BD+43° 3654 - a blue straggler?
Gvaramadze, V. V.; Bomans, D. J.
2008-07-01
The astrometric data on the runaway star BD+43° 3654 are consistent with the origin of this O4If star in the center of the Cyg OB2 association, while BD+43° 3654 is younger than the association. To reconcile this discrepancy, we suggest that BD+43° 3654 is a blue straggler formed via a close encounter between two tight massive binaries in the core of Cyg OB2. A possible implication of this suggestion is that the very massive (and therefore apparently very young) stars in Cyg OB2 could be blue stragglers as well. We also suggest that the binary-binary encounter producing BD+43° 3654 might be responsible for ejection of two high-velocity stars (the stripped helium cores of massive stars) - the progenitors of the pulsars B2020+28 and B2021+51.
Far ultraviolet spectrophotometry of BD +28 4211
Cook, Timothy A.; Cash, Webster; Green, James C.
1991-01-01
The results are reported of a November 1989 rocket flight which recorded a flux-calibrated spectrum of BD +28 4211 from 912 to 1150 A with 1A resolution. BD +28 4211, an SdO-type star, is commonly used as an ultraviolet calibration source in the IUE wavelength band. The present work extends the useful range of this standard shortward of Lyman-alpha. Since previous experiments show marked disparity, this study can be useful in determining a standard in the 912 to 1216 A band.
Guenther, Jaroslav; The ATLAS collaboration
2016-01-01
The ATLAS Experiment has conducted a search for the rare decays of Bs and Bd into mu+mu-. 25 fb−1 of integrated luminosity of proton-proton collisions collected during LHC Run 1 were studied to provide new results presented in this talk. An upper limit is set on the branching ratio BR(Bd to mu+mu-) < 4.2×10−10 at 95% confidence level. For Bs, ATLAS measurement yields the branching ratio BR(Bs to mu+mu-)=(0.9+1.1−0.8)×10−9. The result is consistent with the Standard Model expectation and other available measurements.
Directory of Open Access Journals (Sweden)
Caitlin R Gabor
Full Text Available Few studies have examined the role hormones play in mediating clinical changes associated with infection by the parasite Batrachochytrium dendrobatidis (Bd. Glucocorticoid (GC hormones such as corticosteroids (CORT regulate homeostasis and likely play a key role in response to infection in amphibians. We explore the relationship between CORT release rates and Bd infection in tadpoles of the common midwife toad, Alytes obstetricians, using a non-invasive water-borne hormone collection method across seven populations. We further examined whether tadpoles of A. muletensis infected with a hypervirulent lineage of Bd, BdGPL, had greater CORT release rates than those infected with a hypovirulent lineage, BdCAPE. Finally, we examined the relationship between righting reflex and CORT release rates in infected metamorphic toads of A. obstetricans. We found an interaction between elevation and Bd infection status confirming that altitude is associated with the overall severity of infection. In tandem, increasing elevation was associated with increasing CORT release rates. Tadpoles infected with the hypervirulent BdGPL had significantly higher CORT release rates than tadpoles infected with BdCAPE showing that more aggressive infections lead to increased CORT release rates. Infected metamorphs with higher CORT levels had an impaired righting reflex, our defined experimental endpoint. These results provide evidence that CORT is associated with an amphibian's vulnerability to Bd infection, and that CORT is also affected by the aggressiveness of infection by Bd. Together these results indicate that CORT is a viable biomarker of amphibian stress.
Astrometric studies of the regions BD + 17 degree 4946, BD -5 degree 3071, and Ross 730-1
International Nuclear Information System (INIS)
Russell, J.; Gatewood, G.
1975-01-01
Positions, proper motions, and absolute parallaxes were found for 46 stars in the regions of BD +17 degree4946, BD -5 degree3071, and Ross 730-1. BD +17 degree4946 showed some evidence of irregular variations in position and magnitude. The residuals for Ross 730-1 were used in a preliminary study to test for an appropriate weighting system; a weak weighting system was indicated. (auth)
Widespread occurrence of bd in French Guiana, South America.
Directory of Open Access Journals (Sweden)
Elodie A Courtois
Full Text Available The amphibian chytrid fungus Batrachochytrium dendrobatidis (Bd is a purported agent of decline and extinction of many amphibian populations worldwide. Its occurrence remains poorly documented in many tropical regions, including the Guiana Shield, despite the area's high amphibian diversity. We conducted a comprehensive assessment of Bd in French Guiana in order to (1 determine its geographical distribution, (2 test variation of Bd prevalence among species in French Guiana and compare it to earlier reported values in other South American anuran species (http://www.bd-maps.net; 123 species from 15 genera to define sentinel species for future work, (3 track changes in prevalence through time and (4 determine if Bd presence had a negative effect on one selected species. We tested the presence of Bd in 14 species at 11 sites for a total of 1053 samples (306 in 2009 and 747 in 2012. At least one Bd-positive individual was found at eight out of 11 sites, suggesting a wide distribution of Bd in French Guiana. The pathogen was not uniformly distributed among the studied amphibian hosts, with Dendrobatidae species displaying the highest prevalence (12.4% as compared to Bufonidae (2.6 % and Hylidae (1.5%. In contrast to earlier reported values, we found highest prevalence for three Dendrobatidae species and two of them displayed an increase in Bd prevalence from 2009 to 2012. Those three species might be the sentinel species of choice for French Guiana. For Dendrobates tinctorius, of key conservation value in the Guiana Shield, smaller female individuals were more likely to be infected, suggesting either that frogs can outgrow their chytrid infections or that the disease induces developmental stress limiting growth. Generally, our study supports the idea that Bd is more widespread than previously thought and occurs at remote places in the lowland forest of the Guiana shield.
2013-02-15
...; Special Conditions No. 25-477-SC] Special Conditions: Bombardier Aerospace, Model BD-500-1A10 and BD-500... special conditions. SUMMARY: These special conditions are issued for the Bombardier Aerospace Model BD-500...: Background On December 10, 2009, Bombardier Aerospace applied for a type certificate for their new Model BD...
2012-11-20
... Aerospace, Model BD-500-1A10 and BD-500-1A11 Airplanes; Sidestick Controllers AGENCY: Federal Aviation... conditions for the Bombardier Aerospace Model BD-500-1A10 and BD-500-1A11 airplanes. These airplanes will... on the comments we receive. Background On December 10, 2009, Bombardier Aerospace applied for a type...
2013-12-12
... Inc., Models BD-500-1A10 and BD- 500-1A11 Series Airplanes; Electronic Flight Control System: Control... Inc. Models BD-500-1A10 and BD-500-1A11 series airplanes. These airplanes will have a novel or unusual... comments, data, or views. The most helpful comments reference a specific portion of the special conditions...
Measurement of the B$_{d}^{0}$ meson oscillation frequency
Acciarri, M; Aguilar-Benítez, M; Ahlen, S P; Alpat, B; Alcaraz, J; Alemanni, G; Allaby, James V; Aloisio, A; Alverson, G; Alviggi, M G; Ambrosi, G; Anderhub, H; Andreev, V P; Angelescu, T; Antreasyan, D; Arefev, A; Azemoon, T; Aziz, T; Bagnaia, P; Baksay, L; Ball, R C; Banerjee, S; Banicz, K; Barillère, R; Barone, L; Bartalini, P; Baschirotto, A; Basile, M; Battiston, R; Bay, A; Becattini, F; Becker, U; Behner, F; Berdugo, J; Berges, P; Bertucci, B; Betev, B L; Biasini, M; Biland, A; Bilei, G M; Blaising, J J; Blyth, S C; Bobbink, Gerjan J; Böck, R K; Böhm, A; Borgia, B; Boucham, A; Bourilkov, D; Bourquin, Maurice; Boutigny, D; Brambilla, Elena; Branson, J G; Brigljevic, V; Brock, I C; Buijs, A; Burger, J D; Burger, W J; Busenitz, J K; Buytenhuijs, A O; Cai, X D; Campanelli, M; Capell, M; Cara Romeo, G; Caria, M; Carlino, G; Cartacci, A M; Casaus, J; Castellini, G; Castello, R; Cavallari, F; Cavallo, N; Cecchi, C; Cerrada-Canales, M; Cesaroni, F; Chamizo-Llatas, M; Chan, A; Chang, Y H; Chaturvedi, U K; Chemarin, M; Chen, A; Chen, G; Chen, G M; Chen, H F; Chen, H S; Chen, M; Chiefari, G; Chien, C Y; Choi, M T; Cifarelli, Luisa; Cindolo, F; Civinini, C; Clare, I; Clare, R; Cohn, H O; Coignet, G; Colijn, A P; Colino, N; Costantini, S; Cotorobai, F; de la Cruz, B; Csilling, Akos; Dai, T S; D'Alessandro, R; De Asmundis, R; De Boeck, H; Degré, A; Deiters, K; Denes, P; De Notaristefani, F; DiBitonto, Daryl; Diemoz, M; Van Dierendonck, D N; Di Lodovico, F; Dionisi, C; Dittmar, Michael; Dominguez, A; Doria, A; Dorne, I; Dova, M T; Drago, E; Duchesneau, D; Duinker, P; Durán, I; Dutta, S; Easo, S; Efremenko, Yu V; El-Mamouni, H; Engler, A; Eppling, F J; Erné, F C; Ernenwein, J P; Extermann, Pierre; Fabre, M; Faccini, R; Falciano, S; Favara, A; Fay, J; Fedin, O; Felcini, Marta; Ferguson, T; Fernández, D; Ferroni, F; Fesefeldt, H S; Fiandrini, E; Field, J H; Filthaut, Frank; Fisher, P H; Forconi, G; Fredj, L; Freudenreich, Klaus; Furetta, C; Galaktionov, Yu; Ganguli, S N; Gau, S S; Gentile, S; Gerald, J; Gheordanescu, N; Giagu, S; Goldfarb, S; Goldstein, J; Gong, Z F; Gougas, Andreas; Gratta, Giorgio; Grünewald, M W; Gupta, V K; Gurtu, A; Gutay, L J; Hangarter, K; Hartmann, B; Hasan, A; Hebbeker, T; Hervé, A; Van Hoek, W C; Hofer, H; Hoorani, H; Hou, S R; Hu, G; Ilyas, M M; Innocente, Vincenzo; Janssen, H; Jin, B N; Jones, L W; de Jong, P; Josa-Mutuberria, I; Kasser, A; Khan, R A; Kamyshkov, Yu A; Kapinos, P; Kapustinsky, J S; Karyotakis, Yu; Kaur, M; Kienzle-Focacci, M N; Kim, D; Kim, J K; Kim, S C; Kim, Y G; Kinnison, W W; Kirkby, A; Kirkby, D; Kirkby, Jasper; Kiss, D; Kittel, E W; Klimentov, A; König, A C; Korolko, I; Koutsenko, V F; Krämer, R W; Kramer, T; Krenz, W; Kuijten, H; Kunin, A; Ladrón de Guevara, P; Landi, G; Lapoint, C; Lassila-Perini, K M; Laurikainen, P; Lebeau, M; Lebedev, A; Lebrun, P; Lecomte, P; Lecoq, P; Le Coultre, P; Lee Jae Sik; Lee, K Y; Leggett, C; Le Goff, J M; Leiste, R; Lenti, M; Leonardi, E; Levchenko, P M; Li Chuan; Lieb, E H; Lin, W T; Linde, Frank L; Lista, L; Liu, Z A; Lohmann, W; Longo, E; Lu, W; Lü, Y S; Lübelsmeyer, K; Luci, C; Luckey, D; Ludovici, L; Luminari, L; Lustermann, W; Ma Wen Gan; Macchiolo, A; Maity, M; Majumder, G; Malgeri, L; Malinin, A; Maña, C; Mangla, S; Marchesini, P A; Marin, A; Martin, J P; Marzano, F; Massaro, G G G; Mazumdar, K; McNally, D; Mele, S; Merola, L; Meschini, M; Metzger, W J; Von der Mey, M; Mi, Y; Mihul, A; Van Mil, A J W; Mirabelli, G; Mnich, J; Monteleoni, B; Moore, R; Morganti, S; Mount, R; Müller, S; Muheim, F; Nagy, E; Nahn, S; Napolitano, M; Nessi-Tedaldi, F; Newman, H; Nippe, A; Nowak, H; Organtini, G; Ostonen, R; Pandoulas, D; Paoletti, S; Paolucci, P; Park, H K; Pascale, G; Passaleva, G; Patricelli, S; Paul, T; Pauluzzi, M; Paus, C; Pauss, Felicitas; Peach, D; Pei, Y J; Pensotti, S; Perret-Gallix, D; Petrak, S; Pevsner, A; Piccolo, D; Pieri, M; Pinto, J C; Piroué, P A; Pistolesi, E; Plyaskin, V; Pohl, M; Pozhidaev, V; Postema, H; Produit, N; Prokofev, D; Prokofiev, D O; Raghavan, R; Rahal-Callot, G; Rancoita, P G; Rattaggi, M; Raven, G; Razis, P A; Read, K; Ren, D; Rescigno, M; Reucroft, S; Van Rhee, T; Riemann, S; Riemers, B C; Riles, K; Rind, O; Ro, S; Robohm, A; Rodin, J; Rodríguez-Calonge, F J; Roe, B P; Röhner, S; Romero, L; Rosier-Lees, S; Rosselet, P; Van Rossum, W; Roth, S; Rubio, Juan Antonio; Rykaczewski, H; Salicio, J; Sánchez, E; Santocchia, A; Sarakinos, M E; Sarkar, S; Sassowsky, M; Sauvage, G; Schäfer, C; Shchegelskii, V; Schmidt-Kärst, S; Schmitz, D; Schmitz, P; Schneegans, M; Schöneich, B; Scholz, N; Schopper, Herwig Franz; Schotanus, D J; Schwenke, J; Schwering, G; Sciacca, C; Sciarrino, D; Sens, Johannes C; Servoli, L; Shevchenko, S; Shivarov, N; Shoutko, V; Shukla, J; Shumilov, E; Shvorob, A V; Siedenburg, T; Son, D; Sopczak, André; Soulimov, V; Smith, B; Spillantini, P; Steuer, M; Stickland, D P; Sticozzi, F; Stone, H; Stoyanov, B; Strässner, A; Strauch, K; Sudhakar, K; Sultanov, G G; Sun, L Z; Susinno, G F; Suter, H; Swain, J D; Tang, X W; Tauscher, Ludwig; Taylor, L; Ting, Samuel C C; Ting, S M; Tonisch, F; Tonutti, M; Tonwar, S C; Tóth, J; Tully, C; Tuchscherer, H; Tung, K L; Ulbricht, J; Uwer, U; Valente, E; Van de Walle, R T; Vesztergombi, G; Vetlitskii, I; Viertel, Gert M; Vivargent, M; Völkert, R; Vogel, H; Vogt, H; Vorobev, I; Vorobyov, A A; Vorvolakos, A; Wadhwa, M; Wallraff, W; Wang, J C; Wang, X L; Wang, Y F; Wang, Z M; Weber, A; Wittgenstein, F; Wu, S X; Wynhoff, S; Xu, J; Xu, Z Z; Yang, B Z; Yang, C G; Yao, X Y; Ye, J B; Yeh, S C; You, J M; Zalite, A; Zalite, Yu; Zemp, P; Zeng, Y; Zhang, Z; Zhang, Z P; Zhou, B; Zhou, Y; Zhu, G Y; Zhu, R Y; Zichichi, Antonino
1996-01-01
Time-dependent \\Bd-\\Bbd\\ mixing is studied using 1.5 million hadronic Z decays collected by L3. Semileptonic B decays are selected by requiring at least one reconstructed lepton in both thrust hemispheres. Charge correlations between the tagged leptons are studied as a function of proper time. The proper time of the b-hadron decay is measured by reconstructing the production and decay vertices using a silicon microvertex detector. The measured \\Bd\\ meson oscillation frequency corresponds to a mass difference \\Dmd\\ between the two \\Bd\\ mass eigenstates of \\begin{displaymath} \\Dmd = \\left( 0.496 ^{+ 0.055}_{- 0.051}\\ \\mathrm{(stat)} \\pm{ 0.043}\\ \\mathrm{(syst)} \\right)\\ \\mathrm{ps}^{-1}. \\end{displaymath}
Saudi production capacity climbing to 10 million b/d
International Nuclear Information System (INIS)
Anon.
1994-01-01
Saudi Arabia this year is completing its expansion of production capacity and developing recent discoveries to enhance export flexibility. The 3 million b/d capacity expansion to 10 million b/d, announced in 1989, is on target for completion by year end 1994. Most of the effort involves restoration of mothballed production equipment and installation of several gas-oil separation plants (GOSPs) in existing fields. But Saudi Arabian Oil Co. (Saudi Aramco) also this year will start up production of extra-light oil from a new field in the central part of the kingdom. Start-up of Hawtah area production demonstrates success of an oil search Aramco began after receiving exclusive exploration rights to nearly all of Saudi Arabia's prospective area in 1986. From new fields and traditional producing areas, therefore, Saudi Arabia has the potential to expand production capacity beyond 10 million b/d. The paper describes the development of the extra capacity
Directory of Open Access Journals (Sweden)
Wanyi Li
2014-03-01
Full Text Available Influenza (flu pandemics have exhibited a great threat to human health throughout history. With the emergence of drug-resistant strains of influenza A virus (IAV, it is necessary to look for new agents for treatment and transmission prevention of the flu. Defensins are small (2–6 kDa cationic peptides known for their broad-spectrum antimicrobial activity. Beta-defensins (β-defensins are mainly produced by barrier epithelial cells and play an important role in attacking microbe invasion by epithelium. In this study, we focused on the anti-influenza A virus activity of mouse β-defensin 1 (mBD1 and β defensin-3 (mBD3 by synthesizing their fusion peptide with standard recombinant methods. The eukaryotic expression vectors pcDNA3.1(+/mBD1-mBD3 were constructed successfully by overlap-PCR and transfected into Madin-Darby canine kidney (MDCK cells. The MDCK cells transfected by pcDNA3.1(+/mBD1-mBD3 were obtained by G418 screening, and the mBD1-mBD3 stable expression pattern was confirmed in MDCK cells by RT-PCR and immunofluorescence assay. The acquired stable transfected MDCK cells were infected with IAV (A/PR/8/34, H1N1, 0.1 MOI subsequently and the virus titers in cell culture supernatants were analyzed by TCID50 72 h later. The TCID50 titer of the experimental group was clearly lower than that of the control group (p < 0.001. Furthermore, BALB/C mice were injected with liposome-encapsulated pcDNA3.1(+/mBD1-mBD3 through muscle and then challenged with the A/PR/8/34 virus. Results showed the survival rate of 100% and lung index inhibitory rate of 32.6% in pcDNA3.1(+/mBD1-mBD3group; the TCID50 titer of lung homogenates was clearly lower than that of the control group (p < 0.001. This study demonstrates that mBD1-mBD3 expressed by the recombinant plasmid pcDNA3.1(+/mBD1-mBD3 could inhibit influenza A virus replication both in vitro and in vivo. These observations suggested that the recombinant mBD1-mBD3 might be developed into an agent for
SOA-BD: Service Oriented Architecture for Biomedical Devices
Directory of Open Access Journals (Sweden)
João Marcos Teixeira Lacerda
2017-05-01
Full Text Available Introduction: The communication of information systems with biomedical devices has become complex not only due to the existence of several private communication protocols, but also to the immutable way that software is embedded into these devices. In this sense, this paper proposes a service-oriented architecture to access biomedical devices as a way to abstract the mechanisms of writing and reading data from these devices, thus contributing to enable the focus of the development team of biomedical software to be intended for its functional requirements, i.e. business rules relevant to the problem domain. Methods The SOA-BD architecture consists of five main components: A Web Service for transport and conversion of the device data, Communication Protocols to access the devices, Data Parsers to preprocess data, a Device Repository to store data and transmitted information and Error handling, for error handling of these information. For the development of SOA-BD, technologies such as the XML language and the Java programming language were used. Besides, Software Engineering concepts such as Design Patterns were also used. For the validation of this work, data has been collected from vital sign monitors in an Intensive Care Unit using HL7 standards. Results The tests obtained a difference of about only 1 second in terms of response time with the use of SOA-BD. Conclusion SOA-BD achieves important results such as the reduction on the access protocol complexity, the opportunity for treating patients over long distances, allowing easier development of monitoring applications and interoperability with biomedical devices from diverse manufacturers.
Trajectory and physical properties of near-Earth asteroid 2009 BD
Farnocchia, D.; Mommert, M.; Hora, J. L.; Chesley, S. R.; Vokrouhlický, D.; Trilling, D. E.; Mueller, M.; Harris, A. W.; Smith, H. A.; Fazio, G. G.; Knežević, Zoran; Lemaitre, Anne
2014-01-01
We analyze the trajectory of near-Earth asteroid 2009~BD, which is a candidate target of the NASA Asteroid Redirect Mission. The small size of 2009 BD and its Earth-like orbit pose challenges to understanding the dynamical properties of 2009 BD. In particular, nongravitational perturbations, such as
LA BD EN CLASSE DE FLE ? POURQUOI PAS !
Directory of Open Access Journals (Sweden)
Ana-Marina Tomescu
2009-11-01
Full Text Available Dans la présente étude nous allons essayer de démontrer que la BD représente certainement un phénomène de civilisation, qui donne la possibilité aux apprenants d’une langue étrangère de mieux comprendre un comportement culturel spécifique. Elle aide les apprenants à améliorer leur compétence socio-culturelle, parce qu’elle fait ressortir des éléments de civilisation pertinents, des clichés fréquemment rencontrés dans le monde francophone. La langue utilisée dans les BD est le français de tous les jours, l’accent est mis sur la conversation dans les plus diverses situations et à l’aide des registres de langue différents. Ce sont des motifs suffisants qui recommandent l’utilisation de la BD en classe de FLE, sans oublier de mentionner un atout essentiel : l’humour.
Directory of Open Access Journals (Sweden)
Taeyeon Kim
Full Text Available Biological production of 2,3-butandiol (2,3-BD has received great attention as an alternative to the petroleum-based 2,3-BD production. In this study, a high production of 2,3-BD in fed-batch fermentation was investigated with a newly isolated bacterium designated as Raoultella ornithinolytica B6. The isolate produced 2,3-BD as the main product using hexoses (glucose, galactose, and fructose, pentose (xylose and disaccharide (sucrose. The effects of temperature, pH-control schemes, and agitation speeds on 2,3-BD production were explored to optimize the fermentation conditions. Notably, cell growth and 2,3-BD production by R. ornithinolytica B6 were higher at 25°C than at 30°C. When three pH control schemes (no pH control, pH control at 7, and pH control at 5.5 after the pH was decreased to 5.5 during fermentation were tested, the best 2,3-BD titer and productivity along with reduced by-product formation were achieved with pH control at 5.5. Among different agitation speeds (300, 400, and 500 rpm, the optimum agitation speed was 400 rpm with 2,3-BD titer of 68.27 g/L, but acetic acid was accumulated up to 23.32 g/L. Further enhancement of the 2,3-BD titer (112.19 g/L, yield (0.38 g/g, and productivity (1.35 g/L/h as well as a significant reduction of acetic acid accumulation (9.71 g/L was achieved by the overexpression of homologous budABC genes, the 2,3-BD-synthesis genes involved in the conversion of pyruvate to 2,3-BD. This is the first report presenting a high 2,3-BD production by R.ornithinolytica which has attracted little attention with respect to 2,3-BD production, extending the microbial spectrum of 2,3-BD producers.
DEFF Research Database (Denmark)
Clausen, Signe Sandbech
PT proteins were expressed in cells where direct PTs are believed to perform their function, as well as in the vascular tissue. In NM plants, BdPT4 was localized to the plasma membrane whereas BdPT8 accumulated in the endoplasmic reticulum (ER) in the secretory pathway. A similar expression pattern...... was observed in non-arbusculated cells of AM plants. In arbusculated cells, BdPT8 was detected in the ER while BdPT4 was localized to the plasma membrane and the periarbuscular membrane (PAM) surrounding the arbuscular trunk and thick branches, which further supported a role of both BdPTs in direct Pi uptake......Phosphorus (P) is an essential plant nutrient in agricultural production but the P rock reserves used for production of fertilizers are currently being depleted. One approach to reduce the demand on P fertilizers is to optimize the phosphate (Pi) uptake and utilization efficiency of crop plants...
Patro, Sunita; Maiti, Soumitra; Panda, Santosh Kumar; Dey, Nrisingha
2015-04-01
We describe the use of plant-made β-defensins as effective antimicrobial substances for controlling salmonellosis, a deadly infection caused by Salmonella typhimurium (referred to further as S. typhi). Human β-defensin-1 (hBD-1) and -2 (hBD-2) were expressed under the control of strong constitutive promoters in tobacco plants, and bio-active β-defensins were successfully extracted. In the in vitro studies, enriched recombinant plant-derived human β-defensin-1 (phBD-1) and -2 (phBD-2) obtained from both T1 and T2 transgenic plants showed significant antimicrobial activity against Escherichia coli and S. typhi when used individually and in various combinations. The 2:1 peptide combination of phBD-1:phBD-2 with peptides isolated from T1-and T2-generation plants reduced the growth of S. typhi by 96 and 85 %, respectively. In vivo studies employing the mouse model (Balb/c) of Salmonella infection clearly demonstrated that the administration of plant-derived defensins individually and in different combinations enhanced the mean survival time of Salmonella-infected animals. When treatment consisted of the 2:1 phBD-1:phBD-2 combination, approximately 50 % of the infected mice were still alive at 206 h post-inoculation; the lowest number of viable S. typhi was observed in the liver and spleen of infected animals. We conclude that plant-made recombinant β-defensins (phBD-1 and phBD-2) are promising antimicrobial substances and have the potential to become additional tools against salmonellosis, particularly when used in combination.
An investigation of Bd0 and Bs0 oscillation
Buskulic, D.; de Bonis, I.; Decamp, D.; Ghez, P.; Goy, C.; Lees, J.-P.; Minard, M.-N.; Odier, P.; Pietrzyk, B.; Ariztizabal, F.; Comas, P.; Crespo, J. M.; Efthymiopoulos, I.; Fernandez, E.; Fernandez-Bosman, M.; Gaitan, V.; Garrido, Ll.; Martinez, M.; Mattison, T.; Orteu, S.; Pacheco, A.; Padilla, C.; Pascual, A.; Creanza, D.; de Palma, M.; Farilla, A.; Iaselli, G.; Maggi, G.; Marinelli, N.; Natali, S.; Nuzzo, S.; Ranieri, A.; Raso, G.; Romano, F.; Ruggieri, F.; Selvaggi, G.; Silvestris, L.; Tempesta, P.; Zito, G.; Chai, Y.; Hu, H.; Huang, D.; Huang, X.; Lin, J.; Wang, T.; Xie, Y.; Xu, D.; Xu, R.; Zhang, J.; Zhang, L.; Zhao, W.; Bonvicini, G.; Boudreau, J.; Casper, D.; Drevermann, H.; Forty, R. W.; Ganis, G.; Gay, C.; Girone, M.; Hagelberg, R.; Harvey, J.; Hilgart, J.; Jacobsen, R.; Jost, B.; Knobloch, J.; Lehraus, I.; Maggi, M.; Markou, C.; Mato, P.; Meinhard, H.; Minten, A.; Miquel, R.; Moser, H.-G.; Palazzi, P.; Pater, J. R.; Perlas, J. A.; Perrodo, P.; Pusztaszeri, J.-F.; Ranjard, F.; Rolandi, L.; Rothberg, J.; Ruan, T.; Saich, M.; Schlatter, D.; Schmelling, M.; Sefkow, F.; Tejessy, W.; Tomalin, I. R.; Veenhof, R.; Wachsmuth, H.; Wasserbaech, S.; Wiedenmann, W.; Wildish, T.; Witzeling, W.; Wotschack, J.; Ajaltouni, Z.; Bardadin-Otwinowska, M.; Barres, A.; Boyer, C.; Falvard, A.; Gay, P.; Guicheney, C.; Henrard, P.; Jousset, J.; Michael, B.; Montret, J.-C.; Pallin, D.; Perret, P.; Podlyski, F.; Proriol, J.; Saadi, F.; Fearnley, T.; Hansen, J. B.; Hansen, J. D.; Hansen, J. R.; Hansen, P. H.; Johnson, S. D.; Møllerud, R.; Nilsson, B. S.; Kyriakis, A.; Simopoulou, E.; Siotis, I.; Vayaki, A.; Zachariadou, K.; Badier, J.; Blondel, A.; Bonneaud, G.; Brient, J. C.; Bourdon, P.; Fouque, G.; Passalacqua, L.; Rougé, A.; Rumpf, M.; Tanaka, R.; Verderi, M.; Videau, H.; Candlin, D. J.; Parsons, M. I.; Veitch, E.; Focardi, E.; Moneta, L.; Parrini, G.; Corden, M.; Delfino, M.; Georgipoulos, C.; Jaffe, D. E.; Levinthal, D.; Antonelli, A.; Bencivenni, G.; Bologna, G.; Bossi, F.; Campana, P.; Capon, G.; Cerutti, F.; Chiarella, V.; Felici, G.; Laurelli, P.; Mannocchi, G.; Murtas, F.; Murtas, G. P.; Pepe-Altarelli, M.; Salomone, S.; Colrain, P.; Ten Have, I.; Knowles, I. G.; Lynch, J. G.; Maitland, W.; Morton, W. T.; Raine, C.; Reeves, P.; Scarr, J. M.; Smith, K.; Smith, M. G.; Thompson, A. S.; Thorn, S.; Turnbull, R. M.; Brandl, B.; Braun, O.; Geweniger, C.; Hanke, P.; Hepp, V.; Kluge, E. E.; Maumary, Y.; Putzer, A.; Rensch, B.; Stahl, A.; Tittel, K.; Wunsch, M.; Beuselinck, R.; Binnie, D. M.; Cameron, W.; Cattaneo, M.; Colling, D. J.; Dornan, P. J.; Hassard, J. F.; Lieske, N. M.; Moutoussi, A.; Nash, J.; Patton, S.; Payne, D. G.; Phillips, M. J.; San Martin, G.; Sedgbeer, J. K.; Wright, A. G.; Girtler, P.; Kuhn, D.; Rudolph, G.; Vogl, R.; Bowdery, C. K.; Brodbeck, T. J.; Finch, A. J.; Foster, F.; Hughes, G.; Jackson, D.; Keemer, N. R.; Nuttall, M.; Patel, A.; Sloan, T.; Snow, S. W.; Whelan, E. P.; Galla, A.; Greene, A. M.; Kleinknecht, K.; Raab, J.; Renk, B.; Sander, H.-G.; Schmidt, H.; Walther, S. M.; Wanke, R.; Wolf, B.; Bencheikh, A. M.; Benchouk, C.; Bonissent, A.; Calvet, D.; Carr, J.; Coyle, P.; Diaconu, C.; Drinkard, J.; Etienne, F.; Nicod, D.; Payre, P.; Roos, L.; Rousseau, D.; Schwemling, P.; Talby, M.; Adlung, S.; Assmann, R.; Bauer, C.; Blum, W.; Brown, D.; Cattaneo, P.; Dehning, B.; Dietl, H.; Dydak, F.; Frank, M.; Halley, A. W.; Jakobs, K.; Lauber, J.; Lütjens, G.; Lutz, G.; Männer, W.; Richter, R.; Schröder, J.; Schwarz, A. S.; Settles, R.; Seywerd, H.; Stierlin, U.; Stiegle, U.; St. Denis, R.; Wolf, G.; Alemany, R.; Boucrot, J.; Callot, O.; Cordier, A.; Davier, M.; Duflot, L.; Grivaz, J.-F.; Heusse, Ph.; Janot, P.; Kim, D. W.; Le Diberder, F.; Lefrançois, J.; Lutz, A.-M.; Musolino, G.; Schune, M.-H.; Veillet, J.-J.; Videau, I.; Abbaneo, D.; Bagliesi, G.; Batignani, G.; Bottigli, U.; Bozzi, C.; Calderini, G.; Carpinelli, M.; Ciocci, M. A.; Ciulli, V.; Dell'Orso, R.; Ferrante, I.; Fidecaro, F.; Foà, L.; Forti, F.; Giassi, A.; Giorgi, M. A.; Gregorio, A.; Ligabue, F.; Lusiani, A.; Mannelli, E. B.; Marrocchesi, P. S.; Messineo, A.; Palla, F.; Rizzo, G.; Sanguinetti, G.; Spagnolo, P.; Steinberger, J.; Tenchini, R.; Tonelli, G.; Triggiani, G.; Valassi, A.; Vannini, C.; Venturi, A.; Verdini, P. G.; Walsh, J.; Betteridge, A. P.; Gao, Y.; Green, M. G.; Johnson, D. L.; March, P. V.; Medcalf, T.; Mir, Ll. M.; Quazi, I. S.; Strong, J. A.; Bertin, V.; Botterill, D. R.; Clifft, R. W.; Edgecock, T. R.; Haywood, S.; Edward, M.; Norton, P. R.; Thompson, J. C.; Bloch-Devaux, B.; Colas, P.; Duarte, H.; Emery, S.; Kozanecki, W.; Lançon, E.; Lemaire, M. C.; Locci, E.; Marx, B.; Perez, P.; Rander, J.; Renardy, J.-F.; Rosowsky, A.; Roussarie, A.; Schuller, J.-P.; Schwindling, J.; Si Mohand, D.; Vallage, B.; Johnson, R. P.; Litke, A. M.; Taylor, G.; Wear, J.; Babbage, W.; Booth, C. N.; Buttar, C.; Cartwright, S.; Combley, F.; Dawson, I.; Thompson, L. F.; Barberio, E.; Böhrer, A.; Brandt, S.; Cowan, G.; Grupen, C.; Lutters, G.; Rivera, F.; Schäfer, U.; Smolik, L.; Bosisio, L.; Della Marina, R.; Giannini, G.; Gobbo, B.; Pitis, L.; Ragusa, F.; Bellantoni, L.; Chen, W.; Chen, W.; Conway, J. S.; Feng, Z.; Ferguson, D. P. S.; Gao, Y. S.; Grahl, J.; Harton, J. L.; Hayes, O. J.; Nachtman, J. M.; Pan, Y. B.; Saadi, Y.; Schmitt, M.; Scott, I.; Sharma, V.; Shi, Z. H.; Turk, J. D.; Walsh, A. M.; Weber, F. V.; Sau Lan Wu; Wu, X.; Zheng, M.; Zobernig, G.; Aleph Collaboration
1994-02-01
B 0overlineB0 oscillation is studied using almost a million hadronic Z decays collected by the ALEPH experiment at LEP. Events are selected with two leptons present, on opposite sides of the event and with high transverse momentum. The leptons are expected to be dominantly from b decays; a topological vertexing technique is applied to measure the decay length of the b hadrons, and their momentum is determined using an energy-flow method. The fraction of events in which the leptons have the same charge is studied as a function of the measured decay time, and clear evidence is seen for the time-dependent nature of B d0overlineBd0 mixing. The frequency measured for the oscillation corresponds to a mass difference for the Bd0 mass eigenstates Δmd = (3.3 -0.4+0.5 ± 0.7) × 10 -4 eV/ c2. Allowing a second frequency component for the Bs0 a high value for Δms is favoured, leading to the limit Δms > 12 × 10 -4 eV/ c2 (95% CL), from which ( Δm/ Γ) s > 2.0 is derived.
Response of Superheated Droplet Detector (SDD) and Bubble Detector (BD) to interrupted irradiations
Energy Technology Data Exchange (ETDEWEB)
Mondal, Prasanna Kumar, E-mail: prasanna_ind_82@yahoo.com; Sarkar, Rupa, E-mail: sarkar_rupa2003@yahoo.com; Chatterjee, Barun Kumar, E-mail: barun_k_chatterjee@yahoo.com
2017-06-11
Superheated droplet detectors (SDD) and bubble detectors (BD) are suspensions of micron-sized superheated liquid droplets in inert medium. The metastable droplets can vaporise upon interaction with ionising radiation generating visible bubbles. In this work, we investigated the response of SDD and BD to interrupted neutron irradiations. We observed that the droplet vaporisation rates for SDD and BD are different in nature. The unusual increase in droplet vaporisation rate observed when the SDD is exposed to neutrons after few minutes of radiation-off period is absent for BD. - Highlights: • Superheated droplet detectors (SDD) and bubble detectors (BD) are suspensions of superheated liquid droplets in inert medium. • The bubble nucleation in superheated droplets can be induced by ionising radiation. • The droplet vaporisation rate for SDD is non-monotonic when it is irradiated periodically to neutrons. • For BD the droplet vaporisation rate decrease monotonically when it is irradiated periodically to neutrons.
Photochemistry of U(BH4)4 and U(BD4)4
International Nuclear Information System (INIS)
Paine, R.T.; Schonberg, P.R.; Light, R.W.; Danen, W.C.; Freund, S.M.
1979-01-01
U(BH 4 ) 4 and U(BD 4 ) 4 are observed to undergo complex degradation reactions promoted by broadband UV radiation. The primary products of these reactions appear to be U(BH 4 ) 3 , B 2 H 6 , H 2 , U(BD 4 ) 3 , B 2 D 6 and D 2 . Further, U(BD 4 ) 4 undergoes a related decomposition reaction under the influence of CO 2 laser irradiation at 924.97 cm -1 . (author)
The Life Span of the BD-PND Bubble Detector
International Nuclear Information System (INIS)
Vanhavere, F.; Loos, M.; Thierens, H.
1999-01-01
BD-PND bubble detectors from Bubble Technology Industries (BTI) were used to conduct a study of the life span of these detectors. The manufacturer guarantees an optimum detector performance for three months after receipt. Nevertheless, it is important to know the evolution of their characteristics with time, also after those three months. On a standard set-up with a 252 Cf source the bubble detectors were irradiated until they reached the end of their life span. During this period, the evolution in sensitivity was monitored. The temperature compensating system seems to be the limiting factor with time for the use of the BTI bubble detectors. The change in temperature dependence with age was determined. The same parameters were also checked with several batches of detectors that were used in practice. (author)
Vitamin B@d12@@ concentrations in Mandovi and Zuari estuaries
Digital Repository Service at National Institute of Oceanography (India)
De; Rajendran, A.
Bioassay method using @iCyclotella nana@@ (clone 13) was employed for the estimation of Vitamin B@d12@@ in Mandovi and Zuari estuaries. At the mouth of the Mandovi estuary, B@d12@@ concentration varied between 0.38 and 7.0 ng/l in surface water...
The analysis of B-d ->(eta, eta ')l(+)l(-) decays in the standard model
Erkol, G; Turan, G
We study the differential branching ratio, the branching ratio and the CP-violating asymmetry for the exclusive B-d --> (eta,eta')l(+)l(-) decays in the standard model. We deduce the B-d --> (eta,eta') form factors from the form factors of B --> pi available in the literature, by using the SU(3)(F)
RVX-297- a novel BD2 selective inhibitor of BET bromodomains
Energy Technology Data Exchange (ETDEWEB)
Kharenko, Olesya A., E-mail: olesya@zenithepigenetics.com [Zenith Epigenetics, Suite 300, 4820 Richard Road SW, Calgary, Alberta, T3E 6L1 (Canada); Gesner, Emily M.; Patel, Reena G.; Norek, Karen [Zenith Epigenetics, Suite 300, 4820 Richard Road SW, Calgary, Alberta, T3E 6L1 (Canada); White, Andre; Fontano, Eric; Suto, Robert K. [Xtal BioStructures, Inc., 12 Michigan Dr., Natick, MA 01760 (United States); Young, Peter R.; McLure, Kevin G.; Hansen, Henrik C. [Zenith Epigenetics, Suite 300, 4820 Richard Road SW, Calgary, Alberta, T3E 6L1 (Canada)
2016-08-12
Bromodomains are epigenetic readers that specifically bind to the acetyl lysine residues of histones and transcription factors. Small molecule BET bromodomain inhibitors can disrupt this interaction which leads to potential modulation of several disease states. Here we describe the binding properties of a novel BET inhibitor RVX-297 that is structurally related to the clinical compound RVX-208, currently undergoing phase III clinical trials for the treatment of cardiovascular diseases, but is distinctly different in its biological and pharmacokinetic profiles. We report that RVX-297 preferentially binds to the BD2 domains of the BET bromodomain and Extra Terminal (BET) family of protein. We demonstrate the differential binding modes of RVX-297 in BD1 and BD2 domains of BRD4 and BRD2 using X-ray crystallography, and describe the structural differences driving the BD2 selective binding of RVX-297. The isothermal titration calorimetry (ITC) data illustrate the related differential thermodynamics of binding of RVX-297 to single as well as dual BET bromodomains. - Highlights: • A novel inhibitor of BET bromodomains, RVX-297 is described. • The differential binding modes of RVX-297 in BD1 and BD2 domains of BRD4 and BRD2 using X-ray crystallography are described. • RVX-297 preferentially binds to the BD2 domains of the BET bromodomains. • The structural and thermodynamic properties of the BD2 selective binding of RVX-297 are characterized.
Nuclear hBD-1 accumulation in malignant salivary gland tumours.
Wenghoefer, M.H.; Pantelis, A.; Dommisch, H.; Gotz, W.; Reich, R.; Berge, S.J.; Martini, M.; Allam, J.P.; Jepsen, S.; Merkelbach-Bruse, S.; Fischer, H.P.; Novak, N.; Winter, J.
2008-01-01
BACKGROUND: Whereas the antimicrobial peptides hBD-2 and -3 are related to inflammation, the constitutively expressed hBD-1 might function as 8p tumour suppressor gene and thus play a key role in control of transcription and induction of apoptosis in malignant epithelial tumours. Therefore this
Increased expression and levels of human β defensins (hBD2 and hBD4 in adults with dental caries
Directory of Open Access Journals (Sweden)
Girolamo Jose Barrera
2013-09-01
Full Text Available Introduction: Defensins are small anti-microbial peptides produced by epithelial cells. These peptides have a broad range of actions against microorganisms, including Gram-positive and Gram-negative bacteria.Human defensins are classifi ed into two subfamilies, the α-, and β- defensins, which differ in their distribution of disulphide bonds between the six conserved cysteine residues. Defensins are found in salivaand others compartments of the body. Human β defensins 2 (hBD2, beta defensins 4 (hBD4 and alpha defensins 4 (hNP4 in saliva may contributes to vulnerability or resistance to caries. This study aimed to determine a possible correlation between caries and levels of defensins measuring the expression in gingival tissue and concentrations in saliva samples.Methods: Oral examinations were performed on 100 adults of both genders (18-30 years old, and unstimulated whole saliva was collected for immunoassays of the three peptides and for the salivary pH, buffercapacity, protein, and peroxidase activity. mRNA levels of defensins in gingival sample were assessed by semi-quantitative RT-PCR technique.Results: The median salivary levels of hBD2 and hBD4 were 1.88 μg/ml and 0.86 μg/ml respectively for the caries-free group (n=44 and 7.26 μ/ml (hBD2 and 4.25 μg/ml (hBD4 for all subjects with evidenceof caries (n=56. There was no difference in the levels of hNP4, salivary pH, and proteins between groups, however the peroxidase activity and buffer capacity (interval 6.0-5.0 were reduced in caries group. Transcriptional levels of hBD2 and hBD4 did correlate with caries experience, the mRNA expression of hBD2 and hBD4 were signifi cantly higher in patients with caries than in patients with no-caries (p Conclusion: We conclude that high salivary levels and expression of beta defensins, low peroxidase activity and buffer capacity may represent a biological response of oral tissue to caries. Our observation couldlead to new ways to prevent caries
Increased expression and levels of human β defensins (hBD2 and hBD4 in adults with dental caries
Directory of Open Access Journals (Sweden)
Girolamo Jose Barrera
2013-09-01
Full Text Available Introduction: Defensins are small anti-microbial peptides produced by epithelial cells. These peptides have a broad range of actions against microorganisms, including Gram-positive and Gram-negative bacteria.Human defensins are classifi ed into two subfamilies, the α-, and β- defensins, which differ in their distribution of disulphide bonds between the six conserved cysteine residues. Defensins are found in salivaand others compartments of the body. Human β defensins 2 (hBD2, beta defensins 4 (hBD4 and alpha defensins 4 (hNP4 in saliva may contributes to vulnerability or resistance to caries. This study aimed to determine a possible correlation between caries and levels of defensins measuring the expression in gingival tissue and concentrations in saliva samples.Methods: Oral examinations were performed on 100 adults of both genders (18-30 years old, and unstimulated whole saliva was collected for immunoassays of the three peptides and for the salivary pH, buffercapacity, protein, and peroxidase activity. mRNA levels of defensins in gingival sample were assessed by semi-quantitative RT-PCR technique.Results: The median salivary levels of hBD2 and hBD4 were 1.88 μg/ml and 0.86 μg/ml respectively for the caries-free group (n=44 and 7.26 μ/ml (hBD2 and 4.25 μg/ml (hBD4 for all subjects with evidenceof caries (n=56. There was no difference in the levels of hNP4, salivary pH, and proteins between groups, however the peroxidase activity and buffer capacity (interval 6.0-5.0 were reduced in caries group. Transcriptional levels of hBD2 and hBD4 did correlate with caries experience, the mRNA expression of hBD2 and hBD4 were signifi cantly higher in patients with caries than in patients with no-caries (p < 0.01.Conclusion: We conclude that high salivary levels and expression of beta defensins, low peroxidase activity and buffer capacity may represent a biological response of oral tissue to caries. Our observation couldlead to new ways to prevent
Directory of Open Access Journals (Sweden)
Julia Leclerc
Full Text Available Porphyromonas gingivalis is an etiologic agent of periodontal disease in humans. The disease is associated with the formation of a mixed oral biofilm which is exposed to oxygen and environmental stress, such as oxidative stress. To investigate possible roles for cytochrome bd oxidase in the growth and persistence of this anaerobic bacterium inside the oral biofilm, mutant strains deficient in cytochrome bd oxidase activity were characterized. This study demonstrated that the cytochrome bd oxidase of Porphyromonas gingivalis, encoded by cydAB, was able to catalyse O2 consumption and was involved in peroxide and superoxide resistance, and dioxygen tolerance.
