) EE2.3.30.0032; GA ČR GAP502/12/2409 EU Projects: European Commission(XE) 278976 Institutional support: RVO:60077344 Keywords : Antimicrobial peptide * Defensin * Ixodes ricinus * Listeria monocytogenes * Staphylococcus aureus * Staphylococcus epidermidis * Escherichia coli * Pseudomonas aeruginosa * Fusarium spp Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.620, year: 2015

  9. resistance in the common bean

    African Journals Online (AJOL)



    Jul 12, 2010 ... Two studies, one on performance of six common bean parental genotypes and another on inheritance of resistance to Phaeosariopsis griseola (Pg) in the common bean were carried out in Malawi. Common bean entries namely; Chimbamba, Nasaka, RC 15, CAL 143 and Mexico 54 were evaluated on ...

  10. Surveillance of Ixodes ricinus ticks (Acari: Ixodidae) in Iceland. (United States)

    Alfredsson, Matthias; Olafsson, Erling; Eydal, Matthias; Unnsteinsdottir, Ester Rut; Hansford, Kayleigh; Wint, William; Alexander, Neil; Medlock, Jolyon M


    Ixodes ricinus is a three-host tick, a principal vector of Borrelia burgdorferi (s.l.) and one of the main vectors of tick-borne encephalitis (TBE) virus. Iceland is located in the North Atlantic Ocean with subpolar oceanic climate. During the past 3-4 decades, average temperature has increased, supporting more favourable conditions for ticks. Reports of I. ricinus have increased in recent years. If these ticks were able to establish in a changing climate, Iceland may face new threats posed by tick-borne diseases. Active field surveillance by tick flagging was conducted at 111 sites around Iceland from August 2015 to September 2016. Longworth mammal traps were used to trap Apodemus sylvaticus in southwestern and southern Iceland. Surveillance on tick importation by migratory birds was conducted in southeastern Iceland, using bird nets and a Heligoland trap. Vulpes lagopus carcasses from all regions of the country were inspected for ticks. In addition, existing and new passive surveillance data from two institutes have been merged and are presented. Continental probability of presence models were produced. Boosted Regression Trees spatial modelling methods and its predictions were assessed against reported presence. By field sampling 26 questing I. ricinus ticks (7 males, 3 females and 16 nymphs) were collected from vegetation from three locations in southern and southeastern Iceland. Four ticks were found on migratory birds at their arrival in May 2016. A total of 52 A. sylvaticus were live-trapped but no ticks were found nor on 315 V. lagopus carcasses. Passive surveillance data collected since 1976, reports further 214 I. ricinus ticks from 202 records, with an increase of submissions in recent years. The continental probability of presence model correctly predicts approximately 75% of the recorded presences, but fails to predict a fairly specific category of recorded presence in areas where the records are probably opportunistic and not likely to lead to

  11. Growth and production of castor bean under different levels of irrigation water salinity and nitrogen dosesCrescimento e produção da mamoneira cultivada sob diferentes níveis de salinidade da água de irrigação e doses de nitrogênio

    Directory of Open Access Journals (Sweden)

    Reginaldo Gomes Nobre


    Full Text Available The castor bean (Ricinus communis L. is a plant belonging to the family Euphorbiaceae, and stands for the rusticity and adaptation to adverse conditions of climate and soil, for the fast growth, high production and considerable oil content in its seeds. In this context, this study we conducted to evaluate the effect of different levels of irrigation water of salinity and nitrogen on the growth and yield of castor bean cv. BRS Energia. The experiment was conducted in lysimeters under field conditions, at the Centro de Ciências e Tecnologia Agroalimentar, of Universidade Federal de Campina Grande. A complete randomized block design in a 5 x 5 factorial design with three replications. Treatments included a combination of five levels of electrical conductivity of irrigation water (0.4, 1.4, 2.4, 3.4 and 4.4 dS m-1 and five doses of nitrogen (50, 75; 100, 125 and 150% of the recommended dose. The number of leaves, stem diameter, plant height, dry mass of stems and leaves, and fruit number in primary raceme of castor bean cv. BRS Energia were linearly and negatively affected by irrigation water salinity from 0.4 dS m-1, the dry mass of leaves and production of primary cluster are variables more sensitive to salt stress, increasing doses of nitrogen fertilization promoted at harvest, increase in dry weight of stem and leaves and number of fruit in primary cluster; applying increasing doses of nitrogen reduced the effect of salinity on stem diameter of castor bean cv. BRS Energia.A mamoneira (Ricinus communis L. é uma planta pertencente à família Euphorbiaceae que se destaca pela rusticidade e boa adaptação a condições adversas de clima e solo, apresentando rápido crescimento, elevada produção e considerável teor de óleo em suas sementes. Neste contexto, conduziuse esta pesquisa objetivando avaliar a influência da irrigação com água de diferentes concentrações salinas e doses de nitrogênio sobre o crescimento e a produção de

  12. Vaccination against Bm86 Homologues in Rabbits Does Not Impair Ixodes ricinus Feeding or Oviposition

    NARCIS (Netherlands)

    Coumou, Jeroen; Wagemakers, Alex; Trentelman, Jos J.; Nijhof, Ard M.; Hovius, Joppe W.


    Human tick-borne diseases that are transmitted by Ixodes ricinus, such as Lyme borreliosis and tick borne encephalitis, are on the rise in Europe. Diminishing I. ricinus populations in nature can reduce tick exposure to humans, and one way to do so is by developing an anti-vector vaccine against

  13. Faba bean in cropping systems

    DEFF Research Database (Denmark)

    Steen Jensen, Erik; Peoples, Mark B.; Hauggaard-Nielsen, Henrik


    impact on the environment and climate through new, more sustainable approaches to food production. The aims of this paper are to review the role of faba bean in global plant production systems, the requirements for optimal faba bean production and to highlight the beneficial effects of faba bean......The grain legume (pulse) faba bean (Vicia faba L.) is grown world-wide as a protein source for food and feed. At the same time faba bean offers ecosystem services such as renewable inputs of nitrogen (N) into crops and soil via biological N2 fixation, and a diversification of cropping systems. Even...... though the global average grain yield has almost doubled during the past 50 years the total area sown to faba beans has declined by 56% over the same period. The season-to-season fluctuations in grain yield of faba bean and the progressive replacement of traditional farming systems, which utilized...

  14. Sharing Beans with Friends (United States)

    Bell, Clare V.


    Teachers and researchers have known for decades that the use of storybooks can have a positive impact on students' experiences with mathematics. This article describes how first graders in an urban public school actively engage with mathematics by using the story "Bean Thirteen" as a context for developing number sense. This…

  15. African yam bean

    African Journals Online (AJOL)



    Jun 21, 2010 ... Responses of African yam bean (Sphenostylis stenocarpa) to supplementary application of potassium. (K) on soil were examined. Effects of the varying levels of potassium on vegetative growth, flowering, pod maturation, yield and yield components were also evaluated. There seems to be no significant.

  16. Deep Sequencing Analysis of the Ixodes ricinus Haemocytome.

    Directory of Open Access Journals (Sweden)

    Michalis Kotsyfakis


    Full Text Available Ixodes ricinus is the main tick vector of the microbes that cause Lyme disease and tick-borne encephalitis in Europe. Pathogens transmitted by ticks have to overcome innate immunity barriers present in tick tissues, including midgut, salivary glands epithelia and the hemocoel. Molecularly, invertebrate immunity is initiated when pathogen recognition molecules trigger serum or cellular signalling cascades leading to the production of antimicrobials, pathogen opsonization and phagocytosis. We presently aimed at identifying hemocyte transcripts from semi-engorged female I. ricinus ticks by mass sequencing a hemocyte cDNA library and annotating immune-related transcripts based on their hemocyte abundance as well as their ubiquitous distribution.De novo assembly of 926,596 pyrosequence reads plus 49,328,982 Illumina reads (148 nt length from a hemocyte library, together with over 189 million Illumina reads from salivary gland and midgut libraries, generated 15,716 extracted coding sequences (CDS; these are displayed in an annotated hyperlinked spreadsheet format. Read mapping allowed the identification and annotation of tissue-enriched transcripts. A total of 327 transcripts were found significantly over expressed in the hemocyte libraries, including those coding for scavenger receptors, antimicrobial peptides, pathogen recognition proteins, proteases and protease inhibitors. Vitellogenin and lipid metabolism transcription enrichment suggests fat body components. We additionally annotated ubiquitously distributed transcripts associated with immune function, including immune-associated signal transduction proteins and transcription factors, including the STAT transcription factor.This is the first systems biology approach to describe the genes expressed in the haemocytes of this neglected disease vector. A total of 2,860 coding sequences were deposited to GenBank, increasing to 27,547 the number so far deposited by our previous transcriptome studies

  17. Physicochemical and phytochemical standardization of berries of Myrtus communis Linn.

    Directory of Open Access Journals (Sweden)

    Sabiha Sumbul


    Full Text Available Purpose: Herbal medicines are gaining more and more attention all over the world due to their long historical clinical practice and less side effects. The major limitation with herbal medicines is that the lack of standardization technique. Initially, the crude drugs were identified by comparison only with the standard description available. Materials and Methods: Standardization of drugs means confirmation of its identity and determination of its quality and purity. The quality control standards of various medicinal plants, used in indigenous system of medicine, are significant nowadays in view of commercialization of formulations based on medicinal plants. The quality of herbal drugs is the sum of all factors, which contribute directly or indirectly to the safety, effectiveness, and acceptability of the product. Lack of quality control can affect the efficacy and safety of drugs that may lead to health problems in the consumers. Standardization of drugs is needed to overcome the problems of adulteration and is most developing field of research now. Therefore, there is an urgent need of standardized drugs having consistent quality. Results: The drug showed the presence of phyto-chemical constituents. Powdered drug was treated with different reagents and examined under UV light. Different reagents showed different colors of the drug at 2 wavelengths. The percentage of physiological active compounds viz. total phenolics, tannins, volatile oil, fixed oil, and alkaloids were also observed. Conclusion: Myrtus communis L. (Family: Myrtaceae is one of the important drug being used in Unani system of medicine for various therapeutic purposes. In this study, an attempt has been made to study berries of M. communis from physico-chemical and phytochemical standardization point of view.

  18. Infection of Ixodes ricinus (Acari: Ixodidae) by Borrelia burgdorferi sensu lato in North Africa (United States)

    Zhioua, E.; Bouattour, A.; Hu, C.M.; Gharbi, M.; Aeschliman, A.; Ginsberg, H.S.; Gern, L.


    Free-living adult Ixodes ricinus L. were collected in Amdoun, situated in the Kroumiry mountains in northwestern Tunisia (North Africa). Using direct fluorescence antibody assay, the infection rate of field-collected I. ricinus by Borrelia burgdorferi sensu lato was 30.5% (n = 72). No difference in infection rate was observed between male and female ticks. Spirochetes that had been isolated from I. ricinus from Ain Drahim (Kroumiry Mountains) in 1988 were identified as Borrelia lusitaniae (formerly genospecies PotiB2). This is the first identification of a genospecies of Borrelia burgdorferi sensu lato from the continent of Africa.

  19. Genetic structure and diversity in Juniperus communis populations in Saxony, Germany

    Directory of Open Access Journals (Sweden)

    Reim Stefanie


    Full Text Available In recent years, land use changes led to a rapid decline and fragmentation of J. communis populations in Germany. Population isolation may lead to a restricted gene flow and, further, to negative effects on genetic variation. In this study, genetic diversity and population structure in seven fragmented J. communis populations in Saxony, Germany, were investigated using nuclear microsatellites (nSSR and chloroplast single nucleotide polymorphism (cpSNP. In all Saxony J. communis populations, a high genetic diversity was determined but no population differentiation could be detected whatever method was applied (Bayesian cluster analysis, F-statistics, AMOVA. The same was true for three J. communis out-group samples originating from Italy, Slovakia and Norway, which also showed high genetic diversity and low genetic differences regarding other J. communis populations. Low genetic differentiation among the J. communis populations ascertained with nuclear and chloroplast markers indicated high levels of gene flow by pollen and also by seeds between the sampled locations. Low genetic differentiation may also provide an indicator of Juniper survival during the last glacial maximum (LGM in Europe. The results of this study serve as a basis for the implementation of appropriate conservation measures in Saxony.

  20. Effect of glycerine and essential oils (Anacardium occidentale and Ricinus communis on animal performance, feed efficiency and carcass characteristics of crossbred bulls finished in a feedlot system

    Directory of Open Access Journals (Sweden)

    Olga Teresa Barreto Cruz


    Full Text Available The effect of corn substitution by glycerine and essential oils on animal performance, apparent digestibility and red and white blood cells of crossbred bulls finished in feedlot was evaluated. Thirty bulls with average weight of 311±28.8 kg and 22±2 month-old were allocated in three diets: CON (without glycerine or essential oils, GLY (with glycerine and GEO (with glycerine and essential oils. The bulls were fed a diet of sorghum silage, cracked corn, soybean meal, urea, limestone and mineral salt. Three grams of cashew and castor oil/animal/day were included in GEO diet. Animals were kept in feedlot for 115 days and slaughtered at average weight of 467±40.6 kg. No differences (P<0.05 among diets regarding final body weight, average daily gain and feed conversion were reported. Ether extract intake was higher (P<0.05 in CON diet compared to the others. Dry matter, organic matter and crude protein digestibility was higher (P<0.05 in GLY diet compared to CON. Acid detergent fibre digestibility was higher (P<0.05 in CON compared to GLY diet. Nonfibrous carbohydrate, fibrous carbohydrate and ether extract digestibility were similar (P>0.05 among diets. No effect of glycerine and essential oil addition on total blood cholesterol, triglycerides, haemogram, leukogram and plasmatic proteins was observed. Corn replacement by glycerine and essential oils addition did not affect (P>0.05 carcass weight, dressing and conformation, carcass length and cushion thickness.

  1. Qualitative histologic evaluation of the tissue reaction to the polyurethane resin (ricinus communis - based biopolymer implantation assessed by light and scanning electron microscopy

    Directory of Open Access Journals (Sweden)

    Gustavo Campos Belmonte


    Full Text Available The tissue reaction of bone tissue accessed by light microscopy and scanning electron microscopy (SEM images after polyurethane resin implantation is presented in this study. Twenty four male rabbits were used, divided into two groups of 12 animals each (experimental group and control group in which full-thickness cranial defect was surgically created. At 30 and 90 days post operation 6 animals of each group were euthanized and bone samples were removed for analysis. The microscopic results indicated no inflammatory foreign body reaction, a perfect union between the polymer and surgical bone bed surface, lack of bone resorption and presence of a thin layer of osteogenic material covering the polymer surface in contact with the surgical bone bed. The SEM images demonstrate the porosity of the resin, with diameters from 120 to 500 µm. This important feature of this polymer is associated with its osteoconductivity, allowing the bone growth inside it, improving the integration between the material and bone tissue. These results confirm that polyurethane resin derived from Ricinuscommunis is an excellent bone substitute for use in repair surgery for great bone losses.

  2. Modification of whole flours of navy bean, pinto bean, black bean and chickpea by steam jet cooking and drum drying (United States)

    Whole bean flours of navy bean, pinto bean, black bean and chickpea were processed by excess steam jet cooking, drum drying, and milling to a state resembling the raw flours. Analysis of the structure and size of the particles, color, solubility and pasting characteristics, dietary fiber, and protei...

  3. Ixodes ticks belonging to the Ixodes ricinus complex encode a family of anticomplement proteins. (United States)

    Daix, V; Schroeder, H; Praet, N; Georgin, J-P; Chiappino, I; Gillet, L; de Fays, K; Decrem, Y; Leboulle, G; Godfroid, E; Bollen, A; Pastoret, P-P; Gern, L; Sharp, P M; Vanderplasschen, A


    The alternative pathway of complement is an important innate defence against pathogens including ticks. This component of the immune system has selected for pathogens that have evolved countermeasures. Recently, a salivary protein able to inhibit the alternative pathway was cloned from the American tick Ixodes scapularis (Valenzuela et al., 2000; J. Biol. Chem. 275, 18717-18723). Here, we isolated two different sequences, similar to Isac, from the transcriptome of I. ricinus salivary glands. Expression of these sequences revealed that they both encode secreted proteins able to inhibit the complement alternative pathway. These proteins, called I. ricinus anticomplement (IRAC) protein I and II, are coexpressed constitutively in I. ricinus salivary glands and are upregulated during blood feeding. Also, we demonstrated that they are the products of different genes and not of alleles of the same locus. Finally, phylogenetic analyses demonstrate that ticks belonging to the Ixodes ricinus complex encode a family of relatively small anticomplement molecules undergoing diversification by positive Darwinian selection.

  4. Seasonal distribution of Borreliae in Ixodes ricinus ticks in the Belgrade region

    Directory of Open Access Journals (Sweden)

    Milutinović Marija


    Full Text Available Green areas at four localities in the Belgrade region (Ada Ciganlija, Košutnjak, Miljakovac forest, and Mt. Avala were investigated in 2004. The aim of the research was to clarify the faunistic composition, relative abundance, and population dynamics of ticks, as well as the seasonal distribution of Borrelia burgdorferi sensu lato (sl in Ixodes ricinus. Two species of ticks were detected: Ixodes ricinus and Dermacentor reticulates. Relative abundance analysis revealed that the species Ixodes ricinus was predominant (97.41 %. Out of 942 Ixodes ricinus ticks, 188 (19.96 % were infected with Borrelia burgdorferi sl. The infection rate of adults by localities ranged from 19.16% to 30.99% (Mt. Avala and Ada Ciganlija, respectively.

  5. Experimental in vitro transmission of Babesia sp. (EU1) by Ixodes ricinus. (United States)

    Bonnet, Sarah; Brisseau, Nadine; Hermouet, Axelle; Jouglin, Maggy; Chauvin, Alain


    Babesia sp. (EU1), first characterized in 2003, has been implicated in human cases of babesiosis in Italy, Austria and Germany. It has been identified in roe deer and in its suspected tick vector, Ixodes ricinus, in several European countries. The aim of the present study was to validate the competence of I. ricinus as a vector of Babesia sp. (EU1) via experimental infections. For this purpose, a parasite strain isolated from roe deer was cloned in sheep erythrocytes. After experimental infections, parasite DNA was successfully amplified by PCR in both eggs and larvae originating from infected I. ricinus females and in the salivary glands of females exposed to Babesia sp. (EU1) as nymphs. We also demonstrate that infected females were able to transmit parasite DNA during a new blood meal. Together with previous epidemiological studies, these results validate I. ricinus as a competent vector for Babesia sp. (EU1).

  6. Vaccination against Bm86 Homologues in Rabbits Does Not Impair Ixodes ricinus Feeding or Oviposition.

    Directory of Open Access Journals (Sweden)

    Jeroen Coumou

    Full Text Available Human tick-borne diseases that are transmitted by Ixodes ricinus, such as Lyme borreliosis and tick borne encephalitis, are on the rise in Europe. Diminishing I. ricinus populations in nature can reduce tick exposure to humans, and one way to do so is by developing an anti-vector vaccine against tick antigens. Currently, there is only one anti-vector vaccine available against ticks, which is a veterinary vaccine based on the tick antigen Bm86 in the gut of Rhipicephalus microplus. Bm86 vaccine formulations cause a reduction in the number of Rhipicephalus microplus ticks that successfully feed, i.e. lower engorgement weights and a decrease in the number of oviposited eggs. Furthermore, Bm86 vaccines reduce transmission of bovine Babesia spp. Previously two conserved Bm86 homologues in I. ricinus ticks, designated as Ir86-1 and Ir86-2, were described. Here we investigated the effect of a vaccine against recombinant Ir86-1, Ir86-2 or a combination of both on Ixodes ricinus feeding. Recombinant Ixodes ricinus Bm86 homologues were expressed in a Drosophila expression system and rabbits were immunized with rIr86-1, rIr86-2, a combination of both or ovalbumin as a control. Each animal was infested with 50 female adults and 50 male adults Ixodes ricinus and tick mortality, engorgement weights and egg mass were analyzed. Although serum IgG titers against rIr86 proteins were elicited, no effect was found on tick feeding between the rIr86 vaccinated animals and ovalbumin vaccinated animals. We conclude that vaccination against Bm86 homologues in Ixodes ricinus is not an effective approach to control Ixodes ricinus populations, despite the clear effects of Bm86 vaccination against Rhipicephalus microplus.

  7. Irradiated cocoa beans

    International Nuclear Information System (INIS)

    Ashby, R.; Tesh, J.M.


    Groups of 40 male and 40 female CD rats were fed powdered rodent diet containing 25% (w/w) of either non-irradiated, irradiated or fumigated cocoa beans. The diets were supplemented with certain essential dietary constituents designed to satisfy normal nutritional requirements. An additional 40 male and 40 female rats received basal rodent diet alone (ground) and acted as an untreated control. After 70 days of treatment, 15 male and 15 female rats from each group were used to assess reproductive function of the F 0 animals and growth and development of the F 1 offspring up to weaning; the remaining animals were killed after 91 days of treatment. (orig.)

  8. Phenolic contents of myrtle (Myrtus communis L.) fruits


    Arzu BAYIR YEĞİN; Halil İbrahim UZUN


    Mersin (Myrtus communis L.) Akdeniz Bölgesinin önemli bir doğal bitkisidir. Meyveleri siyah ve beyaz renklidir. Mersin bitkisi hakkında yapılan çalışmaların çoğu özellikle yapraklarında bulunan uçucu yağların tespiti ile ilgili iken, son yıllarda sağlık üzerine etkileri nedeniyle mersinin içerdiği fenolik bileşikler ve bunların etkileri üzerine çalışmalar yoğunlaşmıştır. Çalışmanın amacı, mersin meyvelerinin içerdiği fenolik bileşik miktarlarını ve bunların genotiplere göre değişimini saptama...

  9. Antileishmanial and cytotoxic effects of essential oil and methanolic extract of Myrtus communis L. (United States)

    Mahmoudvand, Hossein; Ezzatkhah, Fatemeh; Sharififar, Fariba; Sharifi, Iraj; Dezaki, Ebrahim Saedi


    Plants used for traditional medicine contain a wide range of substances that can be used to treat various diseases such as infectious diseases. The present study was designed to evaluate the antileishmanial effects of the essential oil and methanolic extract of Myrtus communis against Leishmania tropica on an in vitro model. Antileishmanial effects of essential oil and methanolic extract of M. communis on promastigote forms and their cytotoxic activities against J774 cells were evaluated using MTT assay for 72 hr. In addition, their leishmanicidal activity against amastigote forms was determined in a macrophage model, for 72 hr. Findings showed that the main components of essential oil were α-pinene (24.7%), 1,8-cineole (19.6%), and linalool (12.6%). Findings demonstrated that M. communis, particularly its essential oil, significantly (Pessential oil and methanolic extract was 8.4 and 28.9 μg/ml against promastigotes, respectively. These values were 11.6 and 40.8 μg/ml against amastigote forms, respectively. Glucantime as control drug also revealed IC50 values of 88.3 and 44.6 μg/ml for promastigotes and amastigotes of L. tropica, respectively. The in vitro assay demonstrated no significant cytotoxicity in J774 cells. However, essential oil indicated a more cytotoxic effect as compared with the methanolic extract of M. communis. The findings of the present study demonstrated that M. communis might be a natural source for production of a new leishmanicidal agent.

  10. 9 CFR 319.310 - Lima beans with ham in sauce, beans with ham in sauce, beans with bacon in sauce, and similar... (United States)


    ... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Lima beans with ham in sauce, beans with ham in sauce, beans with bacon in sauce, and similar products. 319.310 Section 319.310 Animals and....310 Lima beans with ham in sauce, beans with ham in sauce, beans with bacon in sauce, and similar...

  11. Effect of maize density, bean cultivar and bean spatial arrangement ...

    African Journals Online (AJOL)

    Effect of maize density, bean cultivar and bean spatial arrangement on intercrop performance. ... L'impact de plantes de maïs à 37000 et 24000 plantes ha-1 et des variétés de " Natal sugar" et "carioca" de haricots plantées dans et entre les lignes de maïs était évalué dans une disposition du type factoriel. La densité de ...

  12. Simultaneous allergen inactivation and detoxification of castor bean cake by treatment with calcium compounds

    International Nuclear Information System (INIS)

    Fernandes, K.V.; Deus-de-Oliveira, N.; Godoy, M.G.; Guimarães, Z.A.S.; Nascimento, V.V.; Melo, E.J.T. de; Freire, D.M.G.; Dansa-Petretski, M.; Machado, O.L.T.


    Ricinus communis L. is of great economic importance due to the oil extracted from its seeds. Castor oil has been used for pharmaceutical and industrial applications, as a lubricant or coating agent, as a component of plastic products, as a fungicide or in the synthesis of biodiesel fuels. After oil extraction, a castor cake with a large amount of protein is obtained. However, this by-product cannot be used as animal feed due to the presence of toxic (ricin) and allergenic (2S albumin) proteins. Here, we propose two processes for detoxification and allergen inactivation of the castor cake. In addition, we establish a biological test to detect ricin and validate these detoxification processes. In this test, Vero cells were treated with ricin, and cell death was assessed by cell counting and measurement of lactate dehydrogenase activity. The limit of detection of the Vero cell assay was 10 ng/mL using a concentration of 1.6 × 10 5 cells/well. Solid-state fermentation (SSF) and treatment with calcium compounds were used as cake detoxification processes. For SSF, Aspergillus niger was grown using a castor cake as a substrate, and this cake was analyzed after 24, 48, 72, and 96 h of SSF. Ricin was eliminated after 24 h of SSF treatment. The cake was treated with 4 or 8% Ca(OH) 2 or CaO, and both the toxicity and the allergenic properties were entirely abolished. A by-product free of toxicity and allergens was obtained


    Directory of Open Access Journals (Sweden)

    Manoel Murilo Macedo Barbosa


    ="en-US" align="JUSTIFY">KEY-WORDS: Ricinus communis L.; seeds pathogens; carbendazim; carboxim; thiram.

    O tratamento de sementes com fungicidas tornou-se medida indispensável no controle de patógenos. Entretanto, a eficácia de muitos produtos ainda não é bem conhecida para algumas culturas. Este trabalho teve por objetivo avaliar o efeito de diferentes doses dos fungicidas carbendazim e carboxim + thiram no controle de patógenos e sua interferência sobre a qualidade fisiológica em sementes de mamona. O ensaio foi constituído dos seguintes tratamentos (gramas do ingrediente ativo por 100 kg de sementes: carbendazim (15, 30 e 60, carboxim + thiram (25 + 25, 50 + 50, 100 + 100, formoldeído 0,15% (v/v e testemunha (água destilada. A qualidade fisiológica das sementes foi determinada pela germinação, primeira contagem, emergência a campo, índice de velocidade de emergência (IVE, número de folhas, comprimento, massa verde e seca da parte aérea e condutividade elétrica. Não houve diferenças estatísticas entre os tratamentos, nas avaliações de germinação, IVE, número de folhas, comprimento, massa verde e seca da parte aérea. O tratamento com formoldeído, se comparado aos demais, proporcionou menores médias (p < 0,05 para a primeira contagem e emergência a campo. Sementes tratadas com fungicidas apresentaram maior condutividade elétrica. Os fungos identificados foram Cladosporium spp.; Bipolaris spp.;

  14. Different methods evaluation of antioxidant properties of Myrtus communis extract and its fractions

    Directory of Open Access Journals (Sweden)

    Soheila Moein


    Full Text Available Myrtus communis L. is a plant traditionally used as an antiseptic and disinfectant drug. In this research, the antioxidant activity of Myrtus communis was assayed by evaluating radical scavenging activity, reducing power, FRAP method and determination of phenolic compounds. The methanolic extract of leaves of Myrtus communis was fractionated by using petroleum ether, chloroform, ethyl acetate and buthanol. In reducing power, different concentrations of samples were mixed with phosphate buffer, ferrocyanate, TCA and ferric chloride. Different concentrations of samples were mixed with DPPH and after 30 min the absorbances were measured. For determination of phenolic content, 500 μl of sample was mixed with Folin-Ciocalteu and sodium carbonate. For determination of flavonoids, 500 μl of sample was mixed with 2 ml of distilled water, NaNO2 and NaOH. In reducing power method, chloroform fraction showed the highest reducing capacity. In the DPPH radical scavenging method, the highest antioxidant capacity was found in buthanol fraction (IC50=84.42±1.8 μg/ml. In FRAP method, the highest antioxidant capacity was found in crude extract (5.4±0.3 mg/ml and buthanol fractions (5.51±0.4 mg/ml, respectively. The highest amount of phenolic compounds was detected in ethyl acetate fraction of Myrtus communis (17.5±0.001 μg/g. The highest amount of flavonoids was found in crude extract of Myrtus communis (171.9±7.3 μg/ml. Overall, we can suggest that the leaves of Myrtus communis can be used as antioxidant and as a food additives to avoid oxidative degradation of foods.

  15. Hypnotic effect of the essential oil from the leaves of Myrtus communis on mice

    Directory of Open Access Journals (Sweden)

    Birhanie MW


    Full Text Available Muluken Walle Birhanie,1 Bizuayehu Walle,1 Kidist Rebba2 1Department of Physiology, 2Department of Nursing, College of Medicine and Health Sciences, Bahir Dar University, Bahir Dar, Ethiopia Background: Myrtus communis has been suggested as a sleep aid in unconventional medicine. Moreover, previous studies have also indicated its sedative- and hypnotic-like activity. In this study, the hypnotic effect of M. communis was investigated.Methods: Essential oil (EO of M. communis (600, 800, and 1,000 mg/kg was given orally to Swiss albino mice of both sex, and the hypnotic effect was evaluated. In addition, the EO of M. communis (500, 600, 800, and 1,000 mg/kg was administered orally to Swiss albino mice of both sex 60 minutes prior to pentobarbital injection (50 mg/kg. Latency to sleep and sleep duration were recorded. The effect of the EO on motor coordination and muscle relaxation was evaluated using chimney and traction tests, 60 and 90 minutes after administration of the respective doses of the EO, respectively.Results: There was no induction of hypnosis as the presence of the righting reflex was intact. However the EO prolonged pentobarbital-induced sleeping time and there was also 50% negative response on the chimney and traction test in a dose dependent manner.Conclusion: The EO of M. communis did not produce a hypnotic effect, but it potentiated a hypnotic effect with significant central nervous system depressant activity. Keywords: Myrtus communis, hypnotic, motor coordination, muscle relaxation, essential oil

  16. Evaluation of rotational effect of bean in large-scale rice-bean rotation using satellite remote sensing experiment (United States)

    Sun, Ling; Zhu, Zesheng


    A large-scale rice-bean rotation experiment was examined to analyze the rotational effect of bean by using the normalized difference vegetation index (NDVI) of bean on satellite remote sensing image. The experiment was undertaken at Rudong County of China from 2009 to 2010. The difference between the bean NDVIs of bean-bean monoculture and rice-bean rotation was used to evaluate the rotational effect of bean. The results show that the NDVI of rice-bean rotation is obviously larger than one of bean-bean monoculture in such large-scale experiment. Thus, we have also found the compelling evidence that the bean yield of rice-bean rotation is greater than the bean yield of bean-bean monoculture.

  17. Occurrence of Francisella spp. in Dermacentor reticulatus and Ixodes ricinus ticks collected in eastern Poland. (United States)

    Wójcik-Fatla, Angelina; Zając, Violetta; Sawczyn, Anna; Cisak, Ewa; Sroka, Jacek; Dutkiewicz, Jacek


    A total of 530 questing Dermacentor reticulatus ticks and 861 questing Ixodes ricinus ticks were collected from Lublin province (eastern Poland) and examined for the presence of Francisella by PCR for 16S rRNA (rrs) and tul4 genes. Only one female D. reticulatus tick out of 530 examined (0.2%) was infected with Francisella tularensis subspecies holarctica, as determined by PCR of the rrs gene. None of 861 I. ricinus ticks were infected with F. tularensis. In contrast, the presence of Francisella-like endosymbionts (FLEs) was detected in more than half of the D. reticulatus ticks (50.4%) and 0.8% of the I. ricinus ticks. The nucleotide sequences of the FLEs detected in D. reticulatus exhibited 100% homology with the nucleotide sequence of the FLE strain FDrH detected in Hungary in D. reticulatus. In conclusion, our results suggest a low contribution of D. reticulatus and I. ricinus ticks to the circulation of F. tularensis in eastern Poland. This finding, however, needs to be confirmed by further studies in other areas. Our study confirmed the common infection of D. reticulatus with Francisella-like endosymbionts (FLEs) of unknown pathogenic potential and revealed, for the first time, a low grade of infection of I. ricinus with FLEs. Copyright © 2015 Elsevier GmbH. All rights reserved.

  18. First detection of murine herpesvirus 68 in adult Ixodes ricinus ticks. (United States)

    Kúdelová, Marcela; Jánošová, Monika; Belvončíková, Petra


    Murine herpesvirus 68 (MHV-68) is a natural pathogen that infects murid rodents, which serves as hosts for Ixodes ricinus ticks. For the first time, MHV-68 was detected in immature I. ricinus ticks feeding on Lacerta viridis lizards trapped in Slovakia, which supports the idea that ticks can acquire the virus from feeding on infected hosts. The recent discovery of MHV-68 infection and MHV-68 M3 gene transcripts in Dermacentor reticulatus ticks collected in Slovakia also supports this suggestion. Here, for the first time, we report MHV-68 infection, which was detected by nested PCR, in I. ricinus adults collected from the vegetation, and the viral load in infected ticks was determined by quantitative PCR. The viral incidence in ticks was 38.1% (21/55), and the viral load varied from 1.5 × 10 3 to 2.85 × 10 4 genome copies per tick. These results suggest that the I. ricinus ticks became infected with MHV-68 from biting infected rodents; thus, I. ricinus ticks may play a role in the spread of this virus in nature.

  19. 76 FR 16700 - Importation of French Beans and Runner Beans From the Republic of Kenya Into the United States (United States)


    .... APHIS-2010-0101] RIN 0579-AD39 Importation of French Beans and Runner Beans From the Republic of Kenya... French beans and runner beans from the Republic of Kenya into the United States. As a condition of entry... French beans and runner beans from the Republic of Kenya into the United States while continuing to...

  20. Borrelia miyamotoi in host-seeking Ixodes ricinus ticks in England. (United States)

    Hansford, K M; Fonville, M; Jahfari, S; Sprong, H; Medlock, J M


    This paper reports the first detection of Borrelia miyamotoi in UK Ixodes ricinus ticks. It also reports on the presence and infection rates of I. ricinus for a number of other tick-borne pathogens of public health importance. Ticks from seven regions in southern England were screened for B. miyamotoi, Borrelia burgdorferi sensu lato (s.l.), Anaplasma phagocytophilum and Neoehrlichia mikurensis using qPCR. A total of 954 I. ricinus ticks were tested, 40 were positive for B. burgdorferi s.l., 22 positive for A. phagocytophilum and three positive for B. miyamotoi, with no N. mikurensis detected. The three positive B. miyamotoi ticks came from three geographically distinct areas, suggesting a widespread distribution, and from two separate years, suggesting some degree of endemicity. Understanding the prevalence of Borrelia and other tick-borne pathogens in ticks is crucial for locating high-risk areas of disease transmission.