One-dimensional nodal neutronics routines for the TRAC-BD1 thermal-hydraulics program
International Nuclear Information System (INIS)
Nigg, D.W.
1983-09-01
Nuclear reactor core transient neutronic behavior is currently modeled in the TRAC-BD1 code using a point-reactor kinetics formulation. This report describes a set of subroutines based on the Analytic Nodal Method that were written to provide TRAC-BD1 with a one-dimensional space-dependent neutronics capability. Use of the routines is illustrated with several test problems. The results of these problems show that the Analytic Nodal neutronics routines have desirable accuracy and computing time characteristics and should be a useful addition to TRAC-BD1
Veldhuizen, Edwin J A; van Dijk, Albert; Tersteeg, Monique H G; Kalkhove, Stefanie I C; van der Meulen, Jan; Niewold, Theo A; Haagsman, Henk P
2007-01-01
Defensins are antimicrobial peptides that play an important role in the innate immune response in the intestine. Up to date, only one beta-defensin (pBD-1), has been described in pig, which was found to be expressed at low levels in the intestine. We set-up a quantitative PCR method to detect the gene expression of pBD-1 and a newly discovered porcine beta-defensin, pBD-2. Expression of pBD-1 mRNA increased from the proximal to the distal part of the intestine whereas pBD-2 expression decreased. The main gene expression sites for pBD-2 were kidney and liver, whereas pBD-1 was mainly expressed in tongue. The porcine small intestinal segment perfusion (SISP) technique was used to investigate effects of Salmonella typhimurium DT104 on intestinal morphology and pBD-1 and pBD-2 mRNA levels in vivo. The early responses were studied 2, 4 and 8 h post-infection in four separate jejunal and ileal segments. Immunohistochemistry showed invasion of the mucosa by Salmonella and changes in intestinal morphology. However, no concomitant changes in expression of either pBD-1 or pBD-2 were observed. We conclude that at least two defensins are differentially expressed in the intestine of pigs, and that expression of both defensins is not altered by S. typhimurium under these conditions.
[Protokolle der Estländischen Ritterschaft 1914-1920. Bd 1-2] / Mati Laur
Laur, Mati, 1955-
2012-01-01
Arvustus: Protokolle der Estländischen Ritterschaft 1914-1920. Bd. 1-2 (Ex fontibus archivi Estoniae, 3). Hrsg. von Thomas Freiherr von Dellingshausen und Henning von Wistingshausen. (Tartu: Eesti Ajalooarhiiv, 2011)
Nuclear hBD-1 accumulation in malignant salivary gland tumours
International Nuclear Information System (INIS)
Wenghoefer, M; Merkelbach-Bruse, S; Fischer, HP; Novak, N; Winter, J; Pantelis, A; Dommisch, H; Götz, W; Reich, R; Bergé, S; Martini, M; Allam, JP; Jepsen, S
2008-01-01
Whereas the antimicrobial peptides hBD-2 and -3 are related to inflammation, the constitutively expressed hBD-1 might function as 8p tumour suppressor gene and thus play a key role in control of transcription and induction of apoptosis in malignant epithelial tumours. Therefore this study was conducted to characterise proteins involved in cell cycle control and host defence in different benign and malignant salivary gland tumours in comparison with healthy salivary gland tissue. 21 paraffin-embedded tissue samples of benign (n = 7), and malignant (n = 7) salivary gland tumours as well as healthy (n = 7) salivary glands were examined immunohistochemically for the expression of p53, bcl-2, and hBD-1, -2, -3. HBD-1 was distributed in the cytoplasm of healthy salivary glands and benign salivary gland tumours but seems to migrate into the nucleus of malignant salivary gland tumours. Pleomorphic adenomas showed cytoplasmic as well as weak nuclear hBD-1 staining. HBD-1, 2 and 3 are traceable in healthy salivary gland tissue as well as in benign and malignant salivary gland tumours. As hBD-1 is shifted from the cytoplasm to the nucleus in malignant salivary gland tumours, we hypothesize that it might play a role in the oncogenesis of these tumours. In pleomorphic adenomas hBD-1 might be connected to their biologic behaviour of recurrence and malignant transformation
Guillem Fabre, “Pus dels majors” (BdT 216.2; Id., “Hon mais vey, pus truep sordeyor” (BdT 216.1
Directory of Open Access Journals (Sweden)
Linda Paterson
2013-03-01
Full Text Available The historical circumstances of Guillem Fabre’s two surviving sirventes has given rise to widely divergent views. This essay builds on Parducci’s contextualisation of BdT 216.2 during the War of the Sicilian Vespers and the so-called Aragonese crusade by the French against Pere III of Aragon in 1284-1285. It argues that Guillem is likely to be referring to events say entre nos because Narbonne was the focal point of the gathering French army and preaching of the crusade. All other textual details are compatible with this period and best explained by this context. But while Parducci places the sirventes in May 1285, it must in fact have preceded the death of Martin IV on 29 March, since his speedily-appointed successor Honorius IV could not be blamed for not having preached a crusade against the heathen before the conflict degenerated into further atrocities. Furthermore a slightly earlier timing better explains the allusion to “the best-known man in the world”, the obvious candidate at this time being Charles of Anjou. Guillem probably composed BdT 216.2 during the build-up to war in 1284, before the death of Charles in January 1285, during the period of war preparations and propaganda speeches. It is also argued here that, pace Parducci, BdT 216.1 did not necessarily precede BdT 216.2.
A MULTI-WAVELENGTH 3D MODEL OF BD+30°3639
Energy Technology Data Exchange (ETDEWEB)
Freeman, M. J.; Kastner, Joel H. [Chester F. Carlson Center for Imaging Science, School of Physics and Astronomy, and Laboratory for Multiwavelength Astrophysics, Rochester Institute of Technology, 54 Lomb Memorial Drive, Rochester NY 14623 (United States)
2016-10-01
We present a 3D multi-wavelength reconstruction of BD+30°3639, one of the best-studied planetary nebulae in the solar neighborhood. BD+30°3639, which hosts a [WR]-type central star, has been imaged at wavelength regimes that span the electromagnetic spectrum, from radio to X-rays. We have used the astrophysical modeling software SHAPE to construct a 3D morpho-kinematic model of BD+30°3639. This reconstruction represents the most complete 3D model of a PN to date from the standpoint of the incorporation of multi-wavelength data. Based on previously published kinematic data in optical emission lines and in lines of CO (radio) and H{sub 2} (near-IR), we were able to reconstruct BD+30's basic velocity components assuming a set of homologous velocity expansion laws combined with collimated flows along the major axis of the nebula. We confirm that the CO “bullets” in the PN lie along an axis that is slightly misaligned with respect to the major axis of the optical nebula, and that these bullets are likely responsible for the disrupted structures of the ionized and H{sub 2}-emitting shells within BD+30. Given the relative geometries and thus dynamical ages of BD+30's main structural components, it is furthermore possible that the same jets that ejected the CO bullets are responsible for the generation of the X-ray-emitting hot bubble within the PN. Comparison of alternative viewing geometries for our 3D reconstruction of BD+30°3639 with imagery of NGC 40 and NGC 6720 suggests a common evolutionary path for these nebulae.
Directory of Open Access Journals (Sweden)
Moreno-Manzanaro Miriam
2011-04-01
Full Text Available Abstract Background Studies in bipolar disorder (BD to date are limited in their ability to provide a whole-disease perspective - their scope has generally been confined to a single disease phase and/or a specific treatment. Moreover, most clinical trials have focused on the manic phase of disease, and not on depression, which is associated with the greatest disease burden. There are few longitudinal studies covering both types of patients with BD (I and II and the whole course of the disease, regardless of patients' symptomatology. Therefore, the Wide AmbispectiVE study of the clinical management and burden of Bipolar Disorder (WAVE-bd (NCT01062607 aims to provide reliable information on the management of patients with BD in daily clinical practice. It also seeks to determine factors influencing clinical outcomes and resource use in relation to the management of BD. Methods WAVE-bd is a multinational, multicentre, non-interventional, longitudinal study. Approximately 3000 patients diagnosed with BD type I or II with at least one mood event in the preceding 12 months were recruited at centres in Austria, Belgium, Brazil, France, Germany, Portugal, Romania, Turkey, Ukraine and Venezuela. Site selection methodology aimed to provide a balanced cross-section of patients cared for by different types of providers of medical aid (e.g. academic hospitals, private practices in each country. Target recruitment percentages were derived either from scientific publications or from expert panels in each participating country. The minimum follow-up period will be 12 months, with a maximum of 27 months, taking into account the retrospective and the prospective parts of the study. Data on demographics, diagnosis, medical history, clinical management, clinical and functional outcomes (CGI-BP and FAST scales, adherence to treatment (DAI-10 scale and Medication Possession Ratio, quality of life (EQ-5D scale, healthcare resources, and caregiver burden (BAS scale
High Milk-Clotting Activity Expressed by the Newly Isolated Paenibacillus spp. Strain BD3526
Directory of Open Access Journals (Sweden)
Feng Hang
2016-01-01
Full Text Available Paenibacillus spp. BD3526, a bacterium exhibiting a protein hydrolysis circle surrounded with an obvious precipitation zone on skim milk agar, was isolated from raw yak (Bos grunniens milk collected in Tibet, China. Phylogenetic analysis based on 16S rRNA and whole genome sequence comparison indicated the isolate belong to the genus Paenibacillus. The strain BD3526 demonstrated strong ability to produce protease with milk clotting activity (MCA in wheat bran broth. The protease with MCA was predominantly accumulated during the late-exponential phase of growth. The proteolytic activity (PA of the BD3526 protease was 1.33-fold higher than that of the commercial R. miehei coagulant. A maximum MCA (6470 ± 281 SU mL−1 of the strain BD3526 was reached under optimal cultivation conditions. The protease with MCA was precipitated from the cultivated supernatant of wheat bran broth with ammonium sulfate and purified by anion-exchange chromatography. The molecular weight of the protease with MCA was determined as 35 kDa by sodium dodecyl sulfate-polyacrylamide gels electrophoresis (SDS-PAGE and gelatin zymography. The cleavage site of the BD3526 protease with MCA in κ-casein was located at the Met106–Ala107 bond, as determined by mass spectrometry analysis.
Directory of Open Access Journals (Sweden)
Giuseppe Noto
2012-09-01
Full Text Available My paper provides a new critical edition, with critical apparatus, comment and translation of a set of anonymous ‘coblas’, copied as a sequence in the anthology present at ff. 55-66 in chansonnier P: BdT 461.126; BdT 461.193; BdT 461.246; BdT 461.217; BdT 461.133 (all of which are unica. I will examine in particular the attributions suggested so far for one or more of these ‘coblas’ (a name that has frequently been put forward is that of Paolo Lanfranchi da Pistoia, author of the sonnet in ‘cobla’ form copied in P immediately preceding the poems discussed here and address the hypothesis put forward by several scholars (and upheld with convincing evidence by Stefano Asperti that the sequence under consideration points to the strong presence of a Tuscan tradition in chansonnier P, clearly contributing, among other things, to outline a “fundamental coherence” (Asperti between some aspects of Dante’s literary culture and this particular songbook.
Bailleul, Geoffrey; Kravtzoff, Amanda; Joulin-Giet, Alix; Lecaille, Fabien; Labas, Valérie; Meudal, Hervé; Loth, Karine; Teixeira-Gomes, Ana-Paula; Gilbert, Florence B; Coquet, Laurent; Jouenne, Thierry; Brömme, Dieter; Schouler, Catherine; Landon, Céline; Lalmanach, Gilles; Lalmanach, Anne-Christine
2016-01-01
Defensins are frontline peptides of mucosal immunity in the animal kingdom, including birds. Their resistance to proteolysis and their ensuing ability to maintain antimicrobial potential remains questionable and was therefore investigated. We have shown by bottom-up mass spectrometry analysis of protein extracts that both avian beta-defensins AvBD2 and AvBD7 were ubiquitously distributed along the chicken gut. Cathepsin B was found by immunoblotting in jejunum, ileum, caecum, and caecal tonsils, while cathepsins K, L, and S were merely identified in caecal tonsils. Hydrolysis product of AvBD2 and AvBD7 incubated with a panel of proteases was analysed by RP-HPLC, mass spectrometry and antimicrobial assays. AvBD2 and AvBD7 were resistant to serine proteases and to cathepsins D and H. Conversely cysteine cathepsins B, K, L, and S degraded AvBD2 and abolished its antibacterial activity. Only cathepsin K cleaved AvBD7 and released Ile4-AvBD7, a N-terminal truncated natural peptidoform of AvBD7 that displayed antibacterial activity. Besides the 3-stranded antiparallel beta-sheet typical of beta-defensins, structural analysis of AvBD7 by two-dimensional NMR spectroscopy highlighted the restricted accessibility of the C-terminus embedded by the N-terminal region and gave a formal evidence of a salt bridge (Asp9-Arg12) that could account for proteolysis resistance. The differential susceptibility of avian defensins to proteolysis opens intriguing questions about a distinctive role in the mucosal immunity against pathogen invasion.
Assessment of a new interfacial friction correlation in TRAC-BD1/MOD1
International Nuclear Information System (INIS)
Analytis, G.T.
1986-01-01
Analysis of a number of 5-bar (and one 1-bar) boiloff experiments in the electrically heated 33-rod bundle NEPTUN at the Swiss Federal Institute for Reactor Research by TRAC-BD1 version 12 and MOD1 has shown that the code consistently underpredicts the collapsed liquid level histories, hence predicting earlier critical heat fluxes and higher peak rod surface temperatures than the measurements showed. Moreover, recent work has demonstrated that these differences can be attributed to the bubbly/churn interfacial friction model in TRAC-BD1 (resulting in rather large interfacial drag) whose appropriateness for rod bundles is questionable; decreasing the interfacial drag resulted in excellent agreement between measurements and code predictions. Recent analysis of boiloff experiments with the French code CATHARE and with a bubbly/churn interfacial drag force f/sub i/ similar to the one of TRAC-BD1 has also resulted in the underprediction of collapsed liquid level histories. In this work, it was shown that the usual vapor drift velocity correlations (through which f/sub i/ is derived) for this flow regime developed for tubes are not appropriate for rod bundles. Moreover, a new f/sub i/ correlation for bubbly/churn flow in rod bundles was developed based on the Froude number. The authors have modified this correlation slightly, implemented it in TRAC-BD1/MOD1, and reanalyzed most of the boiloff experiments in NEPTUN
Lightcurve Analysis for Near-Earth Asteroid (143404) 2003 BD44
Polakis, Tom; Warner, Brian D.; Skiff, Brian A.
2018-01-01
The synodic rotation period has been determined for the near-Earth asteroid (NEA) (143404) 2003 BD44. The asteroid was observed during three intervals with a rotation period on the order of 79 h determined in each case. The lightcurve exhibited rapidly changing morphology as the asteroid approached. Data have submitted to the ALCDEF database.
Relative accuracy of the BD Logic and FreeStyle blood glucose meters.
2007-04-01
The BD Logic((R)) (Becton, Dickinson and Co., Franklin Lakes, NJ) and FreeStyle((R)) (Abbott Diabetes Care, Alameda, CA) meters are used to transmit data directly to insulin pumps for calculation of insulin doses and to calibrate continuous glucose sensors as well as to monitor blood glucose levels. The accuracy of the two meters was evaluated in two inpatient studies conducted by the Diabetes Research in Children Network (DirecNet). In both studies, meter glucose measurements made with either venous or capillary blood were compared with reference glucose measurements made by the DirecNet Central Laboratory at the University of Minnesota using a hexokinase enzymatic method. The BD Logic tended to read lower than the laboratory reference regardless of whether venous (median difference = -9 mg/dL) or capillary blood (median difference = -7 mg/dL) was used. This resulted in lower accuracy of the BD Logic compared with the FreeStyle meter based on the median relative absolute difference (RAD) for both venous blood (median RAD, 9% vs. 5%, P blood (median RAD, 11% vs. 6%, P = 0.008). The greatest discrepancy in the performance of the two meters was at higher reference glucose values. Accuracy was not significantly different when the reference was < or = 70 mg/dL. The BD Logic meter is less accurate than the FreeStyle meter.
checkCIF/PLATON report Datablock: monika-bd1re3
Indian Academy of Sciences (India)
IF USED AS PART OF A REVIEW PROCEDURE. FOR PUBLICATION, IT SHOULD NOT REPLACE THE EXPERTISE OF AN EXPERIENCED. CRYSTALLOGRAPHIC REFEREE. No syntax errors found. CIF dictionary Interpreting this report. Datablock: monika-bd1re3. Bond precision: C-C = 0.0046 A. Wavelength=0.71073.
Label-free biochips for rapid detection of soybean allergen GlymBd ...
African Journals Online (AJOL)
detection. Keywords: Soybean Allergen, Gly mBd 30K, Biochip, Detection, Foods ... methods of choice by food industries and food .... shrimp, fish, peanut, wheat, and graham bread served as negative controls. Manufactured foods such as cream cake, cereal bar, chocolate biscuits, and pineapple cake were screened for.
AutoBD: Automated Bi-Level Description for Scalable Fine-Grained Visual Categorization.
Yao, Hantao; Zhang, Shiliang; Yan, Chenggang; Zhang, Yongdong; Li, Jintao; Tian, Qi
Compared with traditional image classification, fine-grained visual categorization is a more challenging task, because it targets to classify objects belonging to the same species, e.g. , classify hundreds of birds or cars. In the past several years, researchers have made many achievements on this topic. However, most of them are heavily dependent on the artificial annotations, e.g., bounding boxes, part annotations, and so on . The requirement of artificial annotations largely hinders the scalability and application. Motivated to release such dependence, this paper proposes a robust and discriminative visual description named Automated Bi-level Description (AutoBD). "Bi-level" denotes two complementary part-level and object-level visual descriptions, respectively. AutoBD is "automated," because it only requires the image-level labels of training images and does not need any annotations for testing images. Compared with the part annotations labeled by the human, the image-level labels can be easily acquired, which thus makes AutoBD suitable for large-scale visual categorization. Specifically, the part-level description is extracted by identifying the local region saliently representing the visual distinctiveness. The object-level description is extracted from object bounding boxes generated with a co-localization algorithm. Although only using the image-level labels, AutoBD outperforms the recent studies on two public benchmark, i.e. , classification accuracy achieves 81.6% on CUB-200-2011 and 88.9% on Car-196, respectively. On the large-scale Birdsnap data set, AutoBD achieves the accuracy of 68%, which is currently the best performance to the best of our knowledge.Compared with traditional image classification, fine-grained visual categorization is a more challenging task, because it targets to classify objects belonging to the same species, e.g. , classify hundreds of birds or cars. In the past several years, researchers have made many achievements on this topic
Putsathit, Papanin; Morgan, Justin; Bradford, Damien; Engelhardt, Nelly; Riley, Thomas V
2015-02-01
The Becton Dickinson (BD) PCR-based GeneOhm Cdiff assay has demonstrated a high sensitivity and specificity for detecting Clostridium difficile. Recently, the BD Max platform, using the same principles as BD GeneOhm, has become available in Australia. This study aimed to investigate the sensitivity and specificity of BD Max Cdiff assay for the detection of toxigenic C. difficile in an Australian setting. Between December 2013 and January 2014, 406 stool specimens from 349 patients were analysed with the BD Max Cdiff assay. Direct and enrichment toxigenic culture were performed on bioMérieux ChromID C. difficile agar as a reference method. isolates from specimens with discrepant results were further analysed with an in-house PCR to detect the presence of toxin genes. The overall prevalence of toxigenic C. difficile was 7.2%. Concordance between the BD Max assay and enrichment culture was 98.5%. The sensitivity, specificity, positive predictive value and negative predictive value for the BD Max Cdiff assay were 95.5%, 99.0%, 87.5% and 99.7%, respectively, when compared to direct culture, and 91.7%, 99.0%, 88.0% and 99.4%, respectively, when compared to enrichment culture. The new BD Max Cdiff assay appeared to be an excellent platform for rapid and accurate detection of toxigenic C. difficile.
International Nuclear Information System (INIS)
Barik, N.; Das, P.; Panda, A.R.; Roy, K.C.
1993-01-01
Considering B d 0 -bar B d 0 mixing in a potential model of independent quarks by taking the effective interaction Hamiltonian of the standard Salam-Weinberg-Glashow model and subsequently diagonalizing the corresponding mass matrix with respect to B d 0 and bar B d 0 states, we obtain an expression for the mass difference ΔM Bd 0 in terms of the t-quark mass m t . Using the recent observation of the mixing parameter x d =0.72±0.15 by the ARGUS Collaboration, we predict the lower bound on the top-quark mass as m t ≥149 GeV. Further, a consideration of experimental mass difference ΔM Bd 0 =(4.0±0.8)x10 -13 GeV also leads to m t =167 -17 +16 GeV which is in agreement with the recent experimental bound as well as other theoretical predictions. However, such a prediction of m t that utilizes the experimental value of the CKM matrix element |V td | may not appear convincing in view of the large uncertainties in the measurement of |V td | so far reported. Therefore using the range of m t values within its bounds predicted from other independent works, we make a reasonable estimation of |V td |
Polesello, Vania; Zupin, Luisa; Di Lenarda, Roberto; Biasotto, Matteo; Pozzato, Gabriele; Ottaviani, Giulia; Gobbo, Margherita; Crovella, Sergio; Segat, Ludovica
2017-01-01
The aetiology of Oral Lichen Planus (OLP), a chronic inflammatory disease of oral mucosa, is not yet well understood. Since innate immunity may be hypothesized as involved in the susceptibility to OLP, we studied human beta defensin 1 (hBD-1) an antimicrobial peptide constitutively expressed in the saliva, looking at functional genetic variants possibly able to diminish hBD-1 production an consequently conferring major susceptibility to OLP. We analysed three DEFB1 polymorphisms at 5' UTR, -52G>A (rs1799946), -44C>G (rs1800972), -20G>A (rs11362) and two DEFB1 polymorphisms at 3'UTR, c*5G>A (rs1047031), c*87A>G (rs1800971), with the aim of correlating these genetic variants and hBD-1 salivary level in a group of OLP patients and in healthy subjects. We also evaluated hBD-1 salivary concentrations, using ELISA, in OLP and healthy controls. We compared hBD-1 concentrations in OLP and healthy subjects: hBD-1 concentration was significantly higher in OLP patients respect to control. When considering the correlation between DEFB1 polymorphisms genotypes and hBD-1 expression levels, significant results were obtained for SNPs -52G>A (p=0.03 both in OLP patients and healthy individuals) and -44C>G (p=0.02 in OLP patients). hBD-1 production was different between OLP and healthy subjects (not age-matched with OLP). DEFB1 gene polymorphisms, -52G>A and -44C>G, correlated with hBD-1 salivary concentrations. Copyright © 2016 Elsevier Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
Sperauskas J.
2010-12-01
Full Text Available The spectroscopic orbit of a high proper motion star, BD+20 5152, is calculated from 34 CORAVEL-type radial velocity measurements. The star has a slightly eccentric orbit with a period of 5.70613 d, half-amplitude of 47.7 km/s and eccentricity of 0.049. The center-of-mass velocity of the system is -24.3 km/s. BD+20 5152 seems to be a triple system consisting of a G8 dwarf as a primary component and of two K6-M0 dwarfs as secondary and tertiary components. This model is based on the analysis of its UBVRI and JHK magnitudes. According to the SuperWASP photometry, spots on the surface of the primary are suspected. The excessive brightness in the Galex FUV and NUV magnitudes and a non-zero eccentricity suggest the age of this system to be less than 1 Gyr.
TRAC-BD1: transient reactor analysis code for boiling-water systems
International Nuclear Information System (INIS)
Spore, J.W.; Weaver, W.L.; Shumway, R.W.; Giles, M.M.; Phillips, R.E.; Mohr, C.M.; Singer, G.L.; Aguilar, F.; Fischer, S.R.
1981-01-01
The Boiling Water Reactor (BWR) version of the Transient Reactor Analysis Code (TRAC) is being developed at the Idaho National Engineering Laboratory (INEL) to provide an advanced best-estimate predictive capability for the analysis of postulated accidents in BWRs. The TRAC-BD1 program provides the Loss of Coolant Accident (LOCA) analysis capability for BWRs and for many BWR related thermal hydraulic experimental facilities. This code features a three-dimensional treatment of the BWR pressure vessel; a detailed model of a BWR fuel bundle including multirod, multibundle, radiation heat transfer, leakage path modeling capability, flow-regime-dependent constitutive equation treatment, reflood tracking capability for both falling films and bottom flood quench fronts, and consistent treatment of the entire accident sequence. The BWR component models in TRAC-BD1 are described and comparisons with data presented. Application of the code to a BWR6 LOCA is also presented
Assessment of TRAC-BD1/MOD1 using FIST data
International Nuclear Information System (INIS)
Jo, J.H.; Connell, H.R.
1985-01-01
This report is concerned with the assessment of the TRAC-BD1/MOD1 Code, developed at Idaho National Engineering Laboratory. The assessment was conducted using data from the FIST (Full Integral Simulation Test) facility, which is a BWR safety test facility which was built to investigate small break LOCA and operational transients in BWR's and to complement earlier large break LOCA test results from TLTA (Two-Loop Test Apparatus). 21 figs
One-electron oxidation of BD84, an ellipticine antitumor derivative
International Nuclear Information System (INIS)
Sekaki, A.; Gardes-Albert, M.; Houee-Levin, C.; Ferradini, C.; Rivalle, C.; Bisagni, E.; Hickel, B.
1991-01-01
The one-electron oxidation of BD84, an ellipticine-related drug, has been studied by pulse radiolysis using OH· radicals as oxidizing agents. In the absence of oxygen, R· radicals are formed. They disappear by recombination. In the presence of oxygen, R· radicals react with O 2 to give peroxy radicals RO 2 ·, which decay by a second-order process. These results are compared to those obtained for other ellipticine derivatives [fr
DEFF Research Database (Denmark)
Ejegod, Ditte Møller; Junge, Jette; Franzmann, Maria
2016-01-01
BACKGROUND: The novel BD Onclarity(TM) HPV assay (Onclarity) on the BD Viper™ LT system (BD Diagnostics, Sparks, MD), detects E6/E7 DNA from 13 high-risk HPV genotypes and HPV66. We compared the analytical and clinical performance of the Onclarity Assay to that of Hybrid Capture 2 and LINEAR ARRAY...
2010-04-01
... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Form BD-Y2K, information... Exchange Members, Brokers, and Dealers § 249.618 Form BD-Y2K, information required of broker-dealers... FR 37674, July 13, 1998] Editorial Note: For Federal Register citations affecting Form BD-Y2K, see...
Photochemistry of U(BH/sub 4/)/sub 4/ and U(BD/sub 4/)/sub 4/
Energy Technology Data Exchange (ETDEWEB)
Paine, R T; Schonberg, P R; Light, R W [New Mexico Univ., Albuquerque (USA). Dept. of Chemistry; Danen, W C; Freund, S M
1979-01-01
U(BH/sub 4/)/sub 4/ and U(BD/sub 4/)/sub 4/ are observed to undergo complex degradation reactions promoted by broadband UV radiation. The primary products of these reactions appear to be U(BH/sub 4/)/sub 3/, B/sub 2/H/sub 6/, H/sub 2/, U(BD/sub 4/)/sub 3/, B/sub 2/D/sub 6/ and D/sub 2/. Further, U(BD/sub 4/)/sub 4/ undergoes a related decomposition reaction under the influence of CO/sub 2/ laser irradiation at 924.97 cm/sup -1/.
Photometric, Spectroscopic, and X-ray Analysis of the Cool Algol BD+05 706
Torres, G.; Mader, J.; Marschall, L. A.; Neuhaeuser, R.; Duffy, A. S.
2000-12-01
BD+05 706 is an example of a rare class of a dozen or so interacting binaries called ``cool Algols", in which both components of the system are late-type stars. By contrast, the ``classical Algols" are systems in which the star transfering mass is of late spectral type, but the mass gainer is much hotter. BD+05 706 was shown previously to be eclipsing (Marschall, Torres & Neuhaeuser 1998, BAAS, 30, 835). In this paper we report our complete analysis of BVRI light curves for the system obtained at Gettysburg College Observatory, together with spectroscopy from the Harvard-Smithsonian Center for Astrophysics reported previously (Torres, Neuhaeuser & Wichmann 1998, AJ, 115, 2028), and X-ray observations obtained with the ROSAT satellite. Our light curve analysis indicates the presence of spots, most likely on the more massive, active component (primary), which change from season to season. Our results confirm the semi-detached nature of the system, and combined with the spectroscopy they have allowed us to obtain the most precise absolute masses and radii for any object of this class. Our X-ray light curve for BD+05 706 shows the primary eclipse clearly, but no sign of a secondary eclipse, confirming that the primary is the active star. Strong X-ray flares are also visible.
Mixing and CP violation in the Bd and Bs systems at ATLAS
AUTHOR|(INSPIRE)INSPIRE-00229256; The ATLAS collaboration
2016-01-01
This note includes a measurement of the $B^0_s$ decay parameters in the $ B_s \\rightarrow J/\\psi$ channel and a measurement of the $B_d$ meson using the statistics collected by the ATLAS experiment in Run I of the LHC. The first result presents the measurement of the $CP$-violating phase $\\phi_s$, the decay width $\\Gamma_s$ and the width difference between the mass eigenstates $\\Delta \\Gamma_s$. The second result presents the measurement of the width difference $\\Delta \\Gamma_d$, which is extracted from the measurement of the lifetime dependence of $B_d \\to J/\\psi K_S$ and $B_d \\to J/\\psi K^{*0}$ decays. The obtained results are $\\phi_s = −0.098 \\pm 0.084 (\\textrm{stat.}) \\pm 0.040 (\\textrm{syst.})$ rad. and $\\Delta \\Gamma_d / \\Gamma_d = (-0.1 \\pm 1.1 (\\textrm{stat.}) \\pm 0.9 (\\textrm{syst.}))\\times 10^{-2}$.
Dextran synthesized by Leuconostoc mesenteroides BD1710 in tomato juice supplemented with sucrose.
Han, Jin; Hang, Feng; Guo, Benheng; Liu, Zhenmin; You, Chunpin; Wu, Zhengjun
2014-11-04
The characteristics of the growth of Leuconostoc mesenteroides BD1710 and the synthesis of dextran in tomato juice supplemented with 15% sucrose were assayed. L. mesenteroides BD1710 could synthesize approximately 32 g L(-1) dextran in the tomato-juice-sucrose medium when cultured at 28 °C for 48 h, which was on the same level as the dextran yield in a chemically defined medium. The viscosity of the cultured tomato-juice-sucrose medium with various dextran contents was also measured. The results of the monosaccharide composition, molecular-weight distribution, Fourier transform infrared spectra (FTIR) and nuclear magnetic resonance spectra (NMR) showed that the polysaccharide synthesized by L. mesenteroides BD1710 in the tomato-juice-sucrose medium was dextran with a peak molecular weight of 6.35 × 10(5)Da, a linear backbone composed of consecutive α-(1 → 6)-linked d-glucopyranosyl units and approximately 6% α-(1 → 3) branches. Copyright © 2014 Elsevier Ltd. All rights reserved.
Tyring, Stephen; Bukhalo, Michael; Alonso-Llamazares, Javier; Olesen, Martin; Lowson, David; Yamauchi, Paul
2016-01-01
Objective: To evaluate the efficacy of fixed combination aerosol foam calcipotriene 0.005% (Cal) plus betamethasone dipropionate 0.064% (BD). Design: Patients were randomized (100:101:101) to receive Cal/BD foam, Cal foam, or BD foam once daily for four weeks. Setting: Twenty-eight United States centers. Participants: 302 patients (≥18 years) with Psoriasis vulgaris (plaque Psoriasis; ≥mild disease severity by physicians global assessment). Measurements: Treatment success of the body (“clear”/”almost clear” from baseline moderate/severe disease; “clear” from baseline mild disease). Involved scalp treatment success was an additional endpoint. Results: Most patients (76%) had moderate Psoriasis of the body (66% for scalp). At Week 4, 45 percent of Cal/BD foam patients achieved treatment success, significantly more than Cal foam (14.9%; OR 4.34 [95%CI 2.16,8.72] Pfoam (30.7%; 1.81 [1.00,3.26] P=0.047). Fifty-three percent of Cal/BD foam patients achieved treatment success of the scalp, significantly greater than Cal foam (35.6%; 1.91 [1.09,3.35] P=0.021), but not BD foam (47.5%; 1.24 [0.71,2.16] P=0.45). Mean modified Psoriasis area and severity index (population baseline 7.6) improved in all groups, with statistically significant differences in Week 4 Cal/BD foam score (2.37) versus Cal foam (4.39; mean difference -2.03 [-2.63][-1.43] Pfoam (3.37; -1.19 [-1.80][-0.59] Pfoam was significantly more effective than Cal foam and BD foam in providing treatment success at Week 4 and effective on involved scalp. Trial registration: NCT01536938. PMID:27313822
Xiao, Lin; Gao, Yulin; Zhang, Lili; Chen, Peiyun; Sun, Xiaojia; Tang, Siyuan
2016-03-15
Previous literatures on quality of life (QoL) in bipolar disorder (BD) strongly suggested that a disease-specific QoL measure for patients with BD should be developed to evaluate QoL more specifically and reliably. To our knowledge, "Quality of Life in Bipolar Disorder" (QoL.BD) is the first and only questionnaire produced to specifically measure QoL in people with BD. In China, there is no disease-targeted measure available to specifically measure QoL in Chinese patients with BD. The aim of the study is to revise and validate the brief version of the QoL.BD (Bref QoL.BD ) into Chinese version. All the items of the Bref QoL.BD was translated into Chinese language, using the Brislin translation mode. The questionnaire was administered to a total sample of 231 subjects, including 101 BD patients and 130 healthy controls, to test the psychometric properties of Bref QoL.BD (e.g. internal consistency, retest reliability, content validity, item analysis, confirmatory factor analysis, criterion validity, convergent validity, discriminative validity and feasibility). The Chinese version of the Bref QoL.BD had very high internal consistency (Cronbach's alpha=0.815) and retest reliability (intraclass correlation coefficient (ICC )=0.808). Confirmatory factor analysis (CFA) validated the original one-factor structure. The direction and magnitude of correlations with 36-item Short-Form Health Survey (SF-36; rs= 0.313, Psize from only one tertiary care center. And BD patients enrolled were euthymic, excluding the acute BD patients. The Chinese version of the Bref QoL.BD is a feasible, reliable and valid tool for the assessment of QoL for Chinese BD patients. Copyright © 2015 Elsevier B.V. All rights reserved.
SUBSTELLAR-MASS COMPANIONS TO THE K-DWARF BD+14 4559 AND THE K-GIANTS HD 240210 AND BD+20 2457
International Nuclear Information System (INIS)
Niedzielski, A.; Nowak, G.; Adamow, M.; Wolszczan, A.
2009-01-01
We present the discovery of substellar-mass companions to three stars by the ongoing Penn State-Torun Planet Search conducted with the 9.2 m Hobby-Eberly Telescope. The K2-dwarf, BD+14 4559, has a 1.5 M J minimum mass companion with the orbital period of 269 days and shows a non-linear, long-term radial velocity (RV) trend, which indicates a possible presence of another planet-mass body in the system. The K3-giant, HD 240210, exhibits RV variations that require modeling with multiple orbits, but the available data are not yet sufficient to do it unambiguously. A tentative, one-planet model calls for a 5.2 M J minimum mass planet in a 502 day orbit around the star. The most massive of the three stars, the K2-giant, BD+20 2457, whose estimated mass is 2.8 ± 1.5 M sun , has two companions with the respective minimum masses of 21.4 M J and 12.5 M J and orbital periods of 380 and 622 days. Depending on the unknown inclinations of the orbits, the currently very uncertain mass of the star, and the dynamical properties of the system, it may represent the first detection of two brown dwarf-mass companions orbiting a giant. The existence of such objects will have consequences for the interpretation of the so-called brown dwarf desert known to exist in the case of solar-mass stars.
Effect of chloride substitution on the order–disorder transition in NaBH4 and Na11BD4
International Nuclear Information System (INIS)
Olsen, Jørn Eirik; Karen, Pavel; Sørby, Magnus H.; Hauback, Bjørn C.
2014-01-01
Graphical abstract: Interactions that order the BD 4 - tetrahedra below the order–disorder transition became increasingly frustrated by the solute in the Na( 11 BD 4 ) 1−x Cl x solid solutions, and the order disappears at x = 0.158. Highlights: • The order–disorder transition temperature for Na(BH 4 ) 1−x Cl x and Na( 11 BD 4 ) 1−x Cl x is highly dependent on the Cl-content, x. • The transition is characterized by DSC for Na( 11 BD 4 ) 1−x Cl x for x = 0, 0.10 and 0.15. • No transition is observed for x ⩾ 0.20 on cooling to 8 K. • The crystal structures are reported for Na 11 BD 4 at room temperature and 8 K and Na( 11 BD 4 ) 1−x Cl x (x = 0.10, 0.15, 0.20 and 0.25) at 8 K from powder neutron diffraction. -- Abstract: Phase transition associated with anion disordering over two orientations in Na 11 BD 4 (NaBH 4 ) and its solid solutions with NaCl, Na( 11 BD 4 ) 1−x Cl x , is investigated with powder diffraction (neutron and synchrotron radiation), differential scanning calorimetry and Raman spectroscopy. Upon heating, the transition temperature extrapolated to zero rate of heating is 192.2 K for Na 11 BD 4 , ΔS = 4.41 J/mol K, hysteresis 1.7 K and the volume increase 0.43%. Thermal parameters of the transition in Na( 11 BD 4 ) 1−x Cl x follow a colligative-property model of an ideal solution, with x = 0.158(1) as the critical concentration at which the ordering interactions and the transition itself are eliminated. On approaching this limit, the tetragonal distortion of the ordered structure decreases somewhat towards the cubic average, and this is associated with a partial disorder of the tetrahedral anions seen by diffraction methods. In fact, a 3% disorder is already present in the pure solvent of the solid solution (Na 11 BD 4 ) at 8 K
Directory of Open Access Journals (Sweden)
Marco Ventura
2009-12-01
Full Text Available Bifidobacteria, one of the relatively dominant components of the human intestinal microbiota, are considered one of the key groups of beneficial intestinal bacteria (probiotic bacteria. However, in addition to health-promoting taxa, the genus Bifidobacterium also includes Bifidobacterium dentium, an opportunistic cariogenic pathogen. The genetic basis for the ability of B. dentium to survive in the oral cavity and contribute to caries development is not understood. The genome of B. dentium Bd1, a strain isolated from dental caries, was sequenced to completion to uncover a single circular 2,636,368 base pair chromosome with 2,143 predicted open reading frames. Annotation of the genome sequence revealed multiple ways in which B. dentium has adapted to the oral environment through specialized nutrient acquisition, defences against antimicrobials, and gene products that increase fitness and competitiveness within the oral niche. B. dentium Bd1 was shown to metabolize a wide variety of carbohydrates, consistent with genome-based predictions, while colonization and persistence factors implicated in tissue adhesion, acid tolerance, and the metabolism of human saliva-derived compounds were also identified. Global transcriptome analysis demonstrated that many of the genes encoding these predicted traits are highly expressed under relevant physiological conditions. This is the first report to identify, through various genomic approaches, specific genetic adaptations of a Bifidobacterium taxon, Bifidobacterium dentium Bd1, to a lifestyle as a cariogenic microorganism in the oral cavity. In silico analysis and comparative genomic hybridization experiments clearly reveal a high level of genome conservation among various B. dentium strains. The data indicate that the genome of this opportunistic cariogen has evolved through a very limited number of horizontal gene acquisition events, highlighting the narrow boundaries that separate commensals from
Overexpression of BdMATE Gene Improves Aluminum Tolerance in Setaria viridis
Directory of Open Access Journals (Sweden)
Ana P. Ribeiro
2017-06-01
Full Text Available Acidic soils are distributed worldwide, predominantly in tropical and subtropical areas, reaching around 50% of the arable soil. This type of soil strongly reduces crop production, mainly because of the presence of aluminum, which has its solubility increased at low pH levels. A well-known physiological mechanism used by plants to cope with Al stress involves activation of membrane transporters responsible for organic acid anions secretion from the root apex to the rhizosphere, which chelate Al, preventing its absorption by roots. In sorghum, a membrane transporter gene belonging to multidrug and toxic compound extrusion (MATE family was identified and characterized as an aluminum-activated citrate transporter gene responsible for Al tolerance in this crop. Setaria viridis is an emerging model for C4 species and it is an important model to validate some genes for further C4 crops transformation, such as sugarcane, maize, and wheat. In the present work, Setaria viridis was used as a model plant to overexpress a newly identified MATE gene from Brachypodium distachyon (BdMATE, closely related to SbMATE, for aluminum tolerance assays. Transgenic S. viridis plants overexpressing a BdMATE presented an improved Al tolerance phenotype, characterized by sustained root growth and exclusion of aluminum from the root apex in transgenic plants, as confirmed by hematoxylin assay. In addition, transgenic plants showed higher root citrate exudation into the rhizosphere, suggesting that Al tolerance improvement in these plants could be related to the chelation of the metal by the organic acid anion. These results suggest that BdMATE gene can be used to transform C4 crops of economic importance with improved aluminum tolerance.
BD-22deg3467, a DAO-type Star Exciting the Nebula Abell 35
Ziegler, M.; Rauch, T.; Werner, K.; Koppen, J.; Kruk, J. W.