  1. Healthy food trends -- beans and legumes (United States)

    Legumes are large, fleshy, colorful plant seeds. Beans, peas, and lentils are all types of legumes. Vegetables such as beans and other legumes are an important source of protein. They are a key food in healthy ...

  2. Toxicity of copper sulphate on some haematological parameters of a freshwater teleost Cyprinus carpio var. communis


    Ramesh, M.


    Haematological changes in a freshwater teleost, Cyprinus carpio var. communis, exposed to acute and sublethal toxicity of copper sulphate were studied. During the acute treatment, erythrocyte and leucocyte count, and haemoglobin content increased, whereas during the sublethal treatment, erythrocyte count and haemoglobin content decreased and leucocyte count increased.


    Directory of Open Access Journals (Sweden)

    M. Toauibia


    Full Text Available The development of microbial resistance to antibiotics is a global concern. The present study was carried out to determine the composition and the antimicrobial potential of the essential oil of Myrtus communis L. against 13 pathogenic strains responsible of many infections. The results show that levels of MIC observed range from 0.563 to 36 mg/ml. 

  4. Antidiabetic Activity of Different Extracts of Myrtus Communis in Streptozotocin Induced Diabetic Rats

    Directory of Open Access Journals (Sweden)

    Panjeshahin Mohammad Reza


    Full Text Available Background and aim: Hydroalcoholic (70° extract of leaves of Myrtus communis has been shown to have antidiabetic effect in streptozotocin induced diabetic rats in our previous study. In this study, we intended to determine the components of the mentioned extract and identify the mechanism for its action.



    M. Toauibia


    The development of microbial resistance to antibiotics is a global concern. The present study was carried out to determine the composition and the antimicrobial potential of the essential oil of Myrtus communis L. against 13 pathogenic strains responsible of many infections. The results show that levels of MIC observed range from 0.563 to 36 mg/ml. 


    Directory of Open Access Journals (Sweden)

    M. Toauibia


    Full Text Available The development of microbial resistance to antibiotics is a global concern. The present study was carried out to determine the composition and the antimicrobial potential of the essential oil of Myrtus communis L. against 13 pathogenic strains responsible of many infections. The results show that levels of MIC observed range from 0.563 to 36 mg/ml.

  7. An Ixodes ricinus Tick Salivary Lectin Pathway Inhibitor Protects Borrelia burgdorferi sensu lato from Human Complement. (United States)

    Wagemakers, Alex; Coumou, Jeroen; Schuijt, Tim J; Oei, Anneke; Nijhof, Ard M; van 't Veer, Cornelis; van der Poll, Tom; Bins, Adriaan D; Hovius, Joppe W R


    We previously identified tick salivary lectin pathway inhibitor (TSLPI) in Ixodes scapularis, a vector for Borrelia burgdorferi sensu stricto (s.s.) in North America. TSLPI is a salivary protein facilitating B. burgdorferi s.s. transmission and acquisition by inhibiting the host lectin complement pathway through interference with mannose binding lectin (MBL) activity. Since Ixodes ricinus is the predominant vector for Lyme borreliosis in Europe and transmits several complement sensitive B. burgdorferi sensu lato (s.l.) strains, we aimed to identify, describe, and characterize the I. ricinus ortholog of TSLPI. We performed (q)PCRs on I. ricinus salivary gland cDNA to identify a TSLPI ortholog. Next, we generated recombinant (r)TSLPI in a Drosophila expression system and examined inhibition of the MBL complement pathway and complement-mediated killing of B. burgdorferi s.l. in vitro. We identified a TSLPI ortholog in I. ricinus salivary glands with 93% homology at the RNA and 89% at the protein level compared to I. scapularis TSLPI, which was upregulated during tick feeding. In silico analysis revealed that TSLPI appears to be part of a larger family of Ixodes salivary proteins among which I. persulcatus basic tail salivary proteins and I. scapularis TSLPI and Salp14. I. ricinus rTSLPI inhibited the MBL complement pathway and protected B. burgdorferi s.s. and Borrelia garinii from complement-mediated killing. We have identified a TSLPI ortholog, which protects B. burgdorferi s.l. from complement-mediated killing in I. ricinus, the major vector for tick-borne diseases in Europe.

  8. Mitogenomes reveal diversity of the European Lyme borreliosis vector Ixodes ricinus in Italy. (United States)

    Carpi, Giovanna; Kitchen, Andrew; Kim, Hie Lim; Ratan, Aakrosh; Drautz-Moses, Daniela I; McGraw, John J; Kazimirova, Maria; Rizzoli, Annapaola; Schuster, Stephan C


    In Europe, the Ixodes ricinus tick is the most important vector of the etiological agents of Lyme borreliosis and several other emerging tick-borne diseases. Because tick-borne pathogens are dependent on their vectors for transmission, understanding the vector population structure is crucial to inform public health research of pathogen dynamics and spread. However, the population structure and dynamics of this important vector species are not well understood as most genetic studies utilize short mitochondrial and nuclear sequences with little diversity. Herein we obtained and analyzed complete mitochondrial genome (hereafter "mitogenome") sequences to better understand the genetic diversity and the population structure of I. ricinus from two long-standing tick-borne disease foci in northern Italy. Complete mitogenomes of 23 I. ricinus ticks were sequenced at high coverage. Out of 23 mitogenome sequences we identified 17 unique haplotypes composed of 244 segregating sites. Phylogenetic reconstruction using 18 complete mitogenome sequences revealed the coexistence of four highly divergent I. ricinus maternal lineages despite the narrow spatial scale over which these samples were obtained (100km). Notably, the estimated coalescence time of the 18 mitogenome haplotypes is ∼427 thousand years ago (95% HPD 330, 540). This divergence between I. ricinus lineages is consistent with the mitochondrial diversity of other arthropod vector species and indicates that long-term I. ricinus populations may have been less structured and larger than previously thought. Thus, this study suggests that a rapid and accurate retrieval of full mitochondrial genomes from this disease vector enables fine-resolution studies of tick intraspecies genetic relationships, population differentiation, and demographic history. Copyright © 2016 Elsevier Inc. All rights reserved.

  9. Characteristics of water absorption of beans


    上中, 登紀子; 森, 孝夫; 豊沢, 功; Tokiko, Uenaka; Takao, Mori; Isao, Toyosawa


    Characteristics of water absorption of soybean, azuki bean and kidney beans (cv. Toramame and Taishokintoki) were investigated. The way of water absorption of soybean was different from that of other beans, because soybeans absorbed water from whole surface of seed coat immediately after the immersion. Azuki beans absorbed extremely slowly water from only strophiole, and then the water absorption in other tissue was induced by a certain amount of water absorption playing a role of trigger. Th...

  10. Análise macroscópica e histológica do emprego da poliuretana derivada do óleo de mamona (Ricinus communis aplicada na tíbia de cães em fase de crescimento Macroscopic and histopathologic evaluations of the use of polyurethane resins derived from castor oil (Ricinus communis applied in the tibia of the puppies

    Directory of Open Access Journals (Sweden)

    Patricia Popak Maria


    Full Text Available OBJETIVO: Estudar o efeito da poliuretana de mamona aplicada ao osso de cães em crescimento. MÉTODOS: Foram utilizados 12 cães subdivididos aleatoriamente em 3 grupos, os quais receberam o implante de mamona na face medial proximal da tíbia, com análise macroscópica e histopatológica aos 30 (GIII, 60 (GII e 90 (GI dias. RESULTADOS: A poliuretana foi recoberta por uma cápsula conjuntiva fibrosa, não ocorrendo proliferação óssea ao seu redor. CONCLUSÃO: A poliuretana é biocompatível, comportando-se como espaçador biológico em cães. Nesta espécie não ocorre a osteointegração.PURPOSE: To analyze the effects of castor oil derived poliurethane, when applied to bones of puppies. METHODS: Twelve dogs, randomly divided in 3 groups, received a castor oil derived poliurethane at the medial side of the proximal tibia. Gross and histopathologic evaluations were performed at 30 (GIII, 60 (GII and 90 (GI days. RESULTS: The poliurethane was enclosed in a connective fibrous tissue capsule and there was no new bone formation around it. CONCLUSION: The castor oil derived poliurethane is biocompatible and behaves as a biological "stand off" in dogs. Osteointegration does not occur in this species.

  11. Chlorotic mottle of bean (Phaseolus vulgaris L.)

    NARCIS (Netherlands)

    Jayasinghe, W.U.


    For the past years there have been outbreaks of a disease of bean ( Phaseolus vulgaris L.) in Colombia called bean chlorotic mottle. The etiology of bean chlorotic mottle was not known, but the disease was generally believed to be incited by the same whitefly-transmitted virus

  12. Nutraceutical perspectives and utilization of common beans ...

    African Journals Online (AJOL)

    There is a growing interest in common beans and their products because of the health claims associated with their consumption. Common beans are rich in protein, carbohydrate, fiber, minerals and vitamins. Proteins have always been recognized as the most significant macronutrient in common beans and though the seed ...

  13. morphological diversity of tropical common bean germplasm

    African Journals Online (AJOL)


    Common bean (Phaseolus vulgaris L.) landraces and varieties grown by farmers in the tropics are a major source of genes and genetic diversity for bean improvement. These materials are, however, threatened by genetic erosion. In this study, we sought to understand the current state of genetic diversity of common bean in ...

  14. Phytohemagglutination Activity in Extruded Dry Bean Powder (United States)

    Dry beans are a highly nutritious food. Besides making beans palatable, cooking is required to denature lectin, a protein found in beans. If consumed raw or undercooked, lectin poisoning can occur. Symptoms of lectin poisoning include vomiting, diarrhea, and abdominal pain, and occur within hours of...

  15. NetBeans IDE 8 cookbook

    CERN Document Server

    Salter, David


    If you're a Java developer of any level using NetBeans and want to learn how to get the most out of NetBeans, then this book is for you. Learning how to utilize NetBeans will provide a firm foundation for your Java application development.

  16. Mating activity and physiological age of females in population of Ixodes ricinus (L.) (Acari: Ixodidae)

    Czech Academy of Sciences Publication Activity Database

    Mikulová, N.; Dusbábek, František; Bouman, Edwin Arien Poul


    Roč. 13, č. 1 (2005), s. 85-92 ISSN 0132-8077 R&D Projects: GA ČR GA206/04/0751 Institutional research plan: CEZ:AV0Z60220518 Keywords : Ixodes ricinus * age structure * mating activity Subject RIV: EG - Zoology

  17. Ultrastructure and lectin characterization of granular salivary cells from Ixodes ricinus females

    Czech Academy of Sciences Publication Activity Database

    Vancová, Marie; Zacharovová, Klára; Grubhoffer, Libor; Nebesářová, Jana


    Roč. 92, č. 3 (2006), s. 431-440 ISSN 0022-3395 R&D Projects: GA ČR GA206/03/1323 Institutional research plan: CEZ:AV0Z60220518 Keywords : Ixodes ricinus * salivary glands * lectin labeling Subject RIV: EE - Microbiology, Virology Impact factor: 1.300, year: 2006

  18. Ixodes ricinus tick saliva modulates tick-borne encephalitis virus infection of dendritic cells

    Czech Academy of Sciences Publication Activity Database

    Fialová, Anna; Cimburek, Zdeněk; Iezzi, G.; Kopecký, Jan


    Roč. 12, č. 7 (2010), s. 580-585 ISSN 1286-4579 R&D Projects: GA AV ČR IAA600960811 Institutional research plan: CEZ:AV0Z60220518; CEZ:AV0Z50200510 Keywords : Tick-borne encephalitis virus * Dendritic cell * Tick saliva * Ixodes ricinus Subject RIV: EC - Immunology Impact factor: 2.726, year: 2010

  19. Differential expression of Ixodes ricinus tick genes induced by blood feeding or Borrelia burgdorferi infection

    Czech Academy of Sciences Publication Activity Database

    Rudenko, Natalia; Golovchenko, Maryna; Edwards, M. J.; Grubhoffer, Libor


    Roč. 42, č. 1 (2005), s. 36-41 ISSN 0022-2585 R&D Projects: GA AV ČR IAA6022306 Institutional research plan: CEZ:AV0Z60220518 Keywords : Ixodes ricinus * Borrelia burgdorferi * subtractive hybridization Subject RIV: EE - Microbiology, Virology Impact factor: 1.489, year: 2005

  20. Anti-tumour necrosis factor-alpha activity in Ixodes ricinus saliva

    Czech Academy of Sciences Publication Activity Database

    Koník, Peter; Slavíková, Veronika; Salát, Jiří; Řezníčková, Jana; Dvorožňáková, E.; Kopecký, Jan


    Roč. 28, č. 12 (2006), s. 649-656 ISSN 0141-9838 R&D Projects: GA ČR GA524/05/0811; GA MŠk(CZ) LC06009 Institutional research plan: CEZ:AV0Z60220518 Keywords : Ixodes ricinus * tick saliva * TNF Subject RIV: EC - Immunology Impact factor: 2.009, year: 2006

  1. The ecology of Lyme borreliosis risk : interactions between lxodes ricinus, rodents and Borrelia burgdorferi sensu lato

    NARCIS (Netherlands)

    Duijvendijk, van Gilian


    The sheep tick (Ixodes ricinus) is widespread throughout Europe and can transmit Borrelia burgdorferi sensu lato (s.l.), which can cause Lyme borreliosis and B. miyamotoi, the agent of Borrelia miyamotoi disease in humans.

  2. Human pathogenic borreliae in Ixodes ricinus ticks in natural and urban ecosystem (Czech Republic)

    Czech Academy of Sciences Publication Activity Database

    Venclíková, Kristýna; Betášová, Lenka; Šikutová, Silvie; Jedličková, Petra; Hubálek, Zdeněk; Rudolf, Ivo


    Roč. 59, č. 4 (2014), s. 717-720 ISSN 1230-2821 EU Projects: European Commission(XE) 261504 - EDENEXT Institutional support: RVO:68081766 Keywords : Ixodes ricinus * Borrelia burgdorgeri s.l. * genomic species * ixodid ticks Subject RIV: EE - Microbiology, Virology Impact factor: 0.905, year: 2014

  3. Detection and identification of Anaplasma phagocytophilum, Borrelia burgdorferi, and Rickettsia helvetica in Danish Ixodes ricinus ticks

    DEFF Research Database (Denmark)

    Skarphédinsson, Sigurdur; Lyholm, Birgitte Fjendbo; Ljungberg, Marianne


    Borreliosis is an endemic infection in Denmark. Recent serosurveys have indicated that human anaplasmosis may be equally common. The aim of this study was to look for Anaplasma phagocytophilum and related pathogens in Ixodes ricinus ticks and estimate their prevalence, compared to Borrelia, using...

  4. First detection of Borrelia miyamotoi in Ixodes ricinus ticks from northern Italy.

    NARCIS (Netherlands)

    Ravagnan, Silvia; Tomassone, Laura; Montarsi, Fabrizio; Krawczyk, Aleksandra Iwona; Mastrorilli, Eleonora; Sprong, Hein; Milani, Adelaide; Rossi, Luca; Capelli, Gioia


    Borrelia miyamotoi is a spirochete transmitted by several ixodid tick species. It causes a relapsing fever in humans and is currently considered as an emerging pathogen. In Europe, B. miyamotoi seems to occur at low prevalence in Ixodes ricinus ticks but has a wide distribution. Here we report the

  5. Behavioural responses of Ixodes ricinus nymphs to carbon dioxide and rodent odour

    NARCIS (Netherlands)

    Duijvendijk, van G.; Gort, G.; Sprong, H.; Takken, W.


    Many haematophagous ectoparasites use carbon dioxide (CO2) and host odour to detect and locate their hosts. The tick Ixodes ricinus (Linnaeus) (Ixodida: Ixodidae) walks only small distances and quests in vegetation until it encounters a host. The differential effects of CO2 and host odour on the

  6. Occurrence of multiple infections with different Borrelia burgdorferi genospecies in Danish Ixodes ricinus nymphs

    DEFF Research Database (Denmark)

    Andersen, Jean Vennestrøm; Egholm, H.; Mikkelsen, Per Jensen


    The pathogen Borrelia burgdorferi causes Lyme Borreliosis in human and animals world-wide. In Europe the pathogen is transmitted to the host by the vector Ixodes ricinus. The nymph is the primary instar for transmission to humans. We here study the infection rate of five Borrelia genospecies: B...

  7. Ixodes ricinus and Borrelia prevalence at the Arctic Circle in Norway. (United States)

    Hvidsten, Dag; Stuen, Snorre; Jenkins, Andrew; Dienus, Olaf; Olsen, Renate S; Kristiansen, Bjørn-Erik; Mehl, Reidar; Matussek, Andreas


    The distribution limit of Ixodes ricinus ticks in northwestern Europe (Brønnøy, Norway, 1° south of the Arctic Circle), has been known since the 1930s. To reconfirm this finding and extend studies in the areas adjacent to the Arctic Circle (66°33' N), ticks were collected from dogs and cats in 8 districts in northern Norway from 64°56' N to 68°48' N. We detected 549 I. ricinus, 244 (44%) of them in Brønnøy district, and 305 (range 6-87 ticks) in 7 districts in the northern part of the study area. The prevalence of Borrelia in these ticks was determined by real-time PCR. In the Brønnøy district (65°28' N, 12°12' E), 29% of the I. ricinus were Borrelia spp.-positive, and the species B. afzelii was nearly twice as prevalent as B. garinii and/or B. valaisiana. In the study area north of Brønnøy district, only 12 (4%) of the collected ticks contained Borrelia spp. In conclusion, tick occurrence and Borrelia prevalence are high in the Brønnøy district. In contrast, I. ricinus occurrence and Borrelia prevalence are low further north across the Arctic Circle in Norway. Copyright © 2013 Elsevier GmbH. All rights reserved.

  8. Diversity of Ixodes ricinus tick-associated bacterial communities from different forests

    NARCIS (Netherlands)

    Overbeek, van L.S.; Gassner, F.; Lombaers-van der Plas, C.H.; Kastelein, P.; Nunes da Rocha, U.; Takken, W.


    Nymphal Ixodes ricinus ticks (n=180) were collected from three different areas in the Netherlands to investigate the effect of forest composition on tick-associated microbial communities. Sampled habitats differed in thickness of leaf litter and humus layers and vegetation associations and were

  9. Babesia sp. EU1 from Roe Deer and Transmission within Ixodes ricinus (United States)

    Jouglin, Maggy; L’Hostis, Monique; Chauvin, Alain


    We report in vitro culture of zoonotic Babesia sp. EU1 from blood samples of roe deer in France. This study provides evidence of transovarial and transstadial transmission of the parasite within Ixodes ricinus, which suggests that this tick could be a vector and reservoir of EU1. PMID:17953093

  10. Influence of meteorological parameters during the preceding fall and winter on the questing activity of nymphal Ixodes ricinus ticks

    DEFF Research Database (Denmark)

    Vollack, Ken; Sodoudi, Sahar; Névir, Peter


    Wood ticks, Ixodes ricinus L., serve as vectors for various pathogens and are ubiquitous throughout Central Europe. Survival and development of I. ricinus depend on biotic and abiotic factors. We examined whether relative humidity (RH), air (T a ) and soil temperatures (T s ), or snow depth during...... the average number of nymphs questing during spring. Our observations suggest that RH, T s , and snow cover during the preceding months affect the questing activity of nymphal I. ricinus during their first peak of activity. Snow cover serves as an insulator between the atmosphere and soil, which not only...

  11. Angus McBean - Portraits

    NARCIS (Netherlands)

    Pepper, T.


    Angus McBean (1904-90) was one of the most extraordinary British photographers of the twentieth century. In a career that spanned the start of the Second World War through the birth of the 'Swinging Sixties' to the 1980s, he became the most prominent theatre photographer of his generation and, along

  12. Antifungal activity of Myrtus communis against Malassezia sp. isolated from the skin of patients with pityriasis versicolor. (United States)

    Barac, Aleksandra; Donadu, Matthew; Usai, Donatella; Spiric, Vesna Tomic; Mazzarello, Vittorio; Zanetti, Stefania; Aleksic, Ema; Stevanovic, Goran; Nikolic, Natasa; Rubino, Salvatore


    The increasing incidence of fungal infections and antifungal resistance has prompted the search for novel antifungal drugs and alternative agents. We explored the antifungal activity of Myrtus communis essential oil (EO) against Malassezia sp. isolated from the skin of patients with pityriasis versicolor. These broad-spectrum antimicrobial activities of M. communis EO and its potent inhibiting activity on Malassezia growth deserve further research with aim to considerate this EO as candidate for topical use in treatment of skin diseases.

  13. Determination of the parameters of the parasitic stage in Ixodes ricinus females. (United States)

    Bartosik, Katarzyna; Buczek, Alicja


    Ixodes ricinus is a tick commonly found on human and animals and of great medical and veterinary importance. The aim of the study was to determine the parameters of different stages of feeding in Ixodes ricinus females. 229 Ixodes ricinus females were collected from 102 animals--roe deer (Capreolus capreolus) and red deer (Cervus elaphus) culled in southern and south-eastern Poland in 2002. Each female was weighed and the length and width of the scutum as well as the width of the idiosoma were measured. 20 tick females were collected from vegetation growing in the region and analysed in order to compare the changes in the parameters studied to those exhibited by unengorged specimens. Three groups were identified on the basis of female body weight; group I consisted of 52 females in feeding phase I with body weight in the range of 0.0003-0.0043 g (mean 0.0019 g), group II comprised 150 females in feeding phase II with weight in the range of 0.0017-0.3075 g (mean 0.0263 g), and group III consisted of 27 females in feeding phase III with weight in the range of 0.0904-0.3122 g (mean 0.1913 g). Indices characterizing the various feeding phases, such as body index, scutal index, alloscutal index, growth index, engorgement index I and II, and the relative body mass index, were determined. The investigations demonstrated that the values of the morphometric traits in feeding phase I, II and III differe in I. ricinus females. The values of the morphometric features and indices can be helpful in identification of the parasitic stage of I. ricinus females removed from host skin, and assessment of the risk of infection of the host with various parasites injected with tick saliva at the respective feeding phases.

  14. Temporal dynamics of the tick Ixodes ricinus in northern Europe: epidemiological implications. (United States)

    Cayol, Claire; Koskela, Esa; Mappes, Tapio; Siukkola, Anja; Kallio, Eva R


    Tick-borne pathogens pose an increasing threat to human and veterinary health across the northern hemisphere. While the seasonal activity of ticks is largely determined by climatic conditions, host-population dynamics are also likely to affect tick abundance. Consequently, abundance fluctuations of rodents in northern Europe are expected to be translated into tick dynamics, and can hence potentially affect the circulation of tick-borne pathogens. We quantified and explained the temporal dynamics of the tick Ixodes ricinus in the northernmost part of its European geographical range, by estimating (i) abundance in vegetation and (ii) infestation load in the most common rodent species in the study area, the bank vole Myodes glareolus. Ixodes ricinus nymphs and adult females, the life stages responsible for the most of tick bites in humans, peaked in May-June and August-September. Larvae and nymphs were simultaneously active in June and abundance of questing larvae and nymphs in the vegetation showed a positive association with bank vole abundance. Moreover, infesting larvae and nymphs were aggregated on bank voles, and the infestation of bank voles with I. ricinus larvae and nymphs was positively associated with bank vole abundance. Our results indicate early summer and early autumn as periods of increased risk for humans to encounter I. ricinus ticks in boreal urban forests and suggest a 2 years life-cycle for I. ricinus with two cohorts of ticks during the same year. Moreover, we identified a simultaneous activity of larvae and nymphs which allows co-feeding on the rodent host, which in turn supports the transmission of several important zoonotic tick-borne pathogens. Finally, we showed that a high density of the rodent host may enhance the risk that ticks and, potentially, tick-borne pathogens pose to human health.

  15. Avaliação da atividade antibacteriana de folhas de Myrtus communis L. (Myrtaceae

    Directory of Open Access Journals (Sweden)

    Luiz Estevão Salvagnini

    Full Text Available O óleo essencial e o extrato etanólico obtidos a partir de folhas de Myrtus communis foram avaliados quanto 'a atividade inibitória frente a vários microrganismos. Os halos de inibição de crescimento foram avaliados através das técnicas de "template" e difusão em disco para as linhagens de Staphylococcus aureus, Staphylococcus epidermidis, Escherichia coli, Bacillus subtilis e Serratia marcescens. Os resultados obtidos evidenciaram que o óleo de M. communis apresentou atividade antibacteriana superior ao extrato etanólico frente a todas as bactérias. A atividade demonstrada tanto para o óleo como para o extrato etanólico frente a algumas linhagens, foi melhor evidenciada pela técnica "template". E. coli foi resistente ao óleo e extrato etanólico testados.

  16. Flue-gas-influenced heavy metal bioaccumulation by the indigenous microalgae Desmodesmus communis LUCC 002. (United States)

    Palanisami, Swaminathan; Lee, Keesoo; Balakrishnan, Baskar; Nam, Paul Ki-souk


    Desmodesmus communis LUCC 002 was cultivated using flue gas originating from a coal-fired power plant as a carbon dioxide (CO2) source. The flue gas contains various heavy metals. For investigating the fate of flue-gas-introduced metals on the cultivation system, bioaccumulation was measured in the microalgal biomass and milieu. The accumulated biomass was found to contain eight heavy metals: arsenic, chromium, barium, lead, selenium, silver, cadmium, and mercury. High heavy metal accumulations were also found in the control group of algae grown without the addition of flue gas at the same location. Further testing revealed that some of the heavy metals originated from well water used in the cultivation. The flue-gas-influenced bioaccumulation pattern of different heavy metals was observed. The responses of individual heavy metals and the influence of well water microbial flora on the algal growth were investigated, this study showed that hormesis was developed by the D. communis LUCC 002.

  17. Protein Quality of Irradiated Brazilian Beans (United States)

    Delincée, Henry; Villavicencio, Anna-Lucia C. H.; Mancini-Filho, Jorge


    Beans are a major source of dietary protein in Brazil. However, high losses due to insect infestation occur after each harvest. To combat these losses, radiation processing of beans offers promise as an alternative to chemical treatment, provided the nutritional quality of beans is not impaired by the radiation treatment. Conflicting results have been published about the effect of radiation on the biological value of legume proteins. Therefore, two varieties of Brazilian beans were studied: 1) Phaseolus vulgaris L., var. carioca and 2) Vigna unguiculata (L.) Walp, var. macaçar. The beans were irradiated with doses of 0, 0.5, 1.0, 2.5, 5.0 and 10 kGy. Since irradiated beans will be consumed after appropriate storage, the beans under study were stored for 6 months at ambient temperature. Protein quality was measured by a biological assay employing the nitrogen balance approach in weanling rats. The animals were fed with optimally cooked beans, which were the only source of protein (˜10%). Nitrogen contents of legumes, diets, animal urine and faeces were determined by Kjeldahl analysis. The indices for apparent protein quality: net protein utilisation, digestibility and biological value were not influenced by irradiation. Thus, radiation treatment of Brazilian beans offers considerable promise as an effective insect disinfection process, without impairing the biological quality of the valuable bean protein.

  18. Protein Quality of Irradiated Brazilian Beans

    International Nuclear Information System (INIS)

    Delincee, Henry; Villavicencio, Anna-Lucia C.H.; Mancini-Filho, Jorge


    Beans are a major source of dietary protein in Brazil. However, high losses due to insect infestation occur after each harvest. To combat these losses, radiation processing of beans offers promise as an alternative to chemical treatment, provided the nutritional quality of beans is not impaired by the radiation treatment. Conflicting results have been published about the effect of radiation on the biological value of legume proteins. Therefore, two varieties of Brazilian beans were studied: 1) Phaseolus vulgaris L., var. carioca and 2) Vigna unguiculata (L.) Walp, var. macacar. The beans were irradiated with doses of 0, 0.5, 1.0, 2.5, 5.0 and 10 kGy. Since irradiated beans will be consumed after appropriate storage, the beans under study were stored for 6 months at ambient temperature. Protein quality was measured by a biological assay employing the nitrogen balance approach in weanling rats. The animals were fed with optimally cooked beans, which were the only source of protein (∼10%). Nitrogen contents of legumes, diets, animal urine and faeces were determined by Kjeldahl analysis. The indices for apparent protein quality: net protein utilisation, digestibility and biological value were not influenced by irradiation. Thus, radiation treatment of Brazilian beans offers considerable promise as an effective insect disinfestation process, without impairing the biological quality of the valuable bean protein

  19. Protein Quality of Irradiated Brazilian Beans

    Energy Technology Data Exchange (ETDEWEB)

    Delincee, Henry; Villavicencio, Anna-Lucia C.H.; Mancini-Filho, Jorge


    Beans are a major source of dietary protein in Brazil. However, high losses due to insect infestation occur after each harvest. To combat these losses, radiation processing of beans offers promise as an alternative to chemical treatment, provided the nutritional quality of beans is not impaired by the radiation treatment. Conflicting results have been published about the effect of radiation on the biological value of legume proteins. Therefore, two varieties of Brazilian beans were studied: 1) Phaseolus vulgaris L., var. carioca and 2) Vigna unguiculata (L.) Walp, var. macacar. The beans were irradiated with doses of 0, 0.5, 1.0, 2.5, 5.0 and 10 kGy. Since irradiated beans will be consumed after appropriate storage, the beans under study were stored for 6 months at ambient temperature. Protein quality was measured by a biological assay employing the nitrogen balance approach in weanling rats. The animals were fed with optimally cooked beans, which were the only source of protein ({approx}10%). Nitrogen contents of legumes, diets, animal urine and faeces were determined by Kjeldahl analysis. The indices for apparent protein quality: net protein utilisation, digestibility and biological value were not influenced by irradiation. Thus, radiation treatment of Brazilian beans offers considerable promise as an effective insect disinfestation process, without impairing the biological quality of the valuable bean protein.

  20. Extracting Extensor Digitorum Communis Activation Patterns using High-Density Surface Electromyography

    Directory of Open Access Journals (Sweden)

    Xiaogang eHu


    Full Text Available The extensor digitorum communis muscle plays an important role in hand dexterity during object manipulations. This multi-tendinous muscle is believed to be controlled through separate motoneuron pools, thereby forming different compartments that control individual digits. However, due to the complex anatomical variations across individuals and the flexibility of neural control strategies, the spatial activation patterns of the extensor digitorum communis compartments during individual finger extension have not been fully tracked under different task conditions.The objective of this study was to quantify the global spatial activation patterns of the extensor digitorum communis using high-density (7×9 surface electromyogram (EMG recordings. The muscle activation map (based on the root mean square of the EMG was constructed when subjects performed individual four finger extensions at the metacarpophalangeal joint, at different effort levels and under different finger constraints (static and dynamic. Our results revealed distinct activation patterns during individual finger extensions, especially between index and middle finger extensions, although the activation between ring and little finger extensions showed strong covariance. The activation map was relatively consistent at different muscle contraction levels and for different finger constraint conditions. We also found that distinct activation patterns were more discernible in the proximal-distal direction than in the radial-ulnar direction. The global spatial activation map utilizing surface grid EMG of the extensor digitorum communis muscle provides information for localizing individual compartments of the extensor muscle during finger extensions. This is of potential value for identifying more selective control input for assistive devices. Such information can also provide a basis for understanding hand impairment in individuals with neural disorders.

  1. Evaluation of antibacterial effect of Myrtus communis against Acinetobacter baumannii clinical strains

    Directory of Open Access Journals (Sweden)

    Venous Akhavan


    Full Text Available Because of inappropriate use of antibiotics and prevalence of resistant bacteria, there is urgent need for antibacterial drugs that have fewer side effects than antibiotics. Myrtus communis is a medicinal plant which had many uses in traditional medicine. In this study, ethanol leave extract of this plant is tested on Acinetobacter baumannii. In the case of antimicrobial evaluation of plants, one of the effecting factors on effectiveness of the microbial inhibition is extraction techniques. In the presents study, the antibacterial activity of the Ethanol, Methanol, and Ethyl acetate extracts of M. communis plant was evaluated at seven different concentrations by broth microdilution method. The results of this study showed that the antimicrobial effect of M. communis extract is concentration dependent. Different extracts were obtained by the maceration method. Extracts of the plant exhibited antibacterial activity at varied levels against A. baumannii. Obtained results from our antibacterial experiments showed that all extracts have anti-bacterial activity against tested bacterial isolates According to the results, the ethyl acetate extracted fraction showed the highest level of activity at a MIC 400 mg/ml for A. baumannii. The results of this study indicate that, different extracts had growth inhibitory effect on A. baumannii. Therefore this plant has the potential to be evaluated as an alternative or adjunct to antibiotics to treat Acinetobacter infections.

  2. Antifungal and Herbicidal Effects of Fruit Essential Oils of Four Myrtus communis Genotypes. (United States)

    Kordali, Saban; Usanmaz, Ayse; Cakir, Ahmet; Komaki, Amanmohammad; Ercisli, Sezai


    The chemical composition of the essential oils isolated by hydrodistillation from the fruits of four selected Myrtus communis L. genotypes from Turkey was characterized by GC-FID and GC/MS analyses. 1,8-Cineole (29.20-31.40%), linalool (15.67-19.13%), α-terpineol (8.40-18.43%), α-pinene (6.04-20.71%), and geranyl acetate (3.98-7.54%) were found to be the major constituents of the fruit essential oils of all M. communis genotypes investigated. The oils were characterized by high amounts of oxygenated monoterpenes, representing 73.02-83.83% of the total oil compositions. The results of the fungal growth inhibition assays showed that the oils inhibited the growth of 19 phytopathogenic fungi. However, their antifungal activity was generally lower than that of the commercial pesticide benomyl. The herbicidal effects of the oils on the seed germination and seedling growth of Amaranthus retroflexus L., Chenopodium album L., Cirsium arvense (L.) Scop., Lactuca serriola L., and Rumex crispus L. were also determined. The oils completely or partly inhibited the seed germinations and seedling growths of the plants. The findings of the present study suggest that the M. communis essential oils might have potential to be used as natural herbicides as well as fungicides. Copyright © 2016 Verlag Helvetica Chimica Acta AG, Zürich.

  3. Dominance of Dermacentor reticulatus over Ixodes ricinus (Ixodidae) on livestock, companion animals and wild ruminants in eastern and central Poland


    Mierzejewska, Ewa J.; Welc-Faleciak, Renata; Karbowiak, Grzegorz; Kowalec, Maciej; Behnke, Jerzy M.; Bajer, Anna


    The most common tick species parasitizing animals in Poland are Ixodes ricinus and Dermacentor reticulatus. These tick species differ in their distribution, habitats, seasonal activity and host specificity. Ixodes ricinus is the most prevalent and widely distributed, whereas the range of D. reticulatus is limited to eastern and central parts of the country with several new foci in the middle-west and the west. However, as in many central European countries, the range of D. reticulatus is expa...

  4. Weed Azuki Bean, an Overlooked Representative


    YAMAGUCHI, Hirofumi


    Two forms of prostrated and slightly branching Azuki bean (Phaseolus angularis W.F. Wight) grow naturally in the ruderal and cultivated fields in central Japan. These have larger leaves and thick stem, like the cultigen, and have easily dehiscent black pods similar to the wild Azuki bean (P. angularis var. nipponensis Ohwi). Two forms have seeds intermediate in size between the cultigen and wild Azuki beans. The black-seed form shows relatively larger plant stature and is seen in ruderal site...


    Directory of Open Access Journals (Sweden)

    I. T. Balashova


    Full Text Available Beans (Vicia faba L. is the one of the ancient crops which have been cultivated and used for food. The historical note about bean utilization in ancient world and in Russia, and the information aboutcenters of origin, food value of seeds are presented in this review. Botanical characteristics of three bean varieties of VNIISSOK breeding are described.

  6. Kinetics model development of cocoa bean fermentation (United States)

    Kresnowati, M. T. A. P.; Gunawan, Agus Yodi; Muliyadini, Winny


    Although Indonesia is one of the biggest cocoa beans producers in the world, Indonesian cocoa beans are oftenly of low quality and thereby frequently priced low in the world market. In order to improve the quality, adequate post-harvest cocoa processing techniques are required. Fermentation is the vital stage in series of cocoa beans post harvest processing which could improve the quality of cocoa beans, in particular taste, aroma, and colours. During the fermentation process, combination of microbes grow producing metabolites that serve as the precursors for cocoa beans flavour. Microbial composition and thereby their activities will affect the fermentation performance and influence the properties of cocoa beans. The correlation could be reviewed using a kinetic model that includes unstructured microbial growth, substrate utilization and metabolic product formation. The developed kinetic model could be further used to design cocoa bean fermentation process to meet the expected quality. Further the development of kinetic model of cocoa bean fermentation also serve as a good case study of mixed culture solid state fermentation, that has rarely been studied. This paper presents the development of a kinetic model for solid-state cocoa beans fermentation using an empirical approach. Series of lab scale cocoa bean fermentations, either natural fermentations without starter addition or fermentations with mixed yeast and lactic acid bacteria starter addition, were used for model parameters estimation. The results showed that cocoa beans fermentation can be modelled mathematically and the best model included substrate utilization, microbial growth, metabolites production and its transport. Although the developed model still can not explain the dynamics in microbial population, this model can sufficiently explained the observed changes in sugar concentration as well as metabolic products in the cocoa bean pulp.


    African Journals Online (AJOL)


    May 12, 1993 ... RxR bean lines to common bacterial blight. Thé F, were advanced to F; and in each cross over 250 F2 plants were used to evaluate for the number of genes controÜing résistance using Mendelian genetics and. Stanifield 's formula. The plants were inoculated by razor blade method on the leaves and by ...

  8. Assessment of MALDI-TOF MS biotyping for Borrelia burgdorferi sl detection in Ixodes ricinus (United States)

    Boyer, Pierre H.; Boulanger, Nathalie; Nebbak, Amira; Collin, Elodie; Jaulhac, Benoit; Almeras, Lionel


    Matrix Assisted Laser Desorption/Ionization Time-of-Flight Mass Spectrometry (MALDI-TOF MS) has been demonstrated to be useful for tick identification at the species level. More recently, this tool has been successfully applied for the detection of bacterial pathogens directly in tick vectors. The present work has assessed the detection of Borrelia burgdorferi sensu lato in Ixodes ricinus tick vector by MALDI-TOF MS. To this aim, experimental infection model of I. ricinus ticks by B. afzelii was carried out and specimens collected in the field were also included in the study. Borrelia infectious status of I. ricinus ticks was molecularly controlled using half-idiosome to classify specimens. Among the 39 ticks engorged on infected mice, 14 were confirmed to be infected by B. afzelii. For field collection, 14.8% (n = 12/81) I. ricinus ticks were validated molecularly as infected by B. burgdorferi sl. To determine the body part allowing the detection of MS protein profile changes between non-infected and B. afzelii infected specimens, ticks were dissected in three compartments (i.e. 4 legs, capitulum and half-idiosome) prior to MS analysis. Highly reproducible MS spectra were obtained for I. ricinus ticks according to the compartment tested and their infectious status. However, no MS profile change was found when paired body part comparison between non-infected and B. afzelii infected specimens was made. Statistical analyses did not succeed to discover, per body part, specific MS peaks distinguishing Borrelia-infected from non-infected ticks whatever their origins, laboratory reared or field collected. Despite the unsuccessful of MALDI-TOF MS to classify tick specimens according to their B. afzelii infectious status, this proteomic tool remains a promising method for rapid, economic and accurate identification of tick species. Moreover, the singularity of MS spectra between legs and half-idiosome of I. ricinus could be used to reinforce this proteomic identification

  9. Simultaneous allergen inactivation and detoxification of castor bean cake by treatment with calcium compounds. (United States)

    Fernandes, K V; Deus-de-Oliveira, N; Godoy, M G; Guimarães, Z A S; Nascimento, V V; Melo, E J T de; Freire, D M G; Dansa-Petretski, M; Machado, O L T


    Ricinus communis L. is of great economic importance due to the oil extracted from its seeds. Castor oil has been used for pharmaceutical and industrial applications, as a lubricant or coating agent, as a component of plastic products, as a fungicide or in the synthesis of biodiesel fuels. After oil extraction, a castor cake with a large amount of protein is obtained. However, this by-product cannot be used as animal feed due to the presence of toxic (ricin) and allergenic (2S albumin) proteins. Here, we propose two processes for detoxification and allergen inactivation of the castor cake. In addition, we establish a biological test to detect ricin and validate these detoxification processes. In this test, Vero cells were treated with ricin, and cell death was assessed by cell counting and measurement of lactate dehydrogenase activity. The limit of detection of the Vero cell assay was 10 ng/mL using a concentration of 1.6 x 10(5) cells/well. Solid-state fermentation (SSF) and treatment with calcium compounds were used as cake detoxification processes. For SSF, Aspergillus niger was grown using a castor cake as a substrate, and this cake was analyzed after 24, 48, 72, and 96 h of SSF. Ricin was eliminated after 24 h of SSF treatment. The cake was treated with 4 or 8% Ca(OH)2 or CaO, and both the toxicity and the allergenic properties were entirely abolished. A by-product free of toxicity and allergens was obtained.

  10. Simultaneous allergen inactivation and detoxification of castor bean cake by treatment with calcium compounds

    Directory of Open Access Journals (Sweden)

    K.V. Fernandes


    Full Text Available Ricinus communis L. is of great economic importance due to the oil extracted from its seeds. Castor oil has been used for pharmaceutical and industrial applications, as a lubricant or coating agent, as a component of plastic products, as a fungicide or in the synthesis of biodiesel fuels. After oil extraction, a castor cake with a large amount of protein is obtained. However, this by-product cannot be used as animal feed due to the presence of toxic (ricin and allergenic (2S albumin proteins. Here, we propose two processes for detoxification and allergen inactivation of the castor cake. In addition, we establish a biological test to detect ricin and validate these detoxification processes. In this test, Vero cells were treated with ricin, and cell death was assessed by cell counting and measurement of lactate dehydrogenase activity. The limit of detection of the Vero cell assay was 10 ng/mL using a concentration of 1.6 x 10(5 cells/well. Solid-state fermentation (SSF and treatment with calcium compounds were used as cake detoxification processes. For SSF, Aspergillus niger was grown using a castor cake as a substrate, and this cake was analyzed after 24, 48, 72, and 96 h of SSF. Ricin was eliminated after 24 h of SSF treatment. The cake was treated with 4 or 8% Ca(OH2 or CaO, and both the toxicity and the allergenic properties were entirely abolished. A by-product free of toxicity and allergens was obtained.

  11. Simultaneous allergen inactivation and detoxification of castor bean cake by treatment with calcium compounds

    Energy Technology Data Exchange (ETDEWEB)

    Fernandes, K.V.; Deus-de-Oliveira, N. [Laboratório de Química e Função de Proteínas e Peptídeos, Centro de Biociências e Biotecnologia, Universidade Estadual do Norte Fluminense Darcy Ribeiro, Rio de Janeiro, RJ (Brazil); Godoy, M.G. [Laboratório de Biotecnologia Microbiana, Instituto de Química, Universidade Federal do Rio de Janeiro, Rio de Janeiro, RJ (Brazil); Guimarães, Z.A.S. [Laboratório de Biologia Celular e Tecidual, Centro de Biociências e Biotecnologia, Universidade Estadual do Norte Fluminense Darcy Ribeiro, Rio de Janeiro, RJ (Brazil); Nascimento, V.V. [Laboratório de Química e Função de Proteínas e Peptídeos, Centro de Biociências e Biotecnologia, Universidade Estadual do Norte Fluminense Darcy Ribeiro, Rio de Janeiro, RJ (Brazil); Melo, E.J.T. de [Laboratório de Biologia Celular e Tecidual, Centro de Biociências e Biotecnologia, Universidade Estadual do Norte Fluminense Darcy Ribeiro, Rio de Janeiro, RJ (Brazil); Freire, D.M.G. [Laboratório de Biotecnologia Microbiana, Instituto de Química, Universidade Federal do Rio de Janeiro, Rio de Janeiro, RJ (Brazil); Dansa-Petretski, M.; Machado, O.L.T. [Laboratório de Química e Função de Proteínas e Peptídeos, Centro de Biociências e Biotecnologia, Universidade Estadual do Norte Fluminense Darcy Ribeiro, Rio de Janeiro, RJ (Brazil)


    Ricinus communis L. is of great economic importance due to the oil extracted from its seeds. Castor oil has been used for pharmaceutical and industrial applications, as a lubricant or coating agent, as a component of plastic products, as a fungicide or in the synthesis of biodiesel fuels. After oil extraction, a castor cake with a large amount of protein is obtained. However, this by-product cannot be used as animal feed due to the presence of toxic (ricin) and allergenic (2S albumin) proteins. Here, we propose two processes for detoxification and allergen inactivation of the castor cake. In addition, we establish a biological test to detect ricin and validate these detoxification processes. In this test, Vero cells were treated with ricin, and cell death was assessed by cell counting and measurement of lactate dehydrogenase activity. The limit of detection of the Vero cell assay was 10 ng/mL using a concentration of 1.6 × 10{sup 5} cells/well. Solid-state fermentation (SSF) and treatment with calcium compounds were used as cake detoxification processes. For SSF, Aspergillus niger was grown using a castor cake as a substrate, and this cake was analyzed after 24, 48, 72, and 96 h of SSF. Ricin was eliminated after 24 h of SSF treatment. The cake was treated with 4 or 8% Ca(OH){sub 2} or CaO, and both the toxicity and the allergenic properties were entirely abolished. A by-product free of toxicity and allergens was obtained.

  12. Contrasting patterns of genetic divergence in two sympatric pseudo-metallophytes: Rumex acetosa L. and Commelina communis L.

    Directory of Open Access Journals (Sweden)

    Ye M


    Full Text Available Abstract Background Patterns of genetic divergence between populations of facultative metallophytes have been investigated extensively. However, most previous investigations have focused on a single plant species making it unclear if genetic divergence shows common patterns or, conversely, is species-specific. The herbs Rumex acetosa L. and Commelina communis L. are two pseudo-metallophytes thriving in both normal and cupriferous soils along the middle and lower reaches of the Yangtze River in China. Their non-metallicolous and metallicolous populations are often sympatric thus providing an ideal opportunity for comparative estimation of genetic structures and divergence under the selective pressure derived from copper toxicity. Results In the present study, patterns of genetic divergence of R. acetosa and C. communis , including metal tolerance, genetic structure and genetic relationships between populations, were investigated and compared using hydroponic experiments, AFLP, ISSR and chloroplast genetic markers. Our results show a significant reduction in genetic diversity in metallicolous populations of C. communis but not in R. acetosa . Moreover, genetic differentiation is less in R. acetosa than in C. communis , the latter species also shows a clustering of its metallicolous populations. Conclusions We propose that the genetic divergences apparent in R. acetosa and C. communis , and the contrasting responses of the two species to copper contamination, might be attributed to the differences in their intrinsic physiological and ecological properties. No simple and generalised conclusions on genetic divergence in pseudo-metallophytes can thus be drawn.

  13. Babesia microti (Piroplasmida: Babesiidae) in nymphal Ixodes ricinus (Acari: Ixodidae) in the Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Rudolf, Ivo; Golovchenko, Maryna; Šikutová, Silvie; Rudenko, Natalia; Grubhoffer, Libor; Hubálek, Zdeněk


    Roč. 52, č. 3 (2005), s. 274-276 ISSN 0015-5683 R&D Projects: GA ČR(CZ) GA206/03/0726 Institutional research plan: CEZ:AV0Z60930519; CEZ:AV0Z60220518 Keywords : Babesia microti * Ixodes ricinus Subject RIV: EE - Microbiology, Virology Impact factor: 1.138, year: 2005

  14. Optimization of the solid-phase microextraction method in the determination of Ixodes ricinus (L.) volatiles

    Czech Academy of Sciences Publication Activity Database

    Zahradníčková, Helena; Bouman, Edwin Arien Poul


    Roč. 29, č. 2 (2006), s. 236-241 ISSN 1615-9306 R&D Projects: GA ČR(CZ) GA206/04/0751 Institutional research plan: CEZ:AV0Z50070508; CEZ:AV0Z60220518 Keywords : GC/MS * Ixodes ricinus * solid-phase microextraction Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 2.535, year: 2006

  15. Antibiotic treatment of the hard tick Ixodes ricinus: Influence on Midichloria mitochondrii load following blood meal. (United States)

    Ninio, Camille; Plantard, Olivier; Serra, Valentina; Pollera, Claudia; Ferrari, Nicola; Cafiso, Alessandra; Sassera, Davide; Bazzocchi, Chiara


    Midichloria mitochondrii is the most prevalent symbiont of the hard tick Ixodes ricinus, present in 100% of eggs and adult females of wild ticks. This bacterium is intracellular, and is the only known symbiont able to invade the mitochondria of the host cells. However, the role that M. mitochondrii plays in the host metabolism has yet to be elucidated. Multiple lines of evidence indicate the possibility of transmission of this bacterium to the vertebrate host during the tick blood meal. In order to investigate the role of M. mitochondrii in the biology of the tick host, we performed an antibiotic treatment on Ixodes ricinus individuals, with the aim of reducing/eliminating the symbiont, and to potentially observe the dynamic of bacterial infection in the tick host. We microinjected engorged adult females of I. ricinus with tetracycline, and we allowed the resulting larvae to feed on gerbils treated with the same antibiotic. The amount of M. mitochondrii was evaluated at different stages of the experiment using molecular techniques. In addition we evaluated the presence/absence of the symbiont DNA in the blood of gerbils used for the larval feeding. The performed treatments did not allow to eliminate the symbiont population from the host tick, however it allowed to reduce the multiplication that occurs after the larval blood meal. These results open the way for future experiments, using different antibiotic molecules, different administration methods and antibiotic administration on subsequent tick stages, to fulfill the goal of eliminating M. mitochondrii from the host I. ricinus, a major step in our understanding of the impact of this bacterium on ticks. Copyright © 2015 Elsevier GmbH. All rights reserved.

  16. Identification and partial characterisation of new members of the Ixodes ricinus defensin family

    Czech Academy of Sciences Publication Activity Database

    Tonk, Miray; Cabezas Cruz, Alejandro; Valdés, James J.; Rego, Ryan O. M.; Rudenko, Natalia; Golovchenko, Maryna; Bell-Sakyi, L.; de la Fuente, J.; Grubhoffer, Libor


    Roč. 540, č. 2 (2014), s. 146-152 ISSN 0378-1119 R&D Projects: GA ČR(CZ) GAP302/11/1901; GA MŠk(CZ) EE2.3.30.0032 Institutional support: RVO:60077344 Keywords : antimicrobial peptide * defensin * Ixodes ricinus * tick * tick cell line Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.138, year: 2014

  17. Efficiency of experimental infection of Ixodes ricinus ticks with Borrelia burgdorferi spirochetes

    Czech Academy of Sciences Publication Activity Database

    Horká, Helena; Černá-Kýčková, Kateřina; Fišerová, L.; Kopecký, Jan


    Roč. 298, S1 (2008), s. 177-179 ISSN 1438-4221. [International Jena Symposium on Tick-borne Diseases (formerly IPS). Jena, 15.03.2007-17.03.2007] R&D Projects: GA MŠk(CZ) LC06009; GA ČR GA524/05/0811 Institutional research plan: CEZ:AV0Z60220518 Keywords : Ixodes ricinus * Borrelia burgdorferi * immersion of larvae * pathogen transmission Subject RIV: EC - Immunology Impact factor: 3.486, year: 2008

  18. Prevalence and phylogenetic analysis of Babesia spp. in Ixodes ricinus and Ixodes persulcatus ticks in Latvia. (United States)

    Capligina, Valentina; Berzina, Inese; Bormane, Antra; Salmane, Ineta; Vilks, Karlis; Kazarina, Alisa; Bandere, Dace; Baumanis, Viesturs; Ranka, Renate


    Babesia spp. are tick-borne protozoan parasites that have been reported in many European countries and are considered to be emerging pathogens. Several Babesia spp. have been identified in ticks in Latvia. Recently, canine babesiosis cases were diagnosed for the first time in Latvia; therefore, continued studies on the prevalence and occurrence of new species are warranted. In the present study, questing tick samples collected in 2005-2007 were screened for the presence of Babesia spp.; in total, 432 Ixodes ricinus and 693 Ixodes persulcatus ticks were analyzed. Babesia spp. were detected in 1.4% of the I. ricinus ticks and in 1.9% of I. persulcatus ticks. Sequencing revealed that ixodid ticks in Latvia contained Babesia microti, Babesia capreoli, and Babesia venatorum. Babesia microti was the most prevalent species, accounting for 58% of all positive samples; moreover, two distinct B. microti genotypes were identified. Phylogenetic analysis of the full-length 18S rRNA gene of two B. capreoli/B. divergens isolates indicated a closer relationship to the B. capreoli clade than B. divergens. This is the first report of B. venatorum in I. persulcatus ticks in Latvia. Our results suggest that both I. ricinus and I. persulcatus ticks play important roles in the epidemiology of these zoonotic pathogens in Latvia.

  19. Arsenophonus nasoniae and Rickettsiae Infection of Ixodes ricinus Due to Parasitic Wasp Ixodiphagus hookeri.

    Directory of Open Access Journals (Sweden)

    Monika Bohacsova

    Full Text Available Arsenophonus nasoniae, a male-killing endosymbiont of chalcid wasps, was recently detected in several hard tick species. Following the hypothesis that its presence in ticks may not be linked to the direct occurrence of bacteria in tick's organs, we identified A. nasoniae in wasps emerging from parasitised nymphs. We confirmed that 28.1% of Ixodiphagus hookeri wasps parasitizing Ixodes ricinus ticks were infected by A. nasoniae. Moreover, in examined I. ricinus nymphs, A. nasoniae was detected only in those, which were parasitized by the wasp. However, in part of the adult wasps as well as in some ticks that contained wasp's DNA, we did not confirm A. nasoniae. We also found, that in spite of reported male-killing, some newly emerged adult wasp males were also infected by A. nasoniae. Additionally, we amplified the DNA of Rickettsia helvetica and Rickettsia monacensis (known to be Ixodes ricinus-associated bacteria in adult parasitoid wasps. This may be related either with the digested bacterial DNA in wasp body lumen or with a role of wasps in circulation of rickettsiae among tick vectors.

  20. Vector competence of the tick Ixodes ricinus for transmission of Bartonella birtlesii.

    Directory of Open Access Journals (Sweden)

    Caroline Reis

    Full Text Available Bartonella spp. are facultative intracellular vector-borne bacteria associated with several emerging diseases in humans and animals all over the world. The potential for involvement of ticks in transmission of Bartonella spp. has been heartily debated for many years. However, most of the data supporting bartonellae transmission by ticks come from molecular and serological epidemiological surveys in humans and animals providing only indirect evidences without a direct proof of tick vector competence for transmission of bartonellae. We used a murine model to assess the vector competence of Ixodes ricinus for Bartonella birtlesii. Larval and nymphal I. ricinus were fed on a B. birtlesii-infected mouse. The nymphs successfully transmitted B. birtlesii to naïve mice as bacteria were recovered from both the mouse blood and liver at seven and 16 days after tick bites. The female adults successfully emitted the bacteria into uninfected blood after three or more days of tick attachment, when fed via membrane feeding system. Histochemical staining showed the presence of bacteria in salivary glands and muscle tissues of partially engorged adult ticks, which had molted from the infected nymphs. These results confirm the vector competence of I. ricinus for B. birtlesii and represent the first in vivo demonstration of a Bartonella sp. transmission by ticks. Consequently, bartonelloses should be now included in the differential diagnosis for patients exposed to tick bites.

  1. Low prevalence of Borrelia bavariensis in Ixodes ricinus ticks in southeastern Austria. (United States)

    Glatz, Martin; Muellegger, Robert R; Hizo-Teufel, Cecilia; Fingerle, Volker


    Borrelia bavariensis was recently described as a distinct genospecies among the B. burgdorferi sensu lato complex. The prevalence of B. bavariensis in Austria, a highly endemic area for tick-transmitted pathogens, is scarcely characterized. To investigate the prevalence of B. bavariensis in Ixodes ricinus ticks we reevaluated the results of a study conducted in 518 ticks from southeastern Austria collected in 2002 and 2003. The presence of B. burgdorferi s.l.-specific DNA in ticks was analyzed by a PCR for the outer surface protein A (ospA) gene. Borrelia species were differentiated by restriction fragment length polymorphism (RFLP) analysis, and samples positive for B. bavariensis were further analyzed by multilocus sequence analysis. Two of 133 (1.5%) B. burgdorferi s.l.-positive I. ricinus ticks were infected with B. bavariensis. Both specimens were coinfected with the OspA serotype 5 of B. garinii. Borrelia bavariensis is present; however, seem to be rare in I. ricinus ticks in southeastern Austria. Copyright © 2014 Elsevier GmbH. All rights reserved.

  2. Mung Bean: Technological and Nutritional Potential

    NARCIS (Netherlands)

    Dahiya, P.K.; Linnemann, A.R.; Boekel, van M.A.J.S.; Khetarpaul, N.; Grewal, R.B.; Nout, M.J.R.


    Mung bean (Vigna radiata (L.) R.Wilczek) has been intensively researched; scattered data are available on various properties. Data on physical, chemical, food processing, and nutritional properties were collected for whole mung bean grains and reviewed to assess the crop’s potential as food and to

  3. Nutritional and health benefits of dried beans. (United States)

    Messina, Virginia


    Dried beans (often referred to as grain legumes) may contribute to some of the health benefits associated with plant-based diets. Beans are rich in a number of important micronutrients, including potassium, magnesium, folate, iron, and zinc, and are important sources of protein in vegetarian diets. In particular, they are among the only plant foods that provide significant amounts of the indispensable amino acid lysine. Commonly consumed dried beans are also rich in total and soluble fiber as well as in resistant starch, all of which contribute to the low glycemic index of these foods. They also provide ample amounts of polyphenols, many of which are potent antioxidants. Intervention and prospective research suggests that diets that include beans reduce low-density lipoprotein cholesterol, favorably affect risk factors for metabolic syndrome, and reduce risk of ischemic heart disease and diabetes. The relatively low bean intakes of North Americans and northern Europeans can be attributed to a negative culinary image as well as to intestinal discomfort attributable to the oligosaccharide content of beans. Cooking practices such as sprouting beans, soaking and discarding soaking water before cooking, and cooking in water with a more alkaline pH can reduce oligosaccharide content. Promotional efforts are needed to increase bean intake. © 2014 American Society for Nutrition.


    African Journals Online (AJOL)


    arthropoda, class; insecta and family; celeoptera. (Akinsanmi, 1980). This species is light olive coloured and mottled with dark brown or grey reddish legs. The bean weevils are stored products granivores and typically infest various kinds of bean species particularly the species Phaseolus vulgaris where they live for most.

  5. Weed management strategies for castor bean crops

    Directory of Open Access Journals (Sweden)

    Augusto Guerreiro Fontoura Costa


    Full Text Available Castor bean crops are agriculturally relevant due to the quality and versatility of their oil, both for the chemical industry and for biodiesel production. Proper weed management is important for both the cultivation and the yield of castor bean crops; therefore, the intention of the present work is to review pertinent information regarding weed management, including the studies regarding weed interference periods, chemical controls for use in different crop production systems and herbicide selectivity, for castor bean crops. Weed science research for castor bean crops is scarce. One of the main weed management challenges for castor bean crops is the absence of herbicides registered with the Ministry of Agriculture, Livestock and Food Supply (MALFS. Research for viable herbicides for weed control in castor bean crops should be directed by research and/or rural extension institutions, associations and farmers cooperatives, as well as by manufactures, for the registration of these selective herbicides, which would be primarily used to control eudicotyledons in castor bean crops. New studies involving the integration of weed control methods in castor bean also may increase the efficiency of weed management, for both small farmers using traditional crop methods in the Brazilian Northeast region, as well as for areas with the potential for large scale production, using conservation tillage systems, such as the no-tillage crop production system.

  6. the pan- africa bean research alliance (pabra)

    African Journals Online (AJOL)

    Prof. Adipala Ekwamu

    increased access to high value bean products. (varieties) targeted to niche markets. The objectives of this paper are to: (1) present a unique partnership model developed and used by PABRA to breed and deliver improved bean varieties to millions of beneficiaries in Africa; (2) review PABRA's strategy and achievements in.

  7. Phytoremediation of soil polluted by nickel using agricultural crops. (United States)

    Giordani, Cesare; Cecchi, Stefano; Zanchi, Camillo


    Soil pollution due to heavy metals is widespread; on the world scale, it involves about 235 million hectares. The objectives of this research were to establish the uptake efficiency of nickel by some agricultural crops. In addition, we wanted to establish also in which part of plants the metal is stored for an eventual use of biomass or for recycling the metal. The experiments included seven herbaceous crops such as: barley (Hordeum vulgaris), cabbage (Brassica juncea), spinach (Spinacea oleracea), sorghum (Sorgum vulgare), bean (Phaseolus vulgaris), tomato (Solanum lycopersicum), and ricinus (Ricinus communis). We used three levels of treatment (150, 300, and 600 ppm) and one control. At the end of the biological cycle of the crops, the different parts of plants, i.e., roots, stems, leaves, fruits, or seeds, were separately collected, oven dried, weighed, milled, and separately analysed. The leaves and stems of spinach showed a very good nickel storage capacity. The ricinus too proved to be a very good nickel storer. The ability of spinach and ricinus to store nickel was observed also in the leaves of cabbage, even if with a lower storage capacity. The bean, barley, and tomato, in decreasing order of uptake and storage capacity, showed a high concentration of nickel in leaves and stems, whereas the sorghum evidenced a lesser capacity to uptake and store nickel in leaves and stems. The bean was the most efficient in storing nickel in fruits or grains. Tomato, sorghum, and barley have shown a storage capacity notably less than bean. The bean appeared to be the most efficient in accumulating nickel in the roots, followed in decreasing order by sorghum, ricinus, and tomato. With regard to the removal of nickel, spinach was the most efficient as it contains the highest level of this metal per gram of dry matter. The ricinus, cabbage, bean, sorghum, barley, and tomato evidenced a progressively decreasing efficiency in the removal of nickel.

  8. Measurements of essential oil extract and antioxidant in Syrian Myrtus communis L. leaves using photo chemiluminescence assay

    International Nuclear Information System (INIS)

    Zayzafoon, G.; Odeh, A.; Mahzia, Y.


    The essential oil extracts and antioxidant measurements of Syrian Myrtus communis L. leaves as hydrophilic and hydrophobic existence species have been carried out. The plant leaves as a source of antioxidants was tested by the influence of its aqueous and essential oil extracts on the yield of photo chemiluminescence, PCL solution applying very sensitive and reliable method. By means of a photo chemiluminescence assay, it was possible to assess the total antioxidants capacity of hydrophilic and hydrophobic species existence in Syrian Myrtus communis L. leaves. It has been found that, the integral antioxidant capacity measurements value of Syrian Myrtus communis L. leaves was found in Kurdaha site which has a value of 465.67 1.18 nmol TE/g DM (total Trolox equivalent /gram of Dry material) . The following three mainly chemical species were found in the essential oil extracts: -Pinene, Cineole and Limonene. (author)

  9. Enterprise JavaBeans 31

    CERN Document Server

    Rubinger, Andrew


    Learn how to code, package, deploy, and test functional Enterprise JavaBeans with the latest edition of this bestselling guide. Written by the developers of JBoss EJB 3.1, this book not only brings you up to speed on each component type and container service in this implementation, it also provides a workbook with several hands-on examples to help you gain immediate experience with these components. With version 3.1, EJB's server-side component model for building distributed business applications is simpler than ever. But it's still a complex technology that requires study and lots of practi

  10. Hyperglycaemic effect of Artocarpus communis Forst (Moraceae) root bark aqueous extract in Wistar rats. (United States)

    Adewole, S O; Ojewole, J O


    Decoctions and infusions of Artocarpus communis (Forst) (family: Moraceae) root bark are traditionally used among the Yoruba-speaking people of western Nigeria as folk remedies for the management, control and treatment of an array of human diseases, including type 2 diabetes mellitus. Although numerous bioactive prenylflavonoids have been isolated from the roots, stem bark and leaves of A communis, to the best of our knowledge, the effects of the plant's root bark extract on animal models of diabetes mellitus have hitherto not been reported in the biomedical literature. In our pilot study, we observed that A communis root bark aqueous extract (ACE) raised blood glucose concentrations in rats. In view of this finding, the present study was undertaken to investigate the glycaemic effect of ACE in comparison with that of streptozotocin (STZ) in Wistar rats. Four groups (A, B, C and D) of Wistar rats, each group consisting of 10 rats, were used in this study. Group A rats received distilled water in quantities equivalent to the volume of ACE administered. Diabetes mellitus was induced in the animals in groups B and C by intraperitoneal (ip) injections of STZ (75 mg/kg body weight). The rats in group C were additionally treated with ACE (50 mg/kg body weight ip) from the third to the tenth day following STZ treatment. Group D rats received ACE (12.5-100 mg/kg body weight ip) only. The effects of ACE were compared with those of STZ on blood glucose concentrations, serum and pancreatic insulin levels, hepatic hexokinase (HXK) and glucokinase (GCK) activities, and hepatic glycogen contents in the experimental animal paradigm used. The rats in treated groups B, C and D exhibited pronounced polyuria, hypo-insulinaemia and hyperglycaemia. Group D rats developed significant hyperglycaemia (p < 0.05) immediately after ACE administration, whereas groups B and C rats became hyperglycaemic 24 to 72 hours post STZ and STZ + ACE treatments, when compared with the control group A

  11. Gregarine Cephaloidophora communis mawrodiadi, 1908 in the barnacle Euraphia rhyzophorae, Oliveira, 1940 from Brazil

    Directory of Open Access Journals (Sweden)

    Lacombe Dyrce


    Full Text Available The gregarine Cephaloidophora communis was observed for the first time in Brazil in the barnacles Euraphia rhyzophorae collected in Angra dos Reis, Rio de Janeiro, Brazil, between 1990 and 1996. Histological studies showed growth phases of the parasite in specific parts of the digestive system. The intracellular forms occurred in the vacuoles of the intestinal cells. Syzygy was frequent, and the most common form following syzygy was cylindrical, with a single membrane. The cytoplasm of the gregarines was always irregular, dense, and occasionally presenting a dark stoch area.

  12. Phytosynthesis of Silver Nanoparticles Using Myrtus communis L. Leaf Extract and Investigation of Bactericidal Activity (United States)

    Ajdari, M. R.; Tondro, G. H.; Sattarahmady, N.; Parsa, A.; Heli, H.


    Silver nanoparticles have been synthesized using only Myrtus communis L. leaf extract by a facile procedure without other reagents. The extract played the roles of both reducing and capping agent. The nanoparticles were characterized using field-emission scanning microscopy, and remained stable for at least 3 weeks. Antibacterial activity of the nanoparticles was evaluated toward Escherichia coli, Bacillus subtilis, Pseudomonas aeruginosa, Staphylococcus aureus, methicillin-resistant Staphylococcus aureus, and Enterococcus faecalis based on inhibition zone disk diffusion assays. The minimum inhibitory and bactericidal concentrations of the nanoparticles were obtained. Mechanisms for the antibacterial activity were proposed.

  13. HPLC-DAD-MS identification of bioactive secondary metabolites from Ferula communis roots. (United States)

    Arnoldi, Lolita; Ballero, Mauro; Fuzzati, Nicola; Maxia, Andrea; Mercalli, Enrico; Pagni, Luca


    A simple HPLC method was developed to distinguish between 'poisonous' and 'non-poisonous' chemotypes of Ferula communis. The method was performed on a C8 reverse phase analytical column using a binary eluent (aqueous TFA 0.01%-TFA 0.01% in acetonitrile) under gradient condition. The two chemotypes showed different fingerprints. The identification of five coumarins and eleven daucane derivatives by HPLC-diode array detection (HPLC-DAD) and HPLC-MS is described. A coumarin, not yet described, was detected. Copyright 2004 Elsevier B.V.

  14. Clustering common bean mutants based on heterotic groupings ...

    African Journals Online (AJOL)

    The objective of this study was to cluster bean mutants from a bean mutation breeding programme, based on heterotic groupings. This was achieved by genotyping 16 bean genotypes, using 21 Simple Sequence Repeats (SSR) bean markers. From the results, three different clusters A, B and C, were obtained suggesting ...

  15. faba bean and field pea seed proportion for intercropping system

    African Journals Online (AJOL)


    Intercropping of Faba bean (Vicia fabae) and field pea (Pisum sativum) is an important cropping system in the. Horro highlands of ... productivity of the Faba bean/field pea was obtained from intercropping system. Growing Faba bean both as a .... as per the available research recommendation for. Faba bean and field pea ...

  16. Table 5 Mineral content of ashed bean samples

    African Journals Online (AJOL)

    Dr Mamiro


    Aug 5, 2012 ... vegetables; dry bean grains are used in various food preparations, and both are used as relish or side dishes together ... Eastern Africa and Latin America. Zinc content of beans is one of the ... Kidney bean leaves and fresh bean grains, which are prepared as relish and consumed by a number of families in ...

  17. Key odorants in cured Madagascar vanilla beans (Vanilla planiforia) of differing bean quality. (United States)

    Takahashi, Makoto; Inai, Yoko; Miyazawa, Norio; Kurobayashi, Yoshiko; Fujita, Akira


    The odor-active volatiles in Madagascar vanilla beans (Vanilla planiforia) of two grades, red whole beans as standard quality and cuts beans as substandard quality, were characterized by instrumental and sensory analyses. The higher contents of vanillin and β-damascenone in red whole beans than in cuts beans respectively contributed to significant differences in the sweet and dried fruit-like notes, while the higher contents of guaiacol and 3-phenylpropanoic acid in cuts beans than in red whole beans respectively contributed to significant differences in the phenolic and metallic notes. A sensory evaluation to compare red whole beans and their reconstituted aroma characterized both samples as being similar, while in respect of the phenolic note, the reconstituted aroma significantly differed from the reconstituted aroma with guaiacol added at the concentration ratio of vanillin and guaiacol in cuts beans. It is suggested from these results that the concentration ratio of vanillin and guaiacol could be used as an index for the quality of Madagascar vanilla beans.