2013-01-01
Spectral analyses of hot, compact stars with non-local thermodynamical equilibrium (NLTE) model-atmosphere techniques allow the precise determination of photospheric parameters such as the effective temperature (T(sub eff)), the surface gravity (log g), and the chemical composition. The derived photospheric metal abundances are crucial constraints for stellar evolutionary theory. Aims. Previous spectral analyses of the exciting star of the nebula A35, BD-22deg3467, were based on He+C+N+O+Si+Fe models only. For our analysis, we use state-of-the-art fully metal-line blanketed NLTE model atmospheres that consider opacities of 23 elements from hydrogen to nickel. We aim to identify all observed lines in the ultraviolet (UV) spectrum of BD-22deg3467 and to determine the abundances of the respective species precisely. Methods. For the analysis of high-resolution and high signal-to-noise ratio (S/N) far-ultraviolet (FUSE) and UV (HST/STIS) observations, we combined stellar-atmosphere models and interstellar line-absorption models to fully reproduce the entire observed UV spectrum. Results. The best agreement with the UV observation of BD-22deg3467 is achieved at T(sub eff) = 80 +/- 10 kK and log g = 7.2 +/- 0.3. While T(sub eff) of previous analyses is verified, log g is significantly lower. We re-analyzed lines of silicon and iron (1/100 and about solar abundances, respectively) and for the first time in this star identified argon, chromium, manganese, cobalt, and nickel and determined abundances of 12, 70, 35, 150, and 5 times solar, respectively. Our results partially agree with predictions of diffusion models for DA-type white dwarfs. A combination of photospheric and interstellar line-absorption models reproduces more than 90% of the observed absorption features. The stellar mass is M approx. 0.48 Solar Mass. Conclusions. BD.22.3467 may not have been massive enough to ascend the asymptotic giant branch and may have evolved directly from the extended horizontal branch
Jofre de Foixa, “Subrafusa ab cabirol” (BdT 304.4
Directory of Open Access Journals (Sweden)
Wendy Pfeffer
2011-11-01
Full Text Available Jofre de Foixa’s verses “Subrafusa ab cabirol” (BdT 304.4 merit attention for the light the two ‘coblas’ shed on Jofre’s familiarity with his Occitan predecessors, for the information the text provides regarding food practices in his time, and for the use of a food term rare in the Iberian peninsula, “unyo”. The resources of culinary history, specifically fourteenth- and fifteenth-century Languedocian and Catalan cookbooks, allow us better to understand the meaning of Jofre’s lyric.
Ultraviolet observations of planetary nebulae NGC 6572, NGC 5315 and BD + 30/sup 0/ 3639
Energy Technology Data Exchange (ETDEWEB)
Torres-Peimbert, S; Pena, M [Universidad Nacional Autonoma de Mexico, Mexico City. Inst. de Astronomia
1981-01-01
We present IUE observations of three planetary nebulae. We have obtained the chemical composition of NGC 6572 to be log C = -3.60, log N = -3.67, log O = -3.27, and log Ne = -3.8. For NGC 5315 and BD + 30/sup 0/ 3639, the stellar WR contribution in the UV is very significant, and for these nebulae we are only able to derive the carbon abundance. We found log C = -3.01 and >-3.27, respectively.
VizieR Online Data Catalog: BD+46 442 optical spectra (Bollen+, 2017)
Bollen, D.; van Winckel, H.; Kamath, D.
2017-08-01
Reduced high-resolution (R~85000) optical spectra of BD+46 442. These 104 spectra were obtained between July 2009 and January 2016 from the HERMES spectrograph, mounted on the 1.2m Flemish Mercator telescope at La Palma, Canary Islands, Spain. The spectra cover a wavelength range from 3770 to 9000 angstrom in logscale. The flux is given in arbitrary units. The spectra are collected as FITS files. The numbering of the spectra corresponds to the numbering in Table B.1 in the article (e.g. spec_15.fits corresponds to N=15). (2 data files).
International Nuclear Information System (INIS)
Zong Zhaowen; Li Nan; Xiao Taoyuan
2010-01-01
Deficiencies in repair cells and infection are two of the main factors that can hinder the process of wound healing. In the present study, we investigated the ability of human beta-defensin-2 (hBD2) genetically modified dermal multipotent stem cells (dMSCs) to accelerate the healing irradiated wounds complicated by infections. An hBD2 adenovirus expression vector (Adv-hBD2) was firstly constructed and used to infect dMSCs. The antibacterial activity of the supernatant was determined by Kirby-Bauer method and macrodilution broth assay. Time to complete wound healing, residual percentage of wound area, and the number of bacteria under the scar were measured to assess the effects of Adv-hBD2-infected dMSC transplantation on the healing of irradiated wounds complicated by Pseudomonas aeruginosa infection. Results showed that the supernatant from Adv-hBD2-infected dMSCs had obvious antibacterial effects. Transplantation of Adv-hBD2-infected dMSCs killed bacteria in the wound. The complete wound healing time was 19.8±0.45 days, which was significantly shorter than in the control groups (P<0.05). From 14 days after transplantation, the residual wound area was smaller in the experimental group than in the control groups (P<0.05). In conculsion, we found that transplantation of hBD2 genetically modified dMSCs accelerated the healing of wounds complicated by P. aeruginosa infection in whole body irradiated rats. (author)
Characterization of the cydAB-Encoded Cytochrome bd Oxidase from Mycobacterium smegmatis
Kana, Bavesh D.; Weinstein, Edward A.; Avarbock, David; Dawes, Stephanie S.; Rubin, Harvey; Mizrahi, Valerie
2001-01-01
The cydAB genes from Mycobacterium smegmatis have been cloned and characterized. The cydA and cydB genes encode the two subunits of a cytochrome bd oxidase belonging to the widely distributed family of quinol oxidases found in prokaryotes. The cydD and cydC genes located immediately downstream of cydB encode a putative ATP-binding cassette-type transporter. At room temperature, reduced minus oxidized difference spectra of membranes purified from wild-type M. smegmatis displayed spectral features that are characteristic of the γ-proteobacterial type cytochrome bd oxidase. Inactivation of cydA or cydB by insertion of a kanamycin resistance marker resulted in loss of d-heme absorbance at 631 nm. The d-heme could be restored by transformation of the M. smegmatis cyd mutants with a replicating plasmid carrying the highly homologous cydABDC gene cluster from Mycobacterium tuberculosis. Inactivation of cydA had no effect on the ability of M. smegmatis to exit from stationary phase at 37 or 42°C. The growth rate of the cydA mutant was tested under oxystatic conditions. Although no discernible growth defect was observed under moderately aerobic conditions (9.2 to 37.5 × 102 Pa of pO2 or 5 to 21% air saturation), the mutant displayed a significant growth disadvantage when cocultured with the wild type under extreme microaerophilia (0.8 to 1.7 × 102 Pa of pO2 or 0.5 to 1% air saturation). These observations were in accordance with the two- to threefold increase in cydAB gene expression observed upon reduction of the pO2 of the growth medium from 21 to 0.5% air saturation and with the concomitant increase in d-heme absorbance in spectra of membranes isolated from wild-type M. smegmatis cultured at 1% air saturation. Finally, the cydA mutant displayed a competitive growth disadvantage in the presence of the terminal oxidase inhibitor, cyanide, when cocultured with wild type at 21% air saturation in an oxystat. In conjunction with these findings, our results suggest that
Near-Earth Asteroids 2006 RH120 AND 2009 BD: Proxies for Maximally Accessible Objects?
Barbee, Brent W.; Chodas, Paul W.
2015-01-01
NASA's Near-Earth Object Human Space Flight Accessible Targets Study (NHATS) has identified over 1,400 of the approximately 12,800 currently known near-Earth asteroids (NEAs) as more astrodynamically accessible, round-trip, than Mars. Hundreds of those approximately 1,400 NEAs can be visited round-trip for less change-in-velocity than the lunar surface, and dozens can be visited round-trip for less change-in-velocity than low lunar orbit. How accessible might the millions of undiscovered NEAs be? We probe that question by investigating the hypothesis that NEAs 2006 RH120 and 2009 BD are proxies for the most accessible NEAs we would expect to find, and describing possible future NEA population model studies.
Bellivier, F; Delavest, M; Coulomb, S; Figueira, M L; Langosch, J M; Souery, D; Vieta, E
2014-10-01
Bipolar disorder is a complex disease which requires multiple healthcare resources and complex medical care programs including pharmacological and non pharmacological treatment. If mood stabilizers remain the corner stone for bipolar disorder treatment, the development of atypical antipsychotics and their use as mood stabilizers has significantly modified therapeutic care. At the present time, psychiatrists have a large variety of psychotropic drugs for bipolar disorder: mood stabilizers, atypical antipsychotics, antidepressants, anxiolytics… However, despite the publication of guidelines on pharmacological treatment, with a high degree of consensus, everyday clinical practices remain heterogeneous. Moreover, there are few longitudinal studies to describe therapeutic management of bipolar disorder, whatever the phase of the disease is. Indeed, most of the studies are carried out on a specific phase of the disease or treatment. And there is no study comparing French and European practices. In this paper, we aim to present the comparison of the management of pharmacological treatments of bipolar disorder between France and Europe, using the data of the observational Wide AmbispectiVE study of the clinical management and burden of bipolar disorder (WAVE-bd study). The WAVE-bd study is a multinational, multicentre and non-interventional cohort study of patients diagnosed with BD type I or type II, according to DSM IV-TR criteria, in any phase of the disorder, who have experienced at least one mood event during the 12 months before enrolment. In total, 2507 patients have been included across 8 countries of Europe (480 in France). Data collection was retrospective (from 3 to 12 months), but also prospective (from 9 to 15 months) for a total study length of 12 to 27 months. Main outcome measures were the healthcare resource use and pharmacological treatments. Our results show differences in the therapeutic management of bipolar disorder between France and other European
Balance of plant modeling in TRAC-BD1/MOD1
International Nuclear Information System (INIS)
Weaver, W.L.; Giles, M.M.; Mohr, C.M.
1983-01-01
The mission of the TRAC-BD1/MOD1 code is to provide a best-estimate analysis capability for Boiling Water Reactor systems and related experimental facilities for the full range of accidents from large and small break Loss-of-Coolant accidents to operational transients including anticipated transients without scram (ATWS), for which point reactor kinetics is adequate (as a first approximation). Recent model developments allow a complete reactor system including the containment and the balance of plant to be modeled. This paper describes the balance of plant models and presents the results of a simulation of a loss-of-feedwater heater transients which was used to assess the performance of the balance of plant models
Mixing and CP-violation in the Bd and Bs systems at ATLAS
Wharton, Andrew Mark; The ATLAS collaboration
2016-01-01
Search for deviations from the standard model is performed in the systems of the neutral B mesons. The Bs system is studied in the decay into J/psi phi. The mixing phase phi_s and the width difference DeltaGamma_s are determined through the simultaneous study of angular distributions in the final state and of the decay time, performed together with flavour tagging at production. The measurement performed by ATLAS with the full LHC Run-1 sample is discussed and compared to the previous world average. The width difference DeltaGamma_d in the Bd system is obtained from the comparison of the decay time distributions in the flavour specific state J/psi K* and in the CP eigenstate J/psi KS. The result obtained from the full sample of data collected by ATLAS at 7 and 8 TeV is the most accurate single measurement of the width difference currently available.
PLANETS AROUND THE K-GIANTS BD+20 274 AND HD 219415
International Nuclear Information System (INIS)
Gettel, S.; Wolszczan, A.; Niedzielski, A.; Nowak, G.; Adamów, M.; Zieliński, P.; Maciejewski, G.
2012-01-01
We present the discovery of planet-mass companions to two giant stars by the ongoing Penn State-Toruń Planet Search conducted with the 9.2 m Hobby-Eberly Telescope. The less massive of these stars, K5-giant BD+20 274, has a 4.2 M J minimum mass planet orbiting the star at a 578 day period and a more distant, likely stellar-mass companion. The best currently available model of the planet orbiting the K0-giant HD 219415 points to a ∼> Jupiter-mass companion in a 5.7 year, eccentric orbit around the star, making it the longest period planet yet detected by our survey. This planet has an amplitude of ∼18 m s –1 , comparable to the median radial velocity 'jitter', typical of giant stars.
Hang, Feng; Wang, Qinbo; Hong, Qing; Liu, Peiyi; Wu, Zhengjun; Liu, Zhenmin; Zhang, Hao; Chen, Wei
2016-04-01
In this study, a milk-clotting enzyme (MCE) isolated from Paenibacillus spp. BD3526 was purified and characterized. The MCE was purified 8.9-fold with a 10.11% recovery using ammonium sulfate precipitation and anion-exchange chromatography and the specific milk-clotting activity (MCA) reached 6791.73 SU/mg. The enzyme was characterized as a 35kDa metalloproteinase, and the zymogen of which was encoded by a 1671 bp gene named zinc metalloproteinase precursor (zmp) with a predicted molecular weight of 59.6 kDa. The optimal temperature for MCA and proteolytic activity (PA) was 65°C and 60°C, respectively. The enzyme was stable over a pH range of 5.0-9.0 and at temperatures below 50°C. The MCA was completely inactivated when the enzyme was heated at 60°C for 30 min, and the PA was totally inactivated for 20 and 10 min when the enzyme was heated at 55°C and 60°C, respectively. The BD3526 enzyme was preferentially active towards κ-casein (κ-CN) and β-casein (β-CN), as determined by sodium dodecyl sulfate-polyacrylamide gels (SDS-PAGE), whereas the hydrolysis of αs-casein (αs-CN) was slow and comparable to that caused by chymosin and asparatic acid proteinase from Rhizomucor miehei. The cleavage site of the metalloproteinase in κ-CN was located at the Met106-Ala107 bond, as determined by mass spectrometry analysis. Copyright © 2016. Published by Elsevier B.V.
Highly efficient decolorization of Malachite Green by a novel Micrococcus sp. strain BD15.
Du, Lin-Na; Zhao, Ming; Li, Gang; Zhao, Xiao-Ping; Zhao, Yu-Hua
2011-08-01
Malachite Green (MG) is used for a variety of applications but is also known to be carcinogenic and mutagenic. In this study, a novel Micrococcus sp. (strain BD15) was observed to efficiently decolorize MG. The purposes of this study were to explore the optimal conditions for decolorization and to evaluate the potential use of this strain for MG decolorization. Optical microscope and UV-visible analyses were carried out to determine whether the decolorization was due to biosorption or biodegradation. A Plackett-Burman design was employed to investigate the effect of various parameters on decolorization, and response surface methodology was then used to explore the optimal decolorization conditions. Kinetics analysis and antimicrobial activity tests were also performed. The results indicated that the decolorization by the strain was mainly due to biodegradation. Concentrations of MG, urea, and yeast extract and inoculum size had significantly positive effects on MG decolorization, while concentrations of CuCl(2) and MgCl(2), and temperature had significantly negative effects. The interaction between different parameters could significantly affect decolorization, and the optimal conditions for decolorization were 1.0 g/L urea, 0.9 g/L yeast extract, 100 mg/L MG, 0.1 g/L inoculums (dry weight), and incubation at 25.2°C. Under the optimal conditions, 96.9% of MG was removed by the strain within 1 h, which represents highly efficient microbial decolorization. Moreover, the kinetic data for decolorization fit a second-order model well, and the strain showed a good MG detoxification capability. Based on the results of this study, we propose Micrococcus sp. strain BD15 as an excellent candidate strain for MG removal from wastewater.
PHOTOIONIZATION MODELS OF THE INNER GASEOUS DISK OF THE HERBIG BE STAR BD+65 1637
Energy Technology Data Exchange (ETDEWEB)
Patel, P.; Sigut, T. A. A.; Landstreet, J. D., E-mail: ppatel54@uwo.ca [Department of Physics and Astronomy, The University of Western Ontario, London, Ontario Canada N6A 3K7 (Canada)
2016-01-20
We attempt to constrain the physical properties of the inner, gaseous disk of the Herbig Be star BD+65 1637 using non-LTE, circumstellar disk codes and observed spectra (3700–10500 Å) from the ESPaDOnS instrument on the Canada–France–Hawaii Telescope. The photoionizing radiation of the central star is assumed to be the sole source of input energy for the disk. We model optical and near-infrared emission lines that are thought to form in this region using standard techniques that have been successful in modeling the spectra of classical Be stars. By comparing synthetic line profiles of hydrogen, helium, iron, and calcium with the observed line profiles, we try to constrain the geometry, density structure, and kinematics of the gaseous disk. Reasonable matches have been found for all line profiles individually; however, no disk density model based on a single power law for the equatorial density was able to simultaneously fit all of the observed emission lines. Among the emission lines, the metal lines, especially the Ca ii IR triplet, seem to require higher disk densities than the other lines. Excluding the Ca ii lines, a model in which the equatorial disk density falls as 10{sup −10} (R{sub *}/R){sup 3} g cm{sup −3} seen at an inclination of 45° for a 50 R{sub *} disk provides reasonable matches to the overall line shapes and strengths. The Ca ii lines seem to require a shallower drop-off as 10{sup −10} (R{sub *}/R){sup 2} g cm{sup −3} to match their strength. More complex disk density models are likely required to refine the match to the BD+65 1637 spectrum.
Veldhuizen, E.J.; Dijk, van A.; Tersteeg, M.H.; Kalkhove, S.I.; Meulen, van der J.; Niewold, T.A.; Haagsman, H.P.
2007-01-01
Defensins are antimicrobial peptides that play an important role in the innate immune response in the intestine. Up to date, only one ß-defensin (pBD-1), has been described in pig, which was found to be expressed at low levels in the intestine. We set-up a quantitative PCR method to detect the gene
Robustness Property of Robust-BD Wald-Type Test for Varying-Dimensional General Linear Models
Directory of Open Access Journals (Sweden)
Xiao Guo
2018-03-01
Full Text Available An important issue for robust inference is to examine the stability of the asymptotic level and power of the test statistic in the presence of contaminated data. Most existing results are derived in finite-dimensional settings with some particular choices of loss functions. This paper re-examines this issue by allowing for a diverging number of parameters combined with a broader array of robust error measures, called “robust- BD ”, for the class of “general linear models”. Under regularity conditions, we derive the influence function of the robust- BD parameter estimator and demonstrate that the robust- BD Wald-type test enjoys the robustness of validity and efficiency asymptotically. Specifically, the asymptotic level of the test is stable under a small amount of contamination of the null hypothesis, whereas the asymptotic power is large enough under a contaminated distribution in a neighborhood of the contiguous alternatives, thus lending supports to the utility of the proposed robust- BD Wald-type test.
13 CFR 124.503 - How does SBA accept a procurement for award through the 8(a) BD program?
2010-01-01
... under the 8(a) BD program. (g) Basic Ordering Agreements (BOAs). A Basic Ordering Agreement (BOA) is not a contract under the FAR. See 48 CFR 16.703(a). Each order to be issued under the BOA is an... BOA in addition to offering and accepting the BOA itself. (1) SBA will not accept for award on a sole...
13 CFR 124.203 - What must a concern submit to apply to the 8(a) BD program?
2010-01-01
... to, financial statements, Federal personal and business tax returns, and personal history statements... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false What must a concern submit to apply to the 8(a) BD program? 124.203 Section 124.203 Business Credit and Assistance SMALL BUSINESS...
2010-05-17
...., Monday through Friday, except Federal holidays. Examining the AD Docket You may examine the AD docket on....m. and 5 p.m., Monday through Friday, except Federal holidays. The AD docket contains this AD, the... BD-100-1A10 (Challenger 300) airplanes, having serial numbers (S/Ns) 20001 through 20274 inclusive...
International Nuclear Information System (INIS)
Ipe, N.E.; Busick, D.D.; Pollock, R.W.
1987-08-01
The BD-100 is a bubble detector available commercially from Chalk River Nuclear Laboratories, Canada for neutron dosimetry. According to the manufacturer, the BD-100 detects neutrons over an energy range of 100 keV to 14 MeV and the dose equivalent response is independent of energy. The sensitivity of the detector is dependent upon its temperature at the time of irradiation. The sensitized detector self-nucleates upon sharp impact and when heated to temperatures of 48 0 C or greater. The BD-100 is insensitive to low energy gamma rays but responds to 6 MeV photons. The sensitivity (bubbles/μSv) of the BD-100 was found to be energy dependent when exposed to standard neutron sources with average energies ranging from 0.5 to 4.5 MeV. The bubbles formed upon irradiation continued to grow in size with time. The response of electrochemically etched CR-39 to the same neutron sources is also reported for comparison
Lee, M.Y.; Yan, L.J.; Gorter, F.A.; Kim, B.Y.T.; Cui, Y.; Hu, Y.; Yuan, C.; Grindheim, J.; Ganesan, U.; Liu, Z.Y.; Han, C.G.; Yu, J.L.; Li, D.W.; Jackson, A.O.
2012-01-01
Barley stripe mosaic virus North Dakota 18 (ND18), Beijing (BJ), Xinjiang (Xi), Type (TY) and CV21 strains are unable to infect the Brachypodium distachyon Bd3-1 inbred line, which harbours a resistance gene designated Bsr1, but the Norwich (NW) strain is virulent on Bd3-1. Analysis of ND18 and NW
Paulus, Angela; Rossius, Sebastiaan Gijsbertus Hendrik; Dijk, Madelon; de Vries, Simon
2012-01-01
The quinol-linked cytochrome bd oxidases are terminal oxidases in respiration. These oxidases harbor a low spin heme b558 that donates electrons to a binuclear heme b595/heme d center. The reaction with O2 and subsequent catalytic steps of the Escherichia coli cytochrome bd-I oxidase were investigated by means of ultra-fast freeze-quench trapping followed by EPR and UV-visible spectroscopy. After the initial binding of O2, the O–O bond is heterolytically cleaved to yield a kinetically competent heme d oxoferryl porphyrin π-cation radical intermediate (compound I) magnetically interacting with heme b595. Compound I accumulates to 0.75–0.85 per enzyme in agreement with its much higher rate of formation (∼20,000 s−1) compared with its rate of decay (∼1,900 s−1). Compound I is next converted to a short lived heme d oxoferryl intermediate (compound II) in a phase kinetically matched to the oxidation of heme b558 before completion of the reaction. The results indicate that cytochrome bd oxidases like the heme-copper oxidases break the O–O bond in a single four-electron transfer without a peroxide intermediate. However, in cytochrome bd oxidases, the fourth electron is donated by the porphyrin moiety rather than by a nearby amino acid. The production of reactive oxygen species by the cytochrome bd oxidase was below the detection level of 1 per 1000 turnovers. We propose that the two classes of terminal oxidases have mechanistically converged to enzymes in which the O–O bond is broken in a single four-electron transfer reaction to safeguard the cell from the formation of reactive oxygen species. PMID:22287551
International Nuclear Information System (INIS)
White, B.; Ebert, D.; Munno, F.
1990-01-01
Other investigators have evaluated the dose response of neutron bubble dosimeters for possible use as personnel monitors for the U.S. Navy in low level radiation fields. In addition to dose measurements, these devices have been modified to measure the neutron energy spectra. These methods tend to be cumbersome, inaccurate, or both and do not use the same devices as employed in the dosimetry. The BD-100R dosimeter used in this work consists of a test tube containing an elastic polymer with interspersed droplets of two types of Freon; Freon-12 and Freon-114. Each superheated liquid droplet is a potential nucleation site. The minimum energy needed to form a bubble from the nucleation site is given by, E = 16πγ 3 (T)/3(ΔP) 2 , where ΔP is the difference between the vapor pressure of the droplet and the applied pressure. Upon reaching a critical radius, a bubble becomes unstable and grows in size. It may be seen from this equation that the energy deposition required for bubble formation is inversely proportional to the square of the pressure difference. The number of bubbles formed continually decreases with increasing applied pressure, until a pressure is reached where no bubbles are formed since the energy transferred can no longer vaporize the Freon. This investigation is intended to demonstrate the determination of an unknown spectrum utilizing the dosimeter response (number of bubbles formed) as a function of the neutron energy (applied pressure). A set of 12 dosimeters was initially exposed outside the East Beam Port (EBP) at the Maryland University Training Reactor (MUTR). The dosimeters were inside a pressure chamber which could accommodate up to 18 dosimeters. The same set of dosimeters were irradiated using a paraffin moderated PuBe source for which the neutron energy spectrum is unknown. There were eight exposures of six dosimeters at varied pressures in the EBP. The average number of bubbles and standard deviation was measured for each pressure. Data
Bouvier d'Yvoire, Madeleine; Bouchabke-Coussa, Oumaya; Voorend, Wannes; Antelme, Sébastien; Cézard, Laurent; Legée, Frédéric; Lebris, Philippe; Legay, Sylvain; Whitehead, Caragh; McQueen-Mason, Simon J; Gomez, Leonardo D; Jouanin, Lise; Lapierre, Catherine; Sibout, Richard
2013-02-01
Brachypodium distachyon (Brachypodium) has been proposed as a model for grasses, but there is limited knowledge regarding its lignins and no data on lignin-related mutants. The cinnamyl alcohol dehydrogenase (CAD) genes involved in lignification are promising targets to improve the cellulose-to-ethanol conversion process. Down-regulation of CAD often induces a reddish coloration of lignified tissues. Based on this observation, we screened a chemically induced population of Brachypodium mutants (Bd21-3 background) for red culm coloration. We identified two mutants (Bd4179 and Bd7591), with mutations in the BdCAD1 gene. The mature stems of these mutants displayed reduced CAD activity and lower lignin content. Their lignins were enriched in 8-O-4- and 4-O-5-coupled sinapaldehyde units, as well as resistant inter-unit bonds and free phenolic groups. By contrast, there was no increase in coniferaldehyde end groups. Moreover, the amount of sinapic acid ester-linked to cell walls was measured for the first time in a lignin-related CAD grass mutant. Functional complementation of the Bd4179 mutant with the wild-type BdCAD1 allele restored the wild-type phenotype and lignification. Saccharification assays revealed that Bd4179 and Bd7591 lines were more susceptible to enzymatic hydrolysis than wild-type plants. Here, we have demonstrated that BdCAD1 is involved in lignification of Brachypodium. We have shown that a single nucleotide change in BdCAD1 reduces the lignin level and increases the degree of branching of lignins through incorporation of sinapaldehyde. These changes make saccharification of cells walls pre-treated with alkaline easier without compromising plant growth. © 2012 The Authors The Plant Journal © 2012 Blackwell Publishing Ltd.
Albertet, “En amor trob tantz de mals seignoratges” (BdT 16.13
Directory of Open Access Journals (Sweden)
Francesca Sanguineti
2008-12-01
Full Text Available The article provides a commentary and a new critical edition of Albertet’s poem “En amor trob tantz de mals seignoratges”, in which the troubadour praises some of the most courtly ladies of his time. The poem can be linked to the genre of the collective eulogy, where the enumerated ladies are praised essentially for political reasons, since the commendation is clearly addressed to the men hidden behind them: famous specimena of this genre are the ‘tournoiements des dames’ by Huon d’Oisy and Richard de Semilli and Raimbaut de Vaqueiras’ “Carros” (BdT 392.32. Albertet’s song starts with a misogynic tone, since the poet declares that celebrating or loving ladies is worthless, given their immoral behaviour, and with a polemic against the strict rules of courtly love. This misogyny, as is further discovered, is a rhetorical device to praise women as well as a tool to renew the genre of the love song from a thematic point of view.
Agrowaste to vanillin conversion by a natural Pediococcus acidilactici strain BD16.
Chakraborty, Debkumar; Kaur, Baljinder; Obulisamy, Karthikeyan; Selvam, Ammaiyappan; Wong, Jonathan W C
2017-07-01
Owing to its flavoring, antimicrobial, antioxidant and anticarcinogenic nature, vanillin is widely used in foods, beverages, perfumes and pharmaceutical products. Ferulic acid (FA) is an important precursor of vanillin which is abundant in cereals like maize, rice and wheat and sugar beet. A major drawback of microbial vanillin production from FA is the degradation and biotransformation of toxic vanillin to other phenolic derivatives. The present study is undertaken to explore microbial vanillin production from FA precursor rice bran by employing vanillin-resistant Pediococcus acidilactici BD16, a natural lactic acid bacteria isolate. Extracellular, intracellular and cellular vanillin dehydrogenase activity was found least, which was minimized vanillin degradation, and the strain resists more than 5 g L -1 vanillin in the medium. A metabolomics approach was followed for the detection of FA, vanillin and other metabolites generated during fermentation of rice bran medium. A metabolic pathway was also predicted for vanillin biosynthesis. Approximately 1.06 g L -1 of crude vanillin was recovered from rice-bran-containing medium and this further offers scope for the industrial utilization of the organism and its genetic manipulation to enhance production of biovanillin.
Chakraborty, Debkumar; Selvam, Ammaiyappan; Kaur, Baljinder; Wong, Jonathan Woon Chung; Karthikeyan, Obulisamy Parthiba
2017-07-01
Biotechnological production of vanillin is gaining momentum as the natural synthesis of vanillin that is very expensive. Ferulic acid (FA), a costly compound, is used as the substrate to produce vanillin biotechnologically and the making process is still expensive. Therefore, this study investigated the practical use of an agrobiomass waste, rice bran, and provides the first evidence of a cost-effective production of vanillin within 24 h of incubation using recombinant Pediococcus acidilactici BD16 (fcs + /ech + ). Introduction of two genes encoding feruloyl CoA synthetase and enoyl CoA hydratase into the native strain increased vanillin yield to 4.01 g L -1 . Bioconversion was monitored through the transformation of phenolic compounds. A hypothetical metabolic pathway of rice bran during the vanillin bioconversion was proposed with the inserted pathway from ferulic acid to vanillin and compared with that of other metabolic engineered strains. These results could be a gateway of using recombinant lactic acid bacteria for industrial production of vanillin from agricultural waste.
BD+15 2940 AND HD 233604: TWO GIANTS WITH PLANETS CLOSE TO THE ENGULFMENT ZONE
International Nuclear Information System (INIS)
Nowak, G.; Niedzielski, A.; Adamów, M.; Maciejewski, G.; Wolszczan, A.
2013-01-01
We report the discovery of planetary-mass companions to two red giants by the ongoing Penn State-Toruń Planet Search (PTPS) conducted with the 9.2 m Hobby-Eberly Telescope. The 1.1 M ☉ K0-giant, BD+15 2940, has a 1.1 M J minimum mass companion orbiting the star at a 137.5 day period in a 0.54 AU orbit what makes it the closest—in planet around a giant and possible subject of engulfment as the consequence of stellar evolution. HD 233604, a 1.5 M ☉ K5-giant, is orbited by a 6.6 M J minimum mass planet which has a period of 192 days and a semi-major axis of only 0.75 AU making it one of the least distant planets to a giant star. The chemical composition analysis of HD 233604 reveals a relatively high 7 Li abundance which may be a sign of its early evolutionary stage or recent engulfment of another planet in the system. We also present independent detections of planetary-mass companions to HD 209458 and HD 88133, and stellar activity-induced radial velocity variations in HD 166435, as part of the discussion of the observing and data analysis methods used in the PTPS project.
Rocchetti, Talita T; Silbert, Suzane; Gostnell, Alicia; Kubasek, Carly; Campos Pignatari, Antonio C; Widen, Raymond
2017-03-01
A new multiplex PCR test was designed to detect Mycobacterium chelonae, Mycobacterium abscessus group, and Mycobacterium fortuitum complex on the BD MAX System. A total of 197 clinical samples previously submitted for mycobacterial culture were tested using the new protocol. Samples were first treated with proteinase K, and then each sample was inoculated into the BD MAX Sample Buffer Tube. Extraction and multiplex PCR were performed by the BD MAX System, using the BD MAX ExK TNA-3 extraction kit and BD TNA Master Mix, along with specific in-house designed primers and probes for each target. The limit of detection of each target, as well as specificity, was evaluated. Of 197 clinical samples included in this study, 133 were positive and 60 were negative for mycobacteria by culture, and another 4 negative samples were spiked with M. chelonae ATCC 35752. The new multiplex PCR on the BD MAX had 97% concordant results with culture for M. abscessus group detection, 99% for M. chelonae, and 100% for M. fortuitum complex. The new multiplex PCR test performed on the BD MAX System proved to be a sensitive and specific test to detect M. chelonae, M. abscessus group, and M. fortuitum complex by real-time PCR on an automated sample-in results-out platform. Copyright © 2017 American Society for Investigative Pathology and the Association for Molecular Pathology. Published by Elsevier Inc. All rights reserved.
Directory of Open Access Journals (Sweden)
Eun-Bin Bae
2018-01-01
Full Text Available This study was undertaken to evaluate the effect of 3D printed polycaprolactone (PCL/β-tricalcium phosphate (β-TCP scaffold containing bone demineralized and decellularized extracellular matrix (bdECM and human recombinant bone morphogenetic protein-2 (rhBMP-2 on bone regeneration. Scaffolds were divided into PCL/β-TCP, PCL/β-TCP/bdECM, and PCL/β-TCP/bdECM/BMP groups. In vitro release kinetics of rhBMP-2 were determined with respect to cell proliferation and osteogenic differentiation. These three reconstructive materials were implanted into 8 mm diameter calvarial bone defect in male Sprague-Dawley rats. Animals were sacrificed four weeks after implantation for micro-CT, histologic, and histomorphometric analyses. The findings obtained were used to calculate new bone volumes (mm3 and new bone areas (%. Excellent cell bioactivity was observed in the PCL/β-TCP/bdECM and PCL/β-TCP/bdECM/BMP groups, and new bone volume and area were significantly higher in the PCL/β-TCP/bdECM/BMP group than in the other groups (p<.05. Within the limitations of this study, bdECM printed PCL/β-TCP scaffolds can reproduce microenvironment for cells and promote adhering and proliferating the cells onto scaffolds. Furthermore, in the rat calvarial defect model, the scaffold which printed rhBMP-2 loaded bdECM stably carries rhBMP-2 and enhances bone regeneration confirming the possibility of bdECM as rhBMP-2 carrier.
DEFF Research Database (Denmark)
Skovgaard, Sissel; Larsen, Helle Kiellberg; Sand, Carsten
2012-01-01
for Chlamydia trachomatis testing were also examined for GC on the BD Viper™ platform using the BD Probetec ET system. In order to avoid false-positive results all GC BD reactive samples were re-tested using a PCR method with the porA pseudogene as target. Using this method we screened 170% more samples for GC...
A business case for on-site generation: The BD biosciences pharmingen project
Energy Technology Data Exchange (ETDEWEB)
Firestone, Ryan; Creighton, Charles; Bailey, Owen; Marnay, Chris; Stadler, Michael
2003-09-01
Deregulation is haltingly changing the United States electricity markets. The resulting uncertainty and/or rising energy costs can be hedged by generating electricity on-site and other benefits, such as use of otherwise wasted heat, can be captured. The Public Utility Regulatory Policy Act (PURPA) of 1978 first invited relatively small-scale generators ({ge} 1 MW) into the electricity market. The advent of efficient and reliable small scale and renewable equipment has spurred an industry that has, in recent years, made even smaller (business scale) electricity generation an economically viable option for some consumers. On-site energy capture and/or conversion, known as distributed energy resources (DER), offers consumers many benefits, such as economic savings and price predictability, improved reliability, control over power quality, and emissions reductions. Despite these benefits, DER adoption can be a daunting move to a customer accustomed to simply paying a monthly utility bill. San Diego is in many ways an attractive location for DER development: It has high electricity prices typical of California and a moderate climate i.e. energy loads are consistent throughout the year. Additionally, the price shock to San Diego Gas and Electric (SDG&E) customers during the summer of 2000 has interested many in alternatives to electricity price vulnerability. This report examines the business case for DER at the San Diego biotechnology supply company, BD Biosciences Pharmingen, which considered DER for a building with 200-300 kW base-load, much of which accommodates the refrigerators required to maintain chemicals. Because of the Mediterranean climate of the San Diego area and the high rate of air changes required due to on-site use of chemicals, modest space heating is required throughout the year. Employees work in the building during normal weekday business hours, and daily peak loads are typically about 500 kW.
BD -22 5866: A Low-Mass, Quadruple-lined Spectroscopic and Eclipsing Binary
Shkolnik, Evgenya; Liu, Michael C.; Reid, I. Neill; Hebb, Leslie; Cameron, Andrew C.; Torres, Carlos A.; Wilson, David M.
2008-08-01
We report our discovery of an extremely rare, low-mass, quadruple-lined spectroscopic binary BD -22 5866 (=NLTT 53279, integrated spectral type = M0 V), found during an ongoing search for the youngest M dwarfs in the solar neighborhood. From the cross-correlation function, we are able to measure relative flux levels, estimate the spectral types of the components, and set upper limits on the orbital periods and separations. The resulting system is hierarchical, composed of a K7 + K7 binary and an M1 + M2 binary with semimajor axes of aAsin iA system was unresolved with published adaptive optics imaging, limits the projected physical separation of the two binaries at the time of the observation to dABlesssim 4.1 AU at the photometric distance of 51 pc. The maximum observed radial velocity difference between the A and B binaries limits the orbit to aABsin iAB systems, we speculate that an early dynamical process reduced the size of the system, such as the interaction of the two binaries with a circumquadruple disk. Intensive photometric, spectroscopic, and interferometric monitoring, as well as a parallax measurement of this rare quadruple system, is certainly warranted. Based on observations collected at the W. M. Keck Observatory and the Canada-France-Hawaii Telescope (CFHT). The Keck Observatory is operated as a scientific partnership between the California Institute of Technology, the University of California, and NASA, and was made possible by the generous financial support of the W. M. Keck Foundation. The CFHT is operated by the National Research Council of Canada, the Centre National de la Recherche Scientifique of France, and the University of Hawaii.
Coorevits, L; Van den Abeele, A-M
2015-07-01
The yield of blood cultures is proportional to the volume of blood cultured. We evaluated an automatic blood volume monitoring system, recently developed by Becton Dickinson within its BACTEC EpiCenter module, that calculates mean volumes of negative aerobic bottles and generates boxplots and histograms. First, we evaluated the filling degree of 339 aerobic glass blood cultures by calculating the weight-based volume for each bottle. A substantial amount of the bottles (48.3%) were inadequately filled. Evaluation of the accuracy of the monitoring system showed a mean bias of -1.4 mL (-15.4%). Additional evaluation, using the amended software on 287 aerobic blood culture bottles, resulted in an acceptable mean deviation of -0.3 mL (-3.3%). The new software version was also tested on 200 of the recently introduced plastic bottles, which will replace the glass bottles in the near future, showing a mean deviation of +2.8 mL (+26.7%). In conclusion, the mean calculated volumes can be used for the training of a single phlebotomist. However, filling problems appear to be masked when using them for phlebotomist groups or on wards. Here, visual interpretation of boxplots and histograms can serve as a useful tool to observe the spread of the filling degrees and to develop a continuous improvement program. Re-adjustment of the software has proven to be necessary for use with plastic bottles. Due to our findings, BD has developed further adjustments to the software for validated use with plastic bottles, which will be released soon.
Directory of Open Access Journals (Sweden)
Chong Kong T
2006-09-01
Full Text Available Abstract Background Epithelial defensins including human β-defensins (hBDs and α-defensins (HDs are antimicrobial peptides that play important roles in the mucosal defense system. However, the role of defensins in papillomavirus induced epithelial lesions is unknown. Results Papilloma tissues were prospectively collected from 15 patients with recurrent respiratory papillomatosis (RRP and analyzed for defensins and chemokine IL-8 expression by quantitative, reverse-transcriptase polymerase chain reaction (RT-PCR assays. HBD-1, -2 and -3 mRNAs were detectable in papilloma samples from all RRP patients and the levels were higher than in normal oral mucosal tissues from healthy individuals. Immunohistochemical analysis showed that both hBD-1 and 2 were localized in the upper epithelial layers of papilloma tissues. Expression of hBD-2 and hBD-3 appeared to be correlated as indicated by scatter plot analysis (r = 0.837, p Conclusion Human β-defensins are upregulated in respiratory papillomas. This novel finding suggests that hBDs might contribute to innate and adaptive immune responses targeted against papillomavirus-induced epithelial lesions.
Energy Technology Data Exchange (ETDEWEB)
Olsen, Jørn Eirik [Institute for Energy Technology, Physics Department, P.O. Box 40, NO-2027 Kjeller (Norway); Karen, Pavel [University of Oslo, Department of Chemistry, P.O. Box 1033 Blindern, NO-0315 Oslo (Norway); Sørby, Magnus H. [Institute for Energy Technology, Physics Department, P.O. Box 40, NO-2027 Kjeller (Norway); Hauback, Bjørn C., E-mail: bjorn.hauback@ife.no [Institute for Energy Technology, Physics Department, P.O. Box 40, NO-2027 Kjeller (Norway)
2014-02-25
Graphical abstract: Interactions that order the BD{sub 4}{sup -} tetrahedra below the order–disorder transition became increasingly frustrated by the solute in the Na({sup 11}BD{sub 4}){sub 1−x}Cl{sub x} solid solutions, and the order disappears at x = 0.158. Highlights: • The order–disorder transition temperature for Na(BH{sub 4}){sub 1−x}Cl{sub x} and Na({sup 11}BD{sub 4}){sub 1−x}Cl{sub x} is highly dependent on the Cl-content, x. • The transition is characterized by DSC for Na({sup 11}BD{sub 4}){sub 1−x}Cl{sub x} for x = 0, 0.10 and 0.15. • No transition is observed for x ⩾ 0.20 on cooling to 8 K. • The crystal structures are reported for Na{sup 11}BD{sub 4} at room temperature and 8 K and Na({sup 11}BD{sub 4}){sub 1−x}Cl{sub x} (x = 0.10, 0.15, 0.20 and 0.25) at 8 K from powder neutron diffraction. -- Abstract: Phase transition associated with anion disordering over two orientations in Na{sup 11}BD{sub 4} (NaBH{sub 4}) and its solid solutions with NaCl, Na({sup 11}BD{sub 4}){sub 1−x}Cl{sub x}, is investigated with powder diffraction (neutron and synchrotron radiation), differential scanning calorimetry and Raman spectroscopy. Upon heating, the transition temperature extrapolated to zero rate of heating is 192.2 K for Na{sup 11}BD{sub 4}, ΔS = 4.41 J/mol K, hysteresis 1.7 K and the volume increase 0.43%. Thermal parameters of the transition in Na({sup 11}BD{sub 4}){sub 1−x}Cl{sub x} follow a colligative-property model of an ideal solution, with x = 0.158(1) as the critical concentration at which the ordering interactions and the transition itself are eliminated. On approaching this limit, the tetragonal distortion of the ordered structure decreases somewhat towards the cubic average, and this is associated with a partial disorder of the tetrahedral anions seen by diffraction methods. In fact, a 3% disorder is already present in the pure solvent of the solid solution (Na{sup 11}BD{sub 4}) at 8 K.
Zhuravel, O V; Gerashchenko, O L; Khetsuriani, M R; Soldatkina, M A; Pogrebnoy, P V
2014-09-01
The study was aimed on analysis of human beta-defensin-1-4 (hBDs) mRNA expression in cultured thyroid cancer cells and evaluation of effects of recombinant hBD-2 (rec-hBD-2) on growth patterns, migration properties and expression of E-cadherin and vimentin in these cells. The study was performed on cultured follicular thyroid cancer WRO cells, papillary thyroid cancer TPC1 cells, and anaplastic thyroid cancer KTC-2 cells. For analysis of hBD-1-4 mRNA expression in thyroid cancer cells, semiquantitative RT-PCR was used. Effects of rec-hBD-2 on cell proliferation, viability, and migration were analyzed using direct cell counting, MTT test, and scratch assay respectively. Expression of vimentin and E-cadherin was evaluated by quantitative PCR (qPCR). By the data of RT-PCR, all three studied thyroid cancer cell lines express hBD-1 and -4 mRNA, but not hBD-2 mRNA, while hBD-3 expression was detected in WRO and KTC-2 cells. The treatment of TPC-1, WRO, and KTC-2 cells with 100-1000 nM rec-hBD-2 resulted in significant concentration-dependent suppression of cell proliferation, viability, and migratory property. By the data of qPCR, significant up-regulation of vimentin expression was registered in KTC-2 and WRO cells treated with 500 nM rec-hBD-2. Significant down-regulation of E-cadherin expression (p cells treated with the defensin. Also, it has been shown that TPC-1 cells treated with 500 nM rec-hBD-2 acquired more elongated morphology. The data demonstrate that hBD-2 in concentrations higher than 100 nM exerts significant concentration-dependent suppression of thyroid cancer cell growth and migration, and affects vimentin and E-cadherin expression dependent on histologic type of thyroid cancer cells.
Directory of Open Access Journals (Sweden)
Agustin Ibanez
Full Text Available BACKGROUND: Adults with bipolar disorder (BD have cognitive impairments that affect face processing and social cognition. However, it remains unknown whether these deficits in euthymic BD have impaired brain markers of emotional processing. METHODOLOGY/PRINCIPAL FINDINGS: We recruited twenty six participants, 13 controls subjects with an equal number of euthymic BD participants. We used an event-related potential (ERP assessment of a dual valence task (DVT, in which faces (angry and happy, words (pleasant and unpleasant, and face-word simultaneous combinations are presented to test the effects of the stimulus type (face vs word and valence (positive vs. negative. All participants received clinical, neuropsychological and social cognition evaluations. ERP analysis revealed that both groups showed N170 modulation of stimulus type effects (face > word. BD patients exhibited reduced and enhanced N170 to facial and semantic valence, respectively. The neural source estimation of N170 was a posterior section of the fusiform gyrus (FG, including the face fusiform area (FFA. Neural generators of N170 for faces (FG and FFA were reduced in BD. In these patients, N170 modulation was associated with social cognition (theory of mind. CONCLUSIONS/SIGNIFICANCE: This is the first report of euthymic BD exhibiting abnormal N170 emotional discrimination associated with theory of mind impairments.
Ibanez, Agustin; Urquina, Hugo; Petroni, Agustín; Baez, Sandra; Lopez, Vladimir; do Nascimento, Micaela; Herrera, Eduar; Guex, Raphael; Hurtado, Esteban; Blenkmann, Alejandro; Beltrachini, Leandro; Gelormini, Carlos; Sigman, Mariano; Lischinsky, Alicia; Torralva, Teresa; Torrente, Fernando; Cetkovich, Marcelo; Manes, Facundo
2012-01-01
Adults with bipolar disorder (BD) have cognitive impairments that affect face processing and social cognition. However, it remains unknown whether these deficits in euthymic BD have impaired brain markers of emotional processing. We recruited twenty six participants, 13 controls subjects with an equal number of euthymic BD participants. We used an event-related potential (ERP) assessment of a dual valence task (DVT), in which faces (angry and happy), words (pleasant and unpleasant), and face-word simultaneous combinations are presented to test the effects of the stimulus type (face vs word) and valence (positive vs. negative). All participants received clinical, neuropsychological and social cognition evaluations. ERP analysis revealed that both groups showed N170 modulation of stimulus type effects (face > word). BD patients exhibited reduced and enhanced N170 to facial and semantic valence, respectively. The neural source estimation of N170 was a posterior section of the fusiform gyrus (FG), including the face fusiform area (FFA). Neural generators of N170 for faces (FG and FFA) were reduced in BD. In these patients, N170 modulation was associated with social cognition (theory of mind). This is the first report of euthymic BD exhibiting abnormal N170 emotional discrimination associated with theory of mind impairments.
Lee, Mi Kyung; Park, Kui Young; Jin, Taewon; Kim, Ju Hee; Seo, Seong Jun
2017-07-01
Eczematous lesions of atopic dermatitis (AD) patients are known to be a source of Staphylococcus aureus (SA) transmission and might be a reservoir for community-associated methicillin-resistant SA (MRSA). The BD Max StaphSR (BD-SR) is a fully automated, multiplex real-time PCR assay for the direct detection and differentiation of SA and MRSA from nasal swab samples. We evaluated the detection rates of SA and MRSA from skin lesions of outpatients with AD using the BD-SR assay, and determined the usefulness of the BD-SR assay. A total of 244 skin swab samples (skin lesions of 213 outpatients with AD and normal skin of 31 healthy controls) were tested directly by using the BD-SR assay. Of the 213 samples from patients with AD, 69 (32.4%) were positive for SA, 6 (8.7%) of which were positive for MRSA. Only 1 (3.2%) of 31 samples from healthy controls was positive for SA. The BD-SR assay is effective for the rapid detection of SA and MRSA from skin swab samples, which can provide important information for managing patients with AD and preventing the spread of MRSA. © The Korean Society for Laboratory Medicine.
Hubble space telescope near-ultraviolet spectroscopy of the bright cemp-no star BD+44°493
International Nuclear Information System (INIS)
Placco, Vinicius M.; Beers, Timothy C.; Smith, Verne V.; Roederer, Ian U.; Cowan, John J.; Frebel, Anna; Filler, Dan; Ivans, Inese I.; Lawler, James E.; Schatz, Hendrik; Sneden, Christopher; Sobeck, Jennifer S.; Aoki, Wako
2014-01-01
We present an elemental-abundance analysis, in the near-ultraviolet (NUV) spectral range, for the extremely metal-poor star BD+44°493 a ninth magnitude subgiant with [Fe/H] =–3.8 and enhanced carbon, based on data acquired with the Space Telescope Imaging Spectrograph on the Hubble Space Telescope. This star is the brightest example of a class of objects that, unlike the great majority of carbon-enhanced metal-poor (CEMP) stars, does not exhibit over-abundances of heavy neutron-capture elements (CEMP-no). In this paper, we validate the abundance determinations for a number of species that were previously studied in the optical region, and obtain strong upper limits for beryllium and boron, as well as for neutron-capture elements from zirconium to platinum, many of which are not accessible from ground-based spectra. The boron upper limit we obtain for BD+44°493, log ε (B) <–0.70, the first such measurement for a CEMP star, is the lowest yet found for very and extremely metal-poor stars. In addition, we obtain even lower upper limits on the abundances of beryllium, log ε (Be) <–2.3, and lead, log ε (Pb) <–0.23 ([Pb/Fe] <+1.90), than those reported by previous analyses in the optical range. Taken together with the previously measured low abundance of lithium, the very low upper limits on Be and B suggest that BD+44°493 was formed at a very early time, and that it could well be a bona-fide second-generation star. Finally, the Pb upper limit strengthens the argument for non-s-process production of the heavy-element abundance patterns in CEMP-no stars.
Suzaku Reveals Helium-burning Products in the X-Ray-emitting Planetary Nebula BD +30 3639
Murashima, M.; Kokubun, M.; Makishima, K.; Kotoku, J.; Murakami, H.; Matsushita, K.; Hayashida, K.; Arnaud, K.; Hamaguchi, K.; Matsumoto, H.
2006-08-01
BD +30 3639, the brightest planetary nebula at X-ray energies, was observed with Suzaku, an X-ray observatory launched on 2005 July 10. Using the X-ray Imaging Spectrometer, the K lines from C VI, O VII, and O VIII were resolved for the first time, and the C/O, N/O, and Ne/O abundance ratios were determined. The C/O and Ne/O abundance ratios exceed the solar value by factors of at least 30 and 5, respectively. These results indicate that the X-rays are emitted mainly by helium-shell-burning products.
$B_{d} \\to K^{*0}\\mu^{+}\\mu^{-}$ as a lab for discovering new physics at LHCb
Skottowe, Hugh
2010-01-01
The analysis of the penguin decay Bd->K*MuMu at LHCb can act as a laboratory for the discovery and understanding of new physics. Through the Operator Product Expansion, the decay kinematics are well understood in both the Standard Model and in a large range of new physics scenarios. The theoretical errors from QCD effects can be characterized and a set of observables have been derived which minimise their influence in measurements. We will describe how these measurements can be made in LHCb with special emphasis on what can be done with a first run of the LHC with a few hundred pb-1 of integrated luminosity.
$B_d \\to K^*\\mu\\mu$ as a lab for discovering new physics at LHCb
Skottowe, H
2010-01-01
The analysis of the penguin decay $B_d \\to K^*\\mu\\mu$ at LHCb can act as a laboratory for the discovery and understanding of new physics. Through the Operator Product Expansion, the decay kinematics are well understood in both the Standard Model and in a large range of new physics scenarios. The theoretical errors from QCD effects can be characterized and a set of observables have been derived which minimise their influence in measurements. We will describe how these measurements can be made in LHCb with special emphasis on what can be done with a first run of the LHC with a few hundred pb$^{-1}$ of integrated luminosity.
Experimental investigations concerning the three particle reaction 19B(d,3α) at 360 keV
International Nuclear Information System (INIS)
Nocken, U.
1976-01-01
In this paper a complete energy angular correlation measurement of the three-particle reaction 10 B(d,3α) with an incident energy of Esub(d) = 360 keV is reported. By the measurement of coincidence events in two detectors complanar to the incident beam under 24 different angles, the 'Dalitz-plane' is covered in a wide region. An exact theory of three-particle reactions with compound nuclei in the final state does not exist, therefore three wellknown model theories are used for comparison. (orig./WL) [de
International Nuclear Information System (INIS)
Wilson, G.E.; Charboneau, B.L.; Dallman, R.J.; Kullberg, C.M.; Wagner, K.C.; Wheatley, P.D.
1984-01-01
Under auspices of the United States Nuclear Regulatory Commission, their primary boiling water reactor safety analysis code (TRAC-BWR) is being assessed with simulations of a wide range of experimental data. The FY-1984 assessment activities were associated with the latest version (TRAC-BD1/MOD1) of this code. Typical results of the assessment studies are given. Conclusions formulated from these results are presented. These calculations relate to the overall applicability of the current code to safety analysis, and to future work which would further enhance the code's quality and ease of use
Jet creation in post-AGB binaries: the circum-companion accretion disk around BD+46°442
Bollen, Dylan; Van Winckel, Hans; Kamath, Devika
2017-11-01
Aims: We aim at describing and understanding binary interaction processes in systems with very evolved companions. Here, we focus on understanding the origin and determining the properties of the high-velocity outflow observed in one such system. Methods: We present a quantitative analysis of BD+46°442, a post-AGB binary that shows active mass transfer that leads to the creation of a disk-driven outflow or jet. We obtained high-resolution optical spectra from the HERMES spectrograph, mounted on the 1.2 m Flemish Mercator Telescope. By performing a time-series analysis of the Hα profile, we identified the different components of the system. We deduced the jet geometry by comparing the orbital phased data with our jet model. In order to image the accretion disk around the companion of BD+46°442, we applied the technique of Doppler tomography. Results: The orbital phase-dependent variations in the Hα profile can be related to an accretion disk around the companion, from which a high-velocity outflow or jet is launched. Our model shows that there is a clear correlation between the inclination angle and the jet opening angle. The latitudinally dependent velocity structure of our jet model shows a good correspondence to the data, with outflow velocities higher than at least 400 km s-1. The intensity peak in the Doppler map might be partly caused by a hot spot in the disk, or by a larger asymmetrical structure in the disk. Conclusions: We show that BD+46°442 is a result of a binary interaction channel. The origin of the fast outflow in this system might be to a gaseous disk around the secondary component, which is most likely a main-sequence star. Our analysis suggests that the outflow has a rather wide opening angle and is not strongly collimated. Our time-resolved spectral monitoring reveals the launching site of the jet in the binary BD+46°442. Similar orbital phase-dependent Hα profiles are commonly observed in post-AGB binaries. Post-AGB binaries provide ideal
The cDNA Cloning and Sequencing of Reindeer β-defensin reBD-1%驯鹿β-防御素reBD-1 cDNA的克隆及序列分析
Institute of Scientific and Technical Information of China (English)
杨银凤; 赵艳芳; 余兴帮; 郝永峰
2006-01-01
从驯鹿舌黏膜上皮组织中提取总RNA,采用RT-PCR技术扩增出reBD-1的cDNA,并重组到pBlueselect T载体,经限制性内切酶谱分析和DNA序列测定,证实所克隆的reBD-1的cDNA为β-防御素,因为该cDNA包含由192个碱基组成的开放读码框(ORF),该ORF编码64个氨基酸残基的前原防御素,该前原防御素含有β-防御素特征性结构即6个在特定位置上的保守半胱氨酸残基.驯鹿β-防御素属首次发现,为更好地了解驯鹿黏膜防御机制有很大的帮助.
International Nuclear Information System (INIS)
Rhee, I.; Cho, D.; Yeon, J.
2003-01-01
Most nuclear power plants in Korea have adopted Ethanolamine(ETA) as a secondary pH control agent to increase the pH at the liquid phase, which may reduce the corrosion in steam generator tubes and moisture separator/reheat system. Along with its beneficial effect of SG protection from corrosion and degradation, the replacement of ammonia with ETA causes the increased generation of spent resin and the reduced run time of demineralizer in steam generator blowdown(SG BD) system. The composition ratio of cation- to anion- exchange resin in SG BD mixed bed should be increased in the ETA chemistry environment to meet the ratio of cation to anion in the aqueous solution, which results in the simultaneous exhaustion of cation and anion exchange resins. The utilization rate of mixed bed is greatest at the cation-to-anion ratio of 95:1 on the theoretical equivalent basis in the solution, but practically highest at that of 22:1 due to the possible inhomogeneous distribution of cation and anion exchange resins in SG BD bed. The run time of the bed could be extended by 30% such that, at that much, the purchase cost of new resin is saved and the production rate of spent resin is reduced. The guideline on the replacement of resin in SG BD bed is not necessary to secure the removal of radioactive particles without the leakage of the primary coolant into the secondary side since all the radioactive ions can be eliminated by SG BD bed with the sufficient time. They are retained during more than one month after their ingress into the SG BD bed without leakage. With the reduced replacement, thus, the SG BD spent resin that comprises 65% of low-level radioactive solid waste can be much cut down
Flechas, Sandra Victoria; Sarmiento, Carolina; Amézquita, Adolfo
2012-09-01
The amphibian chytrid fungus, Batrachochytrium dendrobatidis, Bd, has been implicated in the decimation and extinction of many amphibian populations worldwide, especially at mid and high elevations. Recent studies have demonstrated the presence of the pathogen in the lowlands from Australia and Central America. We extend here its elevational range by demonstrating its presence at the sea level, in the lowland forests of Gorgona Island, off the Pacific coast of Colombia. We conducted two field surveys, separated by four years, and diagnosed Bd by performing polymerase chain reactions on swab samples from the skin of five amphibian species. All species, including the Critically Endangered Atelopus elegans, tested positive for the pathogen, with prevalences between 3.9 % in A. elegans (in 2010) and 52 % in Pristimantis achatinus. Clinical signs of chytridiomycosis were not detected in any species. To our knowledge, this is the first report of B. dendrobatidis in tropical lowlands at sea level, where temperatures may exceed optimal growth temperatures of this pathogen. This finding highlights the need to understand the mechanisms allowing the interaction between frogs and pathogen in lowland ecosystems.
High-resolution 8-13 micron imaging of the planetary nebulae BD + 30 deg 3639 and NGC 6572
International Nuclear Information System (INIS)
Hora, J.L.; Hoffmann, W.F.; Deutsch, L.K.; Fazio, G.G.
1990-01-01
High-resolution midinfrared images of the planetary nebulae BD + 30 deg 3639 and NGC 6572 are presented at 8.3, 8.7, 9.8, 11.2, and 12.4 microns. Analysis of the maps of BD + 30 deg 3639 supports a model in which the infrared emission originates from two spatially distinct components, one which is responsible for the continuum radiation at 8-12 microns and the other which produces the emission-line features. The NGC 6572 images provides evidence for a previously undetected 11.2 micron UIR emission feature. Comparison with radio continuum maps indicates that the distribution of dust is similar to the distribution of ionized gas in each nebula. Various models of source morphology are also investigated. The planetary nebulae DB + 30 deg 3639 and NGC 6572 can be modeled by an optically thin cylinder or a prolate ellipsoid with enhanced equatorial emission. These models reproduce well the general features of the nebula, such as the bipolar lobes of emission and the ring structure. 67 refs
Marschall, L. A.; Torres, G.; Neuhauser, R.
1998-05-01
BVRI Observations of the star BD+05 706, carried out between January, 1997, and April 1998 using the 0.4m reflector and Photometrics CCD camera at the Gettysburg College Observatory, show that the star is an eclipsing binary system with a light curve characteristic of a class of semi-detached binaries known as the "cool Algols". These results are in good agreement with the previous report of BD+05 706 as a cool Algol by Torres, Neuhauser, and Wichmann,(Astron. J., 115, May 1998) who based their classification on the strong X-ray emission detected by Rosat and on a series of spectroscopic observations of the radial velocities of both components of the system obtained at the Oak Ridge Observatory, the Fred L. Whipple Observatory, and the Multiple Mirror Telescope. Only 10 other examples of cool Algols are known, and the current photometric light curve, together with the radial velocity curves obtained previously, allows us to derive a complete solution for the physical parameters of each component, providing important constraints on models for these interesting systems.
Jagodnik, Kathleen M; Koplev, Simon; Jenkins, Sherry L; Ohno-Machado, Lucila; Paten, Benedict; Schurer, Stephan C; Dumontier, Michel; Verborgh, Ruben; Bui, Alex; Ping, Peipei; McKenna, Neil J; Madduri, Ravi; Pillai, Ajay; Ma'ayan, Avi
2017-07-01
The volume and diversity of data in biomedical research have been rapidly increasing in recent years. While such data hold significant promise for accelerating discovery, their use entails many challenges including: the need for adequate computational infrastructure, secure processes for data sharing and access, tools that allow researchers to find and integrate diverse datasets, and standardized methods of analysis. These are just some elements of a complex ecosystem that needs to be built to support the rapid accumulation of these data. The NIH Big Data to Knowledge (BD2K) initiative aims to facilitate digitally enabled biomedical research. Within the BD2K framework, the Commons initiative is intended to establish a virtual environment that will facilitate the use, interoperability, and discoverability of shared digital objects used for research. The BD2K Commons Framework Pilots Working Group (CFPWG) was established to clarify goals and work on pilot projects that address existing gaps toward realizing the vision of the BD2K Commons. This report reviews highlights from a two-day meeting involving the BD2K CFPWG to provide insights on trends and considerations in advancing Big Data science for biomedical research in the United States. Copyright © 2017 Elsevier Inc. All rights reserved.
Institute of Scientific and Technical Information of China (English)
苏丽娜; 杨银凤; 景岚; 曹贵方
2011-01-01
The aim of this experiment was to construct prokaryotic expression vector of reindeer β-defensin-l(reBD-l), induce the expression of reBD-1 fusion protein in E. Coli, and evaluate the bioactivity of the expression products. The prepro-peptide of reBD-1 was amplified by RT-PCR. The mature peptide of encoding reBD-1 was amplified from recombinant cloning vector PMD19T/ reBD-1, and then cloned into pET-32a (+ ), in which reBD-1 fusion protein expression was induced by IPTG in E. Coli BL2KDE3). The expressed product was further cultured and purified for experiment of bacteriostasis in vitro. The results showed that the amplified products of prepro-peptide and mature peptide were 215 and 138 bp, respectively, and the homology of the sequences of the targeted gene and reBD-1 mRNA was up to 100%. The molecular weight of fusion proteins of prepro-peptide and mature peptide were 28 and 24 ku. The agar diffusion method has demonstrated that 0. 08 mg · mL-1 purified mature peptide protein has obvious antimicrobial activity against S. Aureus and E. Coli. From the results we can conclude that the prepro-peptide and mature peptides have high expression level in E. Coli, and the mature peptide has resistance to both Gram negative and Gram positive bacteria.%旨在构建驯鹿β防御素-1(Reindeerβ-defensin-1,reBD-1)基因的原核表达载体pET-32a(+ )/reBD-1,诱导reBD-1融合蛋白在大肠杆菌中表达,并对其表达产物的生物学活性进行评价.利用RT-PCR技术扩增reBD-1前原肽.从重组克隆载体PMD19T/reBD-1中扩增reBD-1成熟肽编码基因,并克隆入pET-32a(+)中,在大肠杆菌BL21 (DE3)中用IPTG诱导表达reBD-1融合蛋白.表达的融合蛋白扩大培养,进一步纯化后进行体外抑菌试验.结果表明,reBD-1前原肽和成熟肽扩增产物大小分别为215和138 bp,目的基因的序列与驯鹿防御素-1 mRNA序列同源性为100%.前原肽和成熟肽融合蛋白分子量分别为28和24 ku.利用琼脂糖扩散法表明,0
Institute of Scientific and Technical Information of China (English)
杨银凤; 郝永峰; 赵艳芳; 余兴帮; 都格尔斯仁
2008-01-01
为了获得驯鹿β-防御素reBD-1全长cDNA序列,根据已获得的reBD-1 cDNA的已知序列设计1条序列特异性引物作为上游引物,反转录引物中的部分序列即3′接舍器引物作为下游引物,克隆reBD-1 cDNA的3′末端序列.另外,采用反向嵌套PCR RACE法,根据reBD-1 cDNA的已知序列,设计1条5′末端磷酸化的特异性反转录引物和2对特异性反向嵌套PCR引物,首先进行反转录(RT),然后将mRNA反转录成的cDNA进行环化,最后进行反向嵌套巢式PCR,克隆reBD-1 cDNA的5′末端序列.结果成功的克隆出了reBD-1 cDNA的3′和5′末端序列,从而得到372 bp的reBD-1 cDNA全序列,其中包含44 bp 5′非翻译区(UTR)、192 bp的开放读码框(ORF)、终止密码子TAA、118 bp的3′UTR和poly(A)15.reBD-1 cDNA全序列的获得为进一步研究其基因结构、基因表达和基因功能奠定了基础.
Directory of Open Access Journals (Sweden)
Sandra Posch
2016-09-01
Full Text Available We here give information for a deeper understanding of single molecule force spectroscopy (SMFS data through the example of the blood protein von Willebrand factor (VWF. It is also shown, how fitting of rupture forces versus loading rate profiles in the molecular dynamics (MD loading-rate range can be used to demonstrate the qualitative agreement between SMFS and MD simulations. The recently developed model by Bullerjahn, Sturm, and Kroy (BSK was used for this demonstration. Further, Brownian dynamics (BD simulations, which can be utilized to estimate the lifetimes of intramolecular VWF interactions under physiological shear, are described. For interpretation and discussion of the methods and data presented here, we would like to directly point the reader to the related research paper, “Mutual A domain interactions in the force sensing protein von Willebrand Factor” (Posch et al., 2016 [1]. Keywords: Atomic force microscopy, Single molecule force spectroscopy, Molecular dynamics simulation, Brownian dynamics simulation, von Willebrand factor
Mixed-oxide (MOX) fuel performance benchmark. Summary of the results for the PRIMO MOX rod BD8
International Nuclear Information System (INIS)
Ott, L.J.; Sartori, E.; Costa, A.; ); Sobolev, V.; Lee, B-H.; Alekseev, P.N.; Shestopalov, A.A.; Mikityuk, K.O.; Fomichenko, P.A.; Shatrova, L.P.; Medvedev, A.V.; Bogatyr, S.M.; Khvostov, G.A.; Kuznetsov, V.I.; Stoenescu, R.; Chatwin, C.P.
2009-01-01
The OECD/NEA Nuclear Science Committee has established an Expert Group that deals with the status and trends of reactor physics, nuclear fuel performance, and fuel cycle issues related to the disposition of weapons-grade plutonium as MOX fuel. The activities of the NEA Expert Group on Reactor-based Plutonium Disposition are carried out in close cooperation with the NEA Working Party on Scientific Issues in Reactor Systems (WPRS). A major part of these activities includes benchmark studies. This report describes the results of the PRIMO rod BD8 benchmark exercise, the second benchmark by the TFRPD relative to MOX fuel behaviour. The corresponding PRIMO experimental data have been released, compiled and reviewed for the International Fuel Performance Experiments (IFPE) database. The observed ranges (as noted in the text) in the predicted thermal and FGR responses are reasonable given the variety and combination of thermal conductivity and FGR models employed by the benchmark participants with their respective fuel performance codes
First intermediate break test 6IB1 data comparison with a TRAC-BD1/MOD1 blind calculation
International Nuclear Information System (INIS)
Wheatley, P.D.
1985-04-01
TRAC-BD1/MOD1 has been used to calculate the behavior in the FIST (Full Integral Test Facility) facility during an intermediate break in one of the recirculation loops. Results of the calculation are compared with the data from the experiment, and the analysis is discussed in this report. The calculation was blind with only the initial and boundary conditions available prior to performance of the calculation. The calculation has been previously documented without reference to the experimental data (i.e., prior to release of the data). This report extends the prior report by discussing the analysis of the data to code comparisons. This work was performed as part of the Nuclear Regulatory Commission's support to the FIST program which is being provided at the Idaho National Engineering Laboratory
Premarket evaluations of the IMDx C. difficile for Abbott m2000 Assay and the BD Max Cdiff Assay.
Stellrecht, K A; Espino, A A; Maceira, V P; Nattanmai, S M; Butt, S A; Wroblewski, D; Hannett, G E; Musser, K A
2014-05-01
Clostridium difficile-associated diarrhea is a well-recognized complication of antibiotic use. Historically, diagnosing C. difficile has been difficult, as antigen assays are insensitive and culture-based methods require several days to yield results. Nucleic acid amplification tests (NAATs) are quickly becoming the standard of care. We compared the performance of two automated investigational/research use only (IUO/RUO) NAATs for the detection of C. difficile toxin genes, the IMDx C. difficile for Abbott m2000 Assay (IMDx) and the BD Max Cdiff Assay (Max). A prospective analysis of 111 stool specimens received in the laboratory for C. difficile testing by the laboratory's test of record (TOR), the BD GeneOhm Cdiff Assay, and a retrospective analysis of 88 specimens previously determined to be positive for C. difficile were included in the study. One prospective specimen was excluded due to loss to follow-up discrepancy analysis. Of the remaining 198 specimens, 90 were positive by all three methods, 9 were positive by TOR and Max, and 3 were positive by TOR only. One negative specimen was initially inhibitory by Max. The remaining 95 specimens were negative by all methods. Toxigenic C. difficile culture was performed on the 12 discrepant samples. True C. difficile-positive status was defined as either positive by all three amplification assays or positive by toxigenic culture. Based on this definition, the sensitivity and specificity were 96.9% and 95% for Max and 92.8% and 100% for IMDx. In summary, both highly automated systems demonstrated excellent performance, and each has individual benefits, which will ensure that they will both have a niche in clinical laboratories.
Marucco, Andrea P; Minervini, Patricia; Snitman, Gabriela V; Sorge, Adriana; Guelfand, Liliana I; Moral, Laura López
2018-02-05
In patients with invasive fungal infections, the accurate and rapid identification of the genus Candida is of utmost importance since antimycotic sensitivity is closely related to the species. The aim of the present study was to compare the identification results of species of the genus Candida obtained by BD Phoenix™ (Becton Dickinson [BD]) and Maldi-TOF MS (Bruker Microflex LT Biotyper 3.1). A total of 192 isolates from the strain collection belonging to the Mycology Network of the Autonomous City of Buenos Aires, Argentina, were analyzed. The observed concordance was 95%. Only 10 strains (5%) were not correctly identified by the BD Phoenix™ system. The average identification time with the Yeast ID panels was 8h 22min. The BD Phoenix™ system proved to be a simple, reliable and effective method for identifying the main species of the genus Candida. Copyright © 2017 Asociación Argentina de Microbiología. Publicado por Elsevier España, S.L.U. All rights reserved.
2010-01-01
... history, if any, of the requirement; (10) The names and addresses of any small business contractors which... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false How does an agency offer a procurement to SBA for award through the 8(a) BD program? 124.502 Section 124.502 Business Credit and...
Wang, Shuchao; Sun, Chenglong; Zhang, Shoufeng; Zhang, Xiaozhuo; Liu, Ye; Wang, Ying; Zhang, Fei; Wu, Xianfu; Hu, Rongliang
2015-09-01
The rabies virus (RABV) glycoprotein (G) is responsible for inducing neutralizing antibodies against rabies virus. Development of recombinant vaccines using the G genes from attenuated strains rather than street viruses is a regular practice. In contrast to this scenario, we generated three human adenovirus type 5 recombinants using the G genes from the vaccine strains SRV9 and Flury-LEP, and the street RABV strain BD06 (nrAd5-SRV9-G, nrAd5-Flury-LEP-G, and nrAd5-BD06-G). These recombinants were non-replicative, but could grow up to ~10(8) TCID50/ml in helper HEK293AD cells. Expression of the G protein was verified by immunostaining, quantitative PCR and cytometry. Animal experiments revealed that immunization with nrAd5-BD06-G can induce a higher seroconversion rate, a higher neutralizing antibody level, and a longer survival time after rabies virus challenge in mice when compared with the other two recombinants. Moreover, the expression of granulocyte-macrophage colony-stimulating factor (GM-CSF) was significantly higher in mice immunized with nrAd5-BD06-G, which might also contribute to the increased protection. These results show that the use of street RABV G for non-replicative systems may be an alternative for developing effective recombinant rabies vaccines.
Mishra, Aditi; Salari, Autoosa; Berigan, Benton R; Miguel, Kayla C; Amirshenava, Marzie; Robinson, Abbey; Zars, Benjamin C; Lin, Jenna L; Milescu, Lorin S; Milescu, Mirela; Zars, Troy
2018-01-17
Extrinsic control of single neurons and neuronal populations is a powerful approach for understanding how neural circuits function. Adding new thermogenetic tools to existing optogenetic and other forms of intervention will increase the complexity of questions that can be addressed. A good candidate for developing new thermogenetic tools is the Drosophila gustatory receptor family, which has been implicated in high-temperature avoidance behavior. We examined the five members of the Gr28b gene cluster for temperature-dependent properties via three approaches: biophysical characterization in Xenopus oocytes, functional calcium imaging in Drosophila motor neurons, and behavioral assays in adult Drosophila. Our results show that Gr28bD expression in Xenopus oocytes produces a non-specific cationic current that is activated by elevated temperatures. This current is non-inactivating and non-voltage dependent. When expressed in Drosophila motor neurons, Gr28bD can be used to change the firing pattern of individual cells in a temperature-dependent fashion. Finally, we show that pan-neuronal or motor neuron expression of Gr28bD can be used to alter fruit fly behavior with elevated temperatures. Together, these results validate the potential of the Gr28bD gene as a founding member of a new class of thermogenetic tools.
Czech Academy of Sciences Publication Activity Database
Janek, T.; Lukaszewicz, M.; Řezanka, Tomáš; Krasowska, A.
2010-01-01
Roč. 101, č. 15 (2010), s. 6118-6123 ISSN 0960-8524 Institutional research plan: CEZ:AV0Z50200510 Keywords : Pseudomonas fluorescens BD5 * Lipopeptide * Pseudofactins Subject RIV: EE - Microbiology, Virology Impact factor: 4.365, year: 2010
Teng, Da; Wang, Xiumin; Xi, Di; Mao, Ruoyu; Zhang, Yong; Guan, Qingfeng; Zhang, Jun; Wang, Jianhua
2014-10-01
The food-borne bacterial gastrointestinal infection is a serious public health threat. Defensins are evolutionarily conserved innate immune components with broad-spectrum antibacterial activity that do not easily induce resistance. AvBD103b, an avian defensin with potent activity against Salmonella enteritidis, was isolated from the stomach contents of the king penguin (Aptenodytes patagonicus). To elucidate further the antibacterial mechanism of AvBD103b, its effect on the S. enteritidis CVCC3377 cell membrane and intracellular DNA was researched. The cell surface hydrophobicity and a N-phenyl-1-naphthylamine uptake assay demonstrated that AvBD103b treatment increased the cell surface hydrophobicity and outer membrane permeability. Atomic absorption spectrometry, ultraviolet spectrophotometry, flow cytometry, and transmission electron microscopy (TEM) indicated that AvBD103b treatment can lead to the release of the cellular contents and cell death through damage of the membrane. DNA gel retardation and circular dichroism analysis demonstrated that AvBD103b interacted with DNA and intercalated into the DNA base pairs. A cell cycle assay demonstrated that AvBD103b affected cellular functions, such as DNA synthesis. Our results confirmed that AvBD103b exerts its antibacterial activity by damaging the cell membrane and interfering with intracellular DNA, ultimately causing cell death, and suggested that AvBD103b may be a promising candidate as an alternative to antibiotics against S. enteritidis.
Institute of Scientific and Technical Information of China (English)
杨银凤; 赵艳芳; 都格尔斯仁; 吴萨日娜
2007-01-01
β-防御素主要是由哺乳动物黏膜上皮细胞产生,分布在机体宿主-环境的界面位置.在本研究中,利用已克隆的驯鹿β-防御素reBD-1 cDNA作为探针,经地高辛标记后再应用原位杂交技术检测reBD-1 mRNA在驯鹿组织内的表达部位.结果显示reBD-1 mRNA表达在舌背表面的复层扁平上皮内,实质性器官肾也表达在肾小管及肾小囊上皮内,而淋巴器官脾脏内reBD-1 mRNA表达在淋巴细胞和红髓的巨噬细胞内.表明驯鹿β-防御素不仅表达在上皮细胞内,而且在非上皮细胞内也有表达,提示reBD-1在黏膜和系统防御中均起着重要的作用.
Gausbert de Poicibot, “Be·s cuget venjar Amors” (BdT 173.2
Directory of Open Access Journals (Sweden)
Francesca Andolfato
2010-09-01
Full Text Available This paper offers a commentary and a new critical edition of Gausbert de Poicibot’s poem “Be·s cuget venjar Amors”, which apparently belongs to the genre of the ‘mala chanso’, that was particularly popular during the period that the Limousin poet was active. To abandon love enables the poet to recuperate reason and ‘sen’ and to justify, almost in didactic terms, his separation from the lady, thus clearly showing that he had so far sung the praises of a lady who was not worthy of receiving them. The song is also compared to other typical examples of the subgenre to which it belongs, such as “Si be·m partetz, mala dompna, de vos” by Gui d’Uissel (BdT 194.19, considered to be paradigmatic of the ‘mala chanso’ and probably familiar to Gausbert de Poicibot, though it will be pointed out that this poetic mode has roots in the work of troubadours of previous generations, such as Bernart de Ventadorn and Raimbaut d’Aurenga, whom Gausbert seems to use as models.
International Nuclear Information System (INIS)
Lombardo, N.J.; Marseille, T.J.; White, M.D.; Lowery, P.S.
1990-06-01
TRUMP-BD (Boil Down) is an extension of the TRUMP (Edwards 1972) computer program for the analysis of nuclear fuel assemblies under severe accident conditions. This extension allows prediction of the heat transfer rates, metal-water oxidation rates, fission product release rates, steam generation and consumption rates, and temperature distributions for nuclear fuel assemblies under core uncovery conditions. The heat transfer processes include conduction in solid structures, convection across fluid-solid boundaries, and radiation between interacting surfaces. Metal-water reaction kinetics are modeled with empirical relationships to predict the oxidation rates of steam-exposed Zircaloy and uranium metal. The metal-water oxidation models are parabolic in form with an Arrhenius temperature dependence. Uranium oxidation begins when fuel cladding failure occurs; Zircaloy oxidation occurs continuously at temperatures above 13000 degree F when metal and steam are available. From the metal-water reactions, the hydrogen generation rate, total hydrogen release, and temporal and spatial distribution of oxide formations are computed. Consumption of steam from the oxidation reactions and the effect of hydrogen on the coolant properties is modeled for independent coolant flow channels. Fission product release from exposed uranium metal Zircaloy-clad fuel is modeled using empirical time and temperature relationships that consider the release to be subject to oxidation and volitization/diffusion (''bake-out'') release mechanisms. Release of the volatile species of iodine (I), tellurium (Te), cesium (Ce), ruthenium (Ru), strontium (Sr), zirconium (Zr), cerium (Cr), and barium (Ba) from uranium metal fuel may be modeled
Gutiérrez-Sacristán, Alba; Guedj, Romain; Korodi, Gabor; Stedman, Jason; Furlong, Laura I; Patel, Chirag J; Kohane, Isaac S; Avillach, Paul
2018-04-15
In the era of big data and precision medicine, the number of databases containing clinical, environmental, self-reported and biochemical variables is increasing exponentially. Enabling the experts to focus on their research questions rather than on computational data management, access and analysis is one of the most significant challenges nowadays. We present Rcupcake, an R package that contains a variety of functions for leveraging different databases through the BD2K PIC-SURE RESTful API and facilitating its query, analysis and interpretation. The package offers a variety of analysis and visualization tools, including the study of the phenotype co-occurrence and prevalence, according to multiple layers of data, such as phenome, exposome or genome. The package is implemented in R and is available under Mozilla v2 license from GitHub (https://github.com/hms-dbmi/Rcupcake). Two reproducible case studies are also available (https://github.com/hms-dbmi/Rcupcake-case-studies/blob/master/SSCcaseStudy_v01.ipynb, https://github.com/hms-dbmi/Rcupcake-case-studies/blob/master/NHANEScaseStudy_v01.ipynb). paul_avillach@hms.harvard.edu. Supplementary data are available at Bioinformatics online.
Minassian, Angela M; Newnham, Robert; Kalimeris, Elizabeth; Bejon, Philip; Atkins, Bridget L; Bowler, Ian C J W
2014-05-04
For the diagnosis of prosthetic joint infection (PJI) automated BACTEC™ blood culture bottle methods have comparable sensitivity, specificity and a shorter time to positivity than traditional cooked meat enrichment broth methods. We evaluate the culture incubation period required to maximise sensitivity and specificity of microbiological diagnosis, and the ability of BACTEC™ to detect slow growing Propionibacteria spp. Multiple periprosthetic tissue samples taken by a standardised method from 332 patients undergoing prosthetic joint revision arthroplasty were cultured for 14 days, using a BD BACTEC™ instrumented blood culture system, in a prospective study from 1st January to 31st August 2012. The "gold standard" definition for PJI was the presence of at least one histological criterion, the presence of a sinus tract or purulence around the device. Cases where > =2 samples yielded indistinguishable isolates were considered culture-positive. 1000 BACTEC™ bottle cultures which were negative after 14 days incubation were sub-cultured for Propionibacteria spp. 79 patients fulfilled the definition for PJI, and 66 of these were culture-positive. All but 1 of these 66 culture-positive cases of PJI were detected within 3 days of incubation. Only one additional (clinically-insignificant) Propionibacterium spp. was identified on terminal subculture of 1000 bottles. Prolonged microbiological culture for 2 weeks is unnecessary when using BACTEC™ culture methods. The majority of clinically significant organisms grow within 3 days, and Propionibacteria spp. are identified without the need for terminal subculture. These findings should facilitate earlier decisions on final antimicrobial prescribing.
SUBSTELLAR-MASS COMPANIONS TO THE K-GIANTS HD 240237, BD +48 738, AND HD 96127
International Nuclear Information System (INIS)
Gettel, S.; Wolszczan, A.; Niedzielski, A.; Nowak, G.; Adamów, M.; Zieliński, P.; Maciejewski, G.
2012-01-01
We present the discovery of substellar-mass companions to three giant stars by the ongoing Penn State-Toruń Planet Search conducted with the 9.2 m Hobby-Eberly Telescope. The most massive of the three stars, K2-giant HD 240237, has a 5.3 M J minimum mass companion orbiting the star at a 746 day period. The K0-giant BD +48 738 is orbited by a ≥0.91 M J planet which has a period of 393 days and shows a nonlinear, long-term radial velocity (RV) trend that indicates a presence of another, more distant companion, which may have a substellar mass or be a low-mass star. The K2-giant HD 96127 has a ≥4.0 M J mass companion in a 647 day orbit around the star. The two K2-giants exhibit a significant RV noise that complicates the detection of low-amplitude, periodic variations in the data. If the noise component of the observed RV variations is due to solar-type oscillations, we show, using all the published data for the substellar companions to giants, that its amplitude is anti-correlated with stellar metallicity.
Lord, Emily; Newnham, Tana; Dorrell, Lucy; Jesuthasan, Gerald; Clarke, Lorraine; Jeffery, Katie; Sherrard, Jackie
2017-03-01
Trichomonas vaginalis (TV) rates in women are increasing and many are asymptomatic. Nucleic acid amplification tests (NAATs) are becoming the 'gold standard' for diagnosis. We aimed to establish our asymptomatic TV rates by testing all women attending Oxfordshire's Sexual Health service, regardless of symptoms, using the BD ProbeTec™ TV Q x NAATs (BDQ x ). During BDQ x 's verification process, the sensitivity and specificity were calculated using results of 220 endocervical samples from symptomatic women, compared with culture. BDQ x was subsequently implemented and prospectively evaluated over 6 months in female attendees. Wet mount microscopy was also performed in symptomatics. Demographic and clinical characteristics of those diagnosed were analysed. From 220 samples tested by BDQ x and culture: 5 were positive on both and one solely using BDQ x , giving a sensitivity and specificity of 100% and 99.53%, respectively. In the prospective cohort, of 5775 BDQ x tests, 33 (0.57%) were positive. 11/33 (33%) patients were asymptomatic. All patients diagnosed had risk factors: age >25 years (85%), residence in a deprived area (79%) and black ethnicity (21%). Despite BDQ x being highly sensitive and specific, with our low TV prevalence universal screening may not be justified. Targeted screening using local demographic data merits further investigation.
Energy Technology Data Exchange (ETDEWEB)
Lombardo, N.J.; Marseille, T.J.; White, M.D.; Lowery, P.S.
1990-06-01
TRUMP-BD (Boil Down) is an extension of the TRUMP (Edwards 1972) computer program for the analysis of nuclear fuel assemblies under severe accident conditions. This extension allows prediction of the heat transfer rates, metal-water oxidation rates, fission product release rates, steam generation and consumption rates, and temperature distributions for nuclear fuel assemblies under core uncovery conditions. The heat transfer processes include conduction in solid structures, convection across fluid-solid boundaries, and radiation between interacting surfaces. Metal-water reaction kinetics are modeled with empirical relationships to predict the oxidation rates of steam-exposed Zircaloy and uranium metal. The metal-water oxidation models are parabolic in form with an Arrhenius temperature dependence. Uranium oxidation begins when fuel cladding failure occurs; Zircaloy oxidation occurs continuously at temperatures above 13000{degree}F when metal and steam are available. From the metal-water reactions, the hydrogen generation rate, total hydrogen release, and temporal and spatial distribution of oxide formations are computed. Consumption of steam from the oxidation reactions and the effect of hydrogen on the coolant properties is modeled for independent coolant flow channels. Fission product release from exposed uranium metal Zircaloy-clad fuel is modeled using empirical time and temperature relationships that consider the release to be subject to oxidation and volitization/diffusion ( bake-out'') release mechanisms. Release of the volatile species of iodine (I), tellurium (Te), cesium (Ce), ruthenium (Ru), strontium (Sr), zirconium (Zr), cerium (Cr), and barium (Ba) from uranium metal fuel may be modeled.
Institute of Scientific and Technical Information of China (English)
吴萨日娜; 赵艳芳; 余兴帮; 都格尔斯仁; 杨银凤
2006-01-01
为了检测reBD-1 mRNA在驯鹿体内可能的表达器官,研究根据已知的reBD-1 cDNA序列设计了一对预计扩增产物为121 bp的引物,以驯鹿舌、食管、瘤胃、网胃、皱胃、十二指肠、回肠、结肠、肝、肺、气管、肾、膀胱、睾丸、附睾、心脏、脾脏中提取的总RNA为模板,采用反转录PCR(RT-PCR)技术检测驯鹿的上述器官内reBD-1 mRNA的表达情况.结果显示:reBD-1 mRNA在上述组织器官中均有表达,其中在舌、瘤胃、睾丸中表达最强;在食管、十二指肠、结肠、气管、脾脏中有中等量的表达;在网胃、皱胃、回肠、肝、肺、肾、膀胱、附睾、心脏内的表达较弱.β-防御素reBD-1在驯鹿体内的广泛表达提示reBD-1有助于驯鹿的先天性宿主防御.