  18. Prevalence of tick-borne pathogens in questing Ixodes ricinus ticks in urban and suburban areas of Switzerland

    Directory of Open Access Journals (Sweden)

    Corinne P. Oechslin


    Full Text Available Abstract Background Throughout Europe, Ixodes ricinus transmits numerous pathogens. Its widespread distribution is not limited to rural but also includes urbanized areas. To date, comprehensive data on pathogen carrier rates of I. ricinus ticks in urban areas of Switzerland is lacking. Results Ixodes ricinus ticks sampled at 18 (sub- urban collection sites throughout Switzerland showed carrier rates of 0% for tick-borne encephalitis virus, 18.0% for Borrelia burgdorferi (sensu lato, 2.5% for Borrelia miyamotoi, 13.5% for Rickettsia spp., 1.4% for Anaplasma phagocytophilum, 6.2% for "Candidatus Neoehrlichia mikurensis", and 0.8% for Babesia venatorum (Babesia sp., EU1. Site-specific prevalence at collection sites with n > 45 ticks (n = 9 significantly differed for B. burgdorferi (s.l., Rickettsia spp., and "Ca. N. mikurensis", but were not related to the habitat type. Three hundred fifty eight out of 1078 I. ricinus ticks (33.2% tested positive for at least one pathogen. Thereof, about 20% (71/358 were carrying two or three different potentially disease-causing agents. Using next generation sequencing, we could detect true pathogens, tick symbionts and organisms of environmental or human origin in ten selected samples. Conclusions Our data document the presence of pathogens in the (sub- urban I. ricinus tick population in Switzerland, with carrier rates as high as those in rural regions. Carriage of multiple pathogens was repeatedly observed, demonstrating the risk of acquiring multiple infections as a consequence of a tick bite.

  19. First evidence of Babesia venatorum and Babesia capreoli in questing Ixodes ricinus ticks in the Czech Republic. (United States)

    Venclikova, Kristyna; Mendel, Jan; Betasova, Lenka; Hubalek, Zdenek; Rudolf, Ivo


    Ixodes ricinus is the most common tick species occurring in Central Europe and it serves as a principal vector of emerging human pathogens. The aim of this study was to determine the prevalence of Babesia spp. in host-seeking I. ricinus in urban and natural habitats. PCR was applied on samples to assess prevalence of Babesia spp. in questing ixodid ticks. Sequencing was used for Babesia species determination. 1,473 I. ricinus ticks (1,294 nymphs, 99 males and 80 females) were examined for the presence of Babesia spp. at the two study sites. Minimum infection rate for Babesia spp. was found to be 0.5% (infected I. ricinus nymphs were only detected in the natural ecosystem). Two Babesia species were identified by sequencing: B. venatorum (formerly called Babesia sp. EU1) and B. capreoli. The results obtained represent the first evidence of the occurrence of B. venatorum and B. capreoli in host-seeking I. ricinus ticks in the Czech Republic.

  20. Radiation disinfestation of grains and cocoa beans

    International Nuclear Information System (INIS)

    Appiah, V.


    A series of experiments has been performed by Ghanaian scientists from 1977 to 1987 to evaluate the seriousness of infestation and to establish effective doses for radiation disinfestation against insects and fungi which cause deterioration in grains and cocoa beans. Supporting investigations have been done on the effect of radiation disinfestation on some quality parameters and wholesomeness of grains (with maize as the test grain) and cocoa beans. A minimum dose of 0.8 kGy was established for effective control of insects present in stored grains and cocoa beans. For the decontamination against fungi and yeasts, a combination of moist heat (85% RH) applied to 60 deg. C for 30 min followed by a dose of 4 kGy was effective for maize and moist heat (85% RH) applied 80 deg. C and a dose of 4 kGy was recommended for cocoa beans. No significant difference was found between the organoleptic qualities of the products from maize and cocoa that had been treated with moist heat and radiation and the untreated samples. The cooling (solidifying) curves of cocoa butter prepared from untreated and treated cocoa beans were very similar. Irradiated cocoa beans were found to be wholesome. The prospects of radiation disinfestation of grains and cocoa beans have also been discussed. (author). 27 refs, 4 tabs

  1. Management of faba bean gall in faba bean producing area of Eastern Amhara, Ethiopia

    Directory of Open Access Journals (Sweden)

    Bogale Nigir Hailemariam


    Full Text Available Faba bean new disease (faba bean gall (Olpidium viciae (Kusano is the most destructive disease of faba bean ((Vicia faba L. in Ethiopia, particularly in Amhara, Tigray and some part of Oromia region. This problem needs immediate sound management strategy to maximize faba bean productivity. A field study was carried out in Geregera and Jama during the 2013 and 2014 main crop season and Maybar watershed in 2014 to verify the fungicide to faba bean gall. The objective of this study was evaluating effective fungicides for the management of faba bean new disease. The treatments were baylaton in the form of seed dressing and foliar spray; mancozeb, redomil, chlorotalonin and cruzet in the form of foliar spray and apron star and theram used as a foliar spray and also untreated check used as a comparison. The result showed that significantly differ between treatments (p

  2. Yeasts are essential for cocoa bean fermentation. (United States)

    Ho, Van Thi Thuy; Zhao, Jian; Fleet, Graham


    Cocoa beans (Theobroma cacao) are the major raw material for chocolate production and fermentation of the beans is essential for the development of chocolate flavor precursors. In this study, a novel approach was used to determine the role of yeasts in cocoa fermentation and their contribution to chocolate quality. Cocoa bean fermentations were conducted with the addition of 200ppm Natamycin to inhibit the growth of yeasts, and the resultant microbial ecology and metabolism, bean chemistry and chocolate quality were compared with those of normal (control) fermentations. The yeasts Hanseniaspora guilliermondii, Pichia kudriavzevii and Kluyveromyces marxianus, the lactic acid bacteria Lactobacillus plantarum and Lactobacillus fermentum and the acetic acid bacteria Acetobacter pasteurianus and Gluconobacter frateurii were the major species found in the control fermentation. In fermentations with the presence of Natamycin, the same bacterial species grew but yeast growth was inhibited. Physical and chemical analyses showed that beans fermented without yeasts had increased shell content, lower production of ethanol, higher alcohols and esters throughout fermentation and lesser presence of pyrazines in the roasted product. Quality tests revealed that beans fermented without yeasts were purplish-violet in color and not fully brown, and chocolate prepared from these beans tasted more acid and lacked characteristic chocolate flavor. Beans fermented with yeast growth were fully brown in color and gave chocolate with typical characters which were clearly preferred by sensory panels. Our findings demonstrate that yeast growth and activity were essential for cocoa bean fermentation and the development of chocolate characteristics. Crown Copyright © 2014. Published by Elsevier B.V. All rights reserved.

  3. Evaluation of Sebostatic Activity of Juniperus communis Fruit Oil and Pelargonium graveolens Oil Compared to Niacinamide

    Directory of Open Access Journals (Sweden)

    Justyna Kozlowska


    Full Text Available As a facial skin condition, oily skin causes cosmetic problems, such as large pores, shiny appearance, and the feeling of greasiness and heaviness. Furthermore, extensive sebum production leads to common skin disorders such as acne vulgaris or seborrheic dermatitis. This study investigated the efficacy of sebum control tonics containing Juniperus communis fruit oil, Pelargonium graveolens oil, or niacinamide. The effects of Juniperus communis fruit oil, Pelargonium graveolens oil, and niacinamide on sebum excretion rates were investigated using Sebumeter®. Sebum measurements (Sebumeter® SM 815, Courage & Khazaka®, Köln, Germany were made on the skin surface in three places by applying the sebumeter probe to the forehead after 10, 60, and 120 min from application of the tonic. The results indicated that the application of the tonic maintained a lower sebum secretion 10 min and 60 min after the application of the cosmetic, compared to those before it. However, a visible sebum-reducing efficacy after 2 h was reported only for tonic containing 0.25% Pelargonium graveolens oil and for the tonic with the addition of 3% niacinamide. After 2 h, the values of sebum measurements were 44 ± 5.13 a.u. and 58 ± 9.07 a.u., respectively. Our results show that the tonic with the addition of 0.25% Pelargonium graveolens oil is the most effective in reducing sebum production.

  4. Antimicrobial activities of the methanol extract and compounds from Artocarpus communis (Moraceae

    Directory of Open Access Journals (Sweden)

    Ngadjui Bonaventure T


    Full Text Available Abstract Background Artocarpus communis is used traditionally in Cameroon to treat several ailments, including infectious and associated diseases. This work was therefore designed to investigate the antimicrobial activities of the methanol extract (ACB and compounds isolated from the bark of this plant, namely peruvianursenyl acetate C (1, α-amyrenol or viminalol (2, artonin E (4 and 2-[(3,5-dihydroxy-(Z-4-(3-methylbut-1-enylphenyl]benzofuran-6-ol (5. Methods The liquid microdilution assay was used in the determination of the minimal inhibitory concentration (MIC and the minimal microbicidal concentration (MMC, against seven bacterial and one fungal species. Results The MIC results indicated that ACB as well as compounds 4 and 5 were able to prevent the growth of all tested microbial species. All other compounds showed selective activities. The lowest MIC value of 64 μg/ml for the crude extract was recorded on Staphylococcus aureus ATCC 25922 and Escherichia coli ATCC 8739. The corresponding value of 32 μg/ml was recorded with compounds 4 and 5 on Pseudomonas aeruginosa PA01 and compound 5 on E. coli ATCC 8739, their inhibition effect on P. aeruginosa PA01 being more than that of chloramphenicol used as reference antibiotic. Conclusion The overall results of this study provided supportive data for the use of A. communis as well as some of its constituents for the treatment of infections associated with the studied microorganisms.

  5. Antimicrobial activities of the methanol extract and compounds from Artocarpus communis (Moraceae). (United States)

    Kuete, Victor; Ango, Patrick Y; Fotso, Ghislain W; Kapche, Gilbert D W F; Dzoyem, Jean P; Wouking, Arlette G; Ngadjui, Bonaventure T; Abegaz, Berhanu M


    Artocarpus communis is used traditionally in Cameroon to treat several ailments, including infectious and associated diseases. This work was therefore designed to investigate the antimicrobial activities of the methanol extract (ACB) and compounds isolated from the bark of this plant, namely peruvianursenyl acetate C (1), α-amyrenol or viminalol (2), artonin E (4) and 2-[(3,5-dihydroxy)-(Z)-4-(3-methylbut-1-enyl)phenyl]benzofuran-6-ol (5). The liquid microdilution assay was used in the determination of the minimal inhibitory concentration (MIC) and the minimal microbicidal concentration (MMC), against seven bacterial and one fungal species. The MIC results indicated that ACB as well as compounds 4 and 5 were able to prevent the growth of all tested microbial species. All other compounds showed selective activities. The lowest MIC value of 64 μg/ml for the crude extract was recorded on Staphylococcus aureus ATCC 25922 and Escherichia coli ATCC 8739. The corresponding value of 32 μg/ml was recorded with compounds 4 and 5 on Pseudomonas aeruginosa PA01 and compound 5 on E. coli ATCC 8739, their inhibition effect on P. aeruginosa PA01 being more than that of chloramphenicol used as reference antibiotic. The overall results of this study provided supportive data for the use of A. communis as well as some of its constituents for the treatment of infections associated with the studied microorganisms.

  6. Antioxidant properties and xanthine oxidase inhibitory effects of Tamus communis L. root extracts. (United States)

    Boumerfeg, Sabah; Baghiani, Abderrahmane; Messaoudi, Dalila; Khennouf, Seddik; Arrar, Lekhmici


    This study was conducted to search for xanthine oxidase (XO) inhibitors from the root extracts of Tamus communis L. traditionally used in folk medicine in Algeria. Root extracts with different solvents were screened for purified milk xanthine oxidase inhibition. The root extracts (methanol, chloroform and ethyl acetate) and proteins, obtained in distilled water, inhibited bovine, sheep and human milk XO from three species in a concentration-dependent manner, with an additional superoxide scavenging capacity, which reached its highest level with ethyl acetate extract (IC(50) = 0.15, 0.04 and 0.09 g/L) for bovine XO, sheep XO and human XO, respectively. The antioxidant potential was confirmed with the non-enzymatic method, total radical-trapping antioxidant parameter (TRAP) assay, which showed that the Tamus communis L. extracts have a potential antioxidant activity in the same order obtained by using the reduction of cytochrome c, an enzymatic method, in which the antioxidant activity followed a decreasing order: ethyl acetate extract > chloroform extract > protein. Copyright (c) 2008 John Wiley & Sons, Ltd.

  7. Development of an energy-protein for animal food based crop residues pear (Pyrus communis

    Directory of Open Access Journals (Sweden)

    Néstor Julián Pulido-Suárez,


    Full Text Available Pear (Pyrus communis is a fruit from the species of deciduous, widely consumed worldwide for its high quality energ y. However, pear itself does not provide the amount of protein required for cattle feeding, so alternatives to improve its nutritional quality have been studied. On these grounds, the objective of this study was to evaluate the parameters of solid state fermentation, and compositional energ y value of a protein food based on pears (Pyrus communis with apparent physical damage. A completely random design was used to evaluate three treatments; these correspond to percentages of inclusion of calcium carbonate (0.25, 0.50, 0.75 formulation based on already established (40 % pear, 25 % rice flour, 25 % wheat bran and 10 % urea, the parameters evaluated were: pH, ashes (CZ, crude protein (CP and crude fiber (CF, and they were recorded at 0, 24, 48 and 72 hours. As a result, it was found that the pH dropped gradually for each treatment and at each sampling period; however, there were no significant differences. The lower value at the end of the process is recorded T2 (0.25 with 4.66, followed by T3 (0.50 with 4.50, the ash reached values of up to 6 % with T3, and T2 (0.50 reached the highest percentages in fiber and crude protein. Finally, decreasing the fermentation variables ensures a food with no presence of undesirable microorganisms and stable over time.

  8. Feeding toasted field beans to dairy cows


    Jørgensen, K.F.; Kjeldsen, A.M.; Askegaard, M.


    Toasting field beans can improve the protein quality of field beans markedly. In the feed demonstrations carried out in Project EcoProtein testing a new method of toasting with a drum dryer, showed, however, only reduced effect on the protein quality due to a lower than optimal temperature. The toasted field beans were fed in two organic dairy herds, replacing a part of the concentrates in the ration in a cross-over design. Preliminary results showed no milk yield difference in herd 1, but a ...

  9. Reflective Polyethylene Mulch Reduces Mexican Bean Beetle (Coleoptera: Coccinellidae) Densities and Damage in Snap Beans. (United States)

    Nottingham, L B; Kuhar, T P


    Mexican bean beetle, Epilachna varivestis Mulsant, is a serious pest of snap beans, Phaseolus vulgaris L., in the eastern United States. These beetles are intolerant to direct sunlight, explaining why individuals are typically found on the undersides of leaves and in the lower portion of the plant canopy. We hypothesized that snap beans grown on reflective, agricultural polyethylene (plastic mulch) would have fewer Mexican bean beetles and less injury than those grown on black plastic or bare soil. In 2014 and 2015, beans were seeded into beds of metallized, white, and black plastic, and bare soil, in field plots near Blacksburg, VA. Mexican bean beetle density, feeding injury, predatory arthropods, and snap bean yield were sampled. Reflected light intensity, temperature, and humidity were monitored using data loggers. Pyranometer readings showed that reflected light intensity was highest over metallized plastic and second highest over white plastic; black plastic and bare soil were similarly low. Temperature and humidity were unaffected by treatments. Significant reductions in Mexican bean beetle densities and feeding injury were observed in both metallized and white plastic plots compared to black plastic and bare soil, with metallized plastic having the fewest Mexican bean beetle life stages and injury. Predatory arthropod densities were not reduced by reflective plastic. Metallized plots produced the highest yields, followed by white. The results of this study suggest that growing snap beans on reflective plastic mulch can suppress the incidence and damage of Mexican bean beetle, and increase yield in snap beans. © The Authors 2016. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email:

  10. Effects of Wheat and Faba Bean Intercropping on Microorganism Involved in Nitrogen Transformation in the Rhizosphere Soils

    Directory of Open Access Journals (Sweden)

    TANG Yan-fen


    Full Text Available Soil microorganism is one of the key factors that affects soil ecological activity. It is an important symbol of soil health, and the soil nitrogen cycle is closely related to the microorganisms. The relationship between nitrogen and microorganisms under the intercropping is im-portant for the farmland ecosystem. In this paper, phospholipid fatty acids(PLFA analysis was used to determine soil microbial communi-ties, e.g., biomasses of anaerobic bacteria, aerobic bacteria, bacteria, fungi and actinobacteria. The abundance of nitrifying genes(AOB, AOA and three denitrifying genes (nirK, norB, nosZ were measured using real-time quantitative polymerase chain reaction. The enzymes, nitrate and ammonium concentrations were measured using conventional methods. The results showed that along with the growth period, the TPLFAs(total phospholipid fatty acids increased and the bacterias, fungus, actinomyces and aerobic bacterias significantly(P<0.05 dif-fered between intercropping and monoculture. The greater abundance of AOB than AOA and the variation range of 105~106 were observed in all samples. The gene copies of norB and nosZ were pronounced by intercropping in the rhizosphere of faba bean at elongation and heading stages, respectively. The abundance of nirK remarkably(P<0.05differed between intercropping and monoculture. In intercropping rhizo-sphere, the contents of NO3--N were lower than monoculture, while the NH4+-N contents were converse (P<0.05. Conclusively, wheat and fa-ba bean intercropping system could change rhizosphere microenvironment, and then the microbial community structure in the soils, which would facilitate the conservation and supplying of soil nitrogen and reduce the nitrogen loss and pollution under the intercropping conditions to some extent. This might be the nitrogen nutrition mechanism for the overyielding of wheat and faba bean intercropping system.

  11. Morphological anomalies in Ixodes ricinus and Ixodes inopinatus collected from tick-borne encephalitis natural foci in Central Europe

    DEFF Research Database (Denmark)

    Chitimia-Dobler, Lidia; Bestehorn, Malena; Bröker, Michael


    In 2015, 0.02% nymphs displayed anomalies (ectromely) out of the 6744 collected ticks as part of a tick-borne encephalitis program in Germany. In 2016, questing Ixodes ricinus (n = 14,527) and Ixodes inopinatus (n = 75) ticks were collected by flagging as part of a tick-borne encephalitis program......, palps and exoskeleton. Anal groove deformation was observed in three females and three nymphs. In 2016, the frequency of anomalies in I. inopinatus was found five times higher (9.3%) than in I. ricinus (1.9%). This is the first report of anomaly (ectromely, leg atrophy, idiosoma deformation) in flagged...... I. inopinatus and the first report of schizomely in I. ricinus....

  12. Antimicrobial activity of untenospongin B, a metabolic from the marine sponge Hippospongia communis collected from the Atlantic coast of Morocco

    NARCIS (Netherlands)

    Rifai, S.; Kijjoa, A.; van Soest, R.W.M.


    (-)-Untenospongin B isolated from the marine sponge Hippospongia communis has been tested for its antimicrobial activity against bacteria and human pathogenic fungi using agar disk method and was found to possess a broad and strong activity toward the test organisms. Its antifungal activity was

  13. Isolation and characterization of polyphenol oxidase from Sardinian poisonous and non-poisonous chemotypes of Ferula communis (L.). (United States)

    Zucca, Paolo; Sanjust, Enrico; Loi, Martina; Sollai, Francesca; Ballero, Mauro; Pintus, Manuela; Rescigno, Antonio


    Ferula communis (L.), a plant belonging to Apiaceae, is widely present in Sardinia, Italy. Currently, interest in F. communis focuses on the presence of two chemotypes in the wild. One chemotype is poisonous to animals, whereas the other chemotype is non-poisonous. Polyphenol oxidase (PPO) has been extracted and partially purified from the two chemotypes of F. communis. The biochemical characterization of the enzymes showed significant differences. In particular, while the two PPOs were not able to use 6- and 7-hydroxycoumarin as substrates, they showed distinct specificity for 6,7- and 7,8-dihydroxycoumarin. Significant differences in the enzyme behavior towards common PPO inhibitors were also observed. In addition, activation energy and activation energy for denaturation were determined, showing significant differences between FP-PPO and FNP-PPO, particularly for denaturation kinetics. The possible roles of the two PPOs in determining differences in composition and toxicity of the two F. communis chemotypes are also discussed. Copyright © 2013 Elsevier Ltd. All rights reserved.

  14. Prevalence of tick-borne encephalitis virus in Ixodes ricinus ticks in northern Europe with particular reference to Southern Sweden (United States)


    Background In northern Europe, the tick-borne encephalitis virus (TBEV) of the European subtype is usually transmitted to humans by the common tick Ixodes ricinus. The aims of the present study are (i) to obtain up-to-date information on the TBEV prevalence in host-seeking I. ricinus in southern and central Sweden; (ii) to compile and review all relevant published records on the prevalence of TBEV in ticks in northern Europe; and (iii) to analyse and try to explain how the TBE virus can be maintained in natural foci despite an apparently low TBEV infection prevalence in the vector population. Methods To estimate the mean minimum infection rate (MIR) of TBEV in I. ricinus in northern Europe (i.e. Denmark, Norway, Sweden and Finland) we reviewed all published TBEV prevalence data for host-seeking I. ricinus collected during 1958–2011. Moreover, we collected 2,074 nymphs and 906 adults of I. ricinus from 29 localities in Sweden during 2008. These ticks were screened for TBEV by RT-PCR. Results The MIR for TBEV in nymphal and adult I. ricinus was 0.28% for northern Europe and 0.23% for southern Sweden. The infection prevalence of TBEV was significantly lower in nymphs (0.10%) than in adult ticks (0.55%). At a well-known TBEV-endemic locality, Torö island south-east of Stockholm, the TBEV prevalence (MIR) was 0.51% in nymphs and 4.48% in adults of I. ricinus. Conclusions If the ratio of nymphs to adult ticks in the TBEV-analysed sample differs from that in the I. ricinus population in the field, the MIR obtained will not necessarily reflect the TBEV prevalence in the field. The relatively low TBEV prevalence in the potential vector population recorded in most studies may partly be due to: (i) inclusion of uninfected ticks from the ‘uninfected areas’ surrounding the TBEV endemic foci; (ii) inclusion of an unrepresentative, too large proportion of immature ticks, compared to adult ticks, in the analysed tick pools; and (iii) shortcomings in the laboratory

  15. Infections and Coinfections of Questing Ixodes ricinus Ticks by Emerging Zoonotic Pathogens in Western Switzerland (United States)

    Lommano, Elena; Bertaiola, Luce; Dupasquier, Christèle


    In Europe, Ixodes ricinus is the vector of many pathogens of medical and veterinary relevance, among them Borrelia burgdorferi sensu lato and tick-borne encephalitis virus, which have been the subject of numerous investigations. Less is known about the occurrence of emerging tick-borne pathogens like Rickettsia spp., Babesia spp., “Candidatus Neoehrlichia mikurensis,” and Anaplasma phagocytophilum in questing ticks. In this study, questing nymph and adult I. ricinus ticks were collected at 11 sites located in Western Switzerland. A total of 1,476 ticks were analyzed individually for the simultaneous presence of B. burgdorferi sensu lato, Rickettsia spp., Babesia spp., “Candidatus Neoehrlichia mikurensis,” and A. phagocytophilum. B. burgdorferi sensu lato, Rickettsia spp., and “Candidatus Neoehrlichia mikurensis” were detected in ticks at all sites with global prevalences of 22.5%, 10.2%, and 6.4%, respectively. Babesia- and A. phagocytophilum-infected ticks showed a more restricted geographic distribution, and their prevalences were lower (1.9% and 1.5%, respectively). Species rarely reported in Switzerland, like Borrelia spielmanii, Borrelia lusitaniae, and Rickettsia monacensis, were identified. Infections with more than one pathogenic species, involving mostly Borrelia spp. and Rickettsia helvetica, were detected in 19.6% of infected ticks. Globally, 34.2% of ticks were infected with at least one pathogen. The diversity of tick-borne pathogens detected in I. ricinus in this study and the frequency of coinfections underline the need to take them seriously into consideration when evaluating the risks of infection following a tick bite. PMID:22522688

  16. Phenotyping common beans for adaptation to drought (United States)

    Beebe, Stephen E.; Rao, Idupulapati M.; Blair, Matthew W.; Acosta-Gallegos, Jorge A.


    Common beans (Phaseolus vulgaris L.) originated in the New World and are the grain legume of greatest production for direct human consumption. Common bean production is subject to frequent droughts in highland Mexico, in the Pacific coast of Central America, in northeast Brazil, and in eastern and southern Africa from Ethiopia to South Africa. This article reviews efforts to improve common bean for drought tolerance, referring to genetic diversity for drought response, the physiology of drought tolerance mechanisms, and breeding strategies. Different races of common bean respond differently to drought, with race Durango of highland Mexico being a major source of genes. Sister species of P. vulgaris likewise have unique traits, especially P. acutifolius which is well adapted to dryland conditions. Diverse sources of tolerance may have different mechanisms of plant response, implying the need for different methods of phenotyping to recognize the relevant traits. Practical considerations of field management are discussed including: trial planning; water management; and field preparation. PMID:23507928

  17. Synthesis of epoxidised soya bean oil acrylate

    International Nuclear Information System (INIS)

    Hussin bin Mohd Nor; Mohamad Hilmi bin Mahmood; Dahlan bin Haji Mohd.


    An epoxy acrylate was synthesized from Asahi's epoxy resin AER 331 which is an epoxidised soya bean oil (ESBO). Triethylamine (TEA) and Hydroquinone (HQ) were used as catalyst and inhibitor respectively. Observations of the experiment are described. (author)

  18. MedlinePlus: Quinoa Black Bean Salad (United States)

    ... this page: Quinoa Black Bean Salad To use the sharing features ... a side dish. Ingredients 1/2 cup dry quinoa 1 and 1/2 cups water 1 and ...

  19. Uptake and incorporation of sialic acid by the tick Ixodes ricinus

    Czech Academy of Sciences Publication Activity Database

    Vancová, Marie; Štěrba, J.; Dupejová, Jarmila; Simonová, Z.; Nebesářová, Jana; Novotný, M. V.; Grubhoffer, Libor


    Roč. 58, č. 9 (2012), s. 1277-1287 ISSN 0022-1910 R&D Projects: GA AV ČR KJB600960906; GA ČR GA206/09/1782; GA ČR GD206/09/H026; GA MŠk(CZ) LC06009 Institutional research plan: CEZ:AV0Z60220518 Keywords : Tick * Ixodes ricinus * Sialic acid * Basement membrane * Mass spectrometry * Electron microscopy Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.379, year: 2012

  20. IrFC - An Ixodes ricinus injury-responsive molecule related to Limulus Factor C

    Czech Academy of Sciences Publication Activity Database

    Urbanová, Veronika; Hartmann, David; Grunclová, Lenka; Šíma, Radek; Flemming, Tina; Hajdušek, Ondřej; Kopáček, Petr


    Roč. 46, č. 2 (2014), s. 439-447 ISSN 0145-305X R&D Projects: GA ČR GAP506/10/2136; GA ČR GP13-27630P; GA ČR GP13-12816P; GA MŠk(CZ) EE2.3.30.0032 Institutional support: RVO:60077344 Keywords : Complement * Innate immunity * Limulus Clotting Factor C * Phagocytosis * RNA interference * Tick Ixodes ricinus Subject RIV: EC - Immunology Impact factor: 2.815, year: 2014

  1. Functional characterization of two defensin isoforms of the hard tick Ixodes ricinus

    Czech Academy of Sciences Publication Activity Database

    Chrudimská, Tereza; Slaninová, Jiřina; Rudenko, Natalia; Růžek, Daniel; Grubhoffer, Libor


    Roč. 4, č. 1 (2011), e63 ISSN 1756-3305 R&D Projects: GA MŠk(CZ) LC06009; GA ČR GA206/09/1782; GA ČR GD206/09/H026; GA ČR(CZ) GAP302/11/1901 Institutional research plan: CEZ:AV0Z60220518; CEZ:AV0Z40550506 Keywords : defensin * antimicrobial compounds * Ixodes ricinus Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.937, year: 2011

  2. Presence of potentially pathogenic Babesia sp. for human in Ixodes ricinus in Switzerland. (United States)

    Casati, Simona; Sager, Heinz; Gern, Lise; Piffaretti, Jean-Claude


    We have designed and performed a new PCR method based on the 18S rRNA in order to individuate the presence and the identity of Babesia parasites. Out of 1159 Ixodes ricinus (Acari: Ixodidae) ticks collected in four areas of Switzerland, nine were found to contain Babesia DNA. Sequencing of the short amplicon obtained (411-452 bp) allowed the identification of three human pathogenic species: Babesia microti, B. divergens, for the first time in Switzerland, Babesia sp. EU1. We also report coinfections with B. sp. EU1-Borrelia burgdorferi sensu stricto and Babesia sp. EU1-B. afzelii.

  3. beans grown in an intercropping system

    African Journals Online (AJOL)


    Feb 10, 2005 ... Sole crops were planted at the recommended PPD of 44 444 and 11 1 1 11 plants ha'l for maize and climbing beans, respectively. Maize in ... within-row spacing from 0.25 to 0.40 m for maize and 0.30 to 0.50 m for beans. Maize PPD .... mays) and/0r cassava(Manih0t esculentum) plants acting as live ...

  4. Component composition of essential oils and ultrastructure of secretory cells of resin channel needles Juniperus communis (Cupressaceae

    Directory of Open Access Journals (Sweden)

    N. V. Gerling


    Full Text Available The results of determining the qualitative and quantitative composition of essential oil Juniperus communis, growing under the canopy of spruce blueberry sphagnum subzone middle taiga. Juniperus communis essential oil is liquid light yellow color. The content of essential oil was 0.46 % in shoots with needles. 37 substances of components identified. Mass fraction of components in the essential oil of Juniperus communis reached 89 %. The highest percentage of occupied fraction of monoterpenes (82.3 %, the proportion of sesquiterpenes less than 0.5 % of the total composition of essential oils, alcohols 3.5 and 0.7 % esters. In monoterpenes fraction predominant α-pinene (24.5–32.6 %, β-pinene (15–20.3 % and α-phellandrene (6.4–8.8 %. Essential oil of Juniperus communis is characterized by high content of monoterpenoids in contrast to other conifers of the taiga zone. All stages of biosynthesis essential oils occur in the epithelial cells of the resin channel (terpenoidogennyh cells. An oval shape have epithelial cells of the resin channel needles in transverse sections the Juniperus communis, which is situated vacuole in the center. Large number of lipid globules (up to 40 noted in the hyaloplasm of explored cells. Leucoplasts surrounded by membranes of smooth endoplasmic reticulum in cross sections of epithelial cells in resin channel of juniper. Endoplasmic reticulum is poorly developed in epithelial cells, which corresponds to the low content of sesquiterpenes in the needles during the study period. Development of large leucoplasts and large number of mitochondria associated with predominance of synthesis monoterpenoids the in the epithelium cells resin channel.

  5. The occurrence of Ixodes ricinus ticks and important tick-borne pathogens in areas with high tick-borne encephalitis prevalence in different altitudinal levels of the Czech Republic. Part I. Ixodes ricinus ticks and tick-borne encephalitis virus

    Czech Academy of Sciences Publication Activity Database

    Daniel, M.; Danielová, V.; Kříž, B.; Růžek, Daniel; Fialová, A.; Malý, M.; Materna, J.; Pejčoch, M.; Erhart, Jan


    Roč. 65, č. 2 (2016), s. 118-128 ISSN 1210-7913 Institutional support: RVO:60077344 Keywords : Ixodes ricinus * tick-borne encephalitis virus * occurence * altitude * region * season Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.500, year: 2016

  6. Karakteristik Cookies Berbahan Dasar Tepung Sukun (Artocarpus communis Bagi Anak Penderita Autis

    Directory of Open Access Journals (Sweden)

    Dede Sukandar


    Full Text Available Abstrak Tepung sukun (Artocarpus communis merupakan tepung yang bebas gluten sehingga baik digunakan sebagai alternatif dalam pembuatan cookies untuk anak penderita autis. Penelitian ini bertujuan mengetahui tingkat kesukaan panelis terhadap cookies sukun dan berbagai formulasinya dibandingkan dengan cookies berbahan dasar tepung lain yang meliputi pengaruh penambahan bahan tambahan terhadap sifat kimia, fisika, daya terima cookies sukun, kadar kalsium dan fosforus cookies sukun, dan mengetahui cookies sukun tersukai memenuhi standar mutu cookies menurut SNI 01-2973-1992 atau tidak. Uji organoleptik dilakukan untuk mengetahui tingkat kesukaan dan penerimaan panelis terhadap cookies sukun dibandingkan dengan cookies berbahan dasar tepung lain (terigu, beras, sagu dan cookies sukun dalam berbagai formulasi. Parameter yang digunakan meliputi warna, aroma, tekstur, rasa dan penerimaan keseluruhan. Uji kadar kalsium dilakukan menggunakan spektroskopi serapan atom pada λ 422.7 nm dan kadar fosforus menggunakan spektroskopi UV-Vis pada λ 880 nm. Data yang diperoleh dianalisis menggunakan analisis sidik ragam anova dan analisis Duncan. Cookies sukun memiliki penerimaan yang rendah dibandingkan cookies tepung lain berdasarkan penerimaan rasa dan penerimaan umum. Formulasi cookies sukun memperbaiki sifat fisik (aroma, rasa, warna, dan tekstur dan daya terima cookies sukun oleh panelis. Cookies sukun tersukai adalah formulasi 718 dengan bahan tambahan susu kedelai.  Mutu cookies sukun tersukai formulasi 718 sesuai dengan SNI 01-2973-1992 kecuali kadar protein yang masih rendah 8.05% dan terdapat kandungan tembaga dengan sebesar 1.56 ppm. Cookies sukun tersukai memiliki kadar kalsium dan fosforus tertinggi dibandingkan dengan tepung sukun dan cookies komersil untuk anak penderita autis sehingga cookies sukun tersukai sangat baik dikonsumsi oleh anak penderita autis. Kata kunci : Artocarpus communis, autis, cookies sukun, organoleptik, kalsium, fosforus

  7. Variability of Polyphenol Compounds in Myrtus Communis L. (Myrtaceae Berries from Corsica

    Directory of Open Access Journals (Sweden)

    Nathalie Chiaramonti


    Full Text Available Polyphenol compounds were extracted from Myrtus communis L. berries (Myrtaceae by maceration in 70% ethanol and analysed by HPLC-DAD and electrospray mass spectrometry. The Myrtus berries were collected at maturity from seven localities on the island of Corsica (France and the sampling was carried out during three years. The polyphenol composition of Corsican Myrtus berries was characterized by two phenolic acids, four flavanols, three flavonols and five flavonol glycosides. The major compounds were myricetin-3-O-arabinoside and myricetin-3-O-galactoside. Principal components analysis (PCA is applied to study the chemical composition and variability of myrtle berries alcoholic extracts from the seven localities. Canonical analysis and PCA data distinguishes two groups of myrtle berries characterized by different concentrations of polyphenols according to soil and years of harvest. The variations in the polyphenol concentration were due to biotic and abiotic factors.