Samalin, L; Honciuc, M; Boyer, L; de Chazeron, I; Blanc, O; Abbar, M; Llorca, P M
2018-04-13
Shared decision-making (SDM) is a model of interaction between doctors and patients in which both actors contribute to the medical decision-making process. SDM has raised great interest in mental healthcare over the last decade, as it is considered a fundamental part of patient-centered care. However, there is no research evaluating the efficacy of SDM compared to usual care (CAU), as it relates to quality of care and more specifically treatment adherence, in bipolar disorder (BD). This is a 12-month multi-centre, cluster-randomized controlled trial comparing the efficacy of SDM to CAU. Adult BD patients (n = 300) will be eligible after stabilization for at least 4 weeks following an acute mood episode. The intervention will consist of applying the standardized SDM process as developed by the Ottawa Hospital Research Institute in order to choose the maintenance treatment of BD. A multidisciplinary team developed a decision aid "choose my long-term treatment with my doctor" for BD patients to clarify possible therapeutic options. Primary outcome will assess the patient's level of adherence (based on hetero-evaluation) of ongoing treatment at 12 months. Secondary outcomes will assess the difference between the 2 groups of patients in terms of adherence to maintenance drug therapy based on other measures (self-assessment scale and plasma levels of mood stabilizers). Additionally, other dimensions will be assessed: decisional conflict, satisfaction with care and involvement in decision making, beliefs about treatment, therapeutic relationship, knowledge about information for medical decision and clinical outcomes (depression, mania, functioning and quality of life). The primary endpoint will be analysed without adjustment by comparison of adherence scores between the two groups using Student t-tests or Mann-Whitney tests according to the variable distribution. A set of secondary analyses will be adjusted for covariates of clinical interest using generalized linear
Energy Technology Data Exchange (ETDEWEB)
Hendrickx, L
2002-07-01
This study focussed on the localization and quantification of natural genetic transformation using neutral and disadvantageous genes in monoculture biofilms to investigate gene transfer and expression of the transferred genes in the absence of a selective advantage. Data obtained by this investigation were regarded as initial steps for evaluating the applicability of adding catabolic traits into the indigenous bacterial community of biofilm reactors by in situ natural genetic transformation. Because Acinetobacter spp. strains are readily found in waste water treatment plants and because Acinetobacter sp. BD413 possesses a high effective level of competence, natural genetic transformation was investigated in monoculture Acinetobacter sp. BD413 biofilms. The genes used for transformation encoded for the green fluorescent protein (GFP) and its variants. Monitoring of transformation events were performed with the use of automated confocal laser scanning microscopy (CLSM) and semi automated digital image processing and analysis. (orig.)
X-RAY OBSERVATIONS OF BOW SHOCKS AROUND RUNAWAY O STARS. THE CASE OF ζ OPH AND BD+43°3654
Energy Technology Data Exchange (ETDEWEB)
Toalá, J. A.; Guerrero, M. A. [Instituto de Astrofísica de Andalucía, IAA-CSIC, Glorieta de la Astronomía s/n, E-18008 Granada (Spain); Oskinova, L. M.; González-Galán, A. [Institute for Physics and Astronomy, University of Potsdam, D-14476 Potsdam (Germany); Ignace, R. [Department of Physics and Astronomy, East Tennessee State University, Johnson City, TN 37614 (United States); Pohl, M., E-mail: toala@iaa.es [Institute of Astronomy and Astrophysics, Academia Sinica (ASIAA), Taipei 10617,Taiwan (China)
2016-04-20
Non-thermal radiation has been predicted within bow shocks around runaway stars by recent theoretical works. We present X-ray observations toward the runaway stars ζ Oph by Chandra and Suzaku and of BD+43°3654 by XMM-Newton to search for the presence of non-thermal X-ray emission. We found no evidence of non-thermal emission spatially coincident with the bow shocks; nonetheless, diffuse emission was detected in the vicinity of ζ Oph. After a careful analysis of its spectral characteristics, we conclude that this emission has a thermal nature with a plasma temperature of T ≈ 2 × 10{sup 6} K. The cometary shape of this emission seems to be in line with recent predictions of radiation-hydrodynamic models of runaway stars. The case of BD+43°3654 is puzzling, as non-thermal emission has been reported in a previous work for this source.
Dalpke, Alexander H; Hofko, Marjeta; Zimmermann, Stefan
2016-09-01
Vancomycin-resistant enterococci (VRE) are an important cause of health care-associated infections, resulting in significant mortality and a significant economic burden in hospitals. Active surveillance for at-risk populations contributes to the prevention of infections with VRE. The availability of a combination of automation and molecular detection procedures for rapid screening would be beneficial. Here, we report on the development of a laboratory-developed PCR for detection of VRE which runs on the fully automated Becton Dickinson (BD) Max platform, which combines DNA extraction, PCR setup, and real-time PCR amplification. We evaluated two protocols: one using a liquid master mix and the other employing commercially ordered dry-down reagents. The BD Max VRE PCR was evaluated in two rounds with 86 and 61 rectal elution swab (eSwab) samples, and the results were compared to the culture results. The sensitivities of the different PCR formats were 84 to 100% for vanA and 83.7 to 100% for vanB; specificities were 96.8 to 100% for vanA and 81.8 to 97% for vanB The use of dry-down reagents and the ExK DNA-2 kit for extraction showed that the samples were less inhibited (3.3%) than they were by the use of the liquid master mix (14.8%). Adoption of a cutoff threshold cycle of 35 for discrimination of vanB-positive samples allowed an increase of specificity to 87.9%. The performance of the BD Max VRE assay equaled that of the BD GeneOhm VanR assay, which was run in parallel. The use of dry-down reagents simplifies the assay and omits any need to handle liquid PCR reagents. Copyright © 2016, American Society for Microbiology. All Rights Reserved.
Stange, Jonathan P; Kleiman, Evan M; Sylvia, Louisa G; Magalhães, Pedro Vieira da Silva; Berk, Michael; Nierenberg, Andrew A; Deckersbach, Thilo
2016-06-01
Little is known about specific mood symptoms that may confer risk for suicidal ideation (SI) among patients with bipolar disorder (BD). We evaluated prospectively whether particular symptoms of depression and mania precede the onset or worsening of SI, among adults with or without a history of a suicide attempt. We examined prospective data from a large (N = 2,741) cohort of patients participating in the Systematic Treatment Enhancement Program for BD (STEP-BD). We evaluated history of suicide attempts at baseline, and symptoms of depression and mania at baseline and follow-up visits. Hierarchical linear modeling tested whether specific mood symptoms predicted subsequent levels of SI, and whether the strength of the associations differed based on suicide attempt history, after accounting for the influence of other mood symptoms and current SI. Beyond overall current depression and mania symptom severity, baseline SI, and illness characteristics, several mood symptoms, including guilt, reduced self-esteem, psychomotor retardation and agitation, increases in appetite, and distractibility predicted more severe levels of subsequent SI. Problems with concentration, distraction, sleep loss and decreased need for sleep predicted subsequent SI more strongly among individuals with a suicide attempt history. Several specific mood symptoms may confer risk for the onset or worsening of SI among treatment-seeking patients with BD. Individuals with a previous suicide attempt may be at greater risk in part due to greater reactivity to certain mood symptoms in the form of SI. However, overall, effect sizes were small, suggesting the need to identify additional proximal predictors of SI. © 2016 Wiley Periodicals, Inc.
International Nuclear Information System (INIS)
Rhim, Hyun Chul; Baek, JUng Hwan; Jeon, Eui Yong; Koh, Byung Hee; Cho, On Koo; Kim, Young Hwan
1994-01-01
To determine wheter bilirubin/extrahepatic bile duct diameter ratio(B/D ratio) or alkalinephosphatase/extrahepatic bile duct diameter ratio (A/D ratio) can be used to differentiate malignant from benigndisease in distal extrahepatic bile duct obstruction during ultrasonographic examination. We retrospectively reviewed the sonograms and laboratory data of 100 patients with obstructive jaundice (benign : n=50, malignant: : n=50). The diagnosis was confirmed either surgically (n=66) or clinically (n=34). The B/D ratio and A/D radio were calculated by means of dividing total bilirubin (mg/dl) and alkaline phosphatase (I.U.)respectively by maximum extrahepatic bile duct diameter(mm) on ultrasonogram. Significant difference in B/D ratio was found between the benignancy (0.28+0.25) and malignancy (0.98+0.84) groups (P<0.001). Significant difference in A/D ratio was also found between the benignancy (15.00+10.22) and malignancy (32.44+30.28) groups(P<0.001) Accuracies to predict malignancy according to criteria of B/D and A/D ratios were less than 75% and 65%respectively. On the other hand, the positive predictive value and specificity were relatively high. The B/D ratio and A/D ratio calculated from ultrasonograms can be used as a valuable screening index todifferentiate malignancy from benignacy in patients with distal extrahepatic bile duct obstruction, especially when the sonography is difficult because of the interposition of bowel gas or obesity
Mousavi, Zahra; Johnson, Sheri; Li, Descartes
2018-08-15
One previous study suggested that the presence of a manic episode before bipolar depression is related to worse response to antidepressants. To examine this effect in a larger sample, we used data from the large, multi-site STEP-BD study. We hypothesized that among persons treated with antidepressants for bipolar depression, manic or mixed episodes before depression onset (as compared to euthymia) would predict lower rate of recovery, more sustained depressive symptoms and higher rate of switching into mania/hypomania after antidepressant treatment of bipolar depression. 320 participants were available for analyses (140 male) diagnosed with bipolar I, bipolar II, cyclothymia, bipolar disorder not otherwise specified, or schizoaffective disorder bipolar subtype. Patients were randomly assigned to 3 treatment randomization strata (placebo, bupropion, and paroxetine) as adjuncts to mood stabilizers. Analyses were conducted to examine the effect of episode status before the depressive episode on the degree of change in depressive symptoms at 3 and 6 months, the likelihood of depression recovery and the likelihood of anti-depressant induced switching. Presence of a manic episode before depression in patients with bipolar disorder did not significantly predict response to antidepressants. The study was limited by a high rate of attrition, and consideration of only two antidepressant medications. Our findings are in agreement with other past studies suggesting that mania and depression may operate separately for those with bipolar disorder, with differential predictors of the onset and offset of mania versus depression. Future directions may consider vulnerability for these episodes separately. Copyright © 2018 Elsevier B.V. All rights reserved.
Torres, Guillermo; Mader, Jeff A.; Marschall, Laurence A.; Neuhäuser, Ralph; Duffy, Alaine S.
2003-06-01
We present new photometric observations in the BVRI bands of the double-lined eclipsing binary BD +05°706 conducted over three observing seasons, as well as new X-ray observations obtained with ROSAT covering a full orbital cycle (P=18.9 days). A detailed light-curve analysis of the optical data shows the system to be semidetached, confirming indications from an earlier analysis by Torres et al. (published in 1998), with the less massive and cooler star filling its Roche lobe. The system is a member of the rare class of cool Algol systems, which are different from the ``classical'' Algol systems in that the mass-gaining component is also a late-type star rather than a B- or A-type star. By combining the new photometry with a reanalysis of the spectroscopic observations reported by Torres et al., we derive accurate absolute masses for the components of M1=2.633+/-0.028 Msolar and M2=0.5412+/-0.0093 Msolar, radii of R1=7.55+/-0.20 Rsolar and R2=11.02+/-0.21 Rsolar, as well as effective temperatures of 5000+/-100 and 4640+/-150 K, for the primary and secondary, respectively. There are obvious signs of activity (spottedness) in the optical light curve of the binary. Our X-ray light curve clearly shows the primary eclipse but not the secondary eclipse, suggesting that the primary star is the dominant source of the activity in the system. The depth and duration of the eclipse allow us to infer some of the properties of the X-ray-emitting region around that star.
Eisinger, Stephen W; Schwartz, Matthew; Dam, Lisa; Riedel, Stefan
2013-09-01
The stability of urine specimens submitted for culture remains a challenge for many laboratories because of delays in specimen transport. We evaluated the usefulness of BD Vacutainer Plus Urine C&S Preservative Tube in ensuring specimen stability. Clinical urine specimens collected in sterile collection cups (n = 110) were plated onto sheep blood and MacConkey agar following standard laboratory procedures guidelines. Thereafter, specimens were divided into 3 storage conditions: nonpreservative, refrigerated; nonpreservative, room temperature (RT); BD Vacutainer Plus Urine C&S Preservative Tube, RT. For each sample type, additional cultures were set up at 2, 4, 24, and 48 hours. Initially, 18 specimens had no growth, 32 showed mixed skin flora, and 60 yielded at least 1 uropathogen. Increased colony counts of uropathogens were observed for nonpreserved urine samples stored at RT; these changes were statistically significant. Minor differences between refrigerated urine samples and BD Vacutainer Plus Urine C&S Preservative Tube samples were seen but were not statistically significant. The use of preservative-containing collection tubes is desirable to ensure specimen stability when prompt processing or refrigeration is not feasible.
Ekşioğlu, Merve Kaymak; Madenci, Özlem Çakır; Yücel, Nihal; Elçi, Abdullah; Turhan, Bülent; Orhan, Gani; Orçun, Asuman
2016-01-01
The aim of this study was to evaluate the stability of urine collected in preservative tubes for chemistry strip analyses and particle counting to determine whether the transport of urine samples with all of their constituents is possible. 275 pathologic urine specimens were included. Each urine sample was evaluated after 4, 8, 12, 24, and 48 hours of storage in BD Vacutainer(®) Plus Urinalysis Preservative (BD UAP) tubes and compared with refrigeration at 4 °C. All analyses were peformed on H-800 and FUS-200 automatic modular urine analyzers (Dirui Industry, Changchun, China). The kappa coefficients (κ), false positive (FP) and false negative (FN) rates were evaluated. κ > 0.8 was accepted as good agreement. Haemoglobin (Hb), leucocyte esterase (LE), and protein (Pro) analyses should be performed within 4 hours, whereas glucose (Glc) was stable until the end of 48 hours in both storage conditions. Nitrite (Nit) was well preserved in BD UAP tubes for 24 hours but was stable only up to 8 hours at 4 °C. Bilirubin (Bil) had very high FN rates even at 4 hours in both conditions. The particle counting showed high FN rates for white blood cells (WBC) and red blood cells (RBC), whereas squamous epithelial cells (EC) were stable up to 8 hours in both conditions. Preanalytical requirements for both urine chemical strip analyses and particle counting in a unique sample were not met in either condition. Thus, the transfer of urine samples for centralization of urinalysis is not yet feasible.
Frey, Amy B; Wilson, Deborah A; LaSalvia, Margaret M; Tan, Carmela D; Rodriguez, E Rene; Shrestha, Nabin K; Hall, Gerri S; Procop, Gary W
2011-11-01
We use the BD GeneOhm StaphSR Assay (BD Diagnostics, Oakville, Canada) to screen for Staphylococcus aureus nasal colonization and sought to evaluate this assay for the assessment of valve specimens from patients with endocarditis. We examined 23 paired fresh and formalin-fixed, paraffin-embedded cardiac valve tissue samples, 12 of which had S aureus endocarditis, using the BD GeneOhm StaphSR Assay for the detection and differentiation of methicillin-susceptible and methicillin-resistant S aureus. This assay appropriately characterized all specimens with respect to the presence or absence of S aureus. There was an 87.5% correlation between the presence or absence of the mecA gene and the oxacillin susceptibility results for the S aureus isolates studied. The GeneOhm StaphSR assay accurately detected S aureus in cardiac valve tissue samples. Rare discordances were observed between oxacillin susceptibility status and mecA gene detection by this assay.
DEFF Research Database (Denmark)
Nielsen, Søren R. K.
Nærværende lærebog er skrevet med henblik på undervisningen i lineær svingingsteori på konstruktionsliniens 8. semester på Aalborg Universitetscenter. Det pågældende kursus danner grundlaget for efterfølgende undervisning i ikke-lineær svingningsteori, hvilket har påvirket fremstillingens form. D...
Hecker-Stampehl, Jan
2011-01-01
Arvustus : Jörg Zägel (in Zusammenarbeit mit Reiner Steinweg). Vergangenheitsdiskurse in der Ostseeregion. Bd. 1. Auseinandersetzungen in den nordischen Staaten über Krieg. Völkermord, Diktatur, Besatzung und Vertreibung. Berlin : LIT Verlag, 2007. (Kieler Schriften zur Friedenswissenschaft. 14); Bd. 2 : Die Sicht auf Krieg, Diktatur, Völkermord, Besatsung und Vertreibung in Russland, Polen und den baltischen Staaten. Berlin: Lit Verlag, 2007. (Kieler Schriften zur Friedenswissenschaft. 15)
Cadamuro, Janne; Mrazek, Cornelia; Leichtle, Alexander B; Kipman, Ulrike; Felder, Thomas K; Wiedemann, Helmut; Oberkofler, Hannes; Fiedler, Georg M; Haschke-Becher, Elisabeth
2018-02-15
Although centrifugation is performed in almost every blood sample, recommendations on duration and g-force are heterogeneous and mostly based on expert opinions. In order to unify this step in a fully automated laboratory, we aimed to evaluate different centrifugation settings and their influence on the results of routine clinical chemistry analytes. We collected blood from 41 healthy volunteers into BD Vacutainer PST II-heparin-gel- (LiHepGel), BD Vacutainer SST II-serum-, and BD Vacutainer Barricor heparin-tubes with a mechanical separator (LiHepBar). Tubes were centrifuged at 2000xg for 10 minutes and 3000xg for 7 and 5 minutes, respectively. Subsequently 60 and 21 clinical chemistry analytes were measured in plasma and serum samples, respectively, using a Roche COBAS instrument. High sensitive Troponin T, pregnancy-associated plasma protein A, ß human chorionic gonadotropin and rheumatoid factor had to be excluded from statistical evaluation as many of the respective results were below the measuring range. Except of free haemoglobin (fHb) measurements, no analyte result was altered by the use of shorter centrifugation times at higher g-forces. Comparing LiHepBar to LiHepGel tubes at different centrifugation setting, we found higher lactate-dehydrogenase (LD) (P = 0.003 to centrifuged at higher speed (3000xg) for a shorter amount of time (5 minutes) without alteration of the analytes tested in this study. When using LiHepBar tubes for blood collection, a separate LD reference value might be needed.
A roadmap to control penguin effects in B_d"0→J/ψK_S"0 and B_s"0→J/ψϕ
International Nuclear Information System (INIS)
Bruyn, Kristof De; Fleischer, Robert
2015-01-01
Measurements of CP violation in B_d"0→J/ψK_S"0 and B_s"0→J/ψϕ decays play key roles in testing the quark-flavour sector of the Standard Model. The theoretical interpretation of the corresponding observables is limited by uncertainties from doubly Cabibbo-suppressed penguin topologies. With continuously increasing experimental precision, it is mandatory to get a handle on these contributions, which cannot be calculated reliably in QCD. In the case of the measurement of sin 2β from B_d"0→J/ψK_S"0, the U-spin-related decay B_s"0→J/ψK_S"0 offers a tool to control the penguin effects. As the required measurements are not yet available, we use data for decays with similar dynamics and the SU(3) flavour symmetry to constrain the size of the expected penguin corrections. We predict the CP asymmetries of B_s"0→J/ψK_S"0 and present a scenario to fully exploit the physics potential of this decay, emphasising also the determination of hadronic parameters and their comparison with theory. In the case of the benchmark mode B_s"0→J/ψϕ used to determine the B_s"0-B-bar_s"0 mixing phase ϕ_s the penguin effects can be controlled through B_d"0→J/ψρ"0 and B_s"0→J/ψ ( K)-bar "∗"0 decays. The LHCb collaboration has recently presented pioneering results on this topic. We analyse their implications and present a roadmap for controlling the penguin effects.
Agreda, Patricia M.; Beitman, Gerard H.; Gutierrez, Erin C.; Harris, James M.; Koch, Kristopher R.; LaViers, William D.; Leitch, Sharon V.; Maus, Courtney E.; McMillian, Ray A.; Nussbaumer, William A.; Palmer, Marcus L. R.; Porter, Michael J.; Richart, Gregory A.; Schwab, Ryan J.
2013-01-01
We evaluated the effect of storage at 2 to 8°C on the stability of human genomic and human papillomavirus (HPV) DNA stored in BD SurePath and Hologic PreservCyt liquid-based cytology media. DNA retained the ability to be extracted and PCR amplified for more than 2.5 years in both medium types. Prior inability to detect DNA in archived specimens may have been due to failure of the extraction method to isolate DNA from fixed cells. PMID:23678069
Evidence of a massive planet candidate orbiting the young active K5V star BD+20 1790
Hernán-Obispo, M.; Gálvez-Ortiz, M. C.; Anglada-Escudé, G.; Kane, S. R.; Barnes, J. R.; de Castro, E.; Cornide, M.
2010-03-01
Context. BD+20 1790 is a young active, metal-rich, late-type K5Ve star. We have undertaken a study of stellar activity and kinematics for this star over the past few years. Previous results show a high level of stellar activity, with the presence of prominence-like structures, spots on the surface, and strong flare events, despite the moderate rotational velocity of the star. In addition, radial velocity variations with a semi-amplitude of up to 1 km s-1 were detected. Aims: We investigate the nature of these radial velocity variations, in order to determine whether they are due to stellar activity or the reflex motion of the star induced by a companion. Methods: We have analysed high-resolution echelle spectra by measuring stellar activity indicators and computing radial velocity (RV) and bisector velocity spans. Two-band photometry was also obtained to produce the light curve and determine the photometric period. Results: Based upon the analysis of the bisector velocity span, as well as spectroscopic indices of chromospheric indicators, Ca ii H & K, Hα, and taking the photometric analysis into account, we report that the best explanation for the RV variation is the presence of a substellar companion. The Keplerian fit of the RV data yields a solution for a close-in massive planet with an orbital period of 7.78 days. The presence of the close-in massive planet could also be an interpretation for the high level of stellar activity detected. Since the RV data are not part of a planet search programme, we can consider our results as a serendipitous evidence of a planetary companion. To date, this is the youngest main sequence star for which a planetary candidate has been reported. Based on observations collected at the German-Spanish Astronomical Center, Calar Alto, jointly operated by the Max-Planck-Institut für Astronomie Heidelberg and the Instituto de Astrofísica de Andalucía (CSIC). Based on observations made with the Italian Telescopio Nazionale Galileo
Kaur, Baljinder; Chakraborty, Debkumar; Kumar, Balvir
2014-10-01
Occurrence of feruloyl-CoA synthetase (fcs) and enoyl-CoA hydratase (ech) genes responsible for the bioconversion of ferulic acid to vanillin have been reported and characterized from Amycolatopsis sp., Streptomyces sp., and Pseudomonas sp. Attempts have been made to express these genes in Escherichia coli DH5α, E. coli JM109, and Pseudomonas fluorescens. However, none of the lactic acid bacteria strain having GRAS status was previously proposed for heterologous expression of fcs and ech genes for production of vanillin through biotechnological process. Present study reports heterologous expression of vanillin synthetic gene cassette bearing fcs and ech genes in a dairy isolate Pediococcus acidilactici BD16. After metabolic engineering, statistical optimization of process parameters that influence ferulic acid to vanillin biotransformation in the recombinant strain was carried out using central composite design of response surface methodology. After scale-up of the process, 3.14 mM vanillin was recovered from 1.08 mM ferulic acid per milligram of recombinant cell biomass within 20 min of biotransformation. From LCMS-ESI spectral analysis, a metabolic pathway of phenolic biotransformations was predicted in the recombinant P. acidilactici BD16 (fcs (+)/ech (+)).
DEFF Research Database (Denmark)
Ejegod, Ditte; Bottari, Fabio; Pedersen, Helle
2016-01-01
This study describes a validation of the BD Onclarity HPV (Onclarity) assay using the international guidelines for HPV test requirements for cervical cancer screening of women 30 years and above using Danish SurePath screening samples. The clinical specificity (0.90, 95% CI: 0.88-0.91) and sensit......This study describes a validation of the BD Onclarity HPV (Onclarity) assay using the international guidelines for HPV test requirements for cervical cancer screening of women 30 years and above using Danish SurePath screening samples. The clinical specificity (0.90, 95% CI: 0.......88-0.91) and sensitivity (0.97, 95% CI: 0.87-1.0) of the Onclarity assay were shown to be non-inferior to the reference assay (specificity 0.90, 95% CI: 0.88-0.92, sensitivity 0.98, 95% CI: 0.91-1.0). The intra-laboratory reproducibility of Onclarity was 97% with a lower confidence bound of 96% (kappa value: 0...
Energy Technology Data Exchange (ETDEWEB)
Leisewitz, A.; Kruse, H.; Schramm, E.
2001-04-01
/Elektronik, Schienenfahrzeugbereich, Textil-/Polstermoebelindustrie. Parallel dazu werden dreizehn Flammschutzmittel hinsichtlich Mengenstrom, Anwendungen und Toxikologie/Oekotoxikologie charakterisiert. Bd. I: Ergebniszusammenfassung zu Flammschutzmitteleinsatz in Deutschland 1999/2000; Charakterisierung von 13 FSM nach Stoff- und Anwendungseigenschaften, Einsatzspektrum, Mengen; Ableitung von Bewertungsgrundlagen fuer FSM mit Schwergewicht auf Toxikologie/Oekotoxikologie, Kreislauffaehigkeit, Substitutions- und Minderungspotentialen; zusammenfassende Stoffbewertung zu 13 FSM; zusammenfassende Uebersicht zu FSM-Anwendungen. Bd. II: Anwendungsuntersuchungen (Stand der Technik, Trend, Alternativen) zu FSM bei UP-Harzen (Schienenfahrzeuge), bei PU-Daemm- und Montageschaeumen (Baubereich); bei Kunststoffen fuer E+E-Geraete insgesamt, Aussengehaeusen fuer E+E-Geraete und Leiterplatten (Elektro/Elektronikindustrie); bei Polstermoebeln/Matratzen (Textilanwendungen). Bd. III: Toxikologisch/oekotoxikologische Stoffprofile Decabromdiphenylether, Tetrabrombisphenol A; Bis[pentabromphenyl]ethan; Hexabromcyclododecan, Tris[chlorpropyl]phosphat, Resorcinol-bis-diphenyl-phosphat; N-Hydroxymethyl-3-dimethylphosphonpropionamid, roter Phosphor, Ammoniumpolyphosphat, Melamincyanurat, Aluminiumtrihydroxid, Borax, Antimontrioxid. (orig.)
Prisciandaro, James J; Tolliver, Bryan K
2016-11-15
The Young Mania Rating Scale (YMRS) and Montgomery-Asberg Depression Rating Scale (MADRS) are among the most widely used outcome measures for clinical trials of medications for Bipolar Disorder (BD). Nonetheless, very few studies have examined the measurement characteristics of the YMRS and MADRS in individuals with BD using modern psychometric methods. The present study evaluated the YMRS and MADRS in the Systematic Treatment Enhancement Program for BD (STEP-BD) study using Item Response Theory (IRT). Baseline data from 3716 STEP-BD participants were available for the present analysis. The Graded Response Model (GRM) was fit separately to YMRS and MADRS item responses. Differential item functioning (DIF) was examined by regressing a variety of clinically relevant covariates (e.g., sex, substance dependence) on all test items and on the latent symptom severity dimension, within each scale. Both scales: 1) contained several items that provided little or no psychometric information, 2) were inefficient, in that the majority of item response categories did not provide incremental psychometric information, 3) poorly measured participants outside of a narrow band of severity, 4) evidenced DIF for nearly all items, suggesting that item responses were, in part, determined by factors other than symptom severity. Limited to outpatients; DIF analysis only sensitive to certain forms of DIF. The present study provides evidence for significant measurement problems involving the YMRS and MADRS. More work is needed to refine these measures and/or develop suitable alternative measures of BD symptomatology for clinical trials research. Copyright © 2016 Elsevier B.V. All rights reserved.
Baixench, M T; Al-Sheikh, M; Paugam, A
2005-01-01
The study included 37 urine samples which have been artificially infected with low levels (10(3) CFU/mL) of various fungi strains. We compared the effects of sample storage, up to 48 hours, at room temperature, in a urine evacuated tube containing specific additives with storage at + 4 degrees C, for the same length of time, in a urine evacuated tube without any additives. There have been no differences of results (speed of growth and colony size) between the 2 modes of storage. However, the experience has shown that samples needed a careful mixing before seeding to avoid underdetection of the strains. Based on the study results, the BD Vacutainer C&S tubes are suitable for delayed testing for the diagnosis of urine fungal infection.
The period analysis of V418 AQL, SU BOO, RV CVn, CR CAS, GV CYG, V432 PER, and BD+42 2782
International Nuclear Information System (INIS)
Zasche, P.; Wolf, M.; Kučáková, H.; Uhlař, R.
2014-01-01
The minimum timings of eclipsing binaries V418 Aql, SU Boo, RV CVn, CR Cas, GV Cyg, V432 Per, and BD+42 2782 were collected and analyzed. Their long-term behavior was studied via period analysis, revealing a periodic term in eclipse times. We derived 576 new times of minimum. Hence, to describe the periodic variation, a third-body hypothesis was proposed and the resulting orbital periods are as follows: 70, 7.4, 53, 37, 27, 53, and 18 yr, respectively. For the system V432 Per an additional 9.5 yr variation was also found. The predicted minimum masses of these distant bodies were calculated and their detectability discussed. The light curves of SU Boo and RV CVn were analyzed using the PHOEBE program, resulting in physical parameters of the components. New variable stars in the field of V418 Aql were discovered.
Sun, J; Osborne, J P; Kahlow, M A; Kaysser, T M; Hil, J J; Gennis, R B; Loehr, T M
1995-09-26
Cytochrome bd oxidase is a terminal bacterial oxidase containing three cofactors: a low-spin heme (b558), a high-spin heme (b595), and a chlorin d. The center of dioxygen reduction has been proposed to be at a dinuclear b595/d site, whereas b558 is mainly involved in transferring electrons from ubiquinone. One of the unique functional features of this enzyme is its resistance to high concentrations of cyanide (Ki in the millimolar range). With the appropriate selection of laser lines, the ligation and spin states of the b558, b595, and d hemes can be probed selectively by resonance Raman (rR) spectroscopy. Wavelengths between 400 and 500 nm predominantly excite the rR spectra of the b558 and b595 chromophores. Spectra obtained within this interval show a mixed population of spin and ligation states arising from b558 and b595, with the former more strongly enhanced at higher energy. Red excitation wavelengths (590-650 nm) generate rR spectra characteristic of chlorins, indicating the selective enhancement of the d heme. These rR results reveal that cytochrome bd oxidase "as isolated" contains the b558 heme in a six-coordinate low-spin ferric state, the b595 heme in a five-coordinate high-spin (5cHS) ferric state, and the d heme in a mixture of oxygenated (FeIIO2 FeIIIO2-; d650) and ferryl-oxo (FeIV = O; d680) states. However, the rR spectra of these two chlorin species indicate that they are both in the 5cHS state, suggesting that the d heme is lacking a strongly coordinated sixth ligand.(ABSTRACT TRUNCATED AT 250 WORDS)
Carleo, I.; Benatti, S.; Lanza, A. F.; Gratton, R.; Claudi, R.; Desidera, S.; Mace, G. N.; Messina, S.; Sanna, N.; Sissa, E.; Ghedina, A.; Ghinassi, F.; Guerra, J.; Harutyunyan, A.; Micela, G.; Molinari, E.; Oliva, E.; Tozzi, A.; Baffa, C.; Baruffolo, A.; Bignamini, A.; Buchschacher, N.; Cecconi, M.; Cosentino, R.; Endl, M.; Falcini, G.; Fantinel, D.; Fini, L.; Fugazza, D.; Galli, A.; Giani, E.; González, C.; González-Álvarez, E.; González, M.; Hernandez, N.; Hernandez Diaz, M.; Iuzzolino, M.; Kaplan, K. F.; Kidder, B. T.; Lodi, M.; Malavolta, L.; Maldonado, J.; Origlia, L.; Ventura, H. Perez; Puglisi, A.; Rainer, M.; Riverol, L.; Riverol, C.; San Juan, J.; Scuderi, S.; Seemann, U.; Sokal, K. R.; Sozzetti, A.; Sozzi, M.
2018-05-01
Context. Stellar activity is currently challenging the detection of young planets via the radial velocity (RV) technique. Aims: We attempt to definitively discriminate the nature of the RV variations for the young active K5 star BD+20 1790, for which visible (VIS) RV measurements show divergent results on the existence of a substellar companion. Methods: We compare VIS data with high precision RVs in the near-infrared (NIR) range by using the GIANO-B and IGRINS spectrographs. In addition, we present for the first time simultaneous VIS-NIR observations obtained with GIARPS (GIANO-B and HARPS-N) at Telescopio Nazionale Galileo (TNG). Orbital RVs are achromatic, so the RV amplitude does not change at different wavelengths, while stellar activity induces wavelength-dependent RV variations, which are significantly reduced in the NIR range with respect to the VIS. Results: The NIR radial velocity measurements from GIANO-B and IGRINS show an average amplitude of about one quarter with respect to previously published VIS data, as expected when the RV jitter is due to stellar activity. Coeval multi-band photometry surprisingly shows larger amplitudes in the NIR range, explainable with a mixture of cool and hot spots in the same active region. Conclusions: In this work, the claimed massive planet around BD+20 1790 is ruled out by our data. We exploited the crucial role of multi-wavelength spectroscopy when observing young active stars: thanks to facilities like GIARPS that provide simultaneous observations, this method can reach its maximum potential.
DEFF Research Database (Denmark)
Bartels, Mette Damkjaer; Boye, Kit; Rohde, Susanne Mie
2009-01-01
Rapid tests for detection of methicillin-resistant Staphylococcus aureus (MRSA) carriage are important to limit the transmission of MRSA in the health care setting. We evaluated the performance of the BD GeneOhm MRSA real-time PCR assay using a diverse collection of MRSA isolates, mainly from Cop...
Burgey, Christine; Kern, Winfried V; Römer, Winfried; Sakinc, Türkan; Rieg, Siegbert
2015-05-01
Antimicrobial peptides are multifunctional effector molecules of innate immunity. In this study we investigated whether endothelial cells actively contribute to innate defense mechanisms by expression of antimicrobial peptides. We therefore stimulated human umbilical vein endothelial cells (HUVEC) with inflammatory cytokines, Th17 cytokines, heat-inactivated bacteria, bacterial conditioned medium (BCM) of Staphylococcus aureus and Streptococcus sanguinis, and lipoteichoic acid (LTA). Stimulation with single cytokines induced discrete expression of human β-defensin 3 (hBD3) by IFN-γ or IL-1β and of ribonuclease 7 (RNase7) by TNF-α without any effects on LL-37 gene expression. Stronger hBD3 and RNase7 induction was observed after combined stimulation with IL-1β, TNF-α and IFN-γ and was confirmed by high hBD3 and RNase7 peptide levels in cell culture supernatants. In contrast, Th17 cytokines or stimulation with LTA did not result in AMP production. Moreover, only BCM of an invasive S. aureus bacteremia isolate induced hBD3 in HUVEC. We conclude that endothelial cells actively contribute to prevent dissemination of pathogens at the blood-tissue-barrier by production of AMPs that exhibit microbicidal and immunomodulatory functions. Further investigations should focus on tissue-specific AMP induction in different endothelial cell types, on pathogen-specific induction patterns and potentially involved pattern-recognition receptors of endothelial cells. Copyright © 2015 Institut Pasteur. Published by Elsevier Masson SAS. All rights reserved.
Vargas-Martínez, Ana Magdalena; Trapero-Bertran, Marta; Gil-García, Eugenia; Lima-Serrano, Marta
2018-04-15
Nowadays, one of the most prevalent patterns of alcohol consumption is called binge drinking (BD). In 2015, the European School Survey Project on Alcohol and Drugs (ESPAD) Group estimated that about 35% of adolescents of 15-16 years old have had at least one BD occasion in the past 30 days while at national level, the series of surveys on the use of drugs in adolescents of secondary education (ESTUDES, 2014-2015) determined that 32.2% of adolescents stated having performed BD in the last month. The aim of this editorial was to update the context of adolescence drinking and analysing the impact of BD by ages, including health and social costs derived. Once the magnitude of the problem was set, some research and action lines have been established in order to guide future work for the prevention of alcohol misuse and for establishing future preventive policies on alcohol. Finally, the need for evaluating these interventions from the efficiency point of view was discussed and assessed.
The 6-31B(d) basis set and the BMC-QCISD and BMC-CCSD multicoefficient correlation methods.
Lynch, Benjamin J; Zhao, Yan; Truhlar, Donald G
2005-03-03
Three new multicoefficient correlation methods (MCCMs) called BMC-QCISD, BMC-CCSD, and BMC-CCSD-C are optimized against 274 data that include atomization energies, electron affinities, ionization potentials, and reaction barrier heights. A new basis set called 6-31B(d) is developed and used as part of the new methods. BMC-QCISD has mean unsigned errors in calculating atomization energies per bond and barrier heights of 0.49 and 0.80 kcal/mol, respectively. BMC-CCSD has mean unsigned errors of 0.42 and 0.71 kcal/mol for the same two quantities. BMC-CCSD-C is an equally effective variant of BMC-CCSD that employs Cartesian rather than spherical harmonic basis sets. The mean unsigned error of BMC-CCSD or BMC-CCSD-C for atomization energies, barrier heights, ionization potentials, and electron affinities is 22% lower than G3SX(MP2) at an order of magnitude less cost for gradients for molecules with 9-13 atoms, and it scales better (N6 vs N,7 where N is the number of atoms) when the size of the molecule is increased.
Directory of Open Access Journals (Sweden)
Vinayak H. Lokhande
2015-12-01
Full Text Available In this study, we report phytoremediation of textile dyes using hairy roots derived through Agrobacterium rhizogenes (NCIM 5140 infection of in vitro leaf and stem explants of a halophyte Sesuvium portulacastrum (L. L. Leaf explants showed higher frequency of hairy root induction (70% than stem explants (30%, and maximum number of roots (leaf 42.3 ± 2.4 and stem 50.3 ± 1.7. Transformed nature of hairy roots was ascertained by amplifying 970 bp region of T-DNA of Ri plasmid. Hairy roots were screened for phytoremediation of various textile dyes and results showed that HRs were able to degrade Reactive green 19A HE4BD upto 98% within 5 days of incubation. Spectrophotometric analysis showed decrease in dye concentration while HPLC and FTIR analysis confirmed its degradation. Seed germination assay demonstrated non-toxic nature of the extracted metabolites. This is the first report on induction of hairy root culture in Sesuvium portulacastrum and phytoremediation of textile dyes.
Wong, Rebecca; Levi, Angelique W; Harigopal, Malini; Schofield, Kevin; Chhieng, David C
2012-02-01
Our cytology laboratory, like many others, is under pressure to improve quality and provide test results faster while decreasing costs. We sought to address these issues by introducing new technology and lean principles. To determine the combined impact of the FocalPoint Guided Screener (GS) Imaging System (BD Diagnostics-TriPath, Burlington, North Carolina) and lean manufacturing principles on the turnaround time (TAT) and productivity of the gynecologic cytology operation. We established a baseline measure of the TAT for Papanicolaou tests. We then compared that to the performance after implementing the FocalPoint GS Imaging System and lean principles. The latter included value-stream mapping, workflow modification, and a first in-first out policy. The mean (SD) TAT for Papanicolaou tests before and after the implementation of FocalPoint GS Imaging System and lean principles was 4.38 (1.28) days and 3.20 (1.32) days, respectively. This represented a 27% improvement in the average TAT, which was statistically significant (P implementation of FocalPoint GS Imaging System in conjunction with lean principles resulted in a significant decrease in the average TAT for Papanicolaou tests and a substantial increase in the productivity of cytotechnologists while maintaining the diagnostic quality of gynecologic cytology.
Yılmaz, Durmuşhan; Şahin, Engin; Dertli, Enes
2017-11-01
Chiral secondary alcohols are valuable intermediates for many important enantiopure pharmaceuticals and biologically active molecules. In this work, we studied asymmetric reduction of aromatic ketones to produce the corresponding chiral secondary alcohols using lactic acid bacteria (LAB) as new biocatalysts. Seven LAB strains were screened for their ability to reduce acetophenones to their corresponding alcohols. Among these strains, Lactobacillus paracasei BD101 was found to be the most successful at reducing the ketones to the corresponding alcohols. The reaction conditions were further systematically optimized for this strain and high enantioselectivity (99%) and very good yields were obtained. These secondary alcohols were further tested for their antimicrobial activities against important pathogens and significant levels of antimicrobial activities were observed although these activities were altered depending on the secondary alcohols as well as their enantiomeric properties. The current methodology demonstrates a promising and alternative green approach for the synthesis of chiral secondary alcohols of biological importance in a cheap, mild, and environmentally useful process. © 2017 Wiley-VHCA AG, Zurich, Switzerland.
Rakotomiaramanana, Barinjaka Mamitiana; Soler, P
2010-01-01
LHCb is the dedicated flavour physics experiment of the LHC. The experiment is designed for probing new physics through measurements of CP violation and rare decays. This thesis includes simulation studies of the Bd ⇒ K*μ+μ- decay. The LHCb vertex locator (VELO) is the highest precision tracking detector at the LHC and is used to identify primary and secondary vertices for the identification of the $b$ and $c$ hadrons. The VELO modules contain silicon strip detectors which must be operated under reverse bias voltage. This thesis presents the work performed on the design, production and characterisation of the VELO high voltage system. The VELO operates only 8\\mm~from the LHC beam in a high radiation environment. A future upgrade will require operation at up to 10$^{16}$ n_{eq}cm^{-2}.This thesis presents a characterisation of p-type silicon sensors before and after heavy irradiations. The design of the HV system and the substantial programme of quality assurance tests performed on both the hardware and so...
Villaver, E.; Niedzielski, A.; Wolszczan, A.; Nowak, G.; Kowalik, K.; Adamów, M.; Maciejewski, G.; Deka-Szymankiewicz, B.; Maldonado, J.
2017-10-01
Context. Evolved stars with planets are crucial to understanding the dependency of the planet formation mechanism on the mass and metallicity of the parent star and to studying star-planet interactions. Aims: We present two evolved stars (HD 103485 and BD+03 2562) from the Tracking Advanced PlAnetary Systems (TAPAS) with HARPS-N project devoted to RV precision measurements of identified candidates within the PennState - Toruń Centre for Astronomy Planet Search. Methods: The paper is based on precise radial velocity (RV) measurements. For HD 103485 we collected 57 epochs over 3317 days with the Hobby-Eberly Telescope (HET) and its high-resolution spectrograph and 18 ultra-precise HARPS-N data over 919 days. For BD+03 2562 we collected 46 epochs of HET data over 3380 days and 19 epochs of HARPS-N data over 919 days. Results: We present the analysis of the data and the search for correlations between the RV signal and stellar activity, stellar rotation, and photometric variability. Based on the available data, we interpret the RV variations measured in both stars as Keplerian motion. Both stars have masses close to Solar (1.11 M⊙ HD 103485 and 1.14 M⊙ BD+03 2562), very low metallicities ([Fe/H] = - 0.50 and - 0.71 for HD 103485 and BD+03 2562), and both have Jupiter planetary mass companions (m2sini = 7 and 6.4 MJ for HD 103485 and BD+03 2562 resp.) in close to terrestrial orbits (1.4 au HD 103485 and 1.3 au BD+03 2562) with moderate eccentricities (e = 0.34 and 0.2 for HD 103485 and BD+03 2562). However, we cannot totally rule-out the possibility that the signal in the case of HD 103485 is due to rotational modulation of active regions. Conclusions: Based on the current data, we conclude that BD+03 2562 has a bona fide planetary companion while for HD 103485 we cannot totally exclude the possibility that the best explanation for the RV signal modulations is not the existence of a planet but stellar activity. If the interpretation remains that both stars have
Arslan, Fatma Demet; Karakoyun, Inanc; Basok, Banu Isbilen; Aksit, Merve Zeytinli; Baysoy, Anil; Ozturk, Yasemin Kilic; Guclu, Yusuf Adnan; Duman, Can
2017-10-15
Although serum-providing blood tubes with a barrier are still widely used due to their significant advantages, the use of blood tubes with a barrier to provide plasma is becoming widespread. We compared 22 analytes in a BD Vacutainer® Barricor LH Plasma tube for local clinical validation of this new lithium heparin tube with a barrier. Samples from 44 volunteers were collected in different tubes (Becton Dickinson and Company): Z tube without additive (reference), clot-activator tube with gel (SST), lithium heparin tube without gel (LiH), and lithium heparin tube with barrier (Barricor). Analyte concentrations in different tubes were compared with the reference tube. All tubes were also evaluated according to additional testing (different centrifugation durations, blood-sampling techniques and individual differences). Aspartate aminotransferase (AST), glucose (Glc), potassium (K), lactate dehydrogenase (LD), sodium (Na), and total protein (TP) had a significant bias in Barricor (9.19%, - 3.24%, - 4.88%, 21.60%, - 0.40%, 5.03%, respectively) relative to the reference tube. There was no statistical difference between different centrifugation durations and individual differences for AST, K and LD in LiH and/or Barricor (P > 0.05). There was a significant bias for LD between LiH and Barricor in terms of blood-sampling techniques (21.2% and 12.4%, respectively). Recently, the use of plasma has become prominent due to some of its advantages. In this study, plasma AST, K, LD, Glc and TP levels in Barricor were clinically different in comparison to serum. The results of additional tests showed that higher levels of LD in Barricor did not result from haemolysis, and they might be related to other factors including number of platelets, cellular fragility, or functional environment.
Energy Technology Data Exchange (ETDEWEB)
Huseynli, Sabina; Baydemir, Gözde; Sarı, Esma [Department of Chemistry, Biochemistry Division, Hacettepe University, Ankara (Turkey); Elkak, Assem [Laboraory of “Valorisation des Ressources Naturelles et Produits de Santé (VRNPS)”, Doctoral School of Sciences and Technology, Lebanese University, Rafic Hariri University Campus, Hadath (Lebanon); Denizli, Adil, E-mail: denizli@hacettepe.edu.tr [Department of Chemistry, Biochemistry Division, Hacettepe University, Ankara (Turkey)
2015-01-01
Naturally produced by the human immune system, immunoglobulin nowadays is widely used for in vivo and in vitro purposes. The increased needs for pure immunoglobulin have prompted researchers to find new immunoglobulin chromatographic separation processes. Cryogels as chromatographic adsorbents, congregate several mechanical features including good compatibility, large pore structure, flexibility, short diffusion pathway and stability. These different characteristics make them a good alternative to conventional chromatographic methods and allowing their potential use in separation technology. In the present study, two sets of poly(2-hydroxyethyl methacrylate) (PHEMA) based beads were prepared and functionalized with Reactive Red 120 (RR) and Reactive Green HE 4BD (RG) dyes, and then embedded into supermacroporous cryogels. The morphology, physical and chemical features of the prepared bead embedded composite cryogel discs (CCDs) were performed by scanning electron microscopy (SEM), swelling test, elemental analysis and Fourier transform infrared spectroscopy (FTIR). The results showed that the embedded composite cryogel discs have a specific surface area of 192.0 m{sup 2}/g with maximum adsorption capacity of HIgG 239.8 mg/g for the RR functionalized CCD and 170 mg/g for RG functionalized CCD columns, both at pH 6.2. - Highlights: • Dye attached composite cryogel discs were prepared to separate HIgG subclasses. • Composite cryogels characterized by swelling, FTIR, SEM and elemental analysis. • Reactive Green HE 4B and Reactive Red 120 dyes were used as the affinity ligand. • HIgG and subclasses were separate from both aqueous solution and human plasma.
Arslan, Fatma Demet; Karakoyun, Inanc; Basok, Banu Isbilen; Aksit, Merve Zeytinli; Baysoy, Anil; Ozturk, Yasemin Kilic; Guclu, Yusuf Adnan; Duman, Can
2017-01-01
Introduction Although serum-providing blood tubes with a barrier are still widely used due to their significant advantages, the use of blood tubes with a barrier to provide plasma is becoming widespread. We compared 22 analytes in a BD Vacutainer® Barricor LH Plasma tube for local clinical validation of this new lithium heparin tube with a barrier. Materials and methods Samples from 44 volunteers were collected in different tubes (Becton Dickinson and Company): Z tube without additive (reference), clot-activator tube with gel (SST), lithium heparin tube without gel (LiH), and lithium heparin tube with barrier (Barricor). Analyte concentrations in different tubes were compared with the reference tube. All tubes were also evaluated according to additional testing (different centrifugation durations, blood-sampling techniques and individual differences). Results Aspartate aminotransferase (AST), glucose (Glc), potassium (K), lactate dehydrogenase (LD), sodium (Na), and total protein (TP) had a significant bias in Barricor (9.19%, - 3.24%, - 4.88%, 21.60%, - 0.40%, 5.03%, respectively) relative to the reference tube. There was no statistical difference between different centrifugation durations and individual differences for AST, K and LD in LiH and/or Barricor (P > 0.05). There was a significant bias for LD between LiH and Barricor in terms of blood-sampling techniques (21.2% and 12.4%, respectively). Conclusions Recently, the use of plasma has become prominent due to some of its advantages. In this study, plasma AST, K, LD, Glc and TP levels in Barricor were clinically different in comparison to serum. The results of additional tests showed that higher levels of LD in Barricor did not result from haemolysis, and they might be related to other factors including number of platelets, cellular fragility, or functional environment. PMID:28900369
International Nuclear Information System (INIS)
Huseynli, Sabina; Baydemir, Gözde; Sarı, Esma; Elkak, Assem; Denizli, Adil
2015-01-01
Naturally produced by the human immune system, immunoglobulin nowadays is widely used for in vivo and in vitro purposes. The increased needs for pure immunoglobulin have prompted researchers to find new immunoglobulin chromatographic separation processes. Cryogels as chromatographic adsorbents, congregate several mechanical features including good compatibility, large pore structure, flexibility, short diffusion pathway and stability. These different characteristics make them a good alternative to conventional chromatographic methods and allowing their potential use in separation technology. In the present study, two sets of poly(2-hydroxyethyl methacrylate) (PHEMA) based beads were prepared and functionalized with Reactive Red 120 (RR) and Reactive Green HE 4BD (RG) dyes, and then embedded into supermacroporous cryogels. The morphology, physical and chemical features of the prepared bead embedded composite cryogel discs (CCDs) were performed by scanning electron microscopy (SEM), swelling test, elemental analysis and Fourier transform infrared spectroscopy (FTIR). The results showed that the embedded composite cryogel discs have a specific surface area of 192.0 m 2 /g with maximum adsorption capacity of HIgG 239.8 mg/g for the RR functionalized CCD and 170 mg/g for RG functionalized CCD columns, both at pH 6.2. - Highlights: • Dye attached composite cryogel discs were prepared to separate HIgG subclasses. • Composite cryogels characterized by swelling, FTIR, SEM and elemental analysis. • Reactive Green HE 4B and Reactive Red 120 dyes were used as the affinity ligand. • HIgG and subclasses were separate from both aqueous solution and human plasma
Chang, Nakho; Lee, Hye Won; Lim, Joung Eun; Jeong, Da Eun; Song, Hye Jin; Kim, Sudong; Nam, Do-Hyun; Sung, Hyun Hwan; Jeong, Byong Chang; Seo, Seong Il; Jeon, Seong Soo; Lee, Hyun Moo; Choi, Han-Yong; Jeon, Hwang Gyun
2016-08-09
Muscle-invasive bladder cancer (MIBC) consists of a heterogeneous group of tumors with a high rate of metastasis and mortality. To facilitate the in-depth investigation and validation of tailored strategies for MIBC treatment, we have developed an integrated approach using advanced high-throughput drug screening and a clinically relevant patient-derived preclinical platform. We isolated patient-derived tumor cells (PDCs) from a rare MIBC case (BD-138T) that harbors concomitant epidermal growth factor receptor (EGFR) amplification and phosphatase and tensin homolog (PTEN) deletion. High-throughput in vitro drug screening demonstrated that dasatinib, a SRC inhibitor, and PKI-587, a dual PI3K/mTOR inhibitor, exhibited targeted anti-proliferative and pro-apoptotic effects against BD-138T PDCs. Using established patient-derived xenograft models that successfully retain the genomic and molecular characteristics of the parental tumor, we confirmed that these anti-tumor responses occurred through the inhibition of SRC and PI3K/AKT/mTOR signaling pathways. Taken together, these experimental results demonstrate that dasatinib and PKI-587 might serve as promising anticancer drug candidates for treating MIBC with combined EGFR gene amplification and PTEN deletion.
Energy Technology Data Exchange (ETDEWEB)
Hareter, M.; Weiss, W. [Department of Astronomy, University of Vienna, Tuerkenschanzstrasse 17, A-1180 Wien (Austria); Fossati, L. [Department of Physics and Astronomy, Open University, Walton Hall, Milton Keynes MK6 7AA (United Kingdom); Suarez, J. C. [Instituto de Astrofisica de Andalucia (CSIC), Glorieta de la Astronomia S/N, 18008, Granada (Spain); Uytterhoeven, K. [Kiepenheuer-Institut fuer Sonnenphysik, Schoeneckstr. 6, D-79104 Freiburg (Germany); Rainer, M.; Poretti, E., E-mail: hareter@astro.univie.ac.at [INAF-Osservatorio Astronomico di Brera, Via E. Bianchi 46, 23807, Merate (Saint Lucia) (Italy)
2011-12-20
{delta} Sct-{gamma} Dor hybrids pulsate simultaneously in p- and g-modes, which carry information on the structure of the envelope as well as to the core. Hence, they are key objects for investigating A and F type stars with asteroseismic techniques. An important requirement for seismic modeling is small errors in temperature, gravity, and chemical composition. Furthermore, we want to investigate the existence of an abundance indicator typical for hybrids, something that is well established for the roAp stars. Previous to the present investigation, the abundance pattern of only one hybrid and another hybrid candidate has been published. We obtained high-resolution spectra of HD 114839 and BD +18 4914 using the SOPHIE spectrograph of the Observatoire de Haute-Provence and the HARPS spectrograph at ESO La Silla. For each star we determined fundamental parameters and photospheric abundances of 16 chemical elements by comparing synthetic spectra with the observations. We compare our results to that of seven {delta} Sct and nine {gamma} Dor stars. For the evolved BD +18 4914 we found an abundance pattern typical for an Am star, but could not confirm this peculiarity for the less evolved star HD 114839, which is classified in the literature as uncertain Am star. Our result supports the concept of evolved Am stars being unstable. With our investigation we nearly doubled the number of spectroscopically analyzed {delta} Sct-{gamma} Dor hybrid stars, but did not yet succeed in identifying a spectroscopic signature for this group of pulsating stars. A statistically significant spectroscopic investigation of {delta} Sct- {gamma} Dor hybrid stars is still missing, but would be rewarding considering the asteroseismological potential of this group.
International Nuclear Information System (INIS)
Hareter, M.; Weiss, W.; Fossati, L.; Suárez, J. C.; Uytterhoeven, K.; Rainer, M.; Poretti, E.
2011-01-01
δ Sct-γ Dor hybrids pulsate simultaneously in p- and g-modes, which carry information on the structure of the envelope as well as to the core. Hence, they are key objects for investigating A and F type stars with asteroseismic techniques. An important requirement for seismic modeling is small errors in temperature, gravity, and chemical composition. Furthermore, we want to investigate the existence of an abundance indicator typical for hybrids, something that is well established for the roAp stars. Previous to the present investigation, the abundance pattern of only one hybrid and another hybrid candidate has been published. We obtained high-resolution spectra of HD 114839 and BD +18 4914 using the SOPHIE spectrograph of the Observatoire de Haute-Provence and the HARPS spectrograph at ESO La Silla. For each star we determined fundamental parameters and photospheric abundances of 16 chemical elements by comparing synthetic spectra with the observations. We compare our results to that of seven δ Sct and nine γ Dor stars. For the evolved BD +18 4914 we found an abundance pattern typical for an Am star, but could not confirm this peculiarity for the less evolved star HD 114839, which is classified in the literature as uncertain Am star. Our result supports the concept of evolved Am stars being unstable. With our investigation we nearly doubled the number of spectroscopically analyzed δ Sct-γ Dor hybrid stars, but did not yet succeed in identifying a spectroscopic signature for this group of pulsating stars. A statistically significant spectroscopic investigation of δ Sct- γ Dor hybrid stars is still missing, but would be rewarding considering the asteroseismological potential of this group.
Laudat, P; Demondion, E; Jouannet, C; Charron, J; Chillou, C; Salaun, V; Mankikian, B
2012-06-01
Patients admitted in cardiac surgery and cardiac ICU at the Clinic Saint-Gatien (Tours) are screened for MRSA at the entrance by nasal swab and culture on blood agar and selective chromogenic medium made by addition of cefoxitin: BBL CHROMagar MRSA-II BD (result obtained at Day +1). We wanted to assess the molecular biology techniques available to obtain a result at day 0 for the majority of patients and to define an economic and practical strategy for the laboratory. We studied four molecular biology techniques: Cepheid GeneXpert (Cepheid) GeneOhm (BD), LightCycler (Roche) and Hyplex (I2A). Upon reception, nasal swabs were treated by culture, considered as reference, and one of the techniques of molecular biology, according to the manufacturer's notice. We conducted four studies between April 2008 and February 2009 to obtain a significant sample for each of them. By screening we mean a method that allows us to exclude MRSA carriage for patients waiting for surgery, and not to change patient management: for example, lack of isolation measures specific to entrance, no modification of antibiotic prophylaxis during surgery and no isolation measures in the immediate postoperative period. The criteria we considered for this evaluation were: (1) technician time: time to perform one or a series of sample(s) n=10 or more (about 2h for all techniques except GeneXpert 75min), level of skilled competences (no specific training for GeneXpert); (2) results: turnaround time (all molecular biology techniques), ease of reading and results interpretations (no specialized training required for GeneXpert), failure or not (12% of failure of internal controls for GeneOhm); (3) economic: cost for one or a series of sample(s) (n=10 or more), if we considered X as the reference culture cost (10 X Hyplex and LightCycler, 20 X and 40 X for GeneXpert GeneOhm); (4) NPV: 100% for GeneXpert and LightCycler. At same sensitivity, no technique, including culture, can solve alone our problem, which
Plutarque, Sur l' E de Delphes 390 B 6-8 et l'explication de la vision en Timée 45 b-d*
Directory of Open Access Journals (Sweden)
Alain Lernould
2005-04-01
Full Text Available Le traité (ou dialogue « pythique » du platonicien Plutarque de Chéronée (Iier – IIe s. ap. J.-C. intitulé Sur l’E de Delphes est consacré à l’élucidation de la signification de l’E (la cinquième lettre de l’alphabet grec consacré à Apollon Pythien. Une des interprétations (d’inspiration pythagoricienne est que cet E désigne le nombre cinq, le nombre de l’univers. Dans le cadre de l’exposé de cette interprétation est fait état de l’opinion « de certains » selon laquelle il existe une correspondance entre les cinq sens et les cinq éléments. L’A. montre que les deux lignes où il est question de la vue (E 390b6-8 s’inspirent essentiellement de l’explication qu’en Timée 45b-d Platon donne du mécanisme de la vision en termes de mélange du feu pur émis par l’œil avec le feu pur extérieur qui produit la lumière du jour. L’extrême brièveté de ce résumé (empreint d’aristotélisme, l’élément associé à la vue étant ici l’éther considéré comme cinquième corps, d’un passage dans Platon offrant lui-même bon nombre de difficultés, explique que ces deux lignes énigmatiques n’aient jamais été bien comprises. Au passage, l’A. revient sur les notions d’homoiopatheia (d’homogénéité et de summetria (de commensurabilité en Timée 45b-d et 67c-e pour en proposer une interprétation qui souligne et éclaire d’un jour nouveau le caractère dynamique de l’explication platonicienne de la vision. Un Appendice donne un aperçu des différentes lectures d’E 390b6-8 depuis les premières éditions imprimées à la Renaissance jusqu’aux éditions critiques des 19e et 20e siècles.The essay (or dialogue On the E at Delphi of the Platonist Plutarch of Chaeronea (c. 50 – c. 125 A.D. is devoted to the elucidation of the mysterious E – the fifth letter of the Greek alphabet – that is dedicated to Apollo. According to one interpretation the E is, in a Pythagorean
Schieffer, K M; Tan, K E; Stamper, P D; Somogyi, A; Andrea, S B; Wakefield, T; Romagnoli, M; Chapin, K C; Wolk, D M; Carroll, K C
2014-04-01
(i) Evaluation of delayed time to blood culture extraction by the Sepsityper kit and impact of shipping pellets off-site for MALDI-TOF MS analysis. (ii) Comparison of Sepsityper and laboratory-developed extraction methods from a literature review. Using two blood culture systems (BD BACTEC and VersaTREK), we extracted 411 positive blood cultures using the Sepsityper kit to mimic a potential protocol for institutions without a MALDI-TOF MS. Extracted pellets were shipped and analysed on the Bruker UltraflexIII. Successful extraction of 358 (87·1%) samples was determined by the presence of detectable proteins. MALDI-TOF MS correctly identified 332 (80·8%) samples. Delayed time to extraction did not affect Sepsityper extraction or MALDI-TOF MS accuracy. The extracted pellets remain stable and provide accurate results by MALDI-TOF MS when shipped at room temperature to off-site reference laboratories. This is the first study to show that institutions without a MALDI-TOF MS can take advantage of this innovative technology by shipping a volume of blood to an off-site laboratory for extraction and MALDI-TOF MS analysis. We also performed a literature review to compare various extraction methods. © 2014 The Society for Applied Microbiology.
Energy Technology Data Exchange (ETDEWEB)
Oppermann, A
1982-01-01
This work represents the most recent status of modern developments and indicates the complexity of man's technical future. The Dictionary of Modern Engineering contains more than 450,000 terms with over 1 million translation possibilities for the fields of aviation (civilian and military), space travel, navigation, engine, turbine and rocket construction, aerodynamics, statics, atomic physics, electronics, data processing, cybernetics, machine and tool construction, mineral oils, artificial materials, plasma, lasers, as well as all related fields. In addition, expressions in the field of air travel and its related subjects, newly developed under the auspices of BVM and ICAO, were included.
BD scoort goed in Zwitserse proef.
Oomen, G.J.M.
1996-01-01
In a 17-year experiment in Switzerland (DOK trial) biodynamic, organic/biologic (method Rusch/Mueller) and conventional agriculture were compared. Biodynamic agriculture led to a greater biological and chemical soil fertility
Directory of Open Access Journals (Sweden)
Natacha Allgayer
2015-02-01
Full Text Available Enterobactérias pertencem a um grupo grande e heterogêneo de bacilos Gram-negativos cujo habitat natural é o cólon de humanos e animais, sendo microrganismos amplamente distribuídos na natureza. Devido a essas características são frequentemente responsáveis por infecções hospitalares. O principal objetivo desse estudo foi estabelecer uma concordância entre as provas bioquímicas manuais e a automação BD Phoenix 100 na identificação de enterobactérias, a partir de uma análise de registros de pacientes hospitalizados. No período de Agosto de 2011 a Abril de 2012, foram realizados 303 exames no Laboratório Exame de Análises Clinicas pelo método manual e pela automação. Do total, 27,7% foram positivos para enterobactérias. Os microrganismos mais frequentes isolados, foram a Klebsiella pneumoniae 36,9%, seguido pela Escherichia coli 29,8%. O estudo apresentou uma alta concordância entre os métodos, principalmente na identificação dos gêneros. Na identificação das espécies, as bactérias dos gêneros Klebsiella spp. e Serratia spp. não tiveram suas espécies identificadas pelo método manual em sete dos registros observados, sendo identificadas somente pela automação. Assim como a Escherichia coli que não foi identificada pelo método manual, vista como indeterminada em quatro dos registros analisados. Portanto, verificou-se uma boa concordância entre os métodos na identificação das principais enterobactérias isoladas de amostras clínicas.
Consequences of observed Bd-anti Bd mixing in standard and nonstandard models
International Nuclear Information System (INIS)
Datta, A.; Paschos, E.A.; Tuerke, U.
1987-01-01
Implications of the B d -anti B d mixing report by the ARGUS group are investigated. We show that in order for the standard model to accomodate the result, the B → anti B hadronic matrix element must satisfy lower bounds as a function of top quark mass. In this case B S -anti B S mixing is necessarily large (r S > or approx. 0.74) irrespective of m t . This conclusion remains valid in several popular extensions of the standard model with three generations. In contrast to these models, four generation models can accomodate simultaneously the observed B d -anti B d mixing and a relatively small B S -anti B S mixing. (orig.)
Robert, Arnaud
2005-01-01
L'analyse temporelle du correlogramme de Dalitz du canal a trois corps Bd en pi+ pi- pi0 conduit a l'extraction de l'un des parametres definissant la violation de la symetrie CP dans le Modele Standard Electrofaible, l'angle alpha, exempte d'ambiguites discretes entre 0 et pi. Elle permet, entre autres, d'acceder independamment aux valeurs des principaux parametres QCD regissant la desintegration. La contrepartie experimentale repose cependant sur une statistique de signal suffisamment pure et importante et une maitrise precise de la phenomenologie associee. Combines a un rapport d'embranchement de l'ordre de 2.10^{-5}, ces deux arguments justifient a eux seuls le caractere non trivial d'une telle analyse dans l'environnement hadronique de l'experience dediee LHCb. A partir de la reponse simulee du detecteur, et en particulier des performances du calorimetre electromagnetique, cette these montre l'interet essentiel de la reconstruction specifique des pions neutres tres energiques et la necessite d'introduire ...
COMEDIE BD1 experiment: Fission product behaviour during depressurization transients
International Nuclear Information System (INIS)
Gillet, R.; Brenet, D.; Hanson, D.L.; Kimball, O.F.
1996-01-01
An experimental program in the CEA COMEDIE loop has been carried out to obtain integral test data to validate the methods and transport models used to predict fission product release from the core and plate-out in the primary coolant circuit of the Modular High Temperature Gas Cooled Reactor (MHTGR) during normal operation and liftoff, and during rapid depressurization transients. The loop consists of an in-pile section with the fuel element, deposition section (heat exchanger), filters for collecting condensible Fission Productions (FP) during depressurization tests and an out-of-pile section devoted to chemical composition control of the gas and on-line analysis of gaseous FP. After steady state irradiation, the loop was subjected to a series of in-situ blowdowns at shear ratios (ratio of the wall shear stress during blowdown to that during steady state operation) ranging from 0.7 to 5.6. The results regarding the FP profiles on the plate-out section, before and after blowdowns are given. It appears that: the plate-out profiles depend on the FP chemistry; the depressurization phases have led to significant desorption of I 131, but on the contrary, they have almost no effect for the other FP such as Ag 110m, Cs 134, Cs 137 and Te 132. (author). 1 ref., 15 figs
CP violation with self-tagging Bd modes
International Nuclear Information System (INIS)
Dunietz, I.
1991-01-01
Gronau and Wyler (GW) extract the weak phase γ and remove the dependence on final state phases by measuring six charged B mesons rates, which are grouped into two trinangles. This note applies the GW method to self-tagging B d modes. Self-tagging eliminates the need for time-dependent measurements. Of interest are the six rates, Γ(B d →D 0 K *0 )=Γ(anti B d →anti D 0 anti K *0 ), Γ(B d →anti D 0 K *0 )=Γ(anti B d →D 0 anti K *0 ), Γ(B d →D 0 CP K *0 ) and Γ(anti B d →D 0 CP anti K *0 ), where D 0 CP denotes a CP eigenmode of a D 0 or anti D 0 . Here the K *0 must be seen in its K + π - mode, which tags the beauty flavour. An additional handle exists to resolve an ambiguity in vertical strokesin γvertical stroke, which accomplished by isospin symmetry from B u and B d data. Preliminary results of a feasibility study are given. (orig.)
Energy from waste. Vol. 2; Energie aus Abfall. Bd. 2
Energy Technology Data Exchange (ETDEWEB)
Thome-Kozmiensky, K.J.; Beckmann, M.
2007-07-01
In the book under consideration, the thermal treatment in waste incinerators, in industrial power stations and in coal-fired power stations is in the foreground. Possibilities of gasification are described. The chapter 'Developments of thermal waste treatment' consists of the following chapter: (a) Maximal size of waste incineration plants (Johannes J.E. Martin); (b) Trends and highlights of the thermal waste treatment in Europe (Martin Brunner); (c) Utilization of waste heat from Vienna waste incinerators for the operation of a district cooling grid - Effects on the primary energy efficiency of district heating and district cooling in Vienna (Franz Schindelar, Alexander Wallisch); (d) Evolutionary plant development based on experiences (Hans-Peter Buechner); (e) Effects of increased chlorine freights at the cocombustion of secondary fuels at the site of the brown coal fired power station Jaenschwalde (Frank Mielke, Andreas Sparmann, Sven Kappa); (f) Refuse-fueled power stations and waste incinerators - different plant technology? (Hendrik Seeger); (g) Generation of fuel gas from high calorific wastes (Udo Hellwig, Michael Beyer); (h) Strength testing of steam vessels with increased testing pressure (Wolfgang Rossmaier). The chapter 'Energy efficiency of waste incinerators' consists the following contributions: (a) Evaluation of energy efficiency in plants of thermal waste treatment; (b) Scientific-technical and juridical rationality - a contradiction? Comments to the judgement o the VGH Baden-Wuerttemberg according to waste incineration (Bodo A. Baars and Adolf Nottrodt); (c) Determination of the energy efficiency in plants of thermal waste incineration - To the difficulties of equivalent values and calculation of the calorific value (Michael Beckmann, Reinhard Scholz). The chapter 'Optimization of the plant technology' contains the following contributions: (a) Stay a while - Considerations according to the first tank of thermal waste treatment plants with grate firing (Michael Mueck, Werner Hansen, Hans-Peter Alessio); (b) BWV-combustion technology for energy production from waste - a case study: Reno North, line 4. Waste incineration plant with a high effiency (Hans Boegh Andersen); (c) Determination of operational parameters in waste incinerators as a prerequisite for further optimisation (Martin Horeni, Michael Beckmann, Hans Fleischmann, Erhard Barth); (d) Optimization of thermal waste treatment with the INSPECT system by camera based characteristic values and Fuzzy Control (Hubert B. Keller, Joerg Matthes, Holger Schoeenecker, Tristan Krakau); (e) Renewal of process control systems in the waste incineration plant Ruhleben (Thomas Kempin, Henrik Zahn); (f) Fuzzy Control in the waste incineration plant of BSR under consideration of process optimization and economy (Thomas Kempin, Peter Knoop, Henrik Zahn, Christian Gierend). The next chapter 'New plants and extension of plants' contains the following plants: (a) New construction of a waste incinerator in Delfzijl/NL (Matthias Elfers); (b) Replace of waste incinerators at existing sites (Gert Riemenschnieder, Walter Schaefer); (c) Modernisation of the waste-fired cogeneration plant Frankfurt (Gerhard Lohe); (d) Design of plants, supply of fuels and quality control for waste incinerators (Reinhard Schu, Jens Niestroj); (e) Utilization of a water-cooled cooking grate - concept and operating experiences (Werner Auel, Manfred Kuehl); (f) The forward moving combustion grate from Jakob Stiefel GmbH - concept, plants and experiences (Martin Stiefel). The following chapter 'Exhaust gas purification' consists of the following chapters: (a) Does there exist a problem of fine dust or mercury at the waste incineration? (Heidi Foth); (b) Trends in the exhaust gas purification according to the control of the problem of fine dust or mercury - technical solutions (Christoph Mueller, Reiner Stark); (c) Measures and experiments to the reduction of mercury in the waste recycling plant Bonn (Ruediger Heidrich); (d) Considerable exhaust gas cleaning with economical process engineering (Georg Schuster); (e) ALSTOM-NID a process of conditioned dry sorption for biomass, refuse-derived fuels and domestic waste incineration plants (Uwe Gansel, Juergen Gottschalk); (f) Concepts for exhaust gas purification by the example of waste incineration in Premnitz (Ruediger Margraf); (g) Concepts for exhaust gas purification for high-calorific fuels from municipal wastes and trade waste - Waste incinerator Hannover as an example (Christian Fuchs, Thomas Feilenreiter). The last chapter 'Materials and corrosion reduction' contains the following contributions: (a) Fundamentals of refractory applications at waste incineration plants (Peter Fruehauf); (b) New developments at tube liner systems for waste incinerators (Hans Petschauer); (c) Corrosion by utilization of biomass fuels and refuse-derived fuels: Demand for layer supported characteristic corrosion values (Wolfgang Spiegel, Thomas Herzog, Renate Jordan, Gabi Magel, Wolfgang Mueller, Werner Schmidl); (d) Technology upgrade in the scope of sanitation of protection systems for tube walls of a waste boiler in the case of TREA Breisgau (Karl-Ulrich Martin, Oliver Seibel, Bernd Bastian); (e) Cladding in the boiler construction and plant engineering - newest developments (Wolfgang Hoffmeister); (f) Online evaluation of the thermal flow on the walls of a membrane evaporator of steam generators (Michael Beckmann, Sascha Krueger, Gabi Magel, Wolfgang Spiegel); (g) Extension of the reactor runs by effective cleaning in empty trains of incineration plants for wastes and biomass (Stephan Simon).
International Nuclear Information System (INIS)
Eeg, J.O.; Fajfer, S.; Prapotnik, A.
2005-01-01
The amplitudes for decays of the type B d,s →D s,d D s,d , have no factorizable contributions, while B d,s →D s,d D * s,d , and B d,s →D * s,d D * s,d have relatively small factorizable contributions through the annihilation mechanism. The dominant contributions to the decay amplitudes arise from chiral loop contributions and tree level amplitudes which can be obtained in terms of soft gluon emissions forming a gluon condensate. We predict that the branching ratios for the processes anti B 0 d →D s + D s - , anti B 0 d →D s +* D s - and anti B 0 d →D s + D s -* are all of order (2-3) x 10 -4 , while anti B 0 s →D d + D d - , anti B 0 s →D d +* D d - and anti B 0 s →D d + D d -* are of order (4-7) x 10 -3 . We obtain branching ratios for two D * 's in the final state of order two times bigger. (orig.)
2013-11-12
.... 611 of Public Law 92-574, the ``Noise Control Act of 1972.'' The FAA issues special conditions, as... have a novel or unusual design feature associated with an electronic flight control system that provides roll control of the airplanes through pilot inputs to the flight computers. The applicable...
2013-12-11
... electronic flight control system that contains fly-by-wire control laws, including envelope protections, for... issue a finding of regulatory adequacy under Sec. 611 of Public Law 92-574, the ``Noise Control Act of... electronic flight control system that contains fly-by-wire control laws, including envelope protections, for...
2013-12-19
... issue a finding of regulatory adequacy under Sec. 611 of Public Law 92-574, the ``Noise Control Act of...- high bypass, geared turbofan engines. Flight controls are fly-by-wire flight with two passive/uncoupled... and column controls. These airplanes also have a fly-by-wire electronic flight control system. This...
2013-10-31
... five landscape primary cockpit displays. The dimension of the airplanes encompasses a wingspan of 115... by five incidents in the 1990's, which revealed unexpected flame spread along the insulation film... test criteria for insulation films directly relating to in-flight fire resistance. The current test...
75 FR 63420 - Airworthiness Directives; Bombardier, Inc. Model BD-700-1A10 and BD-700-1A11 Airplanes
2010-10-15
... reports of main landing gear (MLG) tire failure on landing, during which a flailing tire tread caused... the brake system performance could adversely affect the aircraft during landing. * * * * * [[Page... have been two in-service reports of main landing gear (MLG) tire failure on landing, during which a...
2011-05-31
.... Per Type Certificate Data Sheet (TCDS) T00003NY, those aircraft models are known under the marketing...., conformal) to the external scene. In addition, the SVS image and the HUD symbols--when considered singly or... external scene. In such cases, these symbols may be displayed but with an altered appearance that makes the...
75 FR 68690 - Airworthiness Directives; Bombardier, Inc. Model BD-700-1A10 and BD-700-1A11 Airplanes
2010-11-09
... five reported cases of balance washer screw failure on similar RATs [ram air turbines]/air driven... turbine imbalance. Such imbalance could potentially result in RAT structural failure (including blade... activated by a dual engine shutdown, could also result in loss of hydraulic power for the flight controls...
Possible implications of small or large CP violation in Bd0 vs (anti B)d0→J/ΨKs decay
International Nuclear Information System (INIS)
Xing Zhizhong
2002-01-01
The author argue that a small or large CP-violating asymmetry in B d 0 vs (anti B) d 0 →J/ψK s decays, which seems to be favored by the recent BaBar or Belle data, might hint at the existence of new physics in B d 0 -(anti B) d 0 mixing. The authors present a model-independent framework to show how new physics modifies the standard-model CP-violating asymmetry. The particularly emphasize that the consistent of cp-violating asymmetry experimental result with standard model prediction must not imply the absence of new physics in B d 0 -(anti B) d 0 mixing
2013-12-19
... Series Airplanes; Seats With Non-Traditional, Large, Non- Metallic Panels AGENCY: Federal Aviation... airplanes will have a novel or unusual design feature associated with seats that include non-traditional... base and significant common design elements. The fuselage is aluminum alloy material, blended double...
76 FR 66198 - Airworthiness Directives; Bombardier, Inc. Model BD-700-1A10 and BD-700-1A11 Airplanes
2011-10-26
...., Monday through Friday, except Federal holidays. For service information identified in this proposed AD...., Monday through Friday, except Federal holidays. The AD docket contains this proposed AD, the regulatory... airplanes, certificated in any category, serial numbers (S/N) 9002 through 9126 inclusive, 9128 through 9312...
2013-12-11
... must not be less than: (1) 2.5g for the normal state of the electronic flight control system with the... speeds. For the FAA to consider a trajectory change as satisfactory, the applicant should propose and...
Directory of Open Access Journals (Sweden)
Alessandro Bampa
2014-02-01
Full Text Available This paper provides a commentary and translation of two contrafacta of Arnaut Daniel’s sestina: Guilhem de Saint Gregori’s "Ben gran avolesa intra" and Bartolomeo Zorzi’s "En tal dezir mos cors intra". For the first song, I will highlight the new contexts and meanings given to Arnaut’s images (which are taken from his sestina and other poems within Guilhem’s invective against Aimers II of Poitiers, in order to evaluate its literary qualities and innovations. Through lexical analysis, this paper will reveal the strong connection between Zorzi’s and Guilhem’s songs. In particular, the paper analyses specifically their common theme of Hell, suggesting Bartolomeo’s text is most likely an answer to Arnaut’s sestina, which clearly expresses a desire of sensual pleasure. The study pays particular attention to the relation between sexual love and the matter of eternal damnation: Zorzi attacks Arnaut’s ferm voler, advancing his argument by evoking Chrétien de Troyes’ "Perceval" (references to which are spread throughout the text, and not only in l. 18 and through his constant stress on the duties towards one’s family.
2013-12-11
... exceeded. When EFCS failure states occur, flight envelope protection features can likewise either be... Series Airplanes; Flight Envelope Protection: General Limiting Requirements AGENCY: Federal Aviation... flight control system that provides flight envelope protections. The applicable airworthiness regulations...
2013-11-12
...), as well as at http://DocketsInfo.dot.gov/ . Docket: Background documents or comments received may be... comments we receive. Background On December 10, 2009, Bombardier Inc. applied for a type certificate for... identical supplier base and significant common design elements. The fuselage is an aluminum alloy material...
2013-10-31
... provide different levels of protection from post-crash fire threats than similar aircraft constructed from... turbofan engines. Flight controls are fly-by-wire systems with two passive/uncoupled side sticks. Avionics... models of airplanes. Maximum operating altitude is 41,000 feet for both models of airplanes. The fuselage...
2013-10-31
... occurrence and that are included in the flight manual (e.g., speed limitations and avoidance of severe... CFR part 25 regardless of calculated system reliability. Where analysis shows the probability of these... required by part 25 or significantly reduce the [[Page 65161
C P asymmetry in Bd → φ KS: Standard model pollution
International Nuclear Information System (INIS)
Grossman, Y.; Worah, M. P.; Seattle, Univ. of Washington
1997-09-01
The difference in the time dependent C P asymmetries between the modes B → ψ K S and B d → φ K S is a clean signal for physics beyond the Standard Model. this interpretation could fail if there is a large enhancement of the matrix element of the b → u u-bar s operator between the B d initial state and the φ K S final state. They argue against this possibility and propose some experimental tests that could shed light on the situation
Energy Technology Data Exchange (ETDEWEB)
Hess, C. [comp.
1998-12-31
In a versatile, often multidisciplinary programme the DECHEMA annual conferences in 1998 present new results from research, the state of the art, and, not least, the persons, companies, and institutions active in various disciplines. This volume contains shortened versions of the lectures and posters presented at the 16th Annual Conference of Biotechnologists. [Deutsch] Die DECHEMA-Jahrestagungen `98 stellen in einem vielseitigen, oft interdisziplinaeren Programm neue Ergebnisse aus der Forschung, den aktuellen Stand der Technik und nicht zuletzt auch die auf den jeweiligen Gebieten aktiven Personen, Firmen und Institutionen vor. In diesem Band sind die Kurzfassungen der Vortraege und Poster der 16. Jahrestagung der Biotechnologen enthalten. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Weber, R
1986-01-01
Reserves of our major energy sources natural gas, petroleum and coal are limited. Their combustion essentially contributes to air pollution widh all its health hazards and environmental impacts. Apart from the fact that power plants supplying energy with the help of nuclear fission are disputed, uranium reserves are limited, too. The developmental state of nuclear fusion, an the other hand, still defies concrete statements as the future availability of fusion-based energy. Considering above facts it is evident that renewable energy sources will be gaining in importance. The book above all intends to give a consistent survey on the forms and capacities of renewable energy sources, existing technologies and technologies currently being developed, historical aspects, the social and environmental compatibility of renewable energy sources, economic aspects, and future prospects. The dictionary contains 197 independent alphabetically arranged and basically coherent chapters which are to provide the basis for profound reflections on the subject.
Forness, Steven R.; Kavale, Kenneth A.
2000-01-01
This article reviews the development and current status of alternatives to the federal definition of emotional disturbance or behavior disorders. It notes that several states are now revising their own terminologies or definitions in response to the 1997 reauthorization of the Individuals with Disabilities Education Act that dropped the term…
Energy Technology Data Exchange (ETDEWEB)
Baumann, M; Dahm-Daphi, J; Dikomey, E; Petersen, C; Rodemann, H P; Zips, D [eds.
2007-07-01
The following topics were dealt with: DNA repair as therapeutical target in radiation therapy, biological imaging and tumor microenvironment, molecular factors of radiation therapy, molecular factors and modulation of the radiation reaction of normal tissues, experimental tumor therapy, EGFR inhibition, the endothel cell as primary target of radiation therapy, molecular and cellular foundations of the radiation biology of protons and ions. (HSI)
Development of Mitsubishi--Lurgi fluidized bd incinerator with pre-drying hearths
Energy Technology Data Exchange (ETDEWEB)
Hori, Y; Senshu, A; Mishima, K; Sato, T; Honda, H
1979-02-01
For a better disposal of a steadily increasing volume of sludges with energy conservation it is essential to develop an effective and energy-saving incinerator. The fluidized bed incinerator now widely used for the disposal of sludges has many superior features as compared with the conventional vertical multiple-hearth incinerator, but, on the other hand, has a defect, that is, a large fuel consumption. This is due to the fact that the fluidized bed incinerator has generally low drying efficiency notwithstanding its excellent burning characteristics with minimum excess air. The feasibility of fuel saving by installing sludge pre-drying hearths and an exhaust gas recirculation system additionally on the conventional fluidized bed incinerator and conducted incineration tests on various kinds of sludges, using a 1500 kg/h pilot plant equipped with the incinerator is examined. As the result, the Mitsubishi--Lurgi fluidized bed incinerator with high efficiency multiple pre-drying hearths which consumes less fuel was developed. Part of the incineration test results are presented.
Basic course in theoretical physics. Vol. 2. Grundkurs in Theoretischer Physik. Bd. 2
Energy Technology Data Exchange (ETDEWEB)
Dietze, H D
1975-01-01
This book is the second volume of an edition of two volumes which concern theoretical physics. In this volume electrodynamics, the foundations of special relativity theory, and elementary quantum mechanics are introduced.
Energy Technology Data Exchange (ETDEWEB)
Baumann, Michael; Dahm-Daphi, Jochen; Dikomey, Ekkehard; Petersen, Cordula; Rodemann, H Peter; Zips, Daniel [eds.
2010-12-18
The proceedings include review contributions on radio-oncology, and new radiation technologies and molecular prediction; and poster sessions on the following topics: hypoxia; molecular mechanisms of radiation resistance; molecular targeting; DNA repair; biological imaging; biology of experimental radiations; normal tissue toxicity; modern radiotherapy; tumor hypoxia and metabolic micro milieu; immune system and radiotherapy.
Energy Technology Data Exchange (ETDEWEB)
Warnecke, H.J. [ed.] [Fraunhofer-Institut fuer Produktionstechnik und Automatisierung (IPA), Stuttgart (Germany)
1992-12-31
This manual is the second, completely revised edition of the standard manual ``Maintenance - Fundamentals``, which was first published in 1981. It presents an outline of all relevant fields of maintenance today and contains practical information on new and established methods of maintenance management and technology. With its comprehensive concept, which addresses any industrial enterprise that wants to remain competitive, the manual is indispensable for maintenance managers in industry, service enterprises and consultancies. Vol.1, ``Maintenance Management``, informs the reader on fundamentals, design with a view to maintenance, organisation of maintenance work, personnel management, industrial safety and economic aspects of maintenance. Current issues such as product liability, electronic data processing, expert systems, environmental protection, controlling based on characteristic data, etc. are gone into. Graphical representations, concrete procedural information and exemplary solutions may be used directly as working tools for the practice of maintenance. (orig.) [Deutsch] Das vorliegende Handbuch ist die zweite, voellig ueberarbeitete und erweiterte Auflage des Standardwerkes ``Instandhaltung - Grundlagen``, das 1981 erstmals erschien. Es gibt einen Ueberblick ueber alle relevanten Gebiete einer modernen Instandhaltung und vermittelt praxisnahes Wissen ueber neue und bewaehrte Methoden und Verfahren des Instandhaltungsmanagements und der Instandhaltungstechnik. Mit dieser umfassenden Konzeption, die auf die Belange des im Wettbewerb stehenden Industriebetriebes ausgerichtet ist, wendet sich das Handbuch an die Fuehrungskraefte der Instandhaltung in der Industrie sowie an Dienstleistungs- und Beratungsunternehmen. Im Band 1 ``Instandhaltungsmanagement`` kann sich der Leser ueber Grundlagen, instandhaltungsgerechtes Konstruieren, Organisation der Instandhaltung, Personalmanagement, Arbeitssicherheit sowie Wirtschaftlichkeit der Instandhaltung informieren. Aktuelle Themen wie Produkthaftung, EDV-Einsatz, Expertensystemen, Umweltschutz, kennzahlengestuetztes Controlling etc. wurden neu aufgenommen. Zahlreiche graphische Darstellungen, konkrete Handlungsanleitungen und Musterloesungen koennen als direkt anwendbare Arbeitshilfen fuer die betriebliche Instandhaltungspraxis eingesetzt werden. (orig.)
Application of TRAC-BD1/MOD1 to a BWR/4 feedwater control failure ATWS
International Nuclear Information System (INIS)
Rouhani, S.Z.; Giles, M.M.; Mohr, C.M. Jr.; Weaver, W.L. III.
1984-01-01
This paper begins with a short description of the Transient Reactor Analysis Code for Boiling Water Reactors (TRAC-BWR), briefly mentioning some of its main features such as specific BWR models and input structure. Next, an input model of a BWR/4 is described, and, the assumptions used in performing an analysis of the loss of a feedwater controller without scram are listed. The important features of the calculated trends in flows, pressure, reactivity, and power are shown graphically and commented in the text. A comparison of some of the main predicted trends with the calculated results from a similar study by General Electric is also presented
Energy Technology Data Exchange (ETDEWEB)
Pfeiler, Wolfgang [Wien Univ. (Austria). Fakultaet fuer Physik
2017-07-01
The following topics are dealt with: Photo- and Compton effect, photon, particle as wave, de Broglie wavelength, self-interference, dispersion relation, wavepacket, probability interpretation, uncertainty relations, occupation inversion, laser condition, tunnel effect, harmonic oscillator, hydrogen atom, quantum numbers, energy levels, electron spin, fine structure, Zeeman effect, periodic system, nuclear properties, binding energy, nuclear magnetism, nuclear models, radioactive decay, nuclear reactions, nuclear fission, nuclear energy, nuclear fusion, dosimetry, elementary particles, conservation laws, quark model, standard model, cosmology (Hubble law, cosmic background radiation, darkmatter, critical mass density, cosmological standard model), Moessbauer effect.