  8. Mersin (Myrtus communis L. Meyvesinin bazı Fiziksel ve Kimyasal Özellikleri

    Directory of Open Access Journals (Sweden)

    Musa Özcan


    Full Text Available İçel’den (Büyükeceli-Gülnar toplanan farklı büyüklük ve renklerdeki mersin (Myrtus communis L. meyvelerinin fiziksel ve kimyasal özellikleri belirlenmiştir. Mor meyvelerde antosiyanin tespit edilirken beyaz renklide bulunmamıştır. Mor meyvelerde tanen miktarı beyazlara göre oldukça yüksektir. Titrasyon asitliği mor meyvelerde aynı olup, beyaza göre yüksektir. Meyveler mineral bakımından zengindir ve en yüksek olarak potasyum belirlenmiştir.

  9. Mersin (Myrtus communis L.) Meyvesinin bazı Fiziksel ve Kimyasal Özellikleri


    Özcan, Musa; Akbulut, Mehmet


    İçel’den (Büyükeceli-Gülnar) toplanan farklı büyüklük ve renklerdeki mersin (Myrtus communis L.) meyvelerinin fiziksel ve kimyasal özellikleri belirlenmiştir. Mor meyvelerde antosiyanin tespit edilirken beyaz renklide bulunmamıştır. Mor meyvelerde tanen miktarı beyazlara göre oldukça yüksektir. Titrasyon asitliği mor meyvelerde aynı olup, beyaza göre yüksektir. Meyveler mineral bakımından zengindir ve en yüksek olarak potasyum belirlenmiştir. 

  10. Sodium Copper Chlorophyllin Immobilization onto Hippospongia communis Marine Demosponge Skeleton and Its Antibacterial Activity

    Directory of Open Access Journals (Sweden)

    Małgorzata Norman


    Full Text Available In this study, Hippospongia communis marine demosponge skeleton was used as an adsorbent for sodium copper chlorophyllin (SCC. Obtained results indicate the high sorption capacity of this biomaterial with respect to SCC. Batch experiments were performed under different conditions and kinetic and isotherms properties were investigated. Acidic pH and the addition of sodium chloride increased SCC adsorption. The experimental data were well described by a pseudo-second order kinetic model. Equilibrium adsorption isotherms were determined and the experimental data were analyzed using both Langmuir and Freundlich isotherms. The effectiveness of the process was confirmed by 13C Cross Polarization Magic Angle Spinning Nuclear Magnetic Resonance (13C CP/MAS NMR, Fourier transform infrared spectroscopy (FTIR, energy-dispersive X-ray spectroscopy (EDS and thermogravimetric analysis (TG. This novel SCC-sponge-based functional hybrid material was found to exhibit antimicrobial activity against the gram-positive bacterium Staphylococcus aureus.

  11. Histomorphological evaluation of Compound bone of Granulated Ricinus in bone regeneration in rabbits (United States)

    Pavan Mateus, Christiano; Orivaldo Chierice, Gilberto; Okamoto, Tetuo


    Histological evaluation is an effective method in the behavioral description of the qualitative and quantitative implanted materials. The research validated the performance of Compound bone of Granulated Ricinus on bone regeneration with the histomorphological analysis results. Were selected 30 rabbits, females, divided into 3 groups of 10 animals (G1, G2, G3) with a postoperative time of 45, 70 and 120 days respectively. Each animal is undergone 2 bone lesions in the ilium, one implemented in the material: Compound bone of Granulated Ricinus and the other for control. After the euthanasia, the iliac bone was removed, identified and subjected to histological procedure. The evaluation histological, histomorphological results were interpreted and described by quantitative and qualitative analysis based facts verified in the three experimental groups evaluating the rate of absorption of the material in the tissue regeneration, based on the neo-bone formation. The histomorphologic results classified as a material biocompatible and biologically active. Action in regeneration by bone resorption occurs slowly and gradually. Knowing the time and rate of absorption and neo-formation bone biomaterial, which can be determined in the bone segment applicable in the clinical surgical area.

  12. Histomorphological evaluation of Compound bone of Granulated Ricinus in bone regeneration in rabbits

    International Nuclear Information System (INIS)

    Mateus, Christiano Pavan; Chierice, Gilberto Orivaldo; Okamoto, Tetuo


    Histological evaluation is an effective method in the behavioral description of the qualitative and quantitative implanted materials. The research validated the performance of Compound bone of Granulated Ricinus on bone regeneration with the histomorphological analysis results. Were selected 30 rabbits, females, divided into 3 groups of 10 animals (G1, G2, G3) with a postoperative time of 45, 70 and 120 days respectively. Each animal is undergone 2 bone lesions in the ilium, one implemented in the material: Compound bone of Granulated Ricinus and the other for control. After the euthanasia, the iliac bone was removed, identified and subjected to histological procedure. The evaluation histological, histomorphological results were interpreted and described by quantitative and qualitative analysis based facts verified in the three experimental groups evaluating the rate of absorption of the material in the tissue regeneration, based on the neo-bone formation. The histomorphologic results classified as a material biocompatible and biologically active. Action in regeneration by bone resorption occurs slowly and gradually. Knowing the time and rate of absorption and neo-formation bone biomaterial, which can be determined in the bone segment applicable in the clinical surgical area.

  13. Variability and action mechanism of a family of anticomplement proteins in Ixodes ricinus.

    Directory of Open Access Journals (Sweden)

    Bernard Couvreur

    Full Text Available BACKGROUND: Ticks are blood feeding arachnids that characteristically take a long blood meal. They must therefore counteract host defence mechanisms such as hemostasis, inflammation and the immune response. This is achieved by expressing batteries of salivary proteins coded by multigene families. METHODOLOGY/PRINCIPAL FINDINGS: We report the in-depth analysis of a tick multigene family and describe five new anticomplement proteins in Ixodes ricinus. Compared to previously described Ixodes anticomplement proteins, these segregated into a new phylogenetic group or subfamily. These proteins have a novel action mechanism as they specifically bind to properdin, leading to the inhibition of C3 convertase and the alternative complement pathway. An excess of non-synonymous over synonymous changes indicated that coding sequences had undergone diversifying selection. Diversification was not associated with structural, biochemical or functional diversity, adaptation to host species or stage specificity but rather to differences in antigenicity. CONCLUSIONS/SIGNIFICANCE: Anticomplement proteins from I. ricinus are the first inhibitors that specifically target a positive regulator of complement, properdin. They may provide new tools for the investigation of role of properdin in physiological and pathophysiological mechanisms. They may also be useful in disorders affecting the alternative complement pathway. Looking for and detecting the different selection pressures involved will help in understanding the evolution of multigene families and hematophagy in arthropods.

  14. Prevalence of pathogenic bacteria in Ixodes ricinus ticks in Central Bohemia. (United States)

    Klubal, Radek; Kopecky, Jan; Nesvorna, Marta; Sparagano, Olivier A E; Thomayerova, Jana; Hubert, Jan


    Bacteria associated with the tick Ixodes ricinus were assessed in specimens unattached or attached to the skin of cats, dogs and humans, collected in the Czech Republic. The bacteria were detected by PCR in 97 of 142 pooled samples including 204 ticks, i.e. 1-7 ticks per sample, collected at the same time from one host. A fragment of the bacterial 16S rRNA gene was amplified, cloned and sequenced from 32 randomly selected samples. The most frequent sequences were those related to Candidatus Midichloria midichlori (71% of cloned sequences), followed by Diplorickettsia (13%), Spiroplasma (3%), Rickettsia (3%), Pasteurella (3%), Morganella (3%), Pseudomonas (2%), Bacillus (1%), Methylobacterium (1%) and Phyllobacterium (1%). The phylogenetic analysis of Spiroplasma 16S rRNA gene sequences showed two groups related to Spiroplasma eriocheiris and Spiroplasma melliferum, respectively. Using group-specific primers, the following potentially pathogenic bacteria were detected: Borellia (in 20% of the 142 samples), Rickettsia (12%), Spiroplasma (5%), Diplorickettsia (5%) and Anaplasma (2%). In total, 68% of I. ricinus samples (97/142) contained detectable bacteria and 13% contained two or more putative pathogenic groups. The prevalence of tick-borne bacteria was similar to the observations in other European countries.

  15. Transport of Babesia venatorum-infected Ixodes ricinus to Norway by northward migrating passerine birds

    Directory of Open Access Journals (Sweden)

    Røed Knut H


    Full Text Available Abstract Background Bovine babesiosis is regarded as a limited health problem for Norwegian cows, and the incidence has decreased markedly since the 1930s. Rare cases of babesiosis in splenectomised humans from infection with Babesia divergens and B.venatorum have been described. The objective of this study was to determine whether birds can introduce Babesia-infected ticks. There are between 30 and 85 million passerine birds that migrate to Norway every spring. Methods Passerine birds were examined for ticks at four bird observatories along the southern Norwegian coast during the spring migrations of 2003, 2004 and 2005. The presence of Babesia was detected in the nymphs of Ixodes ricinus by real-time PCR. Positive samples were confirmed using PCR, cloning and phylogenetic analyses. Results Of 512 ticks examined, real-time PCR revealed five to be positive (1.0%. Of these, four generated products that indicated the presence of Babesia spp.; each of these were confirmed to be from Babesia venatorum (EU1. Two of the four B. venatorum-positive ticks were caught from birds having an eastern migratory route (P Conclusions Birds transport millions of ticks across the North Sea, the Skagerrak and the Kattegat every year. Thus, even with the low prevalence of Babesia-infected ticks, a substantial number of infected ticks will be transported into Norway each year. Therefore, there is a continuous risk for introduction of new Babesia spp. into areas where I. ricinus can survive.

  16. Genetic diversity of Salp15 in the Ixodes ricinus complex (Acari: Ixodidae.

    Directory of Open Access Journals (Sweden)

    Xin Wang

    Full Text Available Salp15, a 15-kDa tick salivary gland protein, is both essential for ticks to successfully obtain host blood and also facilitates transmission of Lyme borreliosis. To determine whether the Salp15 gene is expressed in Ixodes persulcatus and Ixodes sinensis, principle vectors of Lyme borreliosis in China, we studied transcriptions of this gene in semi-engorged larvae, nymph and adults of these two species. A total of eight Salp15 homologues, five in I. persulcatus and three in I. sinensis, were identified by reverse transcriptase-polymerase chain reaction (RT-PCR. Interestingly, the intra-species similarity of Salp15 is approximately equal to its interspecies similarity and more than one Salp15 protein is expressed in a certain tick developmental stage. Comparison of DNA and proteins with other available tick Salp15 homologues suggests that the Salp15 superfamily is genetically conserved and diverse in the Ixodes ricinus complex. These findings indicate that Salp15 proteins in the I. ricinus complex may play an essential role in interacting with the host immune system and transmission of Borrelia genospecies.

  17. Prevalence and Diversity among Anaplasma phagocytophilum Strains Originating from Ixodes ricinus Ticks from Northwest Norway

    Directory of Open Access Journals (Sweden)

    Ann-Kristin Tveten


    Full Text Available The tick-borne pathogen Anaplasma phagocytophilum causes great concern for livestock farmers. Tick-borne fever is a widespread disease in Norway, and antibodies have been produced amongst sheep, roe deer, red deer, and moose. The main vector Ixodes ricinus is found along the Norwegian coastline as far north as the Arctic Circle. A total number of 1804 I. ricinus ticks were collected and the prevalence of the pathogen was determined by species-specific qPCR. The overall infection rate varied from 2.83% to 3.32%, but there were no significant differences (p=0.01 in the overall infection rate in 2010, 2011, or 2012. A multilocus sequencing analysis was performed to further characterise the isolates. The genotyping of 27 strains resulted in classification into 19 different sequences types (ST, none of which was found in the MLST database. The nucleotide diversity was for every locus <0.01, and the number of SNPs was between 1 and 2.8 per 100 bp. The majority of SNPs were synonymous. A goeBURST analysis demonstrated that the strains from northwest Norway cluster together with other Norwegian strains in the MLST database and the strains that are included in this study constitute clonal complexes (CC 9, 10, and 11 in addition to the singleton.

  18. Multi-criteria Decision Analysis to Model Ixodes ricinus Habitat Suitability. (United States)

    Rousseau, Raphaël; McGrath, Guy; McMahon, Barry J; Vanwambeke, Sophie O


    Tick-borne diseases present a major threat to both human and livestock health throughout Europe. The risk of infection is directly related to the presence of its vector. Thereby it is important to know their distribution, which is strongly associated with environmental factors: the presence and availability of a suitable habitat, of a suitable climate and of hosts. The present study models the habitat suitability for Ixodes ricinus in Ireland, where data on tick distribution are scarce. Tick habitat suitability was estimated at a coarse scale (10 km) with a multi-criteria decision analysis (MCDA) method according to four different scenarios (depending on the variables used and on the weights granted to each of them). The western part of Ireland and the Wicklow mountains in the East were estimated to be the most suitable areas for I. ricinus in the island. There was a good level of agreement between results from the MCDA and recorded tick presence. The different scenarios did not affect the spatial outputs substantially. The current study suggests that tick habitat suitability can be mapped accurately at a coarse scale in a data-scarce context using knowledge-based methods. It can serve as a guideline for future countrywide sampling that would help to determine local risk of tick presence and refining knowledge on tick habitat suitability in Ireland.

  19. Investigation of antibacterial activities of Albizia gummifera and Ferula communis on Streptococcus pneumoniae and Streptoccus pyogenes. (United States)

    Unasho, Abayneh; Geyid, Aberra; Melaku, Abebe; Debela, Asfaw; Mekasha, Amha; Girma, Samson; Kebede, Tesfaye; Fantaw, Surafael; Asaminew, Nega; Mamo, Kidanemariam


    Respiratory Tract infections continue to be a major cause of morbidity and mortality world wide. There is a failure to treat respiratory infections due to the emergence of antibiotic resistant strains among the most common respiratory pathogens. To evaluate the in vitro antibacterial activities of two traditionally used plants: Albizia gummifera (Ambabesa-Muka, Oromifa, Sessa-Amharic.) and Ferula communis (Doge-Oromifa, Dog-Amharic) against clinical isolates of S. pyogenes and S. pneumoniae. The study involving the antibacterial susceptibility test of traditionally used plant species against Gram-positive bacterial pathogens was conducted over a period of 5 months (January - August, 2004) at the Ethiopian Health, and Nutrition Research Institute. The in vitro antibacterial activities of 80% methanol crude extracts prepared from the seeds of Ablizia gummifera and, roots of Ferula communis as well as their respective hydro alcoholic solvent fractionates of both plant species were tested for inhibitory activity against the clinical isolates of six S. pneumonae and twenty two S. pyogenes using agar dilution method. Eighty percent ethanol solubilized fractions of both plants were found to have antibacterial effects to all assayed bacteria while aqueous solubilized fractions did not exhibit any effect. Minimum inhibitory concentration (MIC) of the 80% ethanol solubilized fractions was determined and the MIC of the fractions ranged from 500 mg/ ml to 1000 mg/ml for both plants showing the extracts may contain bioactive compounds of therapeutic interest. All extracts showed antibacterial activities against clinical isolates of S. pyogenes and S. pneumoniae. The extracts may contain compounds with potential therapeutic activity. Further purification and identification are needed to be tested using animal models.

  20. Myrtus communis essential oil: chemical composition and antimicrobial activities against food spoilage pathogens. (United States)

    Ben Hsouna, Anis; Hamdi, Naceur; Miladi, Ramzi; Abdelkafi, Slim


    Myrtus communis is a typical plant of the Mediterranean area, which is mainly used as animal and human food and, in folk medicine, for treating some disorders. In the present study, we evaluated in vitro antibacterial and antifungal properties of the essential oils of Myrtus communis (McEO), as well as its phytochemical composition. The GC/MS analysis of the essential oil revealed 17 compounds. Myrtenyl acetate (20.75%), 1,8-cineol (16.55%), α-pinene (15.59%), linalool (13.30%), limonene (8.94%), linalyl acetate (3.67%), geranyl acetate (2.99%), and α-terpineol (2.88%) were the major components. The antimicrobial activity of the essential oil was also investigated on several microorganisms. The inhibition zones and minimal inhibitory concentration (MIC) values of bacterial strains were in the range of 16-28 mm and 0.078-2.5 mg/ml, respectively. The inhibitory activity of the McEO against Gram-positive bacteria was significantly higher than against Gram-negative. It also exhibited remarkable activity against several fungal strains. The investigation of the mode of action of the McEO by the time-kill curve against Listeria monocytogenes (food isolate) showed a drastic bactericidal effect after 5 min using a concentration of 312 μg/ml. These results evidence that the McEO possesses antimicrobial properties, and it is, therefore, a potential source for active ingredients for food and pharmaceutical industries. Copyright © 2014 Verlag Helvetica Chimica Acta AG, Zürich.

  1. ´Candidatus Midichloria mitochondrii´, an endosymbiont of the tick Ixodes ricinus with a unique intramitochondrial lifestyle

    Czech Academy of Sciences Publication Activity Database

    Sassera, D.; Beninati, T.; Bandi, C.; Bouman, Edwin Arien Poul; Sacchi, L.; Fabbi, M.; Lo, N.


    Roč. 56, č. 11 (2006), s. 2535-2540 ISSN 1466-5026 R&D Projects: GA ČR GA206/04/0751 Institutional research plan: CEZ:AV0Z60220518 Keywords : Ixodes ricinus * endosymbiont * intramitochondrial Subject RIV: EH - Ecology, Behaviour Impact factor: 2.662, year: 2006

  2. First evidence of Babesia venatorum and Babesia capreoli in questing Ixodes ricinus ticks in the Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Venclíková, Kristýna; Mendel, Jan; Betášová, Lenka; Hubálek, Zdeněk; Rudolf, Ivo


    Roč. 22, č. 2 (2015), s. 212-214 ISSN 1232-1966 EU Projects: European Commission(XE) 261504 - EDENEXT Institutional support: RVO:68081766 Keywords : Babesia sp. EU1 * Babesia venatorum * Babesia capreoli * Ixodes ricinus * ixodid ticks Subject RIV: EE - Microbiology, Virology Impact factor: 0.895, year: 2015

  3. 'Candidatus Rickettsia mendelii', a novel basal group rickettsia detected in Ixodes ricinus ticks in the Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Hajdušková, Eva; Literák, I.; Papoušek, I.; Costa, F.B.; Nováková, M.; Labruna, M. B.; Zdražilová-Dubská, L.


    Roč. 7, č. 3 (2016), s. 482-486 ISSN 1877-959X Institutional support: RVO:60077344 Keywords : Rickettsiae * Candidatus Rickettsia mendelii * Ixodes ricinus * basal group rickettsiae * ticks * Czech Republic Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.230, year: 2016

  4. Deer presence rather than abundance determines the population density of the sheep tick, Ixodes ricinus, in Dutch forests

    NARCIS (Netherlands)

    Hofmeester, Tim R.; Sprong, Hein; Jansen, Patrick A.; Prins, Herbert H.T.; Wieren, Van Sipke E.


    Background: Understanding which factors drive population densities of disease vectors is an important step in assessing disease risk. We tested the hypothesis that the density of ticks from the Ixodes ricinus complex, which are important vectors for tick-borne diseases, is determined by the density

  5. Identification of Borrelia burgdorferi genospecies isolated from Ixodes ricinus ticks in the South Moravian region of the Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Bonczek, Ondřej; Žákovská, A.; Vargová, L.; Šerý, Omar


    Roč. 22, č. 4 (2015), s. 642-646 ISSN 1232-1966 Institutional support: RVO:67985904 Keywords : Borrelia burgdorferi s. I. * Borrelia spielmanii * Ixodes ricinus Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 0.895, year: 2015

  6. Transmission differentials for multible pathogens as inferred from their prevalence in larva, nymph and sult of Ixodes ricinus (Acari: Ixodidae)

    DEFF Research Database (Denmark)

    Jensen, Per M.; Christoffersen, Christian S.; Moutailler, Sara


    Ixodes ricinus serves as vector for a range of microorganisms capable of causing clinical illness in humans. The microorganisms occur in the same vector populations and are generally affected by the same tick-host interactions. Still, the instars have different host preferences which should...

  7. Deer presence rather than abundance determines the population density of the sheep tick, Ixodes ricinus, in Dutch forests.

    NARCIS (Netherlands)

    Hofmeester, Tim R; Sprong, Hein; Jansen, Patrick A; Prins, Herbert H T; van Wieren, Sipke E


    Understanding which factors drive population densities of disease vectors is an important step in assessing disease risk. We tested the hypothesis that the density of ticks from the Ixodes ricinus complex, which are important vectors for tick-borne diseases, is determined by the density of deer, as

  8. Isolation, cultivation and identification of Borrelia burgdorferi genospecies from Ixodes ricinus ticks from the city of Brno, Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Pejchalová, K.; Žákovská, A.; Mejzlíková, M.; Halouzka, Jiří; Dendis, M.


    Roč. 14, č. 1 (2007), s. 75-79 ISSN 1232-1966 Institutional research plan: CEZ:AV0Z60930519 Keywords : Borrelia burgdorferi * cultivation * DFM method * Ixodes ricinus * Lyme Subject RIV: EE - Microbiology, Virology Impact factor: 1.074, year: 2007

  9. Effects of Kidney Bean, Phaseolus vulgaris Meal on the Growth ...

    African Journals Online (AJOL)

    , Oreochromis niloticus (mean weight 1.36 + 0.05 g) fed diets containing varying levels of the kidney bean, Phaseolus vulgaris were investigated under laboratory conditions. The kidney bean was incorporated at separate levels of 60, 40, ...

  10. Preservation of flavor in freeze dried green beans (United States)

    Huber, C. S.; Heidelbaugh, N. D.; Davis, D.


    Before freeze drying, green beans are heated to point at which their cell structure is altered. Beans freeze dried with altered cell structure have improved rehydration properties and retain color, flavor, and texture.

  11. Incorporation of resistance to angular leaf spot and bean common ...

    African Journals Online (AJOL)



    Jul 3, 2013 ... Key words: Common bean, Pseudocercospora griseola, marker assisted selection, genotype, inheritance. INTRODUCTION. Common beans (Phaseolus ... and to determine the inheritance pattern of the diseases. MATERIALS AND METHODS ..... environmental effects. These results agree with what is.

  12. Java EE 7 development with NetBeans 8

    CERN Document Server

    Heffelfinger, David R


    The book is aimed at Java developers who wish to develop Java EE applications while taking advantage of NetBeans functionality to automate repetitive tasks. Familiarity with NetBeans or Java EE is not assumed.

  13. The integration of multiple independent data reveals an unusual response to Pleistocene climatic changes in the hard tick Ixodes ricinus. (United States)

    Porretta, Daniele; Mastrantonio, Valentina; Mona, Stefano; Epis, Sara; Montagna, Matteo; Sassera, Davide; Bandi, Claudio; Urbanelli, Sandra


    In the last few years, improved analytical tools and the integration of genetic data with multiple sources of information have shown that temperate species exhibited more complex responses to ice ages than previously thought. In this study, we investigated how Pleistocene climatic changes affected the current distribution and genetic diversity of European populations of the tick Ixodes ricinus, an ectoparasite with high ecological plasticity. We first used mitochondrial and nuclear genetic markers to investigate the phylogeographic structure of the species and its Pleistocene history using coalescent-based methods; then we used species distribution modelling to infer the climatic niche of the species at last glacial maximum; finally, we reviewed the literature on the I. ricinus hosts to identify the locations of their glacial refugia. Our results support the scenario that during the last glacial phase, I. ricinus never experienced a prolonged allopatric divergence in separate glacial refugia, but persisted with interconnected populations across Southern and Central Europe. The generalist behaviour in host choice of I. ricinus would have played a major role in maintaining connections between its populations. Although most of the hosts persisted in separate refugia, from the point of view of I. ricinus, they represented a continuity of 'bridges' among populations. Our study highlights the importance of species-specific ecology in affecting responses to Pleistocene glacial-interglacial cycles. Together with other cases in Europe and elsewhere, it contributes to setting new hypotheses on how species with wide ecological plasticity coped with Pleistocene climatic changes. © 2013 Blackwell Publishing Ltd.

  14. Yam bean seed poisoning mimicking cyanide intoxication. (United States)

    Hung, Y-M; Hung, S-Y; Olson, K R; Chou, K-J; Lin, S-L; Chung, H-M; Tung, C-N; Chang, J-C


    Yam bean is a common food in southern Taiwan. However, its seeds are rarely consumed. We describe five patients of yam bean seed poisoning in Taiwan, one of them life-threatening. The five patients presented with perioral numbness, nausea and vomiting after eating a same soup made from yam bean seeds. One of them, a 54-year-old woman, had difficulty breathing and lost consciousness. Physical examination showed dilated pupils and coma with no focal neurological signs. The initial blood pressure was normal. Laboratory data showed a severe anion gap metabolic acidosis, with a serum lactate level of 185 mg/dL. An initial diagnosis of cyanide intoxication was considered and she was given sodium nitrite and sodium thiosulfate i.v. Hypotension ensued shortly afterwards and pulmonary artery catheterization showed a decreased cardiac index. Aggressive fluid and inotropic therapy were given and the patient eventually recovered. The other four patients suffered only minor gastrointestinal and neurological symptoms and received supportive treatment. Cyanide levels were negative in all five patients. Yam bean seed poisoning can cause acute metabolic acidosis and altered mental status, which could be confused with acute cyanide intoxication from a cyanogenic glycoside-containing plant. To our knowledge, this is the first outbreak of yam bean seed poisoning reported in the English published work.

  15. Evaluation of the recycle of nitrogen in a succession bean - corn -bean By means of the isotopic method

    International Nuclear Information System (INIS)

    Duennas Graciela; Munniz, Olegario; Sanchez, Tamara; Gomez, Luis


    To determine the recycle of Nitrogen in a succession bean - corn - bean a was developed I experience under field conditions, on Red Ferralitic soils (Rhodic Ferrasols) with the one I use of the stable isotope 15 Nitrogen

  16. Expressão gênica diferencial em genótipos de mamona (Ricinus communis L. submetidos a déficit hídrico induzido por PEG

    Directory of Open Access Journals (Sweden)

    Patrícia Favoretto Moraes


    Full Text Available A mamoneira é uma cultura de relevância econômica e social no Brasil e no mundo. O óleo produzido por suas sementes, composto principalmente pelo ácido ricinoleico, é estratégico para as indústrias de lubrificantes, cosméticos, polímeros, dentre outras. Embora a mamoneira seja considerada tolerante à seca, a ausência de chuvas no período da floração pode reduzir a produtividade da planta. Respostas diferenciais ao déficit hídrico na espécie têm sido observadas em acessos de bancos de germoplasma e entre cultivares comerciais. Com intuito de conhecer melhor os mecanismos fisiológicos de resposta ao déficit hídrico e direcionar programas de melhoramento genético, o objetivo do trabalho foi analisar a expressão diferencial de genes potencialmente relacionados com a tolerância da mamoneira ao déficit hídrico e o comportamento de enzimas do sistema de defesa antioxidante. O estudo foi conduzido com três acessos (China Careca, IAC 2028 e PB 07 submetidos a um ensaio com solução de polietilenoglicol (PEG 6.000 por um período de 24 horas para indução do déficit hídrico. Os genes CAT, APX, SOD-Cu/Zn, SOD-Fe e SOD-Mn tiveram maior expressão diferencial no acesso China Careca. O gene SOD-Cu/Zn foi o mais diferencialmente expresso quanto comparado ao controle (3,57 vezes no acesso China Careca. Análise da atividade de enzimas relacionadas com estresse oxidativo (Catalase – CAT, Ascorbato Peroxidase – APX, Guaiacol Peroxidase – GPOX e Superoxide Dismutase – SOD revelou que os acessos possuem diferentes mecanismos de resposta ao déficit hídrico. Os resultados apontam que o acesso China Careca pode ser considerado de grande importância para programas de melhoramento genético por apresentar característica de precocidade, sistema de defesa antioxidante mais eficiente e resistência ao déficit hídrico.

  17. Registration of Gabisa Common Bean ( Phaseolus vulgaris L.) Variety

    African Journals Online (AJOL)

    Gabisa is a common name for common bean (Phaseolus vulgaris L.) variety with pedigree name of VAX-2. It is a bush food bean variety selected out of common bean lines introduced to Ethiopia through CIAT program and released in 2007 by the Bako Agricultural Research Center for production in western Ethiopia and ...

  18. Bacteriological Contamination of Soya Bean Flour Sold in Makurdi ...

    African Journals Online (AJOL)

    Soya bean (Glycine max) is a leguminous crop that is used as a staple food worldwide. The raw harvest is processed into various food forms like soya bean flour and processing methods increase the chances of bacterial contamination. This research work assessed the bacteria contamination of soya bean flour sold in and ...

  19. Agronomic description of new improved climbing bean varieties

    African Journals Online (AJOL)

    . 21. David, S and Hoogendijk,M. 1997. Bean production systems in MbaJe district, Uganda with emphasis on varietal diversity and the adoption of new climbing beans. Network on bean research in Africa. CIA T. CIA T, occasional publication ...

  20. 9 CFR 319.301 - Chili con carne with beans. (United States)


    ... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Chili con carne with beans. 319.301 Section 319.301 Animals and Animal Products FOOD SAFETY AND INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE... Dehydrated Meat Food Products § 319.301 Chili con carne with beans. Chili con carne with beans shall contain...

  1. Some engineering properties of white kidney beans (Phaseolus ...

    African Journals Online (AJOL)

    ajl yemi


    Dec 19, 2011 ... white kidney bean grains decreased as the moisture content increased from 105.18 to 71.44 N. Key words: Engineering (physical and mechanical) properties, white kidney beans, moisture content, thousand grain mass, static coefficient of friction. INTRODUCTION. White kidney beans (Phaseolus vulgaris ...

  2. Inheritance of halo blight resistance in common bean | Chataika ...

    African Journals Online (AJOL)

    Halo blight caused by (Pseudomonas syringe pv. phaseolicola (Burkh) (Psp)) is an important disease of common bean (Phaseolus vulgaris L.) world-wide. Several races of the Psp exist and likewise some sources of resistance in common bean have been identified. CAL 143, is a CIAT-bred common bean line, which was ...

  3. New bean seeds and the struggle for their dissemination

    NARCIS (Netherlands)

    Almekinders, C.J.M.; Aguilar, E.; Herrera, R.


    The northern region of Nicaragua has always been an important bean and maize producing area. But a widespread presence of the Golden Mosaic Virus made it impossible to grow beans in the last years. A Participatory Plant Breeding programme started in 1999, aiming to develop new bean varieties that

  4. Effects of fermented soya bean on digestion, absorption and diarrhoea

    NARCIS (Netherlands)

    Kiers, J.L.


    For many centuries Asian people have consumed soya beans in various forms of traditional fermented soya bean foods. Major desirable aspects of fermented soya bean foods are their attractive flavour and texture, certain nutritional properties, and possible health promoting effects. This

  5. Economic performance of community based bean seed production

    African Journals Online (AJOL)


    seed multiplication and marketing enterprises (CBSME) model, as an alternative to the formal seed systems, in order to ... opportunities for small scale growers to ...... Producing bean seed: handbooks for small-scale bean producers. Handbook 1. Network on Bean Research in Africa, Occasional Publications Series,. No. 29.

  6. Controlling bean pod mottle virus (BPMV) (Genus Comovirus of ...

    African Journals Online (AJOL)

    Controlling bean pod mottle virus (BPMV) (Genus Comovirus of soybean with spatial arrangement of maize-soybean in southeastern Nigeria. ... plant produced the lowest grain yield.of 0..82 t / ha. Keywords: Spatial arrangement, Bean leaf beetle, Bean pod Mottl virus, Maize, Soybean. Agro-Science Vol. 3 (2) 2006: pp.

  7. New bean products to improve food security | IDRC - International ...

    International Development Research Centre (IDRC) Digital Library (Canada)


    Apr 21, 2016 ... This is the first time a full nutritional profile of bean varieties has been available in Kenya and Uganda. Two types of products — precooked beans and bean snacks — have been developed, and the latter tested with consumers in major supermarkets in Kenya and Uganda. To increase production of ...

  8. Methyl bromide residues in fumigated cocoa beans

    International Nuclear Information System (INIS)

    Adomako, D.


    The 14 C activity in unroasted [ 14 C]-methyl bromide fumigated cocoa beans was used to study the fate and persistence of CH 3 Br in the stored beans. About 70% of the residues occurred in the shells. Unchanged CH 3 Br could not be detected, all the sorbed CH 3 Br having reacted with bean constituents apparently to form 14 C-methylated derivatives and inorganic bromide. No 14 C activity was found in the lipid fraction. Roasting decreased the bound (non-volatile) residues, with corresponding changes in the activities and amounts of free sugars, free and protein amino acids. Roasted nibs and shells showed a two-fold increase in the volatile fraction of the 14 C residue. This fraction may be related to the volatile aroma compounds formed by Maillard-type reactions. (author)

  9. The speed of kill of fluralaner (Bravecto™) against Ixodes ricinus ticks on dogs. (United States)

    Wengenmayer, Christina; Williams, Heike; Zschiesche, Eva; Moritz, Andreas; Langenstein, Judith; Roepke, Rainer K A; Heckeroth, Anja R


    Pathogens that are transmitted by ticks to dogs, such as Anaplasma phagocytophilum, Babesia spp., Borrelia burgdorferi sensu latu, and Ehrlichia canis, are an increasing problem in the world. One method to prevent pathogen transmission to dogs is to kill the ticks before transmission occurs. Fluralaner (Bravecto™) is a novel isoxazoline insecticide and acaricide that provides long persistent antiparasitic activity following systemic administration. This study investigated the speed of kill of fluralaner against Ixodes ricinus ticks on dogs. A total of 48 dogs were randomized to 8 groups of 6 dogs and each dog was infested with 50 female and 10 male I. ricinus ticks. Two days later (day 0), 4 groups received a single treatment of 25 mg fluralaner/kg body weight as Bravecto™ chewable tablets; the dogs in the other 4 groups were left untreated. Separate control and treatment groups were paired at each time point (4, 8, 12, or 24 hours after treatment) for assessment of tick-killing efficacy. At 4, 8, and 12 weeks after treatment, all dogs were re-infested with 50 female I. ricinus ticks and subsequently assessed for live or dead ticks at either 4, 8, 12, or 24 hours after re-infestation. Efficacy was calculated for each assessment time point by comparison of the treatment group with the respective control group. Tick-killing efficacy was 89.6% at 4 hours, 97.9% at 8 hours, and 100% at 12 and 24 hours after treatment. Eight hours after re-infestation, efficacy was 96.8%, 83.5%, and 45.8% at 4, 8, and 12 weeks after treatment, respectively. At least 98.1% tick-killing efficacy was demonstrated 12 and 24 hours after re-infestation over the entire 12 week study period. Fluralaner kills ticks rapidly after treatment at 4 hours, and over its entire 12-week period of efficacy, it achieves an almost complete killing effect within 12 hours after tick infestation. The rapid tick-killing effect together with the long duration of efficacy enables fluralaner to aid

  10. Study of the Antibacterial Activity of Methanolic and Aqueous Extracts of Myrtus communis on Pathogenic Strains Causing Infection

    Directory of Open Access Journals (Sweden)

    Behrooz Alizadeh Behbahani


    Full Text Available Background Medicine plants have been used as sources of medicine in virtually all cultures. During the last decade, the use of traditional medicine (TM has been expanded globally and is gaining popularity. Objectives The antimicrobial activities of methanol and water extracts of Myrtus communis L. leaves were evaluated in this study. Materials and Methods In this experimental study, the tests were carried out using disk agar diffusion method at four extract concentrations (5, 10, 15 and 20 mg/mL. The MICs and MBCs of the extracts of M. communis were determined by agar dilution method. Average results were reported as the mean and standard error (mean ± SE and SPSS-18 statistical software, oneway ANOVA followed by Turkey’s test were used to do inter-group comparison, while considering P ≤ 0.05 as the significance level. Results Methanol extract of M. communis exhibited significant antibacterial activity in the concentration of 20 mg/mL (P ≤ 0.05 against Staphylococcus epidermidis and Enterococcus faecalis with a greater inhibition zone of 20 mm, while a 14 mm zone of inhibition was observed in Escherichia coli and Shigella flexneri. The minimum inhibitory concentration (MIC of the extracts ranged between 2 mg/mL and 128 mg/mL while the minimum bactericidal concentration (MBC ranged between 4 mg/mL and 256 mg/mL. Conclusions The study showed that species, strains and concentrations of M. communis extract are of those factors that may influence the sensitivity of the tested bacteria. A significant correlation was observed between zone of inhibition and concentration of extract.