Raimbaut de Vaqueiras, “Domna, tant vos ai prejada” (BdT 392.7
Directory of Open Access Journals (Sweden)
Gilda Caiti-Russo
2009-12-01
Full Text Available This paper will attempt to read Raimbaut de Vaqueiras’ ‘contrasto’ from the viewpoint of its explicit addressees: the late twelfth-century imperial nobility of north-western Italy, as embodied by the Malaspina family. The text’s distinctive bilingualism thus assumes social and political significance since it pits the claims of the feudal aristocracy of the hinterland against the power of the Genoese bankers and merchants. The dialectical relationship of the two sides involved, played out by the voices of the jongleur and the Genoese lady, is nevertheless also literary: Raimbaut appears to match popular poetry, poetry which is «non regulata» as Dante would later call it, against a century of courtly Occitan poetry distinguished by an extremely formal tradition. A carnivalesque dimension is thus present in the reciprocal illumination of the two poetic voices: if popular poetry is unregulated despite its expressive qualities, troubadour poetry is confined, by means of the parody of the genre of the ‘salut’, to topics far-removed from reality. Raimbaut’s aim then is to restructure trobar by going back to the beginning: to the Count of Poitiers and his political and cultural act of inventing a secular poetry of aristocratic inspiration and in the vernacular. A ‘male’ poetry that will be formulated by the surprising gap at the end of the poem.
Energy Technology Data Exchange (ETDEWEB)
Hess, C [comp.
1999-12-31
In a versatile, often multidisciplinary programme the DECHEMA annual conferences in 1998 present new results from research, the state of the art, and, not least, the persons, companies, and institutions active in various disciplines. This volume contains shortened versions of the lectures and posters presented at the 16th Annual Conference of Biotechnologists. [Deutsch] Die DECHEMA-Jahrestagungen `98 stellen in einem vielseitigen, oft interdisziplinaeren Programm neue Ergebnisse aus der Forschung, den aktuellen Stand der Technik und nicht zuletzt auch die auf den jeweiligen Gebieten aktiven Personen, Firmen und Institutionen vor. In diesem Band sind die Kurzfassungen der Vortraege und Poster der 16. Jahrestagung der Biotechnologen enthalten. (orig.)
Study of Charmless Bd,s0 → h+h'-π0 decays in LHCb
International Nuclear Information System (INIS)
Roa Romero, D.A.
2013-01-01
This thesis work is about the identification of charmless three-body decays of neutral B mesons with a π 0 in the final state (B d,s 0 → h + h' - π 0 ) through the analysis of a 1.0 fb -1 data sample collected in 2011 by the LHCb experiment at the LHC. Those modes are sensitive to CKM parameters and allow to test Standard Model predictions related to CP violation. Some of them, such as B s 0 → K - π + π 0 and B s 0 → K + K - π 0 , have not been observed previously. This is the first analysis with energetic π 0 in LHCb. To evaluate the detector performance for π 0 , D *+ → D 0 (→ K - π + π 0 )π + decays have been selected. This provides a clean and high statistics sample of neutral pions used to study their energy calibration as well as the effectiveness of the π 0 /γ separation tool of the experiment. Radiative decays are indeed the most dangerous backgrounds for the study of B d,s 0 → h + h' - π 0 modes. To select B d,s 0 → h + h' - π 0 events, a dedicated trigger algorithm has been implemented. It complements the standard online selections and significantly improves the efficiency. Offline, obvious backgrounds, mainly from charm decays, are rejected applying simple criteria. The sample is then further purified using a multivariate classifier. At last, information from the ring imaging Cherenkov detectors allows to separate π + π - π 0 , K ± π ± π 0 and K + K - π 0 final states. A simultaneous fit of the reconstructed B mass spectra in the three sub-samples is used to extract the signal yields. It accounts for the different backgrounds remaining as well as for the signal cross-feeds from one sub-sample to the other. The B 0 → π + π - π 0 , B 0 → K + π - π 0 and B s 0 → K + K - π 0 contributions are clearly established. This is the first observation of the B s 0 → K + K - π 0 decay mode. (author)
Energy Technology Data Exchange (ETDEWEB)
Baumann, Michael; Krause, Mechthild [Universitaetsklinikum Technische Univ. Dresden (Germany). Klinik und Poliklinik fuer Strahlentherapie und Radiologie; Cordes, Nils [Universitaetsklinikum Technische Univ. Dresden (Germany). OncoRay - Nationales Zentrum fuer Strahlenforschung in der Radioonkologie; Helmholtz-Zentrum Dresden-Rossendorf e.V., Dresden (Germany); Petersen, Cordula [Universitaetsklinikum Hamburg-Eppendorf, Hamburg (Germany). Klinik und Poliklinik fuer Strahlentherapie und Radioonkologie; Rodemann, H. Peter [Universitaetsklinikum Tuebingen (Germany). Sektion fuer Strahlenbiologie; Rothkamm, Kai [Universitaetsklinikum Hamburg-Eppendorf, Hamburg (Germany). Lab. fuer Strahlentherapie und Experimentelle Radioonkologie; Zips, Daniel (ed.) [Tuebingen Univ. (Germany). Universitaetsklinik fuer Radioonkologie
2016-05-01
The proceedings of the 25th symposium on experimental radiotherapy and clinical radiobiology include papers on the following issues: radiotherapy individualization based on imaging; pre-clinic imaging and new experimental methods; methods and models, micromilieu and metabolism, combined therapy; secondary tumors following radiotherapy; radiogenic effects in normal tissue; resistance mechanism of tumors and normal tissue; personalized radio-oncology - which biological data are needed; pre-clinic and personalized radio-oncology; biomarkers - pre-clinic and translational; translational examinations for personalized radio-oncology.
Energy Technology Data Exchange (ETDEWEB)
Brandes, E.; Moeller, W. [Laboratorium ' Sicherheitstechnische Kenngroessen' , Braunschweig (Germany)
2003-07-01
This reference manual is based on the 2002 version of the CHEMSAFE database, which is produced since 1989 by the PTB (Physikalisch-Technische Bundesanstalt), the BAM (Bundesanstalt fuer Materialforschung und -pruefung) and the DECHEMA (Gesellschaft fuer Chemische Technik und Biotechnologie e.V.). About 1,900 combustible gases and vapours are listed, along with explosion protection characteristics like flame point, ignition temperature, explosion limits, minimum ignition energy, normal gap width, maximum explosion pressure, and maximum pressure increase over time. Important thermophysical data are presented as well, e.g. boiling temperature, vapour pressure as a function of temperature, melting temperature, and density. Definitions of the characteristics are presented. There are several indexis to facilitate acces (CAS number, sum formula, synonyms). [German] Anwender in Industrie, Handel, Handwerk und Behoerden benoetigen verlaessliche Daten, von Fachleuten bewertete Kenngroessen des Brand- und Explosionsschutzes, um Brand- und Explosionsgefahren beim Verarbeiten, Abfuellen, Lagern, Befoerdern und Entsorgen brennbarer Stoffe beurteilen und angemessene Schutzmassnahmen ergreifen zu koennen. Die 1989 gemeinsam mit der Bundesanstalt fuer Materialfoschung und -pruefung (BAM) und der Gesellschaft fuer Chemische Technik und Biotechnologie e.v (DECHEMA) erstellte Datenbank CHEMSAFE diente als Grundlage dieses Nachschlagewerkes. Die hier bei Drucklegung wiedergegebenen Kenngroessen entsprechen dem Update 2002 der Datenbank CHEMSAFE. Etwa 1.900 brennbare Gase und Daempfe, Kenngroessen des Explosionsschutzes wie Flammpunkt, Zuendtemperatur, Explosionsgrenzen, Mindestzuendenergie, Normspaltweite, maximaler Explosionsdruck und maximaler zeitlicher Druckanstieg sind ebenso aufgelistet wie auch einige wichtige thermophysikalische Groessen wie Siedetemperatur, Dampfdruck als Funktion der Temperatur, Schmelztemperatur und Dichte. Die Angaben werden eingeleitet durch Definitionen der Kenngroessen. Mehrere Register (CAS-Nummer, Summenformel, Synonyme) erleichtern das Auffinden der Daten. (orig.)
Probing new physics in electroweak penguins through Bd and Bs decays
International Nuclear Information System (INIS)
Hofer, Lars; Scherer, Dominik; Vernazza, Leonardo
2011-01-01
An enhanced electroweak penguin amplitude due to the presence of unknown new physics can explain the discrepancies found between theory and experiment in the B → πK decays, in particular in A CP (B - → π 0 K - ) - A CP ( B-bar 0 → π + K - ), but the current precision of the theoretical and experimental results does not allow to draw a firm conclusion. We argue that the B-bar s → φρ 0 and B-bar s → φπ 0 decays offer an additional tool to investigate this possibility. These purely isospin-violating decays are dominated by electroweak penguins and we show that in presence of a new physics contribution their branching ratio can be enhanced by about an order of magnitude, without violating any constraints from other hadronic B decays. This makes them very interesting modes for LHCb and future B factories. In [1] we have performed both a model-independent analysis and a study within realistic New Physics models such as a modified-Z 0 -penguin scenario, a model with an additional Z' boson and the MSSM. In this article we summarise the most important results of our study.
Robust-BD Estimation and Inference for General Partially Linear Models
Directory of Open Access Journals (Sweden)
Chunming Zhang
2017-11-01
Full Text Available The classical quadratic loss for the partially linear model (PLM and the likelihood function for the generalized PLM are not resistant to outliers. This inspires us to propose a class of “robust-Bregman divergence (BD” estimators of both the parametric and nonparametric components in the general partially linear model (GPLM, which allows the distribution of the response variable to be partially specified, without being fully known. Using the local-polynomial function estimation method, we propose a computationally-efficient procedure for obtaining “robust-BD” estimators and establish the consistency and asymptotic normality of the “robust-BD” estimator of the parametric component β o . For inference procedures of β o in the GPLM, we show that the Wald-type test statistic W n constructed from the “robust-BD” estimators is asymptotically distribution free under the null, whereas the likelihood ratio-type test statistic Λ n is not. This provides an insight into the distinction from the asymptotic equivalence (Fan and Huang 2005 between W n and Λ n in the PLM constructed from profile least-squares estimators using the non-robust quadratic loss. Numerical examples illustrate the computational effectiveness of the proposed “robust-BD” estimators and robust Wald-type test in the appearance of outlying observations.
Energy Technology Data Exchange (ETDEWEB)
Beck, F; Euler, K J
1984-01-01
Vol. 1 is a synthesis of electrochemical, battery-technical and energy industry aspects. The role of energy storage systems in the energy industry, e.g. in connection with a hydrogen technology, is discussed along with the thermodynamic, kinetic, materials-technical and process engineering fundamentals. ''Classic'' and new systems are described in full detail for the first time. Cyclisation and technical/economic criteria of selection are discussed. (orig./GG).
Draft genome sequence of Francisella tularensis subsp. holarctica BD11-00177
Coolen, J.P.M.; Sjödin, A.; Maraha, B.; Hajer, G.F.; Forsman, M.; Verspui, E.; Frenay, H.M.E.; Notermans, D.W.; Vries, M.C. de; Reubsaet, F.A.G.; Paauw, A.; Roeselers, G.
2013-01-01
Francisella tularensis is a facultative intracellular bacterium in the class Gammaproteobacteria. This strain is of interest because it is the etiologic agent of tularemia and a highly virulent category A biothreat agent. Here we describe the draft genome sequence and annotation of Francisella
Lifescience Database Archive (English)
Full Text Available GDLYRLKSE DAKSRFVSNLVGQMSGVTIQRNSSSCRFKLLKG*qrfkytlckglgidvndvikfaidqt cksiy*rker...EPHPEFAQHKFDVSGFAARQPYNHPNDDFVQPGDLYRLKSE DAKSRFVSNLVGQMSGVTIQRNSSSCRFKLLKG*qrfkytlckglgidvndvikfaidqt cksiy
Lauer, Antje; McConnel, Lonnie; Singh, Navdeep
2012-01-01
We designed a microbiology project that fully engaged undergraduate biology students, high school students, and their teachers in a summer research program as part of the Research Education Vitalizing Science University Program conducted at California State University Bakersfield. Modern molecular biological methods and microscopy were used to…
Energy Technology Data Exchange (ETDEWEB)
Baumann, Michael; Dahm-Daphi, Jochen; Dikomey, Ekkehard; Petersen, Cordula; Rodemann, H Peter; Zips, Daniel [eds.
2009-07-15
The proceedings on experimental radiotherapy and clinical radiobiology contain two review articles (prediction of normal tissue reactions after radiotherapy, ?H2AX foci as a marker for DNA double-strand breaks) and 34 contributions to the following topics: Hypoxia and molecular mechanisms of radiation resistance; biological imaging of the tumor micromilieu; DNA repair, genomic instability and carcerogenesis; molecular factors of radiation resistance; actual controversial discussion on possible irradiation caused metastasis risk enhancement; EGFR inhibition and irradiation; biology of experimental radiation/ normal tissue toxicity.
Best estimate radiation heat transfer model developed for TRAC-BD1
International Nuclear Information System (INIS)
Spore, J.W.; Giles, M.M.; Shumway, R.W.
1981-01-01
A best estimate radiation heat transfer model for analysis of BWR fuel bundles has been developed and compared with 8 x 8 fuel bundle data. The model includes surface-to-surface and surface-to-two-phase fluid radiation heat transfer. A simple method of correcting for anisotropic reflection effects has been included in the model
BD LSRFortessa for Tulane DoD ID and Cancer Projects
2015-01-21
Consortium building several blocks away. The Department of Microbiology & Immunology has paid for all reagents (except antibodies) and...building several blocks away. The Department of Microbiology & Immunology has paid for all reagents (except antibodies) and maintains a service contract on...Mr. James McLachlan Tulane University 1430 Tulane Avenue (SL-38) New Orleans, LA 70112 QUOTATION DATE: QUOTATION EXPIRATION DATE: REFERENCE
Anonimo, “Totas honors e tuig faig benestan” (BdT 461.234
Directory of Open Access Journals (Sweden)
Marco Grimaldi
2010-08-01
Full Text Available This paper will examine an anonymous ‘planh’, “Totas honor e tuig faig benestan”, for the death of Manfred of Swabia, illegitimate son of Frederick II, who was killed in the battle of Benevento in 1266. The text is copied in a section of the ‘twin’ chansonniers I and K which contains mainly lyric laments (an exception in the troubadour manuscript tradition and for this reason will serve as a basis for a discussion of the concept of ‘documentary series’. The paper will also consider the author’s origin, probably Italian on the basis of the linguistic and metrical evidence, and attempt to place the planh more precisely within the context of the struggle between Charles of Anjou and Manfred, as well as illustrate the role played by political troubadour poetry at the Italian court of the last Swabians.
Energy Technology Data Exchange (ETDEWEB)
Baumann, Michael; Dahm-Daphi, Jochen; Dikomey, Ekkehard; Petersen, Cordula; Rodemannn, Hans-Peter; Zips, Daniel (eds.)
2011-07-01
The proceedings include contributions on the following issues: laser driven proton accelerators on the way for radiotherapy, radiobiological evaluation of new radiations; molecular factors of radiation response; biological targeting; EGFR epidermal growth factor receptor/targeting - combined internal and external irradiation, radiobiology of normal tissues; dose-volume histograms for the radiotherapy: curves without radiobiological relevance or important information for the therapy planning; HPV (human papilloma virus) and radiation sensitivity of HNSCC (head and neck squamous cell carcinomas): evidence, radiobiological mechanism, clinical consequences and perspectives; mechanisms of action and intertumoral heterogeneity of response to EGFR inhibition in radiotherapy of solid tumors; evaluation of biomarkers for radiotherapy.
Supersymmetry and CP violating asymmetries in $B_{d}, s$ decays
Barenboim, G
1999-01-01
We study possible effects of supersymmetry (SUSY) in CP asymmetries in non-leptonic B/sub d, s/ decays in a variety of SUSY flavour models considered in literature. We use both mass insertion and vertex mixing methods to calculate squark-gluino box diagram contribution to B/sub d, s/-B/sub d, s/ mixings. With the squark mixing parameter eta =0.22, and with large new CP phases, it turns out that the CP asymmetries to be measured in upcoming B-factories, HERA-B and LHC-B, can be completely dominated by the SUSY contribution in almost every considered model. Discrimination between the different models can be done by comparing experimental results in different decay modes. In some models squark masses up to ~5 TeV can be probed through these experiments provided the SUSY contribution to B-B mixing is at 10 3.959305e-309vel, ¦M/sub 12//sup SUSY//M/sub 12//sup SM /¦~0.1. This implies that models with heavy squarks have a fair chance to be tested in the future CP experiments before LHC. (41 refs).
Excercises in diagnostic radiology. Vol. 8. Uebungen in radiologischer Diagnostik. Bd. 8. Notfaelle
Energy Technology Data Exchange (ETDEWEB)
Langston, C S; Squire, L F
1982-01-01
Diagnostic radiology in emergency patients as a supplement to anamnesis and examination has gained increasing importance in the last few years. Usually, the physician in charge has only few signs to go by when a patient is sent to radiology. The most frequent signs are pectoral pain, headache, dyspenea, etc. The cases in this book have been selected accordingly. Although the names have been invented the case histories presented have not been greatly changed. The original 'negatives' of the anamnesis are not presented in most cases as they would have taken up too much space. No important information has been omitted. A typical and unusual cases are characterized as such.
Applied ecology - man and the environment. Vol. 2. Angewandte Oekologie - Mensch und Umwelt. Bd. 2
Energy Technology Data Exchange (ETDEWEB)
Bick, H; Olschowy, G; Hansmeyer, K H; Schmoock, P
1984-01-01
This is the second volume on the radio course entitled ''Man and his Environment'', a feature from the media association in 1981/2. Ecology as a science is concerned with the reciprocal relationship between organisms and their environment, a system of which man and his environment is only a small part. Applied ecology consists of protection of the environment with its two main areas ''the protection of the environment against mans intervention'' and ''protecting man against environmental dangers''. The second volume deals with the subjects: agriculture, energy, protection of nature and of the landscape, environment and society. The material covers many different subjects, and the book is concerned with promoting an awareness of and responsibility for the environment.
Measurement of the $B_{d}^{0} - \\overline{B}_{d}^{0}$ oscillation frequency
Acciarri, M; Aguilar-Benítez, M; Ahlen, S P; Alcaraz, J; Alemanni, G; Allaby, James V; Aloisio, A; Alviggi, M G; Ambrosi, G; Anderhub, H; Andreev, V P; Angelescu, T; Anselmo, F; Arefev, A; Azemoon, T; Aziz, T; Bagnaia, P; Baksay, L; Ball, R C; Banerjee, S; Banerjee, Sw; Banicz, K; Barczyk, A; Barillère, R; Barone, L; Bartalini, P; Baschirotto, A; Basile, M; Battiston, R; Bay, A; Becattini, F; Becker, U; Behner, F; Berdugo, J; Berges, P; Bertucci, B; Betev, B L; Bhattacharya, S; Biasini, M; Biland, A; Bilei, G M; Blaising, J J; Blyth, S C; Bobbink, Gerjan J; Böck, R K; Böhm, A; Boldizsar, L; Borgia, B; Bourilkov, D; Bourquin, Maurice; Boutigny, D; Braccini, S; Branson, J G; Brigljevic, V; Brock, I C; Buffini, A; Buijs, A; Burger, J D; Burger, W J; Busenitz, J K; Cai, X D; Campanelli, M; Capell, M; Cara Romeo, G; Carlino, G; Cartacci, A M; Casaus, J; Castellini, G; Cavallari, F; Cavallo, N; Cecchi, C; Cerrada-Canales, M; Cesaroni, F; Chamizo-Llatas, M; Chang, Y H; Chaturvedi, U K; Chekanov, S V; Chemarin, M; Chen, A; Chen, G; Chen, G M; Chen, H F; Chen, H S; Chen, M; Chiefari, G; Chien, C Y; Cifarelli, Luisa; Cindolo, F; Civinini, C; Clare, I; Clare, R; Cohn, H O; Coignet, G; Colijn, A P; Colino, N; Costantini, S; Cotorobai, F; de la Cruz, B; Csilling, Akos; Dai, T S; D'Alessandro, R; De Asmundis, R; Degré, A; Deiters, K; Denes, P; De Notaristefani, F; DiBitonto, Daryl; Diemoz, M; Van Dierendonck, D N; Di Lodovico, F; Dionisi, C; Dittmar, Michael; Dominguez, A; Doria, A; Dova, M T; Drago, E; Duchesneau, D; Duinker, P; Durán, I; Dutta, S; Easo, S; Efremenko, Yu V; El-Mamouni, H; Engler, A; Eppling, F J; Erné, F C; Ernenwein, J P; Extermann, Pierre; Fabre, M; Faccini, R; Falciano, S; Favara, A; Fay, J; Fedin, O; Felcini, Marta; Fenyi, B; Ferguson, T; Ferroni, F; Fesefeldt, H S; Fiandrini, E; Field, J H; Filthaut, Frank; Fisher, P H; Fisk, I; Forconi, G; Fredj, L; Freudenreich, Klaus; Furetta, C; Galaktionov, Yu; Ganguli, S N; García-Abia, P; Gau, S S; Gentile, S; Gerald, J; Gheordanescu, N; Giagu, S; Goldfarb, S; Goldstein, J; Gong, Z F; Gougas, Andreas; Gratta, Giorgio; Grünewald, M W; Gupta, V K; Gurtu, A; Gutay, L J; Haas, D; Hartmann, B; Hasan, A; Hatzifotiadou, D; Hebbeker, T; Hervé, A; Hirschfelder, J; Van Hoek, W C; Hofer, H; Hoorani, H; Hou, S R; Hu, G; Innocente, Vincenzo; Jenkes, K; Jin, B N; Jones, L W; de Jong, P; Josa-Mutuberria, I; Kasser, A; Khan, R A; Kamrad, D; Kamyshkov, Yu A; Kapustinsky, J S; Karyotakis, Yu; Kaur, M; Kienzle-Focacci, M N; Kim, D; Kim, D H; Kim, J K; Kim, S C; Kinnison, W W; Kirkby, A; Kirkby, D; Kirkby, Jasper; Kiss, D; Kittel, E W; Klimentov, A; König, A C; Kopp, A; Korolko, I; Koutsenko, V F; Krämer, R W; Krenz, W; Kunin, A; Lacentre, P E; Ladrón de Guevara, P; Landi, G; Lapoint, C; Lassila-Perini, K M; Laurikainen, P; Lavorato, A; Lebeau, M; Lebedev, A; Lebrun, P; Lecomte, P; Lecoq, P; Le Coultre, P; Lee, H J; Leggett, C; Le Goff, J M; Leiste, R; Leonardi, E; Levchenko, P M; Li Chuan; Lin, C H; Lin, W T; Linde, Frank L; Lista, L; Liu, Z A; Lohmann, W; Longo, E; Lu, W; Lü, Y S; Lübelsmeyer, K; Luci, C; Luckey, D; Luminari, L; Lustermann, W; Ma Wen Gan; Maity, M; Majumder, G; Malgeri, L; Malinin, A; Maña, C; Mangeol, D J J; Mangla, S; Marchesini, P A; Marin, A; Martin, J P; Marzano, F; Massaro, G G G; McNally, D; Mele, S; Merola, L; Meschini, M; Metzger, W J; Von der Mey, M; Mi, Y; Migani, D; Mihul, A; Van Mil, A J W; Milcent, H; Mirabelli, G; Mnich, J; Molnár, P; Monteleoni, B; Moore, R; Moulik, T; Mount, R; Muheim, F; Muijs, A J M; Nahn, S; Napolitano, M; Nessi-Tedaldi, F; Newman, H; Niessen, T; Nippe, A; Nisati, A; Nowak, H; Oh, Yu D; Opitz, H; Organtini, G; Ostonen, R; Palit, S; Palomares, C; Pandoulas, D; Paoletti, S; Paolucci, P; Park, H K; Park, I H; Pascale, G; Passaleva, G; Patricelli, S; Paul, T; Pauluzzi, M; Paus, C; Pauss, Felicitas; Peach, D; Pei, Y J; Pensotti, S; Perret-Gallix, D; Petersen, B; Petrak, S; Pevsner, A; Piccolo, D; Pieri, M; Piroué, P A; Pistolesi, E; Plyaskin, V; Pohl, M; Pozhidaev, V; Postema, H; Produit, N; Prokofev, D; Prokofiev, D O; Quartieri, J; Rahal-Callot, G; Raja, N; Rancoita, P G; Rattaggi, M; Raven, G; Razis, P A; Read, K; Ren, D; Rescigno, M; Reucroft, S; Van Rhee, T; Riemann, S; Riles, K; Rind, O; Robohm, A; Rodin, J; Roe, B P; Romero, L; Rosier-Lees, S; Rosselet, P; Van Rossum, W; Roth, S; Rubio, Juan Antonio; Ruschmeier, D; Rykaczewski, H; Salicio, J; Sánchez, E; Sanders, M P; Sarakinos, M E; Sarkar, S; Sauvage, G; Schäfer, C; Shchegelskii, V; Schmidt-Kärst, S; Schmitz, D; Schneegans, M; Scholz, N; Schopper, Herwig Franz; Schotanus, D J; Schwenke, J; Schwering, G; Sciacca, C; Sciarrino, D; Servoli, L; Shevchenko, S; Shivarov, N; Shoutko, V; Shukla, J; Shumilov, E; Shvorob, A V; Siedenburg, T; Son, D; Soulimov, V; Smith, B; Spillantini, P; Steuer, M; Stickland, D P; Stone, H; Stoyanov, B; Strässner, A; Sudhakar, K; Sultanov, G G; Sun, L Z; Susinno, G F; Suter, H; Swain, J D; Tang, X W; Tauscher, Ludwig; Taylor, L; Ting, Samuel C C; Ting, S M; Tonwar, S C; Tóth, J; Tully, C; Tuchscherer, H; Tung, K L; Uchida, Y; Ulbricht, J; Uwer, U; Valente, E; Vesztergombi, G; Vetlitskii, I; Viertel, Gert M; Vivargent, M; Vlachos, S; Völkert, R; Vogel, H; Vogt, H; Vorobev, I; Vorobyov, A A; Vorvolakos, A; Wadhwa, M; Wallraff, W; Wang, J C; Wang, X L; Wang, Z M; Weber, A; Wu, S X; Wynhoff, S; Xu, J; Xu, Z Z; Yang, B Z; Yang, C G; Yao, X Y; Ye, J B; Yeh, S C; You, J M; Zalite, A; Zalite, Yu; Zemp, P; Zeng, Y; Zhang, Z; Zhang, Z P; Zhou, B; Zhou, Y; Zhu, G Y; Zhu, R Y; Zichichi, Antonino; Ziegler, F
1998-01-01
Time-dependent ${\\mathrm{B^{0}}\\mbox{-}\\bar{\\mathrm{B}} ^{0}}$ mixing is studied using about two million hadronic Z decays registered by L3 in 1994 and 1995. For this study three techniques are used. Tagging of the b-quark charge at decay time is performed by identifying leptons from semileptonic B decays. The flavour of the b quark at production time is determined from the charge of the lepton in the opposite hemisphere or by using a jet-charge technique. The proper time of the B-particle decay is obtained by reconstructing the production and decay vertices or by a measurement of the lepton impact parameter. The combined result for the frequency of ${\\mathrm{B_d^0}}$ meson oscillations is \\begin{displaymath} {\\Delta m_d} = 0.444 \\pm 0.040 \\ \\mathrm{ps}^{-1}. \\end{displaymath} \\end{abstract} \\end{document}
Cavaire ~ Bonafos, "Bonafos, yeu vos envit" (BdT 111.1= 99.1
Directory of Open Access Journals (Sweden)
Rosa María Medina Granda
2015-09-01
Full Text Available The aim of this paper is to study the use of the senhal Bonafos, that occurs in l. 27 of the partimen between Cavaire and Bonafos, as a satirical-parodic senhal. We propose to analyse Bonafos in the same way as we previously examined the use of its opposite, Malafos, in contexts containing a discourse that is far from that of the Canso. This would be the case of the pastorela and the partimen. The use of an echoing irony and its interaction with parody and satire would have made possible the conversion of a previous discursive modalizer into a satirical-parodic senhal in this partimen. We also take into account the use that Jews from the south of France made of the anthroponym Bonafos. The conclusions from previous works as well as the data deriving from the Geopatronyme have provided us with this interesting information. However, we do not believe that in this partimen Bonafos is the real name of the jongleur. On the contrary, we argue that Bonafos, even if an anthroponym, might have continued to ‘encapsulate’ the echo of its hypothetical origin: the discursive modalizer (anc bona fos.
13 CFR 124.3 - What definitions are important in the 8(a) BD program?
2010-01-01
... specified. Day-to-day operations of a firm means the marketing, production, sales, and administrative... U.S. Office of Management and Budget. Principal place of business means the business location where the individuals who manage the concern's day-to-day operations spend most working hours and where top...
Fundamentals of ecology. Vol. 2. Grundlagen der Oekologie. Bd. 2. Standorte und Anwendung
Energy Technology Data Exchange (ETDEWEB)
Odum, E P
1980-01-01
The following topics are discussed: freshwater flora and fauna; marine ecosystems; shelf, krill, mangroves, and coral reefs; terrestrial biota and biogeographic regions; deciduous wood, grassland, desert; microbial-ecological perspectives: taxonomy, efficiency, turnover; aquaculture, agriculture, forestry; types, cost, and phases of environmental pollution; specific population ecology of humans.
Energy Technology Data Exchange (ETDEWEB)
Lenz, Hans Peter (comp.)
2012-11-01
This two-volume report makes the presentations of the 33{sup rd} International Vienna Motor Symposium (April 26-27, 2012) available to a wider audience. The objective of the Vienna Motor Symposia is to examine current topics of particular interest. Among others, the work examines the above mentioned topics. Included is a CD-ROM containing the presentations in their original form and in English translation. Edited by Univ.-Prof. Dr. techn. Dipl.-Ing. H.P. Lenz, VDI, Chairman of the OeVK (Austrian Society of Automotive Engineers, Vienna).
Energy Technology Data Exchange (ETDEWEB)
Lenz, Hans Peter (comp.)
2012-11-01
This two-volume report makes the presentations of the 33{sup rd} International Vienna Motor Symposium (April 26-27, 2012) available to a wider audience. The objective of the Vienna Motor Symposia is to examine current topics of particular interest. Among others, the work examines the above mentioned topics. Included is a CD-ROM containing the presentations in their original form and in English translation. Edited by Univ.-Prof. Dr. techn. Dipl.-Ing. H.P. Lenz, VDI, Chairman of the OeVK (Austrian Society of Automotive Engineers, Vienna).
Energy Technology Data Exchange (ETDEWEB)
Lenz, Hans Peter (comp.)
2013-08-01
This two-volume report makes the presentations of the 34th International Vienna Motor Symposium (April 25-26, 2013) available to a wider audience. The objective of the Vienna Motor Symposia is to examine current topics of particular interest. Among others, the work examines the above mentioned topics. Included is a CD-ROM containing the presentations in their original form and in English translation. Edited by Univ.-Prof. Dr. techn. Dipl.-Ing. H. P. Lenz, VDI, Chairman of the OeVK (Austrian Society of Automotive Engineers, Vienna).
Energy Technology Data Exchange (ETDEWEB)
Lenz, Hans Peter (comp.)
2013-08-01
This two-volume report makes the presentations of the 34th International Vienna Motor Symposium (April 25-26, 2013) available to a wider audience. The objective of the Vienna Motor Symposia is to examine current topics of particular interest. Among others, the work examines the above mentioned topics. Included is a CD-ROM containing the presentations in their original form and in English translation. Edited by Univ.-Prof. Dr. techn. Dipl.-Ing. H. P. Lenz, VDI, Chairman of the OeVK (Austrian Society of Automotive Engineers, Vienna).
Energy Technology Data Exchange (ETDEWEB)
Breidenbach, Karl
2004-07-01
Specialists within the range of the refrigerant plant engineering need comprehensive knowledge in the everyday life of occupation. The standard work under consideration very vividly offers an introduction to the technology of refrigerant plants. The second volume of this standard work contains the following chapters: Evaporator; Air cooler and liquid cooler; Air humidification in the cooled room; Condensor; Evaporation cooler and hybrid cooler, cooling towers; Refrigeration compressor; Coolant filling material; Two-phase coolant (binary ice); Water cooling machine with water as refrigerants; Fluid mechanical fundamentals; Expansion valves; Control and adjustment of refrigerant plants; Dimensioning of components; Planning fundamentals; Dimensioning of refrigerant leading pipes for refrigerants.
Falquet de Romans, “Ma bella dompna, per vos dei esser gais” (BdT 156.8
Directory of Open Access Journals (Sweden)
Paolo Di Luca
2010-08-01
Full Text Available “Ma bella dompna per vos dei esser gais” by Falquet de Romans has been taken for a courtly song for a long time. However, the poem’s metrical form is derived directly from that of the epic, as illustrated by the use of monorhymed ‘décasyllabes’ with non-systematic epic caesura and the presence of a ‘petit vers’ at the end of each stanza. The poem may thus be defined as stanzaic but not lyric because its versification is that of the chanson de geste and its music must be that of an epic chant. Moreover, its content reflects the rhetorical structure of the ‘salut d’amor’, an epistolary genre in which the lover sends a letter to his lady asking her to respond to his love. Thus, “Ma bella dompna” should be considered a formal hybrid between ‘salut d’amor’ and ‘chanson de geste’; in this sense it is to be compared to those few compositions of an epistolary nature that employ epic form, such as Raimbaut de Vaqueiras’ famous letter to the Marquis Boniface of Monferrato, which is probably the prototype of this poetic experiment, along with two pairs of ‘laisses’ exchanged between Gui de Cavaillon and Bertran Folco d’Avignon.
Characterization of the NTPR and BD1 interacting domains of the human PICH-BEND3 complex
DEFF Research Database (Denmark)
Pitchai, Ganesha P; Hickson, Ian D; Streicher, Werner
2016-01-01
Chromosome integrity depends on DNA structure-specific processing complexes that resolve DNA entanglement between sister chromatids. If left unresolved, these entanglements can generate either chromatin bridging or ultrafine DNA bridging in the anaphase of mitosis. These bridge structures are def...
Energy Technology Data Exchange (ETDEWEB)
Holleman, Arnold Frederik; Wiberg, Egon; Wiberg, Nils
2017-06-01
For decades, the ''Holleman/Wiberg '' has offered a comprehensive knowledge of inorganic and organometallic chemistry. With the 103rd edition, a new work has been created, which has been designed for the comprehensive preparation of the examination and as a reference book. This second volume comprises the parts C (''subgroups of the periodic system'', the ''d-block elements'') that of the outer transition elements (expansion of the second outermost electron shells) and in the part D (''lanthanides and actinoids''; f-block elements) of the inner transition elements (expansion of the third outermost electron shells). [German] Das ''Holleman/Wiberg'' bietet seit Jahrzehnten ein umfassendes Stoffwissen der anorganischen und metallorganischen Chemie. Mit der 103. Auflage ist nach umfangreicher Umgestaltung der Vorauflage ein neues Werk entstanden, das zur umfassenden Pruefungsvorbereitung und als Nachschlagewerk bestimmt ist. Dieser 2. Band fasst die Teile C (''Nebengruppen des Periodensystems''; ''d-Block-Elemente'') die der aeusseren Uebergangselemente (Ausbau der zweitaeussersten Elektronenschalen) und im Teil D (''Lanthanoide und Actinoide''; ''f-Block-Elemente) die der inneren Uebergangselemente (Ausbau der drittaeussersten Elektronenschalen) zusammen.
Energy Technology Data Exchange (ETDEWEB)
NONE
2009-12-15
Within the international conference of the Bavarian State Research Center for Agriculture (Munich, Federal Republic of Germany) at 2nd to 4th December, 2009, in Erding (Federal Republic of Germany), the following lectures were held: (1) Design and application of a functional oligonucleotide microarray for the identification of cellulose genes and their expression in (different) biogas Fermenters (M. Engel et al.); (2) Evaluation of the potential of hygienisation of the biogas process with regard to phytogenic damage exciter (R. Friedrich et al.); (3) Prevalence and role of hydrolytic bacteria in mesophilic and thermophilic biogas reactors (V.V. Zverlov et al.); (4) System analysis of biogas plants by means of microbiologic and molecular biologic methods: Comparison of hyperthermophilic (60 C) and thermophilic (55 C) (P. Scherer et al.); (5) Methanogenic archaea in agricultural biogas plants (E. Nettmann et al.); (6) Population dynamics of methanogens during acidification of biogas Fermenters fed with maize silage - a causal analysis (M. Lebuhn et al.); (7) Advanced interpretation of anaerobic batch tests - Conclusions for the practical operation (S. Meier et al.); (8) Development of a NIRS calibration for the determination of the biogas yield of maize (B. Darnhofer et al.); (9) Hydrogen and methane: Enhanced methane as well as hydrogen production and increased process stability by Sensorik control (N. Weran); (10) Stable carbon isotopes: A new laser method for the process analysis and identification of microbiologic reactions in the biogas process (S. Laukenmann et al.); (11) Biogas from grass silage - measurements and modelling (K. Koch et al.); (12) Mathematical modelling of the mesophilic and thermophilic anaerobe fermentation of maize silage (M. Luebken et al.); (13) The basket of benefit methodology as a tool for the comparison of electricity, heat, and fuel production from energy crops, exemplified by different utilization pathways for biogas (M. Bystricky et al.); (14) Greenhouse gas balance of bio-methane - which substrates are suitable? (K. Arnold); (15) Emissions of climate gas and consumption of resources of practice biogas plants (H. Bachmeier et al.); (16) Investigation of emissions of greenhouse gases in the generation of biogas from renewable raw materials (J. Clemens et al.); (17) Potentials of biogas production in the Serbian province Wojwodina and fundamentals of the economic foundation (M. Tesic et al.); (18) Energy assessment and life cycle assessment of different paths of conversion of energy crops to biogas or bioethanol, respectively (B. Schumacher et al.).
Energy Technology Data Exchange (ETDEWEB)
NONE
2009-12-15
Within the international conference of the Bavarian State Research Center for Agriculture (Munich, Federal Republic of Germany) at 2nd to 4th December, 2009, in Erding (Federal Republic of Germany), the following lectures were held: (1) Significance of the sector biogas within the scope of renewable energies (P. Schuesseler); (2) Anaerobic digestion, a superior renewable energy degradation method (G. Lettinga); (3) Trends of the biogas technology - Challenges for the practice (J. Pellmeyer); (4) Extensification of cultivation procedures for the production of biogas substrates (K. Deiglmayer et al.); (5) Approaches for the optimization of crop rotations for biogas plants at Bavarian conditions of cultivation (E. Sticksel et al.); (6) Development and comparison of site specific production systems for energy crops (Ch. Strauss et al.); (7) Which type of maize is useful for the production of biogas? (B. Eder et al.); (8) Fermentation of interim fruits, food stocks and residues of harvest: Review on the possibilities of power generation and avoidance of direct and indirect emissions of climatic gases (W. Stinner et al.); (9) Optimization of anaerobic fermentation by means of mineral additives (H. Heuwinkel et al.); (10) The accuracy of the measurement of gas yields of substrates using the batch method (H. Heuwinkel et al.); (11) Combined mechanical-enzymatic pre-treatment of an improved digestion of substrates during the fermentation of renewable raw materials (D. Schiedr et al.); (12) Anaerobic semi-continuous co-digestion of dairy cattle manure and agricultural residues: Effect of operational parameters (E. Alkaya et al.); (13) Do hydrolytic enzymes enhance methane formation of agricultural feedstock? (T. Suarez Quinones et al.); (14) DAUMEN-Energy ''Design fo Separation and Augmented Methanisation of Fibres Substrates - Contribution to sustainable biogas production'' (P. Stopp et al.); (15) Continuous two-phase solid-state anaerobic digestion: Model-based optimisation (J. Mumme et al.); (16) Investigations according to a comparison of material and energy flows of biogas plants for the fermentation of renewable raw materials (V. Aschmann et al.); (17) Problem of emissions and energy efficiency of biogas operated cogeneration plants during the lifetime (T. Lehmann); (18) Biogas plant construction - the digestion is decisive, new results according to bioextrusion (K.D.N. Weerasinghe et al.); (19) Appropriate bio gas generators for resource poor farmers in Sri Lanka to meet home energy and organic fertilizer needs (R. Kissel et al.); (20) Degree of utilization and causes for yield reduction at biogas plants of different design (R. Kissel et al.); (21) Monitoring and assessment of three biogas plants in Italy (S. Piccinini et al.).
Deckersbach, Thilo; Peters, Amy T.; Sylvia, Louisa; Urdahl, Anna; Magalhães, Pedro V.S.; Otto, Michael W.; Frank, Ellen; Miklowitz, David J.; Berk, Michael; Kinrys, Gustavo; Nierenberg, Andrew
2013-01-01
Objective At least 50% of individuals with bipolar disorder have a lifetime anxiety disorder. Individuals with both bipolar disorder and a co-occurring anxiety disorder experience longer illness duration, greater illness severity, and poorer treatment response. The study explored whether comorbid lifetime anxiety in bipolar patients moderates psychotherapy treatment outcome. Method In the Systematic Treatment Enhancement Program randomized controlled trial of psychotherapy for bipolar depression, participants received up to 30 sessions of intensive psychotherapy (family-focused therapy, interpersonal and social rhythm therapy, or cognitive-behavioral therapy) or collaborative care, a three-session comparison treatment, plus pharmacotherapy. Using the number needed to treat, we computed effect sizes to analyze the relationship between lifetime anxiety disorders and rates of recovery across treatment groups after 1 year. Results A total of 269 patients (113 women) with a comorbid lifetime anxiety disorder (N=177) or without a comorbid lifetime anxiety disorder (N=92) were included in the analysis. Participants with a lifetime anxiety disorder were more likely to recover with psychotherapy than with collaborative care (66% compared with 49% recovered over 1 year; number needed to treat=5.88, small to medium effect). For patients without a lifetime anxiety disorder, there was no difference between rates of recovery in psychotherapy compared with collaborative care (64% compared with 62% recovered; number needed to treat=50, small effect). Participants with one lifetime anxiety disorder were likely to benefit from intensive psychotherapy compared with collaborative care (84% compared with 53% recovered; number needed to treat=3.22, medium to large effect), whereas patients with multiple anxiety disorders exhibited no difference in response to the two treatments (54% compared with 46% recovered; number needed to treat=12.5, small effect). Conclusions Depressed patients with bipolar disorder and comorbid anxiety may be in particular need of additional psychotherapy for treating acute depression. These results need to be replicated in studies that stratify bipolar patients to treatments based on their anxiety comorbidity status. PMID:24077657
Energy Technology Data Exchange (ETDEWEB)
1994-02-01
The Salt Lake City Area Office of the Western Area Power Administration (Western) markets electricity produced at hydroelectric facilities operated by the Bureau of Reclamation. The facilities are known collectively as the Salt Lake City Area Integrated Projects (SLCA/IP) and include dams equipped for power generation on the Green, Gunnison, Rio Grande, and Colorado rivers and on Deer and Plateau creeks in the states of Wyoming, Utah, Colorado, Arizona, and New Mexico. Of these facilities, only the Glen Canyon Unit, the Flaming Gorge Unit, and the Aspinall Unit (which includes Blue Mesa, Morrow Point, and Crystal dams;) are influenced by Western power scheduling and transmission decisions. The EIS alternatives, called commitment-level alternatives, reflect combinations of capacity and energy that would feasibly and reasonably fulfill Westerns firm power marketing responsibilities, needs, and statutory obligations. The viability of these alternatives relates directly to the combination of generation capability of the SLCA/IP with energy purchases and interchange. The economic and natural resource assessments in this environmental impact statement (EIS) include an analysis of commitment-level alternatives. Impacts of the no-action alternative are also assessed. Supply options, which include combinations of electrical power purchases and hydropower operational scenarios reflecting different operations of the dams, are also assessed. The EIS evaluates the impacts of these scenarios relative to socioeconomics, air resources, water resources, ecological resources, cultural resources, land use, recreation, and visual resources.
Achieving a production goal of 1 million B/D of coal liquids by 1990. [Impediments and constraints
Energy Technology Data Exchange (ETDEWEB)
Miller, Charles; LaRosa, Dr., P. J.; Coles, E. T.; Fein, H. L.; Petros, J. J.; Iyer, R. S.; Merritt, R. T.