  11. 76 FR 68057 - Importation of French Beans and Runner Beans From the Republic of Kenya Into the United States (United States)


    .... APHIS-2010-0101] RIN 0579-AD39 Importation of French Beans and Runner Beans From the Republic of Kenya.... SUMMARY: We are amending the fruits and vegetables regulations to allow the importation of French beans... was inspected and found free of quarantine pests. This action will allow for the importation of French...

  12. Evaluation of the reaction oof interspecific hybrids of common bean and tepary bean to Bradyrhizobium y Rhizobium (United States)

    Interspecific hybrids between common bean, Phaseolus vulgaris L., and tepary bean, Phaseolus acutifolius A. Gray, have the potential to increase bean production in regions where rainfall is limited. In 2014, an experiment was initiated using a split-plot design. The treatments included inoculation, ...

  13. Foliar absorption of phosphorus by common bean

    International Nuclear Information System (INIS)

    Boaretto, A.E.; Rosa, J.P.P.


    The effet of urea and/or sucrose on P uptake from H 3 PO 4 and monoammonium phosphate by bean leaves. A solution containing 0.145% P and specific activity 10μ Ci/ml is sprayed early in the morning or late afternoon. Besides the treatment without urea and sucrose, these substances are added in two concentrations 0.66% N + sucrose, and 1.32% N + sucrose. Twenty four hous after application, 52% of the applied P is absorved by the bean trifoliate leaf. (M.A.C.) [pt

  14. Chemical composition and in vitro activity of plant extracts from Ferula communis and Dittrichia viscosa against postharvest fungi. (United States)

    Mamoci, Erjon; Cavoski, Ivana; Simeone, Vito; Mondelli, Donato; Al-Bitar, Lina; Caboni, Pierluigi


    F. communis and D. viscosa are perennial Mediterranean weeds that have been used for different therapeutic purposes in traditional pharmacopeia. Plant extracts were obtained from air dried D. viscosa young shoots (DvA) and F. communis aerial part (FcA) and roots (FcR) with n-hexane. The chemical compositions of the extracts were analyzed by HPLC-DAD, LC-MS (ESI) and LC-Q-TOF techniques. Two sesquiterpene lactones (inuviscolide, tomentosin) and three sesquiterpene acids (costic acid, hydroxycostic acid, ilicic acid) were identified from the D. viscosa extract, while in F. communis extracts three daucane sesquiterpenes (acetoxyferutinin, oxojaeskeanadioyl anisate, fertidin) and one coumarin (ferulenol) derivates were found. Biological activities of plant extracts were studied in in vitro experiments on the colonies and conidia of Botryotinia fuckeliana, Penicillium digitatum, P. expansum, Monilinia laxa, M. fructigena and Aspergillus spp. Extracts showed varying degree of antifungal activities on colony growth and conidia germination. The extract from FcA showed the least effect, while DvA extract had the strongest fungitoxic effects. FcR extract presented a fungitoxic effect on the colony growth, but it was not able to inhibit the conidia germination. These distinctions can be attributed to the differences in chemical composition of plant extracts.

  15. Chemical Composition and In Vitro Activity of Plant Extracts from Ferula communis and Dittrichia viscosa against Postharvest Fungi

    Directory of Open Access Journals (Sweden)

    Donato Mondelli


    Full Text Available F. communis and D. viscosa are perennial Mediterranean weeds that have been used for different therapeutic purposes in traditional pharmacopeia. Plant extracts were obtained from air dried D. viscosa young shoots (DvA and F. communis aerial part (FcA and roots (FcR with n-hexane. The chemical compositions of the extracts were analyzed by HPLC-DAD, LC-MS (ESI and LC-Q-TOF techniques. Two sesquiterpene lactones (inuviscolide, tomentosin and three sesquiterpene acids (costic acid, hydroxycostic acid, ilicic acid were identified from the D. viscosa extract, while in F. communis extracts three daucane sesquiterpenes (acetoxyferutinin, oxojaeskeanadioyl anisate, fertidin and one coumarin (ferulenol derivates were found. Biological activities of plant extracts were studied in in vitro experiments on the colonies and conidia of Botryotinia fuckeliana, Penicillium digitatum, P. expansum, Monilinia laxa, M. fructigena and Aspergillus spp. Extracts showed varying degree of antifungal activities on colony growth and conidia germination. The extract from FcA showed the least effect, while DvA extract had the strongest fungitoxic effects. FcR extract presented a fungitoxic effect on the colony growth, but it was not able to inhibit the conidia germination. These distinctions can be attributed to the differences in chemical composition of plant extracts.

  16. Polymorphism of Beauveria bassiana (Deuteromycota: Hyphomycetes) strains isolated from Ixodes ricinus (Acari: Ixodidae) in Moldova. (United States)

    Mitina, G V; Tokarev, Y S; Movila, A A; Yli-Mattila, T


    Polymorphism of 10 Beauveria bassiana strains, isolated from Ixodes ricinus in Moldova, was evaluated using traditional (morphological and cultural properties) and molecular (RAPD patterns and ITS sequences) methods. The isolates differed greatly in morphological and cultural features, such as color, consistence, and growth rate. Four RAPD-PCR markers were used to evaluate genetic diversity of the strains. Phylogenetic neighbor-joining analysis of RAPD patterns divided strains into 3 major clades. The ITS sequences of 8 strains were identical to those of known B. bassiana strains. Two subsets (1 and 2) different by one nucleotide change were found in the ITS1 region. One strain of subset 1 was different from known B. bassiana strains by possessing 2 point mutations in the ITS region. RAPD-based clustering correlated to ITS sequence and colony morphology-based grouping of the strains. 2010 Elsevier GmbH. All rights reserved.

  17. Detection and identification of Anaplasma phagocytophilum, Borrelia burgdorferi, and Rickettsia helvetica in Danish Ixodes ricinus ticks

    DEFF Research Database (Denmark)

    Skarphédinsson, Sigurdur; Lyholm, Birgitte Fjendbo; Ljungberg, Marianne


    Borreliosis is an endemic infection in Denmark. Recent serosurveys have indicated that human anaplasmosis may be equally common. The aim of this study was to look for Anaplasma phagocytophilum and related pathogens in Ixodes ricinus ticks and estimate their prevalence, compared to Borrelia, using...... Jutland and Funen, while 11% were positive for Borrelia burgdorferi. The Borrelia genotype B. afzelii was most prevalent, followed by B. valaisiana, B. burgdorferi s.s. and B. garinii.A. phagocytophilum was found in 14.5% of nymphs and 40.5% of adult ticks, while Borrelia was found in 13% of nymphs and 8......% of adult ticks. The difference in prevalence between Anaplasma and Borrelia in adult ticks supports the idea that their maintenance cycles in nature may be different. Ticks were also infected with Rickettsia helvetica. Our study indicates that A. phagocytophilum prevalence in ticks in Denmark is as high...

  18. Driving forces for changes in geographical distribution of Ixodes ricinus ticks in Europe

    Directory of Open Access Journals (Sweden)

    Medlock Jolyon M


    Full Text Available Abstract Many factors are involved in determining the latitudinal and altitudinal spread of the important tick vector Ixodes ricinus (Acari: Ixodidae in Europe, as well as in changes in the distribution within its prior endemic zones. This paper builds on published literature and unpublished expert opinion from the VBORNET network with the aim of reviewing the evidence for these changes in Europe and discusses the many climatic, ecological, landscape and anthropogenic drivers. These can be divided into those directly related to climatic change, contributing to an expansion in the tick’s geographic range at extremes of altitude in central Europe, and at extremes of latitude in Scandinavia; those related to changes in the distribution of tick hosts, particularly roe deer and other cervids; other ecological changes such as habitat connectivity and changes in land management; and finally, anthropogenically induced changes. These factors are strongly interlinked and often not well quantified. Although a change in climate plays an important role in certain geographic regions, for much of Europe it is non-climatic factors that are becoming increasingly important. How we manage habitats on a landscape scale, and the changes in the distribution and abundance of tick hosts are important considerations during our assessment and management of the public health risks associated with ticks and tick-borne disease issues in 21st century Europe. Better understanding and mapping of the spread of I. ricinus (and changes in its abundance is, however, essential to assess the risk of the spread of infections transmitted by this vector species. Enhanced tick surveillance with harmonized approaches for comparison of data enabling the follow-up of trends at EU level will improve the messages on risk related to tick-borne diseases to policy makers, other stake holders and to the general public.

  19. Diversity of viruses in Ixodes ricinus, and characterization of a neurotropic strain of Eyach virus

    Directory of Open Access Journals (Sweden)

    S. Moutailler


    Full Text Available Ticks transmit more pathogens—including bacteria, parasites and viruses—than any other arthropod vector. Although the epidemiological status of many tick-borne bacteria is very well characterized, tick-borne viruses are still relatively under-studied. Recently, several novel tick-borne viruses have been isolated from human febrile illnesses following tick bites, indicating the existence of other potential new and unknown tick-borne viruses. We used high-throughput sequencing to analyse the virome of Ixodes ricinus, the main vector of tick-borne pathogens in Europe. The majority of collected viral sequences were assigned to two potentially novel Nairovirus and Phlebovirus viruses, with prevalence rates ranging from 3.95% to 23.88% in adults and estimated to be between 0.14% and 72.16% in nymphs. These viruses could not be isolated from the brains of inoculated immunocompromised mice, perhaps indicating that they are unable to infect vertebrates. Within the I. ricinus virome, we also identified contigs with >90% identity to the known Eyach virus. Initially isolated in the 1980s, this virus was indirectly associated with human disease, but had never been extensively studied. Eyach virus prevalence varied between 0.07% and 5.26% in ticks from the French Ardennes and Alsace regions. Eyach virus was successfully isolated following intracerebral inoculation of immunocompromised mice with Eyach virus-positive tick extracts. This virus was also able to multiply and persist in the blood of immunocompetent mice inoculated by intraperitoneal injection, and caused brain infections in three of nine juveniles, without any obvious deleterious effects.

  20. Diversity of viruses in Ixodes ricinus, and characterization of a neurotropic strain of Eyach virus. (United States)

    Moutailler, S; Popovici, I; Devillers, E; Vayssier-Taussat, M; Eloit, M


    Ticks transmit more pathogens-including bacteria, parasites and viruses-than any other arthropod vector. Although the epidemiological status of many tick-borne bacteria is very well characterized, tick-borne viruses are still relatively under-studied. Recently, several novel tick-borne viruses have been isolated from human febrile illnesses following tick bites, indicating the existence of other potential new and unknown tick-borne viruses. We used high-throughput sequencing to analyse the virome of Ixodes ricinus, the main vector of tick-borne pathogens in Europe. The majority of collected viral sequences were assigned to two potentially novel Nairovirus and Phlebovirus viruses, with prevalence rates ranging from 3.95% to 23.88% in adults and estimated to be between 0.14% and 72.16% in nymphs. These viruses could not be isolated from the brains of inoculated immunocompromised mice, perhaps indicating that they are unable to infect vertebrates. Within the I. ricinus virome, we also identified contigs with >90% identity to the known Eyach virus. Initially isolated in the 1980s, this virus was indirectly associated with human disease, but had never been extensively studied. Eyach virus prevalence varied between 0.07% and 5.26% in ticks from the French Ardennes and Alsace regions. Eyach virus was successfully isolated following intracerebral inoculation of immunocompromised mice with Eyach virus-positive tick extracts. This virus was also able to multiply and persist in the blood of immunocompetent mice inoculated by intraperitoneal injection, and caused brain infections in three of nine juveniles, without any obvious deleterious effects.

  1. Dynamics of digestive proteolytic system during blood feeding of the hard tick Ixodes ricinus

    Directory of Open Access Journals (Sweden)

    Sojka Daniel


    Full Text Available Abstract Background Ticks are vectors of a wide variety of pathogens causing severe diseases in humans and domestic animals. Intestinal digestion of the host blood is an essential process of tick physiology and also a limiting factor for pathogen transmission since the tick gut represents the primary site for pathogen infection and proliferation. Using the model tick Ixodes ricinus, the European Lyme disease vector, we have previously demonstrated by genetic and biochemical analyses that host blood is degraded in the tick gut by a network of acidic peptidases of the aspartic and cysteine classes. Results This study reveals the digestive machinery of the I. ricinus during the course of blood-feeding on the host. The dynamic profiling of concentrations, activities and mRNA expressions of the major digestive enzymes demonstrates that the de novo synthesis of peptidases triggers the dramatic increase of the hemoglobinolytic activity along the feeding period. Overall hemoglobinolysis, as well as the activity of digestive peptidases are negligible at the early stage of feeding, but increase dramatically towards the end of the slow feeding period, reaching maxima in fully fed ticks. This finding contradicts the established opinion that blood digestion is reduced at the end of engorgement. Furthermore, we show that the digestive proteolysis is localized intracellularly throughout the whole duration of feeding. Conclusions Results suggest that the egressing proteolytic system in the early stage of feeding and digestion is a potential target for efficient impairment, most likely by blocking its components via antibodies present in the host blood. Therefore, digestive enzymes are promising candidates for development of novel 'anti-tick' vaccines capable of tick control and even transmission of tick-borne pathogens.

  2. Effects of global changes on the climatic niche of the tick Ixodes ricinus inferred by species distribution modelling. (United States)

    Porretta, Daniele; Mastrantonio, Valentina; Amendolia, Sara; Gaiarsa, Stefano; Epis, Sara; Genchi, Claudio; Bandi, Claudio; Otranto, Domenico; Urbanelli, Sandra


    Global climate change can seriously impact on the epidemiological dynamics of vector-borne diseases. In this study we investigated how future climatic changes could affect the climatic niche of Ixodes ricinus (Acari, Ixodida), among the most important vectors of pathogens of medical and veterinary concern in Europe. Species Distribution Modelling (SDM) was used to reconstruct the climatic niche of I. ricinus, and to project it into the future conditions for 2050 and 2080, under two scenarios: a continuous human demographic growth and a severe increase of gas emissions (scenario A2), and a scenario that proposes lower human demographic growth than A2, and a more sustainable gas emissions (scenario B2). Models were reconstructed using the algorithm of "maximum entropy", as implemented in the software Maxent 3.3.3e; 4,544 occurrence points and 15 bioclimatic variables were used. In both scenarios an increase of climatic niche of about two times greater than the current area was predicted as well as a higher climatic suitability under the scenario B2 than A2. Such an increase occurred both in a latitudinal and longitudinal way, including northern Eurasian regions (e.g. Sweden and Russia), that were previously unsuitable for the species. Our models are congruent with the predictions of range expansion already observed in I. ricinus at a regional scale and provide a qualitative and quantitative assessment of the future climatically suitable areas for I. ricinus at a continental scale. Although the use of SDM at a higher resolution should be integrated by a more refined analysis of further abiotic and biotic data, the results presented here suggest that under future climatic scenarios most of the current distribution area of I. ricinus could remain suitable and significantly increase at a continental geographic scale. Therefore disease outbreaks of pathogens transmitted by this tick species could emerge in previous non-endemic geographic areas. Further studies will

  3. Dominance of Dermacentor reticulatus over Ixodes ricinus (Ixodidae) on livestock, companion animals and wild ruminants in eastern and central Poland. (United States)

    Mierzejewska, Ewa J; Welc-Faleciak, Renata; Karbowiak, Grzegorz; Kowalec, Maciej; Behnke, Jerzy M; Bajer, Anna


    The most common tick species parasitizing animals in Poland are Ixodes ricinus and Dermacentor reticulatus. These tick species differ in their distribution, habitats, seasonal activity and host specificity. Ixodes ricinus is the most prevalent and widely distributed, whereas the range of D. reticulatus is limited to eastern and central parts of the country with several new foci in the middle-west and the west. However, as in many central European countries, the range of D. reticulatus is expanding, and some authors have correlated this expansion with an increasing number of available hosts. The aim of the present study was to determine the tick fauna on domestic and livestock animals in two areas endemic for I. ricinus and D. reticulatus and to compare the risk of infestation with different tick species in open and forest areas. Over a 14 month period, 732 ticks were collected from five host species including domestic animals (dogs and cats), livestock (cows and horses) and wildlife (European bison) in two areas, central and NE Poland, endemic for D. reticulatus. Three tick species were recorded: D. reticulatus (623 individuals; 85.1% of all collected ticks), I. ricinus (106 individuals; 14.5%) and three females of Ixodes hexagonus (0.4%) from a dog. Dermacentor reticulatus was the dominant tick species found on four host species and constituted 86, 81, 97 and 100% of all ticks from dogs, horses, cows and bison, respectively, and was collected from animals throughout the year, including during the winter. The common tick, I. ricinus, was the dominant tick collected from cats (94%). Fully-engorged, ready-for-reproduction females of D. reticulatus were collected from all host species. In May 2012, questing ticks were collected by dragging in forest or open habitats. The density of adult marsh ticks in open areas was around 2 ticks/100 m(2) in the majority of locations, with a maximum of 9.5 ticks/100 m(2). The density of adult I. ricinus was much lower in its typical

  4. Effects of global changes on the climatic niche of the tick Ixodes ricinus inferred by species distribution modelling (United States)


    Background Global climate change can seriously impact on the epidemiological dynamics of vector-borne diseases. In this study we investigated how future climatic changes could affect the climatic niche of Ixodes ricinus (Acari, Ixodida), among the most important vectors of pathogens of medical and veterinary concern in Europe. Methods Species Distribution Modelling (SDM) was used to reconstruct the climatic niche of I. ricinus, and to project it into the future conditions for 2050 and 2080, under two scenarios: a continuous human demographic growth and a severe increase of gas emissions (scenario A2), and a scenario that proposes lower human demographic growth than A2, and a more sustainable gas emissions (scenario B2). Models were reconstructed using the algorithm of “maximum entropy”, as implemented in the software Maxent 3.3.3e; 4,544 occurrence points and 15 bioclimatic variables were used. Results In both scenarios an increase of climatic niche of about two times greater than the current area was predicted as well as a higher climatic suitability under the scenario B2 than A2. Such an increase occurred both in a latitudinal and longitudinal way, including northern Eurasian regions (e.g. Sweden and Russia), that were previously unsuitable for the species. Conclusions Our models are congruent with the predictions of range expansion already observed in I. ricinus at a regional scale and provide a qualitative and quantitative assessment of the future climatically suitable areas for I. ricinus at a continental scale. Although the use of SDM at a higher resolution should be integrated by a more refined analysis of further abiotic and biotic data, the results presented here suggest that under future climatic scenarios most of the current distribution area of I. ricinus could remain suitable and significantly increase at a continental geographic scale. Therefore disease outbreaks of pathogens transmitted by this tick species could emerge in previous non

  5. Nitrogen mineralization in soils amended with sunnhemp, velvet bean and common bean residues

    Directory of Open Access Journals (Sweden)

    Ambrosano Edmilson José


    Full Text Available Nitrogen (15N released from sunnhemp (Crotalaria juncea, velvet bean (Mucuna aterrima and from Phaseolus bean residues was evaluated after incubation of the plant material in an Eutrudox and a Paleudalf, in a greenhouse experiment with pots containing 6 kg of air dried soil. Dry matter equivalent to 13 Mg ha-1 of Phaseolus bean residues and the same amount of above ground parts of the leguminous species, associated to 2.7 and 2.2 Mg ha-1 of roots of sunnhemp and velvet bean respectively, were incorporated into the soil. A completely randomized experimental design was adopted, with treatments arranged in a 2 3 + 1 factorial, replicated three times. The treatments were the following: two soils (Eutrudox and Paleudalf and three plant materials: two green-manures (sunnhemp or velvet bean, and Phaseolus bean residues, besides one control without plant incorporation into the soil. For the green-manure treatments there were two sub-treatments for each legume species, with 15N labeling of either shoots or roots. Soil moisture was maintained relatively constant during the experiment al period and the treatments were sampled weekly during 49 days. Total mineral nitrogen in the soil, as well as that derived from the legume plants were determined by isotope dilution. Nitrogen from the velvet bean accounted for a greater proportion of the soil inorganic N; shoots were responsible for most of N accumulated. Dry bean residues caused immobilization of inorganic N. The leguminous species added were intensively and promptly mineralized preserving the soil native nitrogen. Mineralization of the legume plant N was greater in the Paleudalf soil than in the Eutrudox.

  6. Nitrogen mineralization in soils amended with sunnhemp, velvet bean and common bean residues

    Energy Technology Data Exchange (ETDEWEB)

    Ambrosano, Edmilson Jose [Estacao Experimental de Agronomia de Piracicaba, SP (Brazil). Centro de Acao Regional; Trivelin, Paulo Cesar Ocheuze; Muraoka, Takashi [Centro de Energia Nuclear na Agricultura (CENA), Piracicaba, SP (Brazil). Lab. de Isotopos Estaveis; Cantarella, Heitor [Instituto Agronomico de Campinas (IAC), SP (Brazil). Centro de Solos e Recursos Agroambientais; Ambrosano, Glaucia Maria Bovi [Universidade Estadual de Campinas, Piracicaba, SP (Brazil). Faculdade de Odontologia. Dept. de Odontologia Social e Bioestatistica


    Nitrogen ({sup 15}N) released from sunnhemp (Crotalaria juncea), velvet bean (Mucuna aterrima) and from Phaseolus bean residues was evaluated after incubation of the plant material in an Eutrudox and a Paleudalf, in a greenhouse experiment with pots containing 6 kg of air dried soil. Dry matter equivalent to 13 Mg ha{sup -1} of Phaseolus bean residues and the same amount of above ground arts of the leguminous species, associated to 2.7 and 2.2 Mg ha{sup -1} of roots of sunnhemp and velvet bean respectively, were incorporated into the soil. A completely randomized experimental design was adopted, with treatments arranged in a 2 x 3 + 1 factorial, replicated three times. The treatments were the following: two soils (Eutrudox and Paleudalf) and three plant materials: two green-manures (sunnhemp or velvet bean), and Phaseolus bean residues, besides one control without plant incorporation into the soil. For the green-manure treatments there were two sub-treatments for each legume species, with {sup 15}N labeling of either shoots or roots. Soil moisture was maintained relatively constant during the experimental period and the treatments were sampled weekly during 49 days. Total mineral nitrogen in the soil, as well as that derived from the legume plants were determined by isotope dilution. Nitrogen from the velvet bean accounted for a greater proportion of the soil inorganic N; shoots were responsible for most of N accumulated. Dry bean residues caused immobilization of inorganic N. The leguminous species added were intensively and promptly mineralized preserving the soil native nitrogen. Mineralization of the legume plant N was greater in the Paleudalf soil than in the Eutrudox. (author)

  7. Dynamics of Cocoa Bean Pulp Degradation during Cocoa Bean Fermentation: Effects of Yeast Starter Culture Addition


    Laras Cempaka; Lienda Aliwarga; Susanto Purwo


    Fermentation is a crucial step in the post-harvest processing of cocoa beans. This process comprises mixed culture microbial activities on the cocoa bean pulp, producing metabolites that act as important precursors for cocoa flavour development. Variations in the microbial population dynamics during the fermentation process may induce changes in the overall process. Thus, the introduction of a specific microbial starter culture may improve the quality of the fer...

  8. [Polycyclic aromatic hydrocarbons in the beans, peas and broad beans from domestic market, 1999-2002]. (United States)

    Bałdyga, Barbara; Zbigniew, Borejszo; Wieczorek, Jolanta; Dymkowska-Malesa, Maria; Smoczyńtski, Stefan S


    Seeds of bean, peas and broad bean, purchased from local seed production plants in the provinces of Mazowieckie and Kujawsko-Pomorskie in the years 1999-2002, were determined for the contents of fifteen polycyclic aromatic hydrocarbons. The hydrocarbons were extracted from the seeds with a hexane-acetone mixture by means of sonification. The obtained extracts were then purified in a silica gel column. Polycyclic aromatic hydrocarbons (PAH) were identified and determined quantitatively with liquid chromatography using a fluorescent detector. The presence (in different concentrations) of PAH was reported in the majority of seeds of the bean, peas and broad bean varieties examined, which indicates that they may be ingested with food and bioaccumulated in the human organism. A considerably higher content of SPAH was observed in the seeds of broad bean, compared to those of bean and peas. The highest SPAH determined reached 2 x 10(2) microg/kg of product. The obtained results were comparable with those reported by other authors for vegetables originating from non-industrial areas. It is worth emphasising that all the seeds examined revealed the presence of PAH with carcinogenic properties.


    African Journals Online (AJOL)


    11g. J. B io1cchn. 15 ( 1) 42- 4 7. 42. COMPARATCVE CHEMICAL EVALUATION OF LOCUST BEAN. (Parkia biglobosa) FRUIT PULP HARVESTED DURING THE DRY. AND WET SEA ON . *M. . Nadro and H. A. Umaru. Department of Biochemistry. Federal University of Technology. P. M. B. 2076, Yola. Adamawa State.

  10. Epidemiology of bean rust in Ethiopia

    NARCIS (Netherlands)

    Habtu, A.


    Field and greenhouse experiments were conducted to study the epidemiology of rust ( Uromyces appendiculatus ) on beans ( Phaseolus vulgaris L.) in Ethiopia. The experiments were conducted under low input conditions reflecting

  11. Wild beans (Phaseolus L.) of North America (United States)

    The wild relatives of the five domesticated species of bean (Phaseolus L.) are widely distributed across the tropics and subtropics of the New World, with taxa extending to the Canadian border, the Caribbean islands and Bermuda, the Galapagos Islands, and south to Argentina. Mesoamerica holds the la...

  12. chitwood on African yam bean, Sphenostylis stenocarpa

    African Journals Online (AJOL)



    Jan 24, 2012 ... Uguru and Madukaife, 2001). In fact, given the nutritional status of S. stenocarpa, it has the potential of replacing animal proteins in the diets of many poor Africans who cannot afford the exorbitant cost of proteins from animals. In addition to the nutritional potentials of African yam bean it is wise to depend on ...

  13. Lima Bean Starch-Based Hydrogels

    African Journals Online (AJOL)


    ABSTRACT. Hydrogels were prepared by crosslinking native lima bean starch and polyvinyl alcohol. (PVA) with glutaraldehyde (GA) at varying proportions in an acidic medium. The native starch (N-LBS) and hydrogels (L-GA (low glutaraldehyde) and H-GA (high glutaraldehyde)) were examined for their water absorption ...

  14. Determination of physicomechanical properties of velvet bean ...

    African Journals Online (AJOL)

    Selected physical and mechanical properties of velvet bean (Mucuna pruriens) were studied at two moisture content levels of 13% and 20% (db). Compression strength characteristics were conducted under quasi-static compressive force at longitudinal and latitudinal (lateral) loading positions and the rupture forces, ...

  15. Beans (Phaseolus spp.) - model food legumes

    International Nuclear Information System (INIS)

    Broughton, W.J.; Hemandez, H.; Blair, M.; Beebe, S.; Gepts, P.; Vanderleyden, J.


    Globally, 800 million people are malnourished. Heavily subsidised farmers in rich countries produce sufficient surplus food to feed the hungry, but not at a price the poor can afford. Even donating the rich world's surplus to the poor would not solve the problem. Most poor people earn their living from agriculture, so a deluge of free food would destroy their livelihoods. Thus, the only answer to world hunger is to safeguard and improve the productivity of farmers in poor countries. Diets of subsistence level farmers in Africa and Latin America often contain sufficient carbohydrates (through cassava, corn/maize, rice, wheat, etc.), but are poor in proteins. Dietary proteins can take the form of scarce animal products (eggs, milk, meat, etc.), but are usually derived from legumes (plants of the bean and pea family). Legumes are vital in agriculture as they form associations with bacteria that 'fix-nitrogen' from the air. Effectively this amounts to internal fertilisation and is the main reason that legumes are richer in proteins than all other plants. Thousands of legume species exist but more common beans (Phaseolus vulgaris L.) are eaten than any other. In some countries such as Mexico and Brazil, beans are the primary source of protein in human diets. As half the grain legumes consumed worldwide are common beans, they represent the species of choice for the study of grain legume nutrition. Unfortunately, the yields of common beans are low even by the standards of legumes, and the quality of their seed proteins is sub-optimal. Most probably this results from millennia of selection for stable rather than high yield, and as such, is a problem that can be redressed by modem genetic techniques. We have formed an international consortium called 'Phaseomics' to establish the necessary framework of knowledge and materials that will result in disease-resistant, stress-tolerant, high-quality protein and high-yielding beans. Phaseomics will be instrumental in improving

  16. Chemical evaluation of winged beans ( Psophocarpus ...

    African Journals Online (AJOL)

    Chemical evaluation of winged beans ( Psophocarpus Tetragonolobus ), Pitanga cherries ( Eugenia uniflora) and orchid fruit ( Orchid fruit myristic a) ... The acid value ranged between 0.71 and 2.82 mg/KOH/g while iodine value ranged between 91.15 and 144.57. The refractive index ranged between 1.465 and 1.474 in all ...

  17. Seed coat darkening in Cowpea bean (United States)

    Seed coat of cowpea bean (Vigna unguiculata L. Walp) slowly browns to a darker color during storage. High temperature and humidity during storage might contribute to this color change. Variation in browning rate among seeds in a lot leads to a mixture of seed colors creating an unacceptable product...

  18. Common bean and cowpea improvement in Angola (United States)

    During 2014 and 2015, the Instituto de Investigação Agronómica (IIA) evaluated the performance of common bean (Phaselolus vulgaris L.) breeding lines and improved cowpea (Vigna unguiculata L. Walp.) varieties. The field experiments were planted in the lowlands at Mazozo and in the highlands at Chian...

  19. Insecticide Efficacy and Timing for Control of Western Bean Cutworm (Lepidoptera: Noctuidae) in Dry and Snap Beans. (United States)

    Goudis, L A; Trueman, C L; Baute, T S; Hallett, R H; Gillard, C L


    The western bean cutworm, Striacosta albicosta (Smith) (Lepidoptera: Noctuidae), is a recent pest of corn, dry,and snap beans, in the Great Lakes region, and best practices for its management in beans need to be established.Insecticide efficacy and application timing field studies, conducted in 2011–2013, determined that lambda-cyhalothrin and chlorantraniliprole were capable of reducing western bean cutworm feeding damage in dry beans from 2.3 to 0.4% in preharvest samples, and in snap beans from 4.8 to 0.1% of marketable pods, respectively. The best application timing in dry beans was determined to be 4–18 d after 50% egg hatch. No economic benefit was found when products were applied to dry beans, and despite high artificial inoculation rates, damage to marketable yield was relatively low. Thiamethoxam, methoxyfenozide, and spinetoram were also found to be effective at reducing western bean cutworm damage in dry bean to as low as 0.3% compared to an untreated control with 2.5% damaged pods. In snap beans, increased return on investment between CAD$400 and CAD$600 was seen with multiple applications of lambda-cyhalothrin, and with chlorantraniliprole applied 4 d after egg mass infestation.

  20. Myrtus communis L. as source of a bioactive and safe essential oil. (United States)

    Bouzabata, Amel; Cabral, Célia; Gonçalves, Maria José; Cruz, Maria Teresa; Bighelli, Ange; Cavaleiro, Carlos; Casanova, Joseph; Tomi, Félix; Salgueiro, Ligia


    In Algeria, Myrtus communis L. is distributed throughout the Tell Atlas and the coastal regions of Algiers and Constantine. The leaves are used in respiratory disorders, diarrhea and hemorrhoids. The aims of this work were to evaluate the antifungal and anti-inflammatory potential of well characterized essential oils (EO). Since EO can be applied by inhalation, dermal application and oral administration, we used several mammalian cell lines to assess safe bioactive doses. The chemical composition of two samples was investigated by GC-FID, GC-MS and (13)C NMR spectroscopy. Monoterpene derivatives are the main compounds: α-pinene (50.8 and 33.6%), 1,8-cineole (21.9 and 13.3%), linalool (2.7 and 14.8%), and linalyl acetate (0.5 and 9.5%). The antifungal evaluation revealed that the oils were more active against Cryptococcus neoformans (yeast) and Epidermophyton floccosum, Microsporum canis, Trichophyton rubrum (dermatophytes). The anti-inflammatory potential was evaluated using an in vitro model of lipopolysaccharide (LPS)-stimulated macrophages. Assessment of cell viability was made through the MTT assay. Both oils were able to significantly inhibit NO production, without affecting cell viability, in concentrations up to 0.64 mg/mL. These promising results, disclose bioactive concentrations of Myrtle essential oils with a safety profile suggesting a potential oral and topical application or use by inhalation. Copyright © 2014 Elsevier Ltd. All rights reserved.

  1. Perineal hernia repair using an autologous tunica vaginalis communis in nine intact male dogs. (United States)

    Pratummintra, Kittiya; Chuthatep, Suwicha; Banlunara, Wijit; Kalpravidh, Marissak


    Perineal hernia in dogs is very problematic and mostly requires surgical reconstruction of the weak pelvic diaphragm. Tissue or synthetic grafts have been used for the correction after failure of the conventional herniorrhaphy. Aim of this clinical trial was to assess the possible use of the autologous tunica vaginalis communis as a free graft for perineal hernia repair in intact male dogs. Seven unilateral and 2 bilateral perineal hernias in nine intact male dogs free from testicular and scrotal neoplasms were included in this study. The median surgical time for unilateral herniorrhaphy was 75 min. The median follow-up time was 13 months. The success of the autografting, based on no recurrence and comfort of the animals during urination and defecation, was found in ten of 11 hernias; giving a success rate of 90.91%. One hernia (9.09%) recurred 10 days after surgery. Histopathological examination of the apposing area between the graft and the adjacent tissue, taken during the repair of the recurred case at day 20, revealed neovascularization and connective tissue ingrowth. In conclusion, the tunica vaginalis autograft can be used for perineal herniorrhaphy in intact male dogs.

  2. Apomixis and the problem of obtaining haploids and homozygote diploids in pear (Pyrus communis L.

    Directory of Open Access Journals (Sweden)

    Є. О. Долматов


    Full Text Available The article highlights results of research over simulative apomixes in pear and its utilization for obtaining haploids and homozygote diploids. It has been established that over 50% pear varieties with failed remote hybridization are capable of generating seeds of apomictic origin producing diploid plants. Genotypes displaying maximal inclination to apomixes have been singled out. Apomictic pear seedlings obtained from foreign pollination within the limits of the same combination are inherent in profound morphological diversity. Fruit-bearing apomicts originated from one and the same maternal plant differ to the same extent as hybrid seedlings of the same family. Genetic markers have enabled to establish that these are embryo sacs in which meiosis has completed that give rise to apomictic seeds. In vitro method as used for the purpose of increasing apomictic plants output has been illustrated. The greatest induction of apomictic shoots in vitro has been reached by alternation of BAP cytokinin at concentration of 1mg/l and 2 mg/l on the background of GA3 amounting to 1,5 mg/l. Grafting with shoots in vitro on non-sterile rootstocks of pear (Pyrus communis has increased the output of plants up to 80%. A cytological assessment of 9 apomictic samples is provided. The cytological analysis of samples of apomictic forms has certified the presence of simulative haploid parthenogenesis in pear.

  3. Composition of Myrtus communis L. Essential Oils as Affected by Climatic Conditions

    Directory of Open Access Journals (Sweden)

    Paula Pereira


    Full Text Available Myrtus Communis L. (Myrtaceae family, commonly known as myrtle, possesses a set of qualities that make it very interesting for the pharmaceutical, nutraceutical and cosmetic industries. In this work, myrtle was studied over a period of three years (2006-2008, encompassing the main stages of the development cycle of the plant. The influence of climatic conditions, such as temperature and rainfall, on the chemical composition and yield of the essential oils obtained from leaves and berries was studied. The leaves and berries essential oils were obtained by Clevenger distillation and analysed by GC and GC-MS. The results show that the major components were limonene+1,8-cineole, myrtenyl acetate, α-pinene and linalool. Over the three year period of study, a decrease in the composition of the most volatile compounds (α-pinene and limonene+1,8-cineole was observed, the reverse being found for linalool and myrtenyl acetate. The highest value for the yield of the leaves’ essential oils was observed in the third year (0.64%, w/w, whereas that same year the lowest yield (0.07%, w/w of fruit was observed. These results were likely due to an atypically high record for rainfall in April and May of that year. The highest value of the berry essential oils (0.14%, w/w was obtained in the second year.

  4. Essential Oil of Myrtus communis L. as a Potential Antioxidant and Antimutagenic Agents

    Directory of Open Access Journals (Sweden)

    Neda Mimica-Dukić


    Full Text Available The present study describes DPPH (2,2-diphenyl-1-picrylhydrazyl radical scavenging activity and antimutagenic properties of the essential oil of myrtle (Myrtus communis L.. Plant samples were collected from the two distant localities (southernmost and northern point of the Montenegro coastline. Chemical profiles of the two samples were evaluated by GC-MS. In both of the samples monoterpenes were found to be the predominant compounds. Among them a-pinene, linalool, 1,8-cineole, and myrtenyl acetate were the major compounds. Significant differences between the samples were found in the ranges of a-pinene (14.7%–35.9% and myrtenyl acetate (5.4%–21.6%. Both oils exhibited moderate DPPH scavenging activity, with IC50 values of 6.24 mg/mL and 5.99 mg/mL. The antimutagenic properties were assayed against spontaneous and t-BOOH-induced mutagenesis in Escherichia coli oxyR mutant IC202, a bacterial strain deficient in removing ROS. Reduction of the spontaneous mutagenesis in presence of myrtle EO was only slight, up to 13% at the highest concentration tested. When the oxidative mutagen was used, EO expressed higher reduction of mutagenesis, in a concentration dependent manner, with statistical significance for effect at the highest concentration tested (28%. Suppression of t-BOOH induced mutagenesis was correlated with the observed scavenging activity.

  5. Antibacterial activity of ethanolic extract of Myrtus communis. L leaves against salivary Mutans streptococci

    International Nuclear Information System (INIS)

    AlAnbori, Dalia K.A; AlNimer, Marwan S.M; AlWeheb, Athraa M


    The aim of this study was to evaluate the efficacy of ethanolic extract of Myrtus communis (myrtle) leaves in the selective reduction of Mutans streptococci count in saliva compared to chlorhexidine through in vitro and in vivo experiments. Ethanolic extract (2%) was prepared and screened by UV-visible spectrophotometer to detect peaks of active compounds. The minimum inhibitory concentrations (MICs) of myrtle extract as well as chlorhexidine (0.12%) were determined against Mutans streptococci isolated from human saliva and identified bacteriologically in vivo experiments, the effect of single mouth rinse of myrtle extract or chlorhexidine was investigated against the number of colony forming unit (CFU) of Mutans streptococci for two hours after rinse. The results showed the presence of one large peak at λ266.5 nm and a small one at λ672 of the extract in UV-visible spectra suggesting the presence of flavanoid. The MIC of myrtle was 106.6 μg/mL compared with 3.3 μg/mL of chlorhexidine. Single mouth rinse of myrtle extract significantly reduced the number of CFU of salivary Mutans streptococci but its effect was significantly less than that of chlorhexidine. It was concluded that the antibacterial effect of myrtle on Mutans streptococci was due to its flavanoid content. Therefore, ethanolic extract of myrtle could be a potential remedy for the prevention of colonization by Mutans streptococci thereby preventing or retarding development of dental caries. (author)

  6. Effects of GA3 applications on seedlesness and fruit quality in black myrtle (Myrtus communis L.

    Directory of Open Access Journals (Sweden)

    Esra Alım


    Full Text Available Myrtle (Myrtus communis L. is one of the medical and aromatic plants naturally grown in Mediterranean basin. Myrtle fruits are mostly consumed as fresh or dried while essential oils obtained from the leaves are widely used in pharmacy, perfumery, cosmetic and even as pesticide. Myrtle fruits have white and black color. Nowadays, there is a big demand for myrtle fruits because of its high antioxidant capacity. But it contains high amount of seeds which reduce marketing and production. Main objective of this study is to investigate the effects of GA3 on seedlesness and quality in black myrtle fruits. At different flowering stages, GA3 dose of 100 ppm were applied to whole of the plants. Some applications significantly reduced seed number in fruits. Two applications of GA3 at great ballon and full bloom stages consecutively decreased seed number from 10.69 (control to 1.98 seed fruit-1 . In addition, with three consecutive application of GA3, seed rate decreased to 4.98% while 15.08% in control. Some GA3 applications resulted in fully seedless fruits up to 10.67%. Conversely, GA3 applications did not change fruit weight and some biochemical parameters of fruits.

  7. Variation in Myrtus communis L. Essential Oil Composition and its Antibacterial Activities Components

    International Nuclear Information System (INIS)

    Al-Mairiri, A.; Swied, G.; Hallab, L. A.; Oda, A.


    The Myrtus communis L. leaves samples were collected from five locations of its native grown areas in Lattakia, Syria, during their blooming seasons (June, 2009). Essential oil (EO) extraction was carried out by hydro-distillation in a Clevenger apparatus. The EO was analysed by both gas chromatography-Flame Ionization Detector (GC-FID) and gas chromatography/mass (GC/MS) techniques. The EO yield of the dry samples was found to be around 1.88%. The main identified components of EO were: alpha-pinene 30.40%, 1,8-cineole 17.66%, limonene 8.96%, myrtenol 5.78%, and beta-caryophyllene 5.00%. The bulk EO and the separated components were tested for their antibacterial activities against Escherichia coli O157, Salmonella typhimurium, Klebsiella pneumoniae, Yersinia enterocolitica O9, Brucella melitensis, Proteus spp., and Pseudomonas aeruginosa by using broth micro-dilution method. It was found that citronellal and nerol were the most effective components against all pathogens. (author)

  8. Origins of Common Neural Inputs to Different Compartments of the Extensor Digitorum Communis Muscle. (United States)

    Dai, Chenyun; Shin, Henry; Davis, Bradley; Hu, Xiaogang


    The extensor digitorum communis (EDC) is a multi-compartment muscle that allows dexterous extension of the four digits. However, the level of common input shared across different compartments of this muscle is not well understood. We seek to systematically characterize the common and independent neural input, originated from different levels of the central nervous system, to the different compartments. A motor unit (MU) coherence analysis was used to capture the different sources of common and independent input, by quantifying the coherence of MU discharge between different compartments. The MU activities were obtained from decomposition of surface electromyogram recordings. Our results showed that the MU coherence across different muscle compartments accounted for only a small proportion (60%) in the delta (1-4 Hz) band. Additionally, cross-compartment coherence between the middle and ring-little fingers tended to be higher as compared with other finger combinations. Overall, the common input shared across different fingers are found to be at low to moderate levels, in comparison with the total input, which allows dexterous control of individual digits with some degree of coordinated control of multiple digits.

  9. Chemical And Physiological Studies On Drought Stress Tolerance Of Irradiated Communis Pear Using Tissue Culture

    International Nuclear Information System (INIS)

    Zaied, N.S.; Ragab, E.A.


    The rooted in vitro irradiated pear rootstocks (Pyrus communis) were subjected to drought stress by using different concentrations of mannitol (20, 40, 60, 80 and 100 gm/l), polyethylene glycol (PEG) at concentrations 2, 4, 6, 8 and 10 % to culture medium and also agar at concentrations 6, 8, 10, 12 and 14 gm/l to study their effects on tissue culture and chemical analysis and their tolerance to drought stress. The obtained results showed that the number of shoots, shoot length and number of leaves were higher at 20 and 40 gm/l mannitol. Increasing mannitol concentration enhanced the increase of chlorophyll b, reducing sugars, total indoles and total phenols up to the highest level at 100 gm/l. Adding PEG at concentration 2% to the culture medium encouraged significant increases in the number of shoots and number of leaves and increase chlorophyll a, and non-reducing sugars as well as significant decrease in number of shoots, shoots length, number of leaves, root length and number of roots with increasing agar concentrations to the culture medium. However, decreasing agar concentration in the culture medium induced increase in chlorophyll A and non-reducing sugar

  10. Antioxidant activities and fatty acid composition of wild grown myrtle (Myrtus communis L.) fruits (United States)

    Serce, Sedat; Ercisli, Sezai; Sengul, Memnune; Gunduz, Kazim; Orhan, Emine


    The fruits of eight myrtles, Myrtus communis L. accessions from the Mediterranean region of Turkey were evaluated for their antioxidant activities and fatty acid contents. The antioxidant activities of the fruit extracts were determined by using 2,2-diphenyl-1-picrylhydrazyl (DPPH) and β-carotene-linoleic acid assays. The fatty acid contents of fruits were determined by using gas chromatography. The methanol extracts of fruits exhibited a high level of free radical scavenging activity. There was a wide range (74.51-91.65%) of antioxidant activity among the accessions in the β-carotene-linoleic acid assay. The amount of total phenolics (TP) was determined to be between 44.41-74.44 μg Gallic acid equivalent (GAE)/mg, on a dry weight basis. Oleic acid was the dominant fatty acid (67.07%), followed by palmitic (10.24%), and stearic acid (8.19%), respectively. These results suggest the future utilization of myrtle fruit extracts as food additives or in chemoprevention studies. PMID:20548930

  11. Formulation and Optimization of Oral Mucoadhesive Patches of Myrtus Communis by Box Behnken Design. (United States)

    Hashemi, Mahbubeh; Ramezani, Vahid; Seyedabadi, Mohammad; Ranjbar, Ali Mohamad; Jafari, Hossein; Honarvar, Mina; Fanaei, Hamed


    Purpose: Recurrent aphthous stomatitis (RAS) is the most common painful ulcerative disease of oral mucosa happening in ~20% of people. Aimed to develop Myrtus communis L. (Myrtle) containing oral patches, we applied box-behnken design to evaluate the effect of polymers such as Polyvinyl pyrrolidone (PVP), Gelatin, Methylcellulose (MC) and Pectin. Methods: The patches properties such as tensile strength, folding endurance, swelling index, thickness, mucoadhesive strength and the pattern of myrtle release were evaluated as dependent variables. Then, the model was adjusted according to the best fitted equation with box behnken design. Results: The results indicated that preparation of myrtle patch with hydrophilic polymers showed the disintegration time up to 24h and more. Using of polyvinyl pyrrolidone as a water soluble polymer and a pore-former polymer led to faster release of soluble materials from the patch to 29 (min -1 ). Also it decreases swelling index by increasing the patch disintegration. Gelatin and Pectin, with rigid matrix and water interaction properties, decreased the swelling ratio. Pectin increased the tensile strength, but gelatin produced an opposite effect. Thinner Myrtle patch (about 28µm) was obtained by formulation of methyl cellulose with equal ratio with polyvinyl pyrrolidone or gelatin. Conclusion: Altogether, the analysis showed that the optimal formulation was achieved with of 35.04 mg of Gelatin, 7.22 mg of Pectin, 7.20 mg of polyvinyl pyrrolidone, 50.52 mg of methyl cellulose and 20 mg of Myrtle extract.

  12. First molecular evidence of potentially zoonotic Babesia microti and Babesia sp. EU1 in Ixodes ricinus ticks in Belgium. (United States)

    Lempereur, Laetitia; De Cat, Ann; Caron, Yannick; Madder, Maxime; Claerebout, Edwin; Saegerman, Claude; Losson, Bertrand


    We report the first molecular evidence of the presence of Babesia sp. EU1 and Babesia microti in Ixodes ricinus ticks in Belgium. A 1-year national survey collected 1005 ticks from cats and dogs. A polymerase chain reaction technique amplifying a part of the 18S rRNA gene detected Babesia spp. in 11 out of 841 selected and validated tick extracts. Subsequent sequencing identified Ba. microti (n=3) and Babesia sp. EU1 (n=6). This study has demonstrated a low infection rate (1.31% with 95% CI: 0.65-2.33) of Babesia spp. carriage in I. ricinus ticks in Belgium but, for the first time, reports two potentially zoonotic species belonging to this genus. Coinfection with Ba. microti and Borrelia burgdorferi sensu stricto also was demonstrated. In addition, this study clearly demonstrates that inhibitors of polymerase chain reaction amplification are present in engorged ticks.

  13. Effect of forest clearing on the abundance of Ixodes ricinus ticks and the prevalence of Borrelia burgdorferi s.l

    Czech Academy of Sciences Publication Activity Database

    Hubálek, Zdeněk; Halouzka, Jiří; Juřicová, Zina; Šikutová, Silvie; Rudolf, Ivo


    Roč. 20, č. 2 (2006), s. 166-172 ISSN 0269-283X R&D Projects: GA ČR GA206/03/0726 EU Projects: European Commission(XE) 10284 - EDEN Institutional research plan: CEZ:AV0Z60930519 Keywords : Ixodes ricinus * Borrelia burgdorferi sensu lato * Lyme borreliosis risk Subject RIV: FN - Epidemiology, Contagious Diseases ; Clinical Immunology Impact factor: 2.033, year: 2006

  14. Effect of salivary gland extract from Ixodes ricinus ticks on the proliferation of Borrelia burgdorferi sensu stricto in vivo

    Czech Academy of Sciences Publication Activity Database

    Macháčková, Martina; Oborník, Miroslav; Kopecký, Jan


    Roč. 53, č. 2 (2006), s. 153-158 ISSN 0015-5683 R&D Projects: GA ČR GA524/05/0811 Grant - others:Studentská grantová agentura, Biologická fakulta Jihočeské univerzity(CZ) SGA2004/009 Institutional research plan: CEZ:AV0Z60220518 Keywords : Borrelia burgdorferi * Ixodes ricinus * saliva-activated transmission Subject RIV: EC - Immunology Impact factor: 1.511, year: 2006

  15. Functional expression and characterization of cathepsin B and L from the gut of the tick Ixodes ricinus

    Czech Academy of Sciences Publication Activity Database

    Franta, Zdeněk; Pěničková, Helena; Dvorak, J.; Schneider, E. I.; Horn, Martin; Mareš, Michael; Sojka, Daniel; McKerrow, J. H.; Caffrey, C. R.; Kopáček, Petr


    Roč. 276, S1 (2009), s. 309-309 ISSN 1742-464X. [34th FEBS Congress: Life's Molecular Interactions. 04.07.2009-09.07.2009, Prague] R&D Projects: GA AV ČR IAA600960910; GA MŠk(CZ) LC06009 Institutional research plan: CEZ:AV0Z60220518; CEZ:AV0Z40550506 Keywords : cathepsin B and L * Ixodes ricinus * functionl expresssion Subject RIV: EB - Genetics ; Molecular Biology

  16. Salivary gland extract from engorged Ixodes ricinus (Acari: Ixodidae) stimulates in vitro growth of Borrelia burgdorferi sensu lato

    Czech Academy of Sciences Publication Activity Database

    Rudolf, Ivo; Šikutová, Silvie; Kopecký, Jan; Hubálek, Zdeněk


    Roč. 50, č. 3 (2010), s. 294-298 ISSN 0233-111X R&D Projects: GA ČR GA206/03/0726; GA AV ČR IAA600960811 Institutional research plan: CEZ:AV0Z60930519; CEZ:AV0Z60220518 Keywords : salivary gland extract * Ixodes ricinus ticks * Borrelia burgdorferi sensu lato Subject RIV: EE - Microbiology, Virology Impact factor: 1.395, year: 2010

  17. Europe-Wide Meta-Analysis of Borrelia burgdorferi Sensu Lato Prevalence in Questing Ixodes ricinus Ticks

    Czech Academy of Sciences Publication Activity Database

    Strnad, Martin; Hönig, Václav; Růžek, Daniel; Grubhoffer, Libor; Rego, Ryan O. M.


    Roč. 83, č. 15 (2017), č. článku e00609-17. ISSN 0099-2240 EU Projects: European Commission(XE) 278976 - ANTIGONE; European Commission(XE) 602272 - ANTIDotE Institutional support: RVO:60077344 Keywords : Borrelia burgdorferi sensu lato * tick * Ixodes ricinus * genospecies * meta-analysis * Lyme borreliosis * Lyme disease Subject RIV: EE - Microbiology, Virology OBOR OECD: Microbiology Impact factor: 3.807, year: 2016

  18. Ixodes ricinus ticks are reservoir hosts for Rickettsia helvetica and potentially carry flea-borne Rickettsia species

    Directory of Open Access Journals (Sweden)

    Gaasenbeek Cor


    Full Text Available Abstract Background Hard ticks have been identified as important vectors of rickettsiae causing the spotted fever syndrome. Tick-borne rickettsiae are considered to be emerging, but only limited data are available about their presence in Western Europe, their natural life cycle and their reservoir hosts. Ixodes ricinus, the most prevalent tick species, were collected and tested from different vegetation types and from potential reservoir hosts. In one biotope area, the annual and seasonal variability of rickettsiae infections of the different tick stages were determined for 9 years. Results The DNA of the human pathogen R. conorii as well as R. helvetica, R. sp. IRS and R. bellii-like were found. Unexpectedly, the DNA of the highly pathogenic R. typhi and R. prowazekii and 4 other uncharacterized Rickettsia spp. related to the typhus group were also detected in I. ricinus. The presence of R. helvetica in fleas isolated from small rodents supported our hypothesis that cross-infection can occur under natural conditions, since R. typhi/prowazekii and R. helvetica as well as their vectors share rodents as reservoir hosts. In one biotope, the infection rate with R. helvetica was ~66% for 9 years, and was comparable between larvae, nymphs, and adults. Larvae caught by flagging generally have not yet taken a blood meal from a vertebrate host. The simplest explanation for the comparable prevalence of R. helvetica between the defined tick stages is, that R. helvetica is vertically transmitted through the next generation with high efficiency. The DNA of R. helvetica was also present in whole blood from mice, deer and wild boar. Conclusion Besides R. helvetica, unexpected rickettsiae are found in I. ricinus ticks. We propose that I. ricinus is a major reservoir host for R. helvetica, and that vertebrate hosts play important roles in the further geographical dispersion of rickettsiae.

  19. Broad-range survey of vector-borne pathogens and tick host identification of Ixodes ricinus from Southern Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Hönig, Václav; Carolan, H. E.; Vavrušková, Zuzana; Massire, C.; Mosel, M.l R.; Crowder, C. D.; Rounds, M. A.; Ecker, D. J.; Růžek, Daniel; Grubhoffer, Libor; Luft, B. J.; Eshoo, M. W.


    Roč. 93, č. 11 (2017), č. článku fix129. ISSN 0168-6496 EU Projects: European Commission(XE) 278976 - ANTIGONE Institutional support: RVO:60077344 Keywords : burgdorferi sensu-lato * tick * Ixodes ricinus * pcr-esi/ms * Borrelia * host * Lyme borreliosis * Babesia * Anaplasma * Rickettsia Subject RIV: EE - Microbiology, Virology OBOR OECD: Microbiology Impact factor: 3.720, year: 2016

  20. Two ways of experimental infection of Ixodes ricinus ticks (Acari: Ixodidae) with spirochetes of Borrelia burgdorferi sensu lato complex

    Czech Academy of Sciences Publication Activity Database

    Fišerová, Lenka; Černá, Kateřina; Horká, Helena; Kopecký, Jan


    Roč. 55, č. 2 (2008), s. 150-154 ISSN 0015-5683 R&D Projects: GA ČR GA524/05/0811; GA MŠk(CZ) LC06009 Institutional research plan: CEZ:AV0Z60220518 Keywords : Lyme disease spirochete * Borrelia burgdorferi * Borrelia baronii * Borrelia afzelii * tick * Ixodes ricinus Subject RIV: EC - Immunology Impact factor: 1.307, year: 2008

  1. Acceptability and characterization of extruded pinto, navy and black beans. (United States)

    Simons, Courtney W; Hall, Clifford; Tulbek, Mehmet; Mendis, Mihiri; Heck, Taylor; Ogunyemi, Samuel


    Consumption of dry beans has been relatively flat over the last decade. Creating new bean products may increase the consumption of beans and allow more consumers to obtain the health benefits of beans. In this study, pinto, navy and black beans were milled and the resulting flours extruded into puffs. Unflavored extruded puffs were evaluated by untrained panelists using a hedonic scale for appearance, flavor, texture and overall acceptability. The compositions of raw flours and extrudates were characterized. Sensory results indicated that all beans met or exceeded the minimum requirement for acceptability. Overall acceptability of navy and pinto beans was not significantly different, while acceptability of black bean puffs was significantly lower. Total protein (198-217 g kg(-1)) in extrudates was significantly different among the three beans. Total starch ranged from 398 to 406 g kg(-1) and was not significantly different. Resistant starch, total extractable lipid and raffinose contents were significantly reduced by extrusion. Extrusion did not affect crude fiber and phytic acid contents. The minimal effects on protein and fiber contents, the significant reduction in raffinose content and the acceptability of the unflavored extruded puffs support using various bean flours as ingredients in extruded puffed products. © 2014 Society of Chemical Industry.

  2. Zinc supplementation, production and quality of coffee beans

    Directory of Open Access Journals (Sweden)

    Herminia Emilia Prieto Martinez


    Full Text Available Besides its importance in the coffee tree nutrition, there is almost no information relating zinc nutrition and bean quality. This work evaluated the effect of zinc on the coffee yield and bean quality. The experiment was conducted with Coffea arabica L. in "Zona da Mata" region, Minas Gerais, Brazil. Twelve plots were established at random with 4 competitive plants each. Treatments included plants supplemented with zinc (eight plots and control without zinc supplementation (four plots. Plants were subjected to two treatments: zinc supplementation and control. Yield, number of defective beans, beans attacked by berry borers, bean size, cup quality, beans zinc concentration, potassium leaching, electrical conductivity, color index, total tritable acidity, pH, chlorogenic acids contents and ferric-reducing antioxidant activity of beans were evaluated. Zinc positively affected quality of coffee beans, which presented lower percentage of medium and small beans, lower berry borer incidence, lower potassium leaching and electrical conductivity, higher contents of zinc and chlorogenic acids and higher antioxidant activity in comparison with control beans.

  3. Methylxanthine and catechin content of fresh and fermented cocoa beans, dried cocoa beans, and cocoa liquor

    Directory of Open Access Journals (Sweden)

    Pedro P. Peláez


    Full Text Available The theobromine and catechin content can affect the quality of cocoa liquor and is influenced by cacao variety, production area (PA, and fermentation, as well as the method of drying beans (FDB and cocoa liquor production (CLP. This study examined variationsin methylxanthine and catechin levels in fresh and fermented cocoa beans, dried cocoa grains, and in cocoa liquor from Trinitario, Criollo, and Forastero cacao varieties. A total of 123 cocoa bean samples from three Peruvian PAs at different altitudes, Tingo María (TM, San Alejandro (SA, and Curimana (CU, were evaluated. The theobromine (Tb and caffeine (Cf contents in fresh cocoa beans were affected by both cocoa type and PA. The caffeine content was higher in Trinitario cacao than in Criollo and Forastero varieties (p ≤ 0.05. The Tb and CF contents decreased in dry cocoa grain and was affected by FDB (p ≤ 0.05 (1.449 ± 0.004 to 1.140 ± 0.010 and 0.410 ± 0.03 to 0.165 ± 0.02 g Tb and C, respectively, per 100 g dry weight. Cocoa beans from Tingo María, which has thehighest altitude, had higher Tb and CF contents than those from other PAs. The catechin (C and epicatechin (EC contents were affected by the FDB and CLP, and were highestin fresh cocoa beans from the Tingo María area (range: 0.065 ± 0.01 to 0.020 ± 0.00 g C/100 g. The C and EC contents decreased during FDB and CLP (0.001 g C/100 g of cocoa liquor. Taken together, these results show that higher concentrations of Tb, Cf, C,and EC are present in fresh cocoa beans. Moreover, the cocoa variety influenced cocoa liquor quality. Overall, cocoa from the Tingo María PA had the most desirable chemical composition.

  4. Protein (Viridiplantae): 761564 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available :27 3977:222 ... 235629:222 ... 235880:222 ... 3987:222 ... 3988:222 ... triptychon and cpc, putative Ricinus communis MADFDHSSSNDISVNSTEDISQDSKLDFSEDEETLITRMFNLVGERWSLIAGRIPGRTAEEIEKYWTSRYSTSQ

  5. Protein (Viridiplantae): 761566 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available :27 3977:222 ... 235629:222 ... 235880:222 ... 3987:222 ... 3988:222 ... triptychon and cpc, putative Ricinus communis MDRRRRKQAKITIVESEEVSSIEWEYINMNQQEEDLIYRMYRLVGERWDLIAGRIPGRKAEEIERFWIMRHRKVF

  6. Protein (Viridiplantae): 761565 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available :27 3977:222 ... 235629:222 ... 235880:222 ... 3987:222 ... 3988:222 ... triptychon and cpc, putative Ricinus communis MADSEHSTSDETYMDSQEERNQESKIEFSEDEEALVIRMYNLVGERWSLIAGRIPGRTAEDIEKYWNSRYSTSE

  7. Protein (Viridiplantae): 761563 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available :27 3977:222 ... 235629:222 ... 235880:222 ... 3987:222 ... 3988:222 ... triptychon and cpc, putative Ricinus communis MGDLDHTSNDTDQDTQDVKGDQDYSRPDFSEDEENLIARMFSLVGERWSLIAGRIPGRTAEEIEKYWATKDSSSNEG

  8. Climate of origin affects tick (Ixodes ricinus) host-seeking behavior in response to temperature: implications for resilience to climate change? (United States)

    Gilbert, Lucy; Aungier, Jennifer; Tomkins, Joseph L


    Climate warming is changing distributions and phenologies of many organisms and may also impact on vectors of disease-causing pathogens. In Europe, the tick Ixodes ricinus is the primary vector of medically important pathogens (e.g., Borrelia burgdorferi sensu lato, the causative agent of Lyme borreliosis). How might climate change affect I. ricinus host-seeking behavior (questing)? We hypothesize that, in order to maximize survival, I. ricinus have adapted their questing in response to temperature in accordance with local climates. We predicted that ticks from cooler climates quest at cooler temperatures than those from warmer climates. This would suggest that I. ricinus can adapt and therefore have the potential to be resilient to climate change. I. ricinus were collected from a cline of climates using a latitudinal gradient (northeast Scotland, North Wales, South England, and central France). Under laboratory conditions, ticks were subjected to temperature increases of 1°C per day, from 6 to 15°C. The proportion of ticks questing was recorded five times per temperature (i.e., per day). The theoretical potential to quest was then estimated for each population over the year for future climate change projections. As predicted, more ticks from cooler climates quested at lower temperatures than did ticks from warmer climates. The proportion of ticks questing was strongly associated with key climate parameters from each location. Our projections, based on temperature alone, suggested that populations could advance their activity season by a month under climate change, which has implications for exposure periods of hosts to tick-borne pathogens. Our findings suggest that I. ricinus have adapted their behavior in response to climate, implying some potential to adapt to climate change. Predictive models of I. ricinus dynamics and disease risk over continental scales would benefit from knowledge of these differences between populations.

  9. Dynamic transcriptome profiling of Bean Common Mosaic Virus (BCMV) infection in Common Bean (Phaseolus vulgaris L.). (United States)

    Martin, Kathleen; Singh, Jugpreet; Hill, John H; Whitham, Steven A; Cannon, Steven B


    Bean common mosaic virus (BCMV) is widespread, with Phaseolus species as the primary host plants. Numerous BCMV strains have been identified on the basis of a panel of bean varieties that distinguish the pathogenicity types with respect to the viral strains. The molecular responses in Phaseolus to BCMV infection have not yet been well characterized. We report the transcriptional responses of a widely susceptible variety of common bean (Phaseolus vulgaris L., cultivar 'Stringless green refugee') to two BCMV strains, in a time-course experiment. We also report the genome sequence of a previously unreported BCMV strain. The interaction with the known strain NL1-Iowa causes moderate symptoms and large transcriptional responses, and the newly identified strain (Strain 2 or S2) causes severe symptoms and moderate transcriptional responses. The transcriptional profiles of host plants infected with the two isolates are distinct, and involve numerous differences in splice forms in particular genes, and pathway specific expression patterns. We identified differential host transcriptome response after infection of two different strains of Bean common mosaic virus (BCMV) in common bean (Phaseolus vulgaris L.). Virus infection initiated a suite of changes in gene expression level and patterns in the host plants. Pathways related to defense, gene regulation, metabolic processes, photosynthesis were specifically altered after virus infection. Results presented in this study can increase the understanding of host-pathogen interactions and provide resources for further investigations of the biological mechanisms in BCMV infection and defense.

  10. Safety assessment of the biogenic amines in fermented soya beans and fermented bean curd. (United States)

    Yang, Juan; Ding, Xiaowen; Qin, Yingrui; Zeng, Yitao


    To evaluate the safety of biogenic amines, high performance liquid chromatography (HPLC) was used to evaluate the levels of biogenic amines in fermented soya beans and fermented bean curd. In fermented soya beans, the total biogenic amines content was in a relatively safe range in many samples, although the concentration of histamine, tyramine, and β-phenethylamine was high enough in some samples to cause a possible safety threat, and 8 of the 30 samples were deemed unsafe. In fermented bean curd, the total biogenic amines content was more than 900 mg/kg in 19 white sufu amples, a level that has been determined to pose a safety hazard; putrescine was the only one detected in all samples and also had the highest concentration, which made samples a safety hazard; the content of tryptamine, β-phenethylamine, tyramine, and histamine had reached the level of threat to human health in some white and green sufu samples, and that may imply another potential safety risk; and 25 of the 33 samples were unsafe. In conclusion, the content of biogenic amines in all fermented soya bean products should be studied and appropriate limits determined to ensure the safety of eating these foods.

  11. Dynamics of Cocoa Bean Pulp Degradation during Cocoa Bean Fermentation: Effects of Yeast Starter Culture Addition

    Directory of Open Access Journals (Sweden)

    Laras Cempaka


    Full Text Available Fermentation is a crucial step in the post-harvest processing of cocoa beans. This process comprises mixed culture microbial activities on the cocoa bean pulp, producing metabolites that act as important precursors for cocoa flavour development. Variations in the microbial population dynamics during the fermentation process may induce changes in the overall process. Thus, the introduction of a specific microbial starter culture may improve the quality of the fermentation. This article discusses the effects ofthe addition of Saccharomyces cerevisae var. Chevalieri starter culture on cocoa bean fermentation. The dynamics in the yeast concentration, sugary pulp compounds and metabolic products were measured during fermentation. The alterations in the dynamic metabolite profile were significant, although only a slight difference was observed in the yeast population. A higher fermentation index was measured for the cocoa bean fermentation with yeast starter culture, 1.13 compared to 0.84. In conclusion, this method can potentially be applied to shorten the cocoa bean fermentation time.

  12. Occurrence of Babesia spp., Rickettsia spp. and Bartonella spp. in Ixodes ricinus in Bavarian public parks, Germany

    Directory of Open Access Journals (Sweden)

    Mahling Monia


    Full Text Available Abstract Background Only limited information is available about the occurrence of ticks and tick-borne pathogens in public parks, which are areas strongly influenced by human beings. For this reason, Ixodes ricinus were collected in public parks of different Bavarian cities in a 2-year survey (2009 and 2010 and screened for DNA of Babesia spp., Rickettsia spp. and Bartonella spp. by PCR. Species identification was performed by sequence analysis and alignment with existing sequences in GenBank. Additionally, coinfections with Anaplasma phagocytophilum were investigated. Results The following prevalences were detected: Babesia spp.: 0.4% (n = 17, including one pool of two larvae in 2009 and 0.5 to 0.7% (n = 11, including one pool of five larvae in 2010; Rickettsia spp.: 6.4 to 7.7% (n = 285, including 16 pools of 76 larvae in 2009. DNA of Bartonella spp. in I. ricinus in Bavarian public parks could not be identified. Sequence analysis revealed the following species: Babesia sp. EU1 (n = 25, B. divergens (n = 1, B. divergens/capreoli (n = 1, B. gibsoni-like (n = 1, R. helvetica (n = 272, R. monacensis IrR/Munich (n = 12 and unspecified R. monacensis (n = 1. The majority of coinfections were R. helvetica with A. phagocytophilum (n = 27, but coinfections between Babesia spp. and A. phagocytophilum, or Babesia spp. and R. helvetica were also detected. Conclusions I. ricinus ticks in urban areas of Germany harbor several tick-borne pathogens and coinfections were also observed. Public parks are of particularly great interest regarding the epidemiology of tick-borne pathogens, because of differences in both the prevalence of pathogens in ticks as well as a varying species arrangement when compared to woodland areas. The record of DNA of a Babesia gibsoni-like pathogen detected in I. ricinus suggests that I. ricinus may harbor and transmit more Babesia spp. than previously known. Because of their high recreational value for human beings, urban green

  13. Occurrence of Babesia spp., Rickettsia spp. and Bartonella spp. in Ixodes ricinus in Bavarian public parks, Germany. (United States)

    Schorn, Sabine; Pfister, Kurt; Reulen, Holger; Mahling, Monia; Silaghi, Cornelia


    Only limited information is available about the occurrence of ticks and tick-borne pathogens in public parks, which are areas strongly influenced by human beings. For this reason, Ixodes ricinus were collected in public parks of different Bavarian cities in a 2-year survey (2009 and 2010) and screened for DNA of Babesia spp., Rickettsia spp. and Bartonella spp. by PCR. Species identification was performed by sequence analysis and alignment with existing sequences in GenBank. Additionally, coinfections with Anaplasma phagocytophilum were investigated. The following prevalences were detected: Babesia spp.: 0.4% (n = 17, including one pool of two larvae) in 2009 and 0.5 to 0.7% (n = 11, including one pool of five larvae) in 2010; Rickettsia spp.: 6.4 to 7.7% (n = 285, including 16 pools of 76 larvae) in 2009. DNA of Bartonella spp. in I. ricinus in Bavarian public parks could not be identified. Sequence analysis revealed the following species: Babesia sp. EU1 (n = 25), B. divergens (n = 1), B. divergens/capreoli (n = 1), B. gibsoni-like (n = 1), R. helvetica (n = 272), R. monacensis IrR/Munich (n = 12) and unspecified R. monacensis (n = 1). The majority of coinfections were R. helvetica with A. phagocytophilum (n = 27), but coinfections between Babesia spp. and A. phagocytophilum, or Babesia spp. and R. helvetica were also detected. I. ricinus ticks in urban areas of Germany harbor several tick-borne pathogens and coinfections were also observed. Public parks are of particularly great interest regarding the epidemiology of tick-borne pathogens, because of differences in both the prevalence of pathogens in ticks as well as a varying species arrangement when compared to woodland areas. The record of DNA of a Babesia gibsoni-like pathogen detected in I. ricinus suggests that I. ricinus may harbor and transmit more Babesia spp. than previously known. Because of their high recreational value for human beings, urban green areas are likely to remain in the research focus on

  14. Puffing, a novel coffee bean processing technique for the enhancement of extract yield and antioxidant capacity. (United States)

    Kim, Wooki; Kim, Sang-Youn; Kim, Dae-Ok; Kim, Byung-Yong; Baik, Moo-Yeol


    Puffing of coffee beans, which induces heat- and pressure-derived physicochemical changes, was applied as an alternative to roasting. Roasted or puffed coffee beans with equivalent lightness values were compared. The moisture content was higher while the crude fat and protein compositions were lower in puffed beans than in roasted beans. The pH was lower and the acid content was higher in puffed beans than in roasted beans. The roasted beans exhibited greater specific volumes, while the puffed beans displayed greater extraction yields. The trigonelline and total phenolic contents were greater in puffed beans than in roasted beans resulting in an enhanced antioxidant capacity. Sensory evaluation of roasted and puffed coffee bean brews revealed that puffing did not affect the flavor or overall acceptance. The current study provides evidence that puffing is an alternative to roasting coffee beans with various benefits. Copyright © 2017 Elsevier Ltd. All rights reserved.

  15. Ion beam analysis of ground coffee and roasted coffee beans

    Energy Technology Data Exchange (ETDEWEB)

    Debastiani, R., E-mail:; Santos, C.E.I. dos; Yoneama, M.L.; Amaral, L.; Dias, J.F.


    The way that coffee is prepared (using roasted ground coffee or roasted coffee beans) may influence the quality of beverage. Therefore, the aim of this work is to use ion beam techniques to perform a full elemental analysis of packed roasted ground coffee and packed roasted coffee beans, as well as green coffee beans. The samples were analyzed by PIXE (particle-induced X-ray emission). Light elements were measured through RBS (Rutherford backscattering spectrometry) experiments. Micro-PIXE experiments were carried out in order to check the elemental distribution in the roasted and green coffee beans. In general, the elements found in ground coffee were Mg, P, S, Cl, K, Ca, Ti, Mn, Fe, Cu, Zn, Rb and Sr. A comparison between ground coffee and grinded roasted beans shows significant differences for several elements. Elemental maps reveal that P and K are correlated and practically homogeneously distributed over the beans.

  16. Antioxidant activity of black bean (Phaseolus vulgaris L. protein hydrolysates

    Directory of Open Access Journals (Sweden)

    Jarine Amaral do EVANGELHO


    Full Text Available Abstract The objective of this work was to study the effect of enzymatic hydrolysis of black bean protein concentrate using different enzymes. Bean proteins were extracted and hydrolyzed over a period of 120 min using the enzymes pepsin or alcalase. The protein hydrolysates’ molecular weight was assayed by electrophoresis and the antioxidant activity was evaluated by the capturing methods of free radicals ABTS●+ and DPPH. Electrophoretic results showed that the bands above 50 kDa disappeared, when the beans protein was subjected to hydrolysis with pepsin. The bean protein hydrolysate obtained by hydrolysis with alcalase enzyme, showed higher antioxidant activity for inhibition of the radical ABTS●+. However, the hydrolysates obtained by hydrolysis with pepsin had higher antioxidant activity for inhibition of the radical DPPH. The use of pepsin and alcalase enzymes, under the same reaction time, produced black bean protein hydrolysates with different molecular weight profiles and superior antioxidant activity than the native bean protein.

  17. Ion beam analysis of ground coffee and roasted coffee beans

    International Nuclear Information System (INIS)

    Debastiani, R.; Santos, C.E.I. dos; Yoneama, M.L.; Amaral, L.; Dias, J.F.


    The way that coffee is prepared (using roasted ground coffee or roasted coffee beans) may influence the quality of beverage. Therefore, the aim of this work is to use ion beam techniques to perform a full elemental analysis of packed roasted ground coffee and packed roasted coffee beans, as well as green coffee beans. The samples were analyzed by PIXE (particle-induced X-ray emission). Light elements were measured through RBS (Rutherford backscattering spectrometry) experiments. Micro-PIXE experiments were carried out in order to check the elemental distribution in the roasted and green coffee beans. In general, the elements found in ground coffee were Mg, P, S, Cl, K, Ca, Ti, Mn, Fe, Cu, Zn, Rb and Sr. A comparison between ground coffee and grinded roasted beans shows significant differences for several elements. Elemental maps reveal that P and K are correlated and practically homogeneously distributed over the beans

  18. Negative effects of temperature and atmospheric depositions on the seed viability of common juniper (Juniperus communis). (United States)

    Gruwez, R; De Frenne, P; De Schrijver, A; Leroux, O; Vangansbeke, P; Verheyen, K


    Environmental change is increasingly impacting ecosystems worldwide. However, our knowledge about the interacting effects of various drivers of global change on sexual reproduction of plants, one of their key mechanisms to cope with change, is limited. This study examines populations of poorly regenerating and threatened common juniper (Juniperus communis) to determine the influence of four drivers of global change (rising temperatures, nitrogen deposition, potentially acidifying deposition and altering precipitation patterns) on two key developmental phases during sexual reproduction, gametogenesis and fertilization (seed phase two, SP2) and embryo development (seed phase three, SP3), and on the ripening time of seeds. In 42 populations throughout the distribution range of common juniper in Europe, 11,943 seeds of two developmental phases were sampled. Seed viability was determined using seed dissection and related to accumulated temperature (expressed as growing degree-days), nitrogen and potentially acidifying deposition (nitrogen plus sulfur), and precipitation data. Precipitation had no influence on the viability of the seeds or on the ripening time. Increasing temperatures had a negative impact on the viability of SP2 and SP3 seeds and decreased the ripening time. Potentially acidifying depositions negatively influenced SP3 seed viability, while enhanced nitrogen deposition led to lower ripening times. Higher temperatures and atmospheric deposition affected SP3 seeds more than SP2 seeds. However, this is possibly a delayed effect as juniper seeds develop practically independently, due to the absence of vascular communication with the parent plant from shortly after fertilization. It is proposed that the failure of natural regeneration in many European juniper populations might be attributed to climate warming as well as enhanced atmospheric deposition of nitrogen and sulfur.

  19. Antibacterial Effect of Myrtus Communis Hydro-Alcoholic Extract on Pathogenic Bacteria

    Directory of Open Access Journals (Sweden)

    Ali Taheri


    Full Text Available Background: Today, due to the changes in the form of the resistance of pathogenic bacteria, discovering new antimicrobial drugs is under study. So, the aim of this study is to evaluate the antimicrobial properties of the extract of the myrtle herb on some of pathogenic bacteria. Materials and Methods: Hydroalcoholic extract of the leaves of myrtle herb was evaluated at 4 concentrations including 10-80 mg/ml on four strains of pathogenic bacteria using penetrative dissemination method together with the measuring diameter of the growth inhibition zone; then the results were compared to four conventional antibiotics. The minimum inhibitory and bactericidal concentrations were studied using macro dilution method. Results: Treatment by the concentration of 80 mg/ml extract of this herb showed the greatest effect on the bacterium Staphylococcus aureus and Vibrio cholera serotype Ogawa which had a significant difference with all other treatments and standard antibiotics (p> 0.05. The extract showed no effect on the bacterium Pseudomonas aeruginosa and just concentration of 80 mg/ml showed a little effect on E. coli and other antibiotics had no significant effect except tetracycline which has little effect on this strain. Minimum inhibitory concentration was 0.2 mg/ml for bacterium Staphylococcus aureus (S. aureus and the maximum for E.coli by 8 mg/ml.Conclusion: This study showed that under study bacteria were more resistant to the antibiotics and the extract of Myrtus communis leaves showed greatest antibacterial effect against S. aureus and V. cholerae cerotype Ogawa.

  20. Effect of copper tolerant Elsholtzia splendens on bacterial community associated with Commelina communis on a copper mine spoil. (United States)

    Yang, Ruyi; Guo, Fuyu; Li, Jing; Su, Nannan; Shao, Zongyuan; Zan, Shuting


    Facilitation, or positive plant-plant interaction, has received increasing concern from ecologists over the last two decades. Facilitation may occur through direct mitigation of severe environments or indirect mediation by a third participant from the same or different trophic levels. The copper (Cu) tolerant species Elsholtzia splendens facilitates the establishment and growth of co-occurring Commelina communis through indirect enrichment of microbial activity. However, whether and how E. splendens impacts the microbial community that is associated with C. communis is less known. We characterized the soil bacterial community in the rhizosphere of C. communis in the absence and presence of E. splendens using PCR-DGGE (polymerase chain reaction-denaturing gradient gel electrophoresis) and sequencing. The result showed that the richness of the bacterial community increased, but diversity and evenness remained similar, in the presence of E. splendens. Chloroflexi, Acidobacteria and Proteobacteria were the most dominant bacteria. The relative abundance of dominant and minor bacterial groups showed distinctly different responses to E. splendens. Principal component analysis and redundancy analysis indicated that variation of the bacterial community was determined by multiple factors and might be driven by the tested soil parameters collectively, or alternatively changed through plant root exudates or other microorganisms. Our results enhance the understanding of how the bacterial community associated with a beneficiary plant responds to a benefactor plant and suggests that the changes of bacterial community composition may have far-reaching influence on plant-soil feedback and the aboveground plant community in the long run. Copyright © 2016. Published by Elsevier B.V.

  1. The Effect of Myrtus communis Extract on Liver Enzymes and Blood Biochemical Factors in Diabetic Adult Male Rats

    Directory of Open Access Journals (Sweden)

    Habiballah Johari


    Full Text Available Background: The aim of this study was the effect of Myrtus communis extract on liver enzymes and blood biochemical factors in diabetic adult male rats. Materials and Methods: This study has been carried out experimentally and completely random. Seventy adult male Wistar rats were divided in 7 groups including: control which received no treatment, sham who received 2 mL of distilled water, the 1st, 2nd and 3rd experimental groups which received 0.75, 1.5 and 3 mg/kg Myrtus communis leaf extract respectively, the 4th experimental group as the diabetic control group who received streptozotocin (60 mg/kg and the 5th experimental group as the diabetic treatment group who received 3 mg/kg of extract. This experiment lasted 14 days with prescript orally. After this period, all the rats, were weighted, anesthetized and blood samples were taken from the heart centrifuged and sera were evaluated for the concentration of various factors. In addition liver were removed and sliced. Results: According to the obtained results, the plasma concentration of liver enzyme (alanine aminotransferase, alkaline phosphatase, aspartate aminotransferase, cholesterol and glucose presented a significant decrease at (p≤0.05. Whereas no significant change were seen in body weight, triglyceride, urea, albumin and total protein. Histological studies of the liver tissue showed no significant difference among various groups. Conclusion: Myrtus communis is comprise of collections of flavonoids and other various components with antioxidant and anti inflammatory properties. Thence it can effective in treatment of liver diseases and decrease of blood sugar and cholesterol in diabetes mellitus patients.

  2. Bean grain hysteresis with induced mechanical damage

    Directory of Open Access Journals (Sweden)

    Renata C. Campos

    Full Text Available ABSTRACT This study aimed to evaluate the effect of mechanical damage on the hysteresis of beans with induced mechanical damage under different conditions of temperature and relative humidity. Beans (Phaseolus vulgaris L. harvested manually with 35% water content (w.b. were used. Part of this product was subjected to induced mechanical damage by Stein Breakage Tester and controlled drying (damaged and control sample, for sorption processes. The sorption isotherms of water were analyzed for different temperature conditions: 20, 30, 40 and 50 oC; and relative humidity: 0.3; 0.4; 0.5; 0.7 and 0.9 (decimal. Equilibrium moisture content data were correlated with six mathematical models, and the Modified Oswin model was the one that best fitted to the experimental data. According to the above mentioned isotherms, it was possible to observe the phenomenon of hysteresis of damaged and control samples, and this phenomenon was more pronounced in control ones.

  3. Chemical and Sensorial Evaluation of a Newly Developed Bean Jam


    Guiné, Raquel; Figueiredo, Ana; Correia, Paula; Gonçalves, Fernando


    The purpose of the present work was to develop an innovative food product with nutritional properties as well as appealing organoleptic qualities. The product, a jam, was prepared with the beans’ cooking water combined with fresh apple or carrot, without the addition of any conservatives. Three different jams were produced: bean and carrot, bean and apple and bean, apple and cinnamon. The developed products underwent a sensorial...

  4. Changes in the geographical distribution and abundance of the tick Ixodes ricinus during the past 30 years in Sweden

    Directory of Open Access Journals (Sweden)

    Jaenson Thomas GT


    Full Text Available Abstract Background Ixodes ricinus is the main vector in Europe of human-pathogenic Lyme borreliosis (LB spirochaetes, the tick-borne encephalitis virus (TBEV and other pathogens of humans and domesticated mammals. The results of a previous 1994 questionnaire, directed at people living in Central and North Sweden (Svealand and Norrland and aiming to gather information about tick exposure for humans and domestic animals, suggested that Ixodes ricinus ticks had become more widespread in Central Sweden and the southern part of North Sweden from the early 1980s to the early 1990s. To investigate whether the expansion of the tick's northern geographical range and the increasing abundance of ticks in Sweden were still occurring, in 2009 we performed a follow-up survey 16 years after the initial study. Methods A questionnaire similar to the one used in the 1994 study was published in Swedish magazines aimed at dog owners, home owners, and hunters. The questionnaire was published together with a popular science article about the tick's biology and role as a pathogen vector in Sweden. The magazines were selected to get information from people familiar with ticks and who spend time in areas where ticks might be present. Results Analyses of data from both surveys revealed that during the near 30-year period from the early 1980s to 2008, I. ricinus has expanded its distribution range northwards. In the early 1990s ticks were found in new areas along the northern coastline of the Baltic Sea, while in the 2009 study, ticks were reported for the first time from many locations in North Sweden. This included locations as far north as 66°N and places in the interior part of North Sweden. During this 16-year period the tick's range in Sweden was estimated to have increased by 9.9%. Most of the range expansion occurred in North Sweden (north of 60°N where the tick's coverage area doubled from 12.5% in the early 1990s to 26.8% in 2008. Moreover, according to the

  5. Changes in the geographical distribution and abundance of the tick Ixodes ricinus during the past 30 years in Sweden. (United States)

    Jaenson, Thomas G T; Jaenson, David G E; Eisen, Lars; Petersson, Erik; Lindgren, Elisabet


    Ixodes ricinus is the main vector in Europe of human-pathogenic Lyme borreliosis (LB) spirochaetes, the tick-borne encephalitis virus (TBEV) and other pathogens of humans and domesticated mammals. The results of a previous 1994 questionnaire, directed at people living in Central and North Sweden (Svealand and Norrland) and aiming to gather information about tick exposure for humans and domestic animals, suggested that Ixodes ricinus ticks had become more widespread in Central Sweden and the southern part of North Sweden from the early 1980s to the early 1990s. To investigate whether the expansion of the tick's northern geographical range and the increasing abundance of ticks in Sweden were still occurring, in 2009 we performed a follow-up survey 16 years after the initial study. A questionnaire similar to the one used in the 1994 study was published in Swedish magazines aimed at dog owners, home owners, and hunters. The questionnaire was published together with a popular science article about the tick's biology and role as a pathogen vector in Sweden. The magazines were selected to get information from people familiar with ticks and who spend time in areas where ticks might be present. Analyses of data from both surveys revealed that during the near 30-year period from the early 1980s to 2008, I. ricinus has expanded its distribution range northwards. In the early 1990s ticks were found in new areas along the northern coastline of the Baltic Sea, while in the 2009 study, ticks were reported for the first time from many locations in North Sweden. This included locations as far north as 66°N and places in the interior part of North Sweden. During this 16-year period the tick's range in Sweden was estimated to have increased by 9.9%. Most of the range expansion occurred in North Sweden (north of 60°N) where the tick's coverage area doubled from 12.5% in the early 1990s to 26.8% in 2008. Moreover, according to the respondents, the abundance of ticks had increased

  6. Changes in the geographical distribution and abundance of the tick Ixodes ricinus during the past 30 years in Sweden (United States)


    Background Ixodes ricinus is the main vector in Europe of human-pathogenic Lyme borreliosis (LB) spirochaetes, the tick-borne encephalitis virus (TBEV) and other pathogens of humans and domesticated mammals. The results of a previous 1994 questionnaire, directed at people living in Central and North Sweden (Svealand and Norrland) and aiming to gather information about tick exposure for humans and domestic animals, suggested that Ixodes ricinus ticks had become more widespread in Central Sweden and the southern part of North Sweden from the early 1980s to the early 1990s. To investigate whether the expansion of the tick's northern geographical range and the increasing abundance of ticks in Sweden were still occurring, in 2009 we performed a follow-up survey 16 years after the initial study. Methods A questionnaire similar to the one used in the 1994 study was published in Swedish magazines aimed at dog owners, home owners, and hunters. The questionnaire was published together with a popular science article about the tick's biology and role as a pathogen vector in Sweden. The magazines were selected to get information from people familiar with ticks and who spend time in areas where ticks might be present. Results Analyses of data from both surveys revealed that during the near 30-year period from the early 1980s to 2008, I. ricinus has expanded its distribution range northwards. In the early 1990s ticks were found in new areas along the northern coastline of the Baltic Sea, while in the 2009 study, ticks were reported for the first time from many locations in North Sweden. This included locations as far north as 66°N and places in the interior part of North Sweden. During this 16-year period the tick's range in Sweden was estimated to have increased by 9.9%. Most of the range expansion occurred in North Sweden (north of 60°N) where the tick's coverage area doubled from 12.5% in the early 1990s to 26.8% in 2008. Moreover, according to the respondents, the abundance

  7. Subunit heterogeneity in the lima bean lectin. (United States)

    Roberts, D D; Etzler, M E; Goldstein, I J


    Three forms of lectin (components I, II, and III) from lima beans (Phaseolus lunatus) have been purified on an affinity support containing the synthetic type A blood group trisaccharide alpha-D-GalNAc-(1 leads to 3)-[alpha-L-Fuc-(1 leads to 2)]-beta-D-Gal-(1 leads to). Conversion of components I and II to component III has been achieved by reduction in 10(-2) M dithiothreitol. Isoelectric focusing of lima bean lectin in the presence of 8 M urea and beta-mercaptoethanol revealed charge heterogeneity of the lectin subunits. Three major subunit classes of apparent pI 7.05, 6.65, and 6.45, designated alpha, beta, and alpha', respectively, were identified; they occur in a relative abundance of 2:5:3. Green lima beans harvested before maturity lacked the alpha' subunit (pI 6.45) which appears to accumulate during seed maturation. The three subunits are glycoproteins of identical size and immunochemical reactivity. Identical NH2-terminal sequences were found for the three subunits. Amino acid analysis and tryptic peptide mapping indicated that the observed charge heterogeneity is probably due to differences in the primary structure of the subunits. Studies of subunit composition of charge isolectins provided evidence of nonrandom subunit assembly. A model is proposed involving pairing of a pI 6.65 subunit with either a pI 7.06 or 6.45 subunit to form dimeric units. Possible roles for subunit heterogeneity and ordered subunit assembly in determining the metal and sugar binding properties of lima bean lectin are discussed.

  8. First report of Neofabraea kienholzii causing bull’s eye rot on pear (Pyrus communis) in the Netherlands


    Wenneker, M.; Pham, K.T.K.; Boekhoudt, L.C.; Boer, de, F.A.; Leeuwen, van, P.J.; Hollinger, T.C.; Thomma, B.P.H.J.


    Pear (Pyrus communis L.) is an important fruit crop in the Netherlands, with a total production of 349,000 tons in 2014, and ‘Conference’ is the main cultivar. In the Netherlands, pears are kept in controlled atmosphere cold storage up to 11 months after harvest. Symptoms of bull’s eye rot were observed in 2015 on ‘Conference’ pears in storage in the Netherlands. Bull’s eye lesions on apple and pear fruits are generally caused by four Neofabraea species: N. alba Jacks, N. malicorticis Guthrie...

  9. Evaluation of the Antimicrobial Properties of the Essential Oil of Myrtus communis L. against Clinical Strains of Mycobacterium spp.

    Directory of Open Access Journals (Sweden)

    Stefania Zanetti


    Full Text Available Mycobacterium tuberculosis is the etiological agent of tuberculosis. The World Health Organization has estimated that 8 million of people develop active TB every year and the situation is complicated by an increase of Mycobacterium tuberculosis strains resistant to drugs used in antitubercular therapy: MDR and XDR-TB. Myrtle leaf extracts, used as an antiseptic in Sardinian traditional medicine, have strong antibacterial activity as several investigations showed. In this study we investigated the antimicrobial properties of the essential oil of Myrtus communis against clinical strains of M. tuberculosis and M. paratuberculosis.

  10. The Antimicrobial Effect of Methanolic Extracts of Achillea wilhelmsii, Myrtus communis, and Allium sativum on Pseudomonas aeruginosa

    Directory of Open Access Journals (Sweden)

    Mehdi Rostami Rad


      In this study, the effect of Achillea Wilhelmsii, Myrtus communis, and Allium sativum extracts, was investigated on 4 strains of Pseudomonas aeruginosa, and the effect of each extract, was studied using agar dilution method.   Among these three extracts, the Allium sativum  extract showed the highest antimicrobial activity. Also, observations were indicative of difference in the susceptibility of the studied strains to different extracts, which showed different reactions to each of the extracts based on the origin and antibiotic resistance level.   According to the results of this study, extracts are a natural and valuable sources to produce antimicrobial drugs against pseudomonas strains and other resistant pathogenic bacteria.    

  11. Identification of host blood-meal sources and Borrelia in field-collected Ixodes ricinus ticks in north-western Poland. (United States)

    Wodecka, Beata; Skotarczak, Bogumila


    Forest animals play fundamental roles in the maintenance of Ixodes ricinus and Borrelia species in the forest biotope. To identify the forest vertebrate species that are host for I. ricinus and for the recognition of the reservoirs of Borrelia species, the blood-meal of 325 I. ricinus ticks collected at two forest sites in north-western Poland were analysed. Nested PCR was used to detect polymorphisms in a fragment of the mitochondrial 12S rRNA gene for the identification of the hosts species. The products were digested with the restriction enzymes, a combination that allows the identification of 60 vertebrate species, comprising 17 bird, 4 reptile and 39 mammalian species. Host DNA was detected in 244 (75%) I. ricinus individuals, with the species being detected and classified for 210 (86%) samples. The restriction patterns resulted in the identification of 14 vertebrate species, including 2 species of birds, lizard, badger, rabbit, deer; most of the samples contained DNA from wild boar (Sus scrofa), red fox (Vulpes vulpes), red deer (Cervus elaphus) and roe deer (Capreolus capreolus). Identification of Borrelia species was based on the flaB gene using nested PCR coupled to RFLP. This method allows the identification of all Borrelia species transmitted by I. ricinus in Europe, including B. miyamotoi and 3 genetic variants of B. garinii. In the studied isolates, 2 species belonging to B. burgdorferi sensu lato were identified--B. garinii and B. afzelii, and B. miyamotoi, which are related to relapsing fever borreliae.

  12. Prevention of adhesion formation in Wistar-albino rats by increased bowel movements achieved with oral Ricinus oil use for 8 days postoperatively: an experimental study. (United States)

    Kahyaoglu, Serkan; Timur, Hakan; Kaba, Metin; Kahyaoglu, Inci; Sirvan, Levent; Cicek, Mahmut Nedim


    Adhesion formation frequently occurs after abdominopelvic surgery and can cause significant morbidity for patients. Meticulous hemostasis, minimal access surgery and utilization of surgical adjuvants intraoperatively are clinically useful measures to minimize adhesion formation. We investigated the clinical efficiency of oral Ricinus oil treatment for 8 days postoperatively to decrease adhesion formation in this case-control study in a rat model. Following computer-generated randomization, 24 female Wistar-albino rats were operated on, with 10 standard cautery lesions on the right uterine horn and two simple suture lesions on left uterine horn generated with absorbable material. Half (n=12) the rats received 0.13 g (0.2 ml) Ricinus oil emulsion (40 g/60 ml) via the oral route during the first 8 days postoperatively, and the remaining rats (n=11) were considered as controls. The extent, severity, degree, total adhesion scores and histopathological features of the adhesions were the main outcome measures. The degree and total adhesion formation scores in the Ricinus oil group and control group revealed significant differences in adhesion extent and severity. The total adhesion scores of the Ricinus oil and control groups were 3.00 ± 2.21 and 5.18 ± 2.78 respectively (P0.05). Ricinus oil treatment following abdominopelvic surgery for the 8-day period that covers the completion of tissue healing process may be a promising, cheap and cost-effective treatment strategy for patients. Copyright © 2012 Elsevier Ireland Ltd. All rights reserved.

  13. First evidence of [i]Babesia venatorum[/i] and [i]Babesia capreoli[/i] in questing Ixodes ricinus ticks in the Czech Republic

    Directory of Open Access Journals (Sweden)

    Kristyna Venclikova


    Full Text Available Introduction and objective. [i]Ixodes ricinus[/i] is the most common tick species occurring in Central Europe and it serves as a principal vector of emerging human pathogens. The aim of this study was to determine the prevalence of [i]Babesia spp[/i]. in host-seeking [i]I. ricinus[/i] in urban and natural habitats. Materials and methods. PCR was applied on samples to assess prevalence of [i]Babesia spp.[/i] in questing ixodid ticks. Sequencing was used for [i]Babesia[/i] species determination. Results. 1,473 [i]I. ricinus[/i] ticks (1,294 nymphs, 99 males and 80 females were examined for the presence of [i]Babesia spp[/i]. at the two study sites. Minimum infection rate for [i]Babesia[/i] spp. was found to be 0.5% (infected I. ricinus nymphs were only detected in the natural ecosystem. Two[i] Babesia[/i] species were identified by sequencing: [i]B. venatorum[/i] (formerly called[i] Babesia[/i] sp. EU1 and [i]B. capreoli. [/i] Conclusions. The results obtained represent the first evidence of the occurrence of [i]B. venatorum[/i] and [i]B. capreoli[/i] in host-seeking[i] I. ricinus[/i] ticks in the Czech Republic.

  14. Pb-210 in beans grown in normal background environments

    Energy Technology Data Exchange (ETDEWEB)

    Mingote, Raquel M.; Nogueira, Regina A., E-mail:, E-mail: [Centro Regional de Ciencias Nucleares do Centro-Oeste (CRCN-CO/CNEN-GO), Abadia de Goias, GO (Brazil)


    A survey was carried out on the activity concentration of {sup 210}Pb in common beans (Phaseolus vulgaris L.) grown in normal background environments in Brazil. The Carioca beans and the black type were analyzed, which contribute with 90% of the Brazilian market share of the common beans. To this study 18 bean samples sowing in the Middle-Western and Southern regions of Brazil during the years 2010-2011 were analyzed. The proportion per bean type was similar to the national production: most of the Carioca beans (n=13; 72%) and black beans (n=5; 28%). Other 17 values of {sup 210}Pb activity concentration in beans grown in Southeastern region available in the GEORAD, a dataset of radioactivity in Brazil, were added to the statistic analysis of the data. Considering the information contained in censored observations (60%), representative value of {sup 210}Pb activity concentration in beans was estimated by using robust ROS, a censored data analysis method. The value 0.047 Bq kg{sup -1} fresh wt. obtained here is according to {sup 210}Pb activity concentration in grains reported by UNSCEAR 0.05 Bq kg{sup -1}. (author)

  15. Effect of partial replacement of fishmeal with african yam bean ...

    African Journals Online (AJOL)

    Effect of partial replacement of fishmeal with african yam bean ( Sphenostylis stenocarpa ) meal on eggs, sperm quality and spawning performance of African Catfish Clarias gariepinus (Burchell, 1822) broodstock.

  16. Elemental characterization of Brazilian beans using neutron activation analysis

    International Nuclear Information System (INIS)

    Lilian Seiko Kato; Nadai Fernandes, E.A. De; Marcio Arruda Bacchi; Gabriel Adrian Sarries; Andres Enrique Lai Reyes


    Beans are important for many developing countries as a source of protein and mineral nutrients. Here, ten commercial types of Brazilian beans, from the species Phaseolus vulgaris (common beans) and Vigna unguiculata (cowpeas), were analyzed by neutron activation analysis for the determination of Br, Ca, Co, Cs, Fe, K, Mo, Na, Rb, Sc and Zn. There were statistical differences (p/0.05) amongst the commercial types, except for Br, Rb and Sc. In general, non-essential elements showed high variability, indicating that the origin of beans had a strong influence on the mass fraction of such elements. (author)

  17. The Effective Design of Bean Bag as a Vibroimpact Damper

    Directory of Open Access Journals (Sweden)

    A.Q. Liu


    Full Text Available The technique of a bean bag damper has been effectively applied in many engineering fields to control the vibroimpact of a structural system. In this study, the basic parameters responsible for the design of an effective bean bag: the size of beans, the mass ratio of the bean bag to the structure to which it is attached, the clearance distance and the position of the bag, are studied by both theoretical and experimental analyses. These will provide a better understanding of the performance of the bean bag for optimisation of damper design. It was found that reducing the size of beans would increase the exchange of momentum in the system due to the increase in the effective contact areas. Within the range of mass ratios studied, the damping performance of the damper was found to improve with higher mass ratios. There was an optimum clearance for any specific damper whereby the maximum attenuation could be achieved. The position of the bag with respect to nodes and antipodes of the primary structure determined the magnitude of attenuation attainable. Furthermore, the limitations of bean bags have been identified and a general criteria for the design of a bean bag damper has been formulated based on the study undertaken. It was shown that an appropriately configured bean bag damper was capable of reducing the amplitude of vibration by 80% to 90%.

  18. Pb-210 in beans grown in normal background environments

    International Nuclear Information System (INIS)

    Mingote, Raquel M.; Nogueira, Regina A.


    A survey was carried out on the activity concentration of 210 Pb in common beans (Phaseolus vulgaris L.) grown in normal background environments in Brazil. The Carioca beans and the black type were analyzed, which contribute with 90% of the Brazilian market share of the common beans. To this study 18 bean samples sowing in the Middle-Western and Southern regions of Brazil during the years 2010-2011 were analyzed. The proportion per bean type was similar to the national production: most of the Carioca beans (n=13; 72%) and black beans (n=5; 28%). Other 17 values of 210 Pb activity concentration in beans grown in Southeastern region available in the GEORAD, a dataset of radioactivity in Brazil, were added to the statistic analysis of the data. Considering the information contained in censored observations (60%), representative value of 210 Pb activity concentration in beans was estimated by using robust ROS, a censored data analysis method. The value 0.047 Bq kg -1 fresh wt. obtained here is according to 210 Pb activity concentration in grains reported by UNSCEAR 0.05 Bq kg -1 . (author)

  19. Mung bean proteins and peptides: nutritional, functional and bioactive properties

    Directory of Open Access Journals (Sweden)

    Zhu Yi-Shen


    Full Text Available To date, no extensive literature review exists regarding potential uses of mung bean proteins and peptides. As mung bean has long been widely used as a food source, early studies evaluated mung bean nutritional value against the Food and Agriculture Organization of the United Nations (FAO/the World Health Organization (WHO amino acids dietary recommendations. The comparison demonstrated mung bean to be a good protein source, except for deficiencies in sulphur-containing amino acids, methionine and cysteine. Methionine and cysteine residues have been introduced into the 8S globulin through protein engineering technology. Subsequently, purified mung bean proteins and peptides have facilitated the study of their structural and functional properties. Two main types of extraction methods have been reported for isolation of proteins and peptides from mung bean flours, permitting sequencing of major proteins present in mung bean, including albumins and globulins (notably 8S globulin. However, the sequence for albumin deposited in the UniProt database differs from other sequences reported in the literature. Meanwhile, a limited number of reports have revealed other useful bioactivities for proteins and hydrolysed peptides, including angiotensin-converting enzyme inhibitory activity, anti-fungal activity and trypsin inhibitory activity. Consequently, several mung bean hydrolysed peptides have served as effective food additives to prevent proteolysis during storage. Ultimately, further research will reveal other nutritional, functional and bioactive properties of mung bean for uses in diverse applications.

  20. Molecular detection of tick-borne pathogens in Ixodes ricinus from Moldova collected in 1960. (United States)

    Movila, Alexandru; Toderas, Ion; Uspenskaia, Inga; Conovalov, Jurii


    This study is the first report about the prevalence of tick-borne pathogens, as well as their (co-)infection rates, in the museum-archived I. ricinus female ticks collected in Moldova in 1960. A total of 16.7% (21/126) ticks was mono-infected. Borrelia burgdorferi sensu stricto was revealed as the most abundant species (4.8%) followed by B. garinii (1.6%), B. afzelii (0.8%), B. valaisiana (0.8%), and B. lusitaniae (0.8%). DNA of Rickettsia helvetica (2.4%), R. monacensis (2.4%), Anaplasma phagocytophilum (2.4%), 'Candidatus Neoehrlichia mikurensis' (0.8%), and Babesia microti (0.8%) were also detected, indicating the occurrence of these emerging tick-borne microorganisms in Moldova since 1960 at least. In this study, we detected a co-infection (0.8%; 1/126 tested ticks) between B. microti and R. helvetica. Additional investigations are warranted to further characterize a historical snapshot of the distribution of tick-borne pathogens in Europe. Copyright © 2013 Elsevier GmbH. All rights reserved.