1980-03-01
Under this contract, Bechtel analyzed the resource requirements and reviewed major obstacles to the daily production of several million barrels of synthetic coal liquids. Further, the study sought to identify the industry infrastructure needed to support the commercial readiness of the coal liquefaction process. A selected list of critical resource items and their domestic/international availability was developed and examined, and the impact of their supply on the various synthetic coal liquids programs was evaluated. The study approach was to develop representative, or generic, direct and indirect coal liquefaction conceptual designs from available technology and costs data. The generic processes were to employ technology that would be considered commercial by the mid- or late-1980s. The size of the generic construction mobilization was considered reasonable at the outset of the program. The product slate was directed toward unrefined liquid fuels rather than diesel oil or gasoline. The generic processes were to use a wide range of coals to permit siting in most coal-producing regions across the country. Because of the dearth of conceptual design data in the literature, Bechtel developed generic plant designs by using in-house design expertise. Bechtel assumed that because it is first generation technology, the indirect process will be used at the outset of the liquids program, and the direct process will be introduced two to four years later as a second generation technology. The products of either of these processes will be limited to boiler fuels and/or other liquid products which require further upgrading. Cost estimates were developed from equipment lists, as well as material and labor estimates, which enabled the determination of an order-of-magnitude cost estimate and target plant construction schedule for both processes.
International Nuclear Information System (INIS)
Sgouros, George; Howell, R. W.; Bolch, Wesley E.; Fisher, Darrell R.
2009-01-01
The fundamental physical quantity for relating all biologic effects to radiation exposure is the absorbed dose, the energy imparted per unit mass of tissue. Absorbed dose is expressed in units of joules per kilogram (J/kg) and is given the special name gray (Gy). Exposure to ionizing radiation may cause both deterministic and stochastic biologic effects. To account for the relative effect per unit absorbed dose that has been observed for different types of radiation, the International Commission on Radiological Protection (ICRP) has established radiation weighting factors for stochastic effects. The product of absorbed dose in Gy and the radiation weighting factor is defined as the equivalent dose. Equivalent dose values are designated by a special named unit, the sievert (Sv). Unlike the situation for stochastic effects, no well-defined formalism and associated special named quantities have been widely adopted for deterministic effects. The therapeutic application of radionuclides and, specifically, -particle emitters in nuclear medicine has brought to the forefront the need for a well-defined dosimetry formalism applicable to deterministic effects that is accompanied by corresponding special named quantities. This commentary reviews recent proposals related to this issue and concludes with a recommendation to establish a new named quantity
Energy Technology Data Exchange (ETDEWEB)
NONE
1996-12-31
This conference report contains the lectures presented at the BMBF status seminar on the cooperative project ``Bodies of landfills``, which took place at Wuppertal on 25th and 26th April 1995. The cooperative project was started in autumn 1993 and studies the long-term behaviour of wastes deposited at landfills in general. Inorganic and municipal wastes are studied separately. (orig./SR) [Deutsch] Der vorliegende Tagungsband enthaelt die Vortraege des BMBF-Statusseminars zum Verbundvorhaben `Deponiekoerper` vom 25. und 26. April 1995 in Wuppertal. Das Verbundvorhaben `Deponiekoerper` wurde im Herbst 1993 begonnen und befasst sich ganz generell mit dem langfristigen Deponieverhalten von Abfaellen. Es ist unterteilt in die Untersuchung von anorganischen Abfaellen und von Siedlungsabfaellen. (orig./SR)
Violation of CP invariance for neutral K0-, D0-, Bd0-, Bs0-mesons and quarks in weak interactions
International Nuclear Information System (INIS)
Beshtoev, Kh.M.
2014-01-01
CP violation in the Kobayashi-Maskawa matrix was introduced by using phase which is the same for the three families of quarks. However, analysis of CP violation of mesons has shown that new small-angle mixings appear besides of CP phases. This work is devoted to the consideration of possible schemes for introducing CP violation. It is noted that in general case it is not correct to use CP phase only for the first and third quark families as it is usually introduced. CP phase has to be presented for all quark families, and moreover these phases cannot be the same for all families. Besides, a common case of CP violation was considered for K 0 , D 0 , B d 0 , B s 0 mesons, where mixing angles and phases are present at CP violation. Expressions for transition probabilities for these processes are given. In conclusion, mixing of d, s, b quarks at CP violation was considered with taking into account their angle mixings and phases.
Arnaut Daniel, “D’autra guiza e d’autra razo” (BdT 29.7
Directory of Open Access Journals (Sweden)
Gianluca Valenti
2012-09-01
Full Text Available This paper will focus on some specific aspects of Arnaut Daniel’s “D’autra guiza e d’autra razo” which, despite its success in its day and age (some verses were reused by Petrarch in the opening sonnet of the “RVF”, has received little critical attention in modern times. In particular, I will examine the incipit (whose alterity with respect to the rest of the Occitan lyric tradition points to an explicit declaration of intent on the part of the author, the lack of a tornada and, finally, the possibility that Arnaut Daniel was influenced by the section in the “Rhetorica ad Herennium” devoted to mnemonic technique. Moreover, the hypothesis that material concerning the art of memory has been used here helps to explain some particularly problematic textual loci, such as ll. 5-7 and 34.
Inclusive decays of the B meson and possible life-time difference between Bd0 and B± mesons
International Nuclear Information System (INIS)
Tanimoto, Morimitsu
1992-01-01
We study branching ratios of the inclusive semileptonic decay and the inclusive anti ccanti s decay of the B meson in the spectator model, focusing on the life-time difference between B d 0 and B + mesons. In the case of τsub(B ± )/τsub(B d 0 )=1, it is impossible to get the branching ratio below 12% for B→eνX without going over 20% for B→anti ccanti s, which is unfavored by the inclusive K - decay of the B meson. It is found that the sizable life-time difference leads to the reasonable inclusive semileptonic decay rate and the inclusive anti ccanti s decay rate. (orig.)
International Nuclear Information System (INIS)
1996-01-01
The Colorado River Storage Project Customer Office of the Western Area Power Administration (Western) markets electricity produced at hydroelectric facilities operated by the Bureau of Reclamation. The facilities are known collectively as the Salt Lake City Area Integrated Projects (SLCA/IP) and include dams equipped for power generation on the Colorado, Green, Gunnison, and Rio Grande rivers and on Plateau Creek in Arizona, Colorado, Utah, Wyoming, and New Mexico. Of these facilities, only the Glen Canyon Unit, the Flaming Gorge Unit, and the Aspinall Unit (which includes Blue Mesa, Morrow Point, and Crystal dams) are influenced by Western power scheduling and transmission decisions. The environmental impact statement (EIS) alternatives, called commitment-level alternatives, reflect combinations of capacity and energy that would feasibly and reasonably fulfill Western's firm power marketing responsibilities, needs, and statutory obligations. The viability of these alternatives relates directly to the combination of generation capability of the SLCA/IP with energy purchases and interchange. The economic and natural resource assessments in this EIS include an analysis of commitment-level alternatives. Impacts of the no-action alternative are also assessed. Supply options, which include combinations of electrical power purchases and hydropower operational scenarios reflecting different operations of the dams, are also assessed. The EIS evaluates the impacts of these scenarios relative to socioeconomics, air resources, water resources, ecological resources, cultural resources, land use, recreation, and visual resources. Western has identified commitment-level alternative 1, the Post-1989 commitment level, as its preferred alternative. The impact evaluations indicate that this commitment level is also the environmentally preferred alter native
Search for the rare decays Bs->mu+mu- and Bd->mu+mu- with the LHCb experiment
CERN. Geneva
2011-01-01
Decays of the B0 and B0s mesons into two muons are extremely rare in the Standard Model as they occur only via helicity suppressed loop diagrams. Their amplitudes can be significantly different in many New Physics models, especially with an extended Higgs sector. Therefore, the search for these decays provides a sensitive probe of physics beyond the Standard Model. A search for the decays B0s ->mu+mu- and B0 ->mu+mu- is performed with about 37 pb-1 of pp collisions at sqrt(s) = 7TeV collected by the LHCb experiment at the Large Hadron Collider at CERN. The analysis relies mostly on control samples with minimal use of the simulation. The observed numbers of events are consistent with the background expectations. The resulting upper limits on the branching ratios are B(B0s->mu+mu-) < 56x10-9 and B(B0->mu+mu-) < 15x10-9 at 95% confidence level. The analysis is presented and prospects are also given for the coming run.
Energy Technology Data Exchange (ETDEWEB)
NONE
2015-04-15
This handbook was prepared primarily with the aim to provide information to experts in industry, authorities or research facilities engaged in criticality-safety-related problems that will allow an adequate and rapid assessment of criticality safety issues already in the planning and preparation of nuclear facilities. However, it is not the intention of the authors of the handbook to offer ready solutions to complex problems of nuclear safety. Such questions have to remain subject to an in-depth analysis and assessment to be carried out by dedicated criticality safety experts. Compared with the previous edition dated December 1998, this handbook has been further revised and supplemented. The proven basic structure of the handbook remains unchanged. The handbook follows in some ways similar criticality handbooks or instructions published in the USA, UK, France, Japan and the former Soviet Union. The expedient use of the information given in this handbook requires a fundamental understanding of criticality and the terminology of nuclear safety. In Vol. 1, ''Criticality and Nuclear Safety'', therefore, first the most important terms and fundamentals are introduced and explained. Subsequently, experimental techniques and calculation methods for evaluating criticality problems are presented. The following chapters of Vol. 1 deal i. a. with the effect of neutron reflectors and absorbers, neutron interaction, measuring methods for criticality, and organisational safety measures and provide an overview of criticality-relevant operational experience and of criticality accidents and their potential hazardous impact. Vol. 2 parts 1 and 2 finally compile criticality parameters in graphical and tabular form. The individual graph sheets are provided with an initially explained set of identifiers, to allow the quick finding of the information of current interest. Part 1 includes criticality parameters for systems with {sup 235}U as fissile material, while part 2 deals with systems comprising {sup 233}U, plutonium and higher actinides.
2011-03-31
... holidays. The AD docket contains the NPRM, the regulatory evaluation, any comments received, and other... 20274 inclusive, certificated in any category. Note 1: This AD requires revisions to certain operator... 20003 through 20173 inclusive, 20176, and 20177: Within 50 flight hours after June 1, 2010, do a...
2010-12-21
..., except Federal holidays. For service information identified in this proposed AD, contact Bombardier, Inc... Friday, except Federal holidays. The AD docket contains this proposed AD, the regulatory evaluation, any... (Challenger 300) airplanes, having serial numbers (S/Ns) 20001 through 20274 inclusive, certificated in any...
Energy Technology Data Exchange (ETDEWEB)
Darmer, G
1979-01-01
The 2nd volume is intended to consolidate the cooperation between science and practice, using planning examples and models. In view of the fact that the general public attaches great importance to issues of re-cultivation, and in view of recently issued legal regulations on mining, aiming at the useful recultivation of exploited areas, and also because of the great variety of potential, but very often competitive ways of subsequent utilization, this second volume was published hust on time. The book imparts topical information which can be used practically. It gives instructions to operators of open cast mines, contractors of civil and highway engineering works, and - of course - to contractors of landscape gardening, to landscape planners, to the public administration dealing with mining issues and recultivation, as well as to students of all faculties concerned.
Garin lo Brun, “Nueyt e iorn suy en pessamen” (BdT 163.1
Directory of Open Access Journals (Sweden)
Francesco Carapezza
2008-12-01
Full Text Available The article provides a commentary and a new interpretation of Garin lo Brun’s poem “Nueyt et jorn”. The unusual typology of this dialogical poem has led to problems concerning generic classification, since it starts with an introductory stanza in the first person, where the theme of the inner debate is presented, followed by the opposed precepts of ‘Mezura’ (Measure, Moderation and ‘Leujaria’ (Levity in reported speech; moreover, the two personifications always address the lyric subject without really speaking to each other. Composed around 1150, when a system of dialogical genres had not yet been fixed, “Nueyt et jorn” has been classified in different ways by scholars. The poem contains some archaic features which connect it to the Occitan ‘tenso’ specimen by Uc Catola and Marcabru, as well as to Guilhem IX’s ironically dilemmatic poem “Companho farai un vers convinen”. Futhermore, a closer examination of the fifth stanza’s ‘varia lectio’ provides evidence of the affinity between “Nueyt et jorn” and Marcabru’s didactic poem “Cortesamen vuelh comenzar”, thus leaving room for the hypothesis that the latter has been a clear and direct source of inspiration for Garin. The collected data allow for the assumption that “Nueyt et jorn” carries out a transposition of the biblical conflictus between vices and virtues in the courtly context of troubadour lyric.
Peire Bremon Ricas Novas, “Rics pres, ferms e sobeirans” (BdT 330.15a
Directory of Open Access Journals (Sweden)
Paolo Di Luca
2008-03-01
Full Text Available This article provides a new critical edition and a commentary of Peire Bremon Ricas Novas’s “Rics pres, ferms e sobeirans”, a courtly love song composed between 1228 and 1257 and dedicated to Audiart del Baux. Built as a eulogy of the lady, the song focuses on the central theme of the moral and material ‘ricor’ (richness of the latter. The complexity of the metrical form, which displays a systematic use of the technique of ‘rim derivatiu’, is paralleled by the semantic obscurity of a number of verses and hapaxes, all discussed in the commentary. Stanzas III and IV show echoes of Jaufre Rudel’s “amor de lonh”, since the lover-poet declares that the distance and the ethnical difference between himself and the lady are abolished by the strength of his feelings. The use of ethnonyms in stanza IV is closely examined: the lover-poet reveals that he loves a Castilian lady who looks like a ‘Serrana’ (the name of an Iberian population, admitting that he would like her even if she were Catalan or Syrian. These references to the lady’s ethnical origins are puzzling: they can be read as a calembour with burlesque overtones, as well as a climax aiming to define the real provenance of the lady or as a rhetorical device to underline that courtly love does not know any kind of boundary.
Energy Technology Data Exchange (ETDEWEB)
Ebel, K D [ed.; Willich, E [ed.; Richter, E [ed.; Benz-Bohm, G; Bliesener-Harzheim, J A; Ebel, K D; Oestreich, A E; Reinwein, H; Schaper, J; Schumacher, R; Stoever, B
1995-06-01
The book presents in-depth material covering the full scope of tasks and problems of differential diagnostic radiology in children. The particular approach chosen by the authors provides information that will solve even the most difficult cases, guiding the reader on his way from radiographic findings to appropriate diagnosis. All radiographic findings have been characterized and classified and put into a tabulated system relating them to the relevant differential diagnosis. The system of reference adopted specifies a given lesion or disease by reference to the most significant diagnostic keywords obtained from anamnesis, clinical data, and further diagnostic evaluation. The tentative diagnosis is taken as the basis for further specification illustrated by the characteristic X-ray pictures and full-text descriptions. Almost all diagnoses are accompanied by a comprehensive image documentation obtained by all currently available imaging methods. (MG) [Deutsch] Das vorliegende Buch gibt einen kompletten Ueberblick ueeber die gesamte Bandbreite der Differentialdiagnostik in der Paediatrischen Radiologie und soll so auch in schwierigen Faeellen den Weg vom Roentgensymptom zur Diagnose ermoeglichen. Alle relevanten Roentgensymptome werden systematisch charakterisiert und die entsprechenden Differentialdiagnosen tabellarisch zusammengestellt. Jede Erkrankung wird durch Verweise auf die wichtigsten differentialdiagnostischen Stichworte aus Anamnese, Klinik und weiterfuehrende Diagnostik naeher eingegrenzt. Ausgehend von der Verdachtsdiagnose werden wegweisende Roentgenbefunde in Wort und Bild dargestellt. Fast alle erwaehnten Befunde werden durch Abbildungen unter Beruecksichtigung aller moderner bildgebenden Verfahren dokumentiert. (MG)
Energy Technology Data Exchange (ETDEWEB)
Cziesielski, E [Technische Univ. Berlin (Germany, F.R.); ed.
1988-01-01
This volume on 'Building Technique' gives information on the following subjects: Interaction between building physics and building design (analysis, solutions); thermal protection (heat transfer, thermal protection requirements, energy saving); protection against damp (water economy, water transport, protection against rain); sealing buildings (material, stressing of buildings by humidity of the ground and service water, drainage, sealing); noise insulation (basic terms, sound absorption, acoustic phenomena, noise from domestic equipment, protection against outside noise); fire protection (technical building regulations, fire protection regulations, classes of building material, fire resistance classes, fire behaviour of special building components). The subsequent part of the report is concerned with the history of building design (design and building technique, tasks of the architect, year of birth of modern building design 1743. Prehistory of building design). (HWJ) With 186 figs.
2011-10-19
...., Washington, DC 20590. Hand Delivery: U.S. Department of Transportation, Docket Operations, M-30, West... deformation was attributed to two (2) batches of raw material that did not meet the required tensile strength... . Follow the instructions for submitting comments. Fax: (202) 493-2251. Mail: U.S. Department of...
Search for the decays B$_{d}^{0}$ --> $\\gamma\\gamma$ and B$_{s}^{0}$ --> $\\gamma\\gamma$
Acciarri, M; Adriani, O; Aguilar-Benítez, M; Ahlen, S P; Alpat, B; Alcaraz, J; Allaby, James V; Aloisio, A; Alverson, G; Alviggi, M G; Ambrosi, G; Anderhub, H; Andreev, V P; Angelescu, T; Antreasyan, D; Arefev, A; Azemoon, T; Aziz, T; Bagnaia, P; Baksay, L; Ball, R C; Banerjee, S; Banicz, K; Barillère, R; Barone, L; Bartalini, P; Baschirotto, A; Basile, M; Battiston, R; Bay, A; Becattini, F; Becker, U; Behner, F; Bencze, G L; Berdugo, J; Berges, P; Bertucci, B; Betev, B L; Biasini, M; Biland, A; Bilei, G M; Bizzarri, R; Blaising, J J; Bobbink, Gerjan J; Böck, R K; Böhm, A; Borgia, B; Boucham, A; Bourilkov, D; Bourquin, Maurice; Boutigny, D; Brambilla, Elena; Branson, J G; Brigljevic, V; Brock, I C; Buijs, A; Bujak, A T; Burger, J D; Burger, W J; Burgos, C; Busenitz, J K; Buytenhuijs, A O; Cai, X D; Capell, M; Cara Romeo, G; Caria, M; Carlino, G; Cartacci, A M; Casaus, J; Castellini, G; Castello, R; Cavallari, F; Cavallo, N; Cecchi, C; Cerrada-Canales, M; Cesaroni, F; Chamizo-Llatas, M; Chan, A; Chang, Y H; Chaturvedi, U K; Chemarin, M; Chen, A; Chen, C; Chen, G; Chen, G M; Chen, H F; Chen, H S; Chen, M; Chiefari, G; Chien, C Y; Choi, M T; Cifarelli, Luisa; Cindolo, F; Civinini, C; Clare, I; Clare, R; Coan, T E; Cohn, H O; Coignet, G; Colijn, A P; Colino, N; Commichau, V; Costantini, S; Cotorobai, F; de la Cruz, B; Dai, T S; D'Alessandro, R; De Asmundis, R; De Boeck, H; Degré, A; Deiters, K; Dénes, E; Denes, P; De Notaristefani, F; DiBitonto, Daryl; Diemoz, M; Van Dierendonck, D N; Di Lodovico, F; Dionisi, C; Dittmar, Michael; Dominguez, A; Doria, A; Dorne, I; Dova, M T; Drago, E; Duchesneau, D; Duinker, P; Durán, I; Dutta, S; Easo, S; Efremenko, Yu V; El-Mamouni, H; Engler, A; Eppling, F J; Erné, F C; Ernenwein, J P; Extermann, Pierre; Fabbretti, R; Fabre, M; Faccini, R; Falciano, S; Favara, A; Fay, J; Felcini, Marta; Ferguson, T; Fernández, D; Fernández, G; Ferroni, F; Fesefeldt, H S; Fiandrini, E; Field, J H; Filthaut, Frank; Fisher, P H; Forconi, G; Fredj, L; Freudenreich, Klaus; Gailloud, M; Galaktionov, Yu; Ganguli, S N; García-Abia, P; Gau, S S; Gentile, S; Gerald, J; Gheordanescu, N; Giagu, S; Goldfarb, S; Goldstein, J; Gong, Z F; González, E; Gougas, Andreas; Goujon, D; Gratta, Giorgio; Grünewald, M W; Gupta, V K; Gurtu, A; Gustafson, H R; Gutay, L J; Hartmann, B; Hasan, A; He, J T; Hebbeker, T; Hervé, A; Hilgers, K; Van Hoek, W C; Hofer, H; Hoorani, H; Hou, S R; Hu, G; Ilyas, M M; Innocente, Vincenzo; Janssen, H; Jin, B N; Jones, L W; de Jong, P; Josa-Mutuberria, I; Kasser, A; Khan, R A; Kamyshkov, Yu A; Kapinos, P; Kapustinsky, J S; Karyotakis, Yu; Kaur, M; Kienzle-Focacci, M N; Kim, D; Kim, J K; Kim, S C; Kim, Y G; Kinnison, W W; Kirkby, A; Kirkby, D; Kirkby, Jasper; Kittel, E W; Klimentov, A; König, A C; Koffeman, E; Kornadt, O; Koutsenko, V F; Koulbardis, A; Krämer, R W; Kramer, T; Krenz, W; Kuijten, H; Kunin, A; Ladrón de Guevara, P; Landi, G; Lapoint, C; Lassila-Perini, K M; Laurikainen, P; Lebeau, M; Lebedev, A; Lebrun, P; Lecomte, P; Lecoq, P; Le Coultre, P; Lee Jae Sik; Lee, K Y; Leggett, C; Le Goff, J M; Leiste, R; Lenti, M; Leonardi, E; Levchenko, P M; Li Chuan; Lieb, E H; Lin, W T; Linde, Frank L; Lindemann, B; Lista, L; Liu, Z A; Lohmann, W; Longo, E; Lu, W; Lü, Y S; Lübelsmeyer, K; Luci, C; Luckey, D; Ludovici, L; Luminari, L; Lustermann, W; Ma Wen Gan; Macchiolo, A; Maity, M; Malgeri, L; Malinin, A; Maña, C; Mangla, S; Maolinbay, M; Marchesini, P A; Marin, A; Martin, J P; Marzano, F; Massaro, G G G; Mazumdar, K; McNally, D; Mele, S; Merola, L; Meschini, M; Metzger, W J; Mi, Y; Mihul, A; Van Mil, A J W; Mirabelli, G; Mnich, J; Möller, M; Monteleoni, B; Moore, R; Morand, R; Morganti, S; Mount, R; Muheim, F; Müller, S; Nagy, E; Nahn, S; Napolitano, M; Nessi-Tedaldi, F; Newman, H; Nippe, A; Nowak, H; Organtini, G; Ostonen, R; Pandoulas, D; Paoletti, S; Paolucci, P; Pascale, G; Passaleva, G; Patricelli, S; Paul, T; Pauluzzi, M; Paus, C; Pauss, Felicitas; Pei, Y J; Pensotti, S; Perret-Gallix, D; Petrak, S; Pevsner, A; Piccolo, D; Pieri, M; Pinto, J C; Piroué, P A; Pistolesi, E; Plyaskin, V; Pohl, M; Pozhidaev, V; Postema, H; Produit, N; Raghavan, R; Rahal-Callot, G; Rancoita, P G; Rattaggi, M; Raven, G; Razis, P A; Read, K; Redaelli, M; Ren, D; Rescigno, M; Reucroft, S; Ricker, A; Riemann, S; Riemers, B C; Riles, K; Rind, O; Ro, S; Robohm, A; Rodin, J; Rodríguez-Calonge, F J; Roe, B P; Röhner, M; Röhner, S; Romero, L; Rosier-Lees, S; Rosselet, P; Van Rossum, W; Roth, S; Rubio, Juan Antonio; Rykaczewski, H; Salicio, J; Salicio, J M; Sánchez, E; Santocchia, A; Sarakinos, M E; Sarkar, S; Sassowsky, M; Sauvage, G; Schäfer, C; Shchegelskii, V; Schmitz, D; Schmitz, P; Schneegans, M; Schöneich, B; Scholz, N; Schopper, Herwig Franz; Schotanus, D J; Schulte, R; Schultze, K; Schwenke, J; Schwering, G; Sciacca, C; Seiler, P G; Sens, Johannes C; Servoli, L; Shevchenko, S; Shivarov, N; Shoutko, V; Shukla, J; Shumilov, E; Son, D; Sopczak, André; Soulimov, V; Smith, B; Spickermann, T; Spillantini, P; Steuer, M; Stickland, D P; Sticozzi, F; Stone, H; Stoyanov, B; Strauch, K; Sudhakar, K; Sultanov, G G; Sun, L Z; Susinno, G F; Suter, H; Swain, J D; Tang, X W; Tauscher, Ludwig; Taylor, L; Ting, Samuel C C; Ting, S M; Toker, O; Tonisch, F; Tonutti, M; Tonwar, S C; Tóth, J; Tsaregorodtsev, A Yu; Tsipolitis, G; Tully, C; Tuchscherer, H; Ulbricht, J; Urbàn, L; Uwer, U; Valente, E; Van de Walle, R T; Vetlitskii, I; Viertel, Gert M; Vivargent, M; Völkert, R; Vogel, H; Vogt, H; Vorobev, I; Vorobyov, A A; Vuilleumier, L; Wadhwa, M; Wallraff, W; Wang, J C; Wang, X L; Wang, Y F; Wang, Z M; Weber, A; Weill, R; Willmott, C; Wittgenstein, F; Wu, S X; Wynhoff, S; Xu, J; Xu, Z Z; Yang, B Z; Yang, C G; Yao, X Y; Ye, J B; Yeh, S C; You, J M; Zaccardelli, C; Zalite, A; Zemp, P; Zeng, J Y; Zeng, Y; Zhang, Z; Zhang, Z P; Zhou, B; Zhou, G J; Zhou, J F; Zhou, Y; Zhu, G Y; Zhu, R Y; Zichichi, Antonino; Van der Zwaan, B C C
1995-01-01
A search for the decays \\Bdsgg in 2.95 million hadronic \\rm Z decays has been performed using the L3 detector at LEP. No candidates are found in the signal region and upper limits have been set on the branching ratios: \\Brdgg < 3.9\\times 10^{-5} and \\Brsgg < 14.8\\times 10^{-5} at 90\\% CL. These are the first limits set on these exclusive rare decays.
2012-04-05
... prompted by reports that the horizontal stabilizer trim actuator (HSTA) no-back and the number 1 motor...: Cesar Gomez, Aerospace Engineer, Airframe and Mechanical Systems Branch, ANE-171, FAA, New York Aircraft... Actuator (HSTA) No Back and the Number 1 Motor Brake Assembly (MBA) can both fail dormant. A failure of the...
Energy Technology Data Exchange (ETDEWEB)
NONE
1995-12-31
This conference report contains the lectures presented at the BMBF status seminar on the cooperative project ``Bodies of landfills``, which took place at Wuppertal on 25th and 26th April 1995. The cooperative project was started in autumn 1993 and studies the long-term behaviour of wastes deposited at landfills in general. Inorganic and municipal wastes are studied separately. (orig./SR) [Deutsch] Der vorliegende Tagungsband enthaelt die Vortraege des BMBF-Statusseminars zum Verbundvorhaben `Deponiekoerper` vom 25. und 26. April 1995 in Wuppertal. Das Verbundvorhaben `Deponiekoerper` wurde im Herbst 1993 begonnen und befasst sich ganz generell mit dem langfristigen Deponieverhalten von Abfaellen. Es ist unterteilt in die Untersuchung von anorganischen Abfaellen und von Siedlungsabfaellen. (orig./SR)
How to determine all the angles of the unitarity triangle from Bd0 → DKS and Bs0 → Dφ
International Nuclear Information System (INIS)
Gronau, M.; London, D.
1990-10-01
We consider within the standard model the time-dependent decay rates of the three processes B d 0 → D 0 Ks.anti D 0 Ks and D 1 0 Ks, where D 1 0 is a neutral D meson CP-eigenstate. We show that it is possible to derive from these processes, in which two weak amplitudes are involved, two of the three angles in the unitarity triangle of the Cabibbo-Kobayashi-Maskawa matrix. The third angle can be determined from B s 0 → DΦ. All three angles are obtained free of hadronic final-state uncertainties. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Lenz, Hans Peter (comp.)
2010-07-01
These two volumes contain all the lectures delivered at the 31{sup st} International Vienna Motor Symposium, which took place on 29{sup th} and 30{sup th} April, 2010. In these lectures pre-eminent automotive engineers presented various aspects of state-of-the-art of engine technology. Further to this, I would like to express my heartfelt thanks to all of these individuals, as well as the companies they represent, for their contributions to our conference. All lectures on the enclosed CD are available in their original version as well as in English translation. The word-search facility at www.oevk.at - the Austrian Society of Automotive Engineers (OEVK) website - allows a direct access to the titles of lectures, together with information on all the authors and companies that have participated in the International Vienna Motor Symposia since 1999 (German since 1981). The publications list - which is to be found on the following page - provides an anthology of all lectures delivered at the International Vienna Motor Symposia between 1979 and 2010. It is intended to provide a broader public with further information on the topics and subject matter dealt with by these conferences. The 32{sup nd} International Vienna Motor Symposium is to take place on the 5{sup th} and 6{sup th} Mai, 2011, and may I take this early opportunity to extend you an invitation. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Lenz, Hans Peter (comp.)
2010-07-01
These two volumes contain all the lectures delivered at the 31{sup st} International Vienna Motor Symposium, which took place on 29{sup th} and 30{sup th} April, 2010. In these lectures pre-eminent automotive engineers presented various aspects of state-of-the-art of engine technology. Further to this, I would like to express my heartfelt thanks to all of these individuals, as well as the companies they represent, for their contributions to our conference. All lectures on the enclosed CD are available in their original version as well as in English translation. The word-search facility at www.oevk.at - the Austrian Society of Automotive Engineers (OEVK) website - allows a direct access to the titles of lectures, together with information on all the authors and companies that have participated in the International Vienna Motor Symposia since 1999 (German since 1981). The publications list - which is to be found on the following page - provides an anthology of all lectures delivered at the International Vienna Motor Symposia between 1979 and 2010. It is intended to provide a broader public with further information on the topics and subject matter dealt with by these conferences. The 32{sup nd} International Vienna Motor Symposium is to take place on the 5{sup th} and 6{sup th} Mai, 2011, and may I take this early opportunity to extend you an invitation. (orig.)
Coexistence of an unstirred chemostat model with B-D functional response by fixed point index theory
Directory of Open Access Journals (Sweden)
Xiao-zhou Feng
2016-11-01
Full Text Available Abstract This paper deals with an unstirred chemostat model with the Beddington-DeAngelis functional response. First, some prior estimates for positive solutions are proved by the maximum principle and the method of upper and lower solutions. Second, the calculation on the fixed point index of chemostat model is obtained by degree theory and the homotopy invariance theorem. Finally, some sufficient condition on the existence of positive steady-state solutions is established by fixed point index theory and bifurcation theory.
Energy Technology Data Exchange (ETDEWEB)
Goedecke, Ralf (ed.) [Degussa AG, Hanau (Germany)
2006-07-01
The book was written by practicians for practicians; it explains the process engineering of liquid and gas mixtures for purification, separation and concentration of the fluid components by means of selective separating techniques, i.e. absorption, rectification, evaporation, condensation, extraction, adsorption, chromatography, membrane techique, melt crystallisation, and separation with supercritical fluids. All the necessary fundamentals of thermodynamics, heat and mass transfer, fluid mechanics and boundary layer processes are considered. There is a new and comprehensive chapter on the synthesis of fluid process engineering, from the first conception to its practical application. In this context, also aspects like miniplant technology, process synthesis and simulation are discussed as well as important problems concerning internals, scale-up and fouling. In order to provide accurate in-depth knowledge, renowned experts of industry and science cooperated to write this book. With its wide range of subjects, it addresses projecting and operating engineers, newcomers and university students who intend to put their knowledge into practice after their exams. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Goedecke, Ralf [Degussa AG, Hanau (Germany)
2006-07-01
The book was written by practicians for practicians; it explains the process engineering of liquid and gas mixtures for purification, separation and concentration of the fluid components by means of selective separating techniques, i.e. absorption, rectification, evaporation, condensation, extraction, adsorption, chromatography, membrane techique, melt crystallisation, and separation with supercritical fluids. All the necessary fundamentals of thermodynamics, heat and mass transfer, fluid mechanics and boundary layer processes are considered. There is a new and comprehensive chapter on the synthesis of fluid process engineering, from the first conception to its practical application. In this context, also aspects like miniplant technology, process synthesis and simulation are discussed as well as important problems concerning internals, scale-up and fouling. In order to provide accurate in-depth knowledge, renowned experts of industry and science cooperated to write this book. With its wide range of subjects, it addresses projecting and operating engineers, newcomers and university students who intend to put their knowledge into practice after their exams. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Oppermann, A [comp.
1987-01-01
This book 'Dictionary of Modern Technology' represents the most recent status of modern developments and indicates the complexity of man's technical future. The dictionary contains more than 250.000 terms with the double or treble of translation possibilities for the fields of aerodynamics, statics, space operations, construction of aircrafts, helicopters, motors, turbines, rockets, cars, tools and machines, oil, nuclear physics, electro technics, electronics, data processing, cybernetics, radar engineering, plastics, plasma energy and laser. Further the total of the terminology new built by the ministerial committees concerning air traffic control, the total air traffic as well as the above mentioned fields. From the Federal Language Commission Cologne the complete military field concerning army, air force and naval forces could be added.
Energy Technology Data Exchange (ETDEWEB)
Bucksch, H
1987-01-01
Architecture, building and civil engineering are encountered everywhere; in monuments or ruins from the past, in the engineering feats of the industrial age or the modern buildings crowding our city centres. The English and German technical terms for civil engineering and construction machinery and equipment have already been compiled in a dictionary published like this one by the Bauverlag GmbH, Wiesbaden. This dictionary rounds matters off. Technical terms abound in architecture just as they do in any other branch of art or engineering. Anyone interested in architecture, whether as a specialist, art lover, student or layman, cannot hope to understand it without first mastering its concepts and the technical terms with which they are clothed. The same applies to building and building materials. A concept must be named in order to be understood. This principle is as fundamental today as ever it was and is one we share with our earliest ancestors. This dictionary lists terms for many concepts from the aforementioned fields. Its aim is to help breach the language barrier and facilitate the perusal of architectural publications and trade journals in English and German. (orig.).
Energy Technology Data Exchange (ETDEWEB)
Heinrich, J.; Frye, C.; Hoelscher, B.; Meyer, I.; Pitz, M.; Cyrys, J.; Schneller, H.; Wjst, M.; Wichmann, H.E.
2001-10-01
The aim of the environmental epidemiologic study was to determine possible negative effects on the health of children in the very polluted areas of Bitterfeld and Hettstedt in comparison to the less polluted areas of Anhalt-Zerbst (Eastern Germany). The time changes of the health parameters were recorded along with the running redevelopments during the time period of 6 years. The study design consisted of three repeated regional cross sectional studies in 1992/93, 1995/96 and 1998/99. In all, there was information of 7.611 questionnaires to be analysed (participation rate: 89%, 75% and 75%). Children living in the most polluted area of Hettstedt had a noticeable higher risk for non allergic respiratory diseases and symptoms compared to children living in the control area of Anhalt-Zerbst. During the time of the examinations in 1992 till 1999 a clear statistically significant decrease in the prevalences of these restrictions of health could be shown. Children without indoor pollutants in their homes profited most by the improvement of ambient air quality. The better lung function (FVC, FEV{sub 1}) between 1992 and 1999 underlines the improvement of the respiratory health. Children living in both polluted ares have allergies more often (physician's diagnosis, symptoms, allergy specific antibodies). The incidence of asthma, the bronchial hyperreactivity and atopic exzema increased, the prevalence of rhinitis and allergic sensitization did not increase. The body burden with lead and cadmium was higher in children living in polluted areas, but it decreased during the period of observation. In 1997, however, the lead concentration in blood increased a little, parallel to the higher lead concentration in settled dust in Hettstedt at that time. (orig.) [German] Ziel der umweltepidemiologischen Studie war es, moegliche gesundheitliche Beeitraechtigungen von Kindern in den Belastungsgebieten Bitterfeld und Hettstedt i. Vgl. zu dem wenig belasteten Gebiet Anhalt-Zerbst zu ermitteln. Darueber hinaus wurden die zeitlichen Veraenderungen der Gesundheitsparameter begleitend zu den laufenden Sanierungsmassnahmen ueber den Zeitraum von 6 Jahren erfasst. Das Studiendesign bestand aus 3 wiederholten regionalen Querschnittsuntersuchungen in den Jahren 1992/93, 1995/96 und 1998/99. Insgesamt lagen Informationen von 7611 Frageboegen zur Auswertung vor (Beteiligungsrate: 89%, 75% bzw. 75%). Fuer die Belastungsregion Hettstedt waren deutlich hoehere Risiken fuer nicht allergische respiratorische Erkrankungen und Symptome im Vergleich zu Kindern des Kontrollgebietes Anhalt-Zerbst nachweisbar. Waehrend des Untersuchungszeitraumes 1992-1999 zeigte sich eine deutlich statistisch signifikante Abnahme der Praevalenz dieser gesundheitlichen Einschraenkungen, Kinder ohne Exposition mit Innenraumschadstoffen im haeuslichen Bereich profitieren von der Verbesserung der Aussenluftbelastung am meisten. Fuer die Verbesserung der Atemwegsgesundheit sprachen auch bessere Lungenfunktionswerte (FVC, FEV{sub 1}) im Laufe des Beobachtungszeitraumes 1992-1999. Kinder aus den beiden Belastungsregionen hatten haeufiger Allergien (Arztdiagnose, Symptome, allergenspezifischer Antikoerper-Nachweis). Die Haeufigkeit des Asthmas, der bronchialen Hyperreaktivitaet und der Neurodermitis nahm zu; die Praevalenz des Heuschnupfens und der allergischen Sensibilisierung nicht. Die korporale Belastung mit Blei und Cadmium war bei Kindern in den belasteten Regionen erhoeht, nahm aber im Verlauf des Beobachtungszeitraumes ab. Allerdings folgten gestiegenen Bleigehalten im Sedimentationsstaub in Hettstedt im Jahre 1997 leicht gestiegene Blutbleikonzentrationen. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Heinrich, J; Frye, C; Hoelscher, B; Meyer, I; Pitz, M; Cyrys, J; Schneller, H; Wjst, M; Wichmann, H E
2001-10-01
The aim of the environmental epidemiologic study was to determine possible negative effects on the health of children in the very polluted areas of Bitterfeld and Hettstedt in comparison to the less polluted areas of Anhalt-Zerbst (Eastern Germany). The time changes of the health parameters were recorded along with the running redevelopments during the time period of 6 years. The study design consisted of three repeated regional cross sectional studies in 1992/93, 1995/96 and 1998/99. In all, there was information of 7.611 questionnaires to be analysed (participation rate: 89%, 75% and 75%). Children living in the most polluted area of Hettstedt had a noticeable higher risk for non allergic respiratory diseases and symptoms compared to children living in the control area of Anhalt-Zerbst. During the time of the examinations in 1992 till 1999 a clear statistically significant decrease in the prevalences of these restrictions of health could be shown. Children without indoor pollutants in their homes profited most by the improvement of ambient air quality. The better lung function (FVC, FEV{sub 1}) between 1992 and 1999 underlines the improvement of the respiratory health. Children living in both polluted ares have allergies more often (physician's diagnosis, symptoms, allergy specific antibodies). The incidence of asthma, the bronchial hyperreactivity and atopic exzema increased, the prevalence of rhinitis and allergic sensitization did not increase. The body burden with lead and cadmium was higher in children living in polluted areas, but it decreased during the period of observation. In 1997, however, the lead concentration in blood increased a little, parallel to the higher lead concentration in settled dust in Hettstedt at that time. (orig.) [German] Ziel der umweltepidemiologischen Studie war es, moegliche gesundheitliche Beeitraechtigungen von Kindern in den Belastungsgebieten Bitterfeld und Hettstedt i. Vgl. zu dem wenig belasteten Gebiet Anhalt-Zerbst zu ermitteln. Darueber hinaus wurden die zeitlichen Veraenderungen der Gesundheitsparameter begleitend zu den laufenden Sanierungsmassnahmen ueber den Zeitraum von 6 Jahren erfasst. Das Studiendesign bestand aus 3 wiederholten regionalen Querschnittsuntersuchungen in den Jahren 1992/93, 1995/96 und 1998/99. Insgesamt lagen Informationen von 7611 Frageboegen zur Auswertung vor (Beteiligungsrate: 89%, 75% bzw. 75%). Fuer die Belastungsregion Hettstedt waren deutlich hoehere Risiken fuer nicht allergische respiratorische Erkrankungen und Symptome im Vergleich zu Kindern des Kontrollgebietes Anhalt-Zerbst nachweisbar. Waehrend des Untersuchungszeitraumes 1992-1999 zeigte sich eine deutlich statistisch signifikante Abnahme der Praevalenz dieser gesundheitlichen Einschraenkungen, Kinder ohne Exposition mit Innenraumschadstoffen im haeuslichen Bereich profitieren von der Verbesserung der Aussenluftbelastung am meisten. Fuer die Verbesserung der Atemwegsgesundheit sprachen auch bessere Lungenfunktionswerte (FVC, FEV{sub 1}) im Laufe des Beobachtungszeitraumes 1992-1999. Kinder aus den beiden Belastungsregionen hatten haeufiger Allergien (Arztdiagnose, Symptome, allergenspezifischer Antikoerper-Nachweis). Die Haeufigkeit des Asthmas, der bronchialen Hyperreaktivitaet und der Neurodermitis nahm zu; die Praevalenz des Heuschnupfens und der allergischen Sensibilisierung nicht. Die korporale Belastung mit Blei und Cadmium war bei Kindern in den belasteten Regionen erhoeht, nahm aber im Verlauf des Beobachtungszeitraumes ab. Allerdings folgten gestiegenen Bleigehalten im Sedimentationsstaub in Hettstedt im Jahre 1997 leicht gestiegene Blutbleikonzentrationen. (orig.)
Directory of Open Access Journals (Sweden)
Oriana Scarpati
2014-11-01
Full Text Available In three poems of Bertran Carbonel (a fictive tenso between Lover and Heart, a sirventes, and a planh an unknown person is referred to by the initials «P.G.». In the tenso, this mysterious person figures as the impartial judge of the tenso itself; in the sirventes he is bitterly blamed; in the planh he is mentioned as the object of the lament. On the basis of a metrical, rhetorical and stylistic analysis, the present article aims to demonstrate that these three poems are to be interpreted as progymnasmata, and that, although several scholars have assumed that the reference is to the troubadour Peire Guilhem, no real person is actually hidden under the fictive persona «P.G.» In the article a new critical edition of each poem is also provided.
2010-01-01
... Assistance SMALL BUSINESS ADMINISTRATION 8(a) BUSINESS DEVELOPMENT/SMALL DISADVANTAGED BUSINESS STATUS... must qualify as a small business concern as defined in part 121 of this title. The size standard... have obtained, or are likely to obtain, a substantial unfair competitive advantage within an industry...
National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...
Energy Technology Data Exchange (ETDEWEB)
Boch, Rudolf [TU Chemnitz (Germany). Wirtschafts- und Sozialgeschichte; Karlsch, Rainer (ed.)
2011-07-01
The book on the Wismut plant covers the following issues: Introduction: history of uranium mining of Wismut. Significance of uranium mining in politics and science: Uranium for the strategic equilibrium; the ore of the Cold War; special zones; ''Party within the Party'', radiation protection in uranium mining; Freiberg's geoscientists searching strategic metals in the 1940ies; end of the shift. Social history and daily routine: Good money for hard work; foreign among ''friends''; personnel data; gainful employment for women and emancipation in the frame of mining; from symphony orchestra to laymen circles; the fightning spirit of pitman-sportsmen.
Lu, P.; Heineke, M.H.; Koul, A.; Andries, K.; Cook, G.M.; Lill, H.; van Spanning, R.J.M.; Bald, D.
2015-01-01
Targeting respiration and ATP synthesis has received strong interest as a new strategy for combatting drug-resistant Mycobacterium tuberculosis. Mycobacteria employ a respiratory chain terminating with two branches. One of the branches includes a cytochrome bc 1 complex and an aa 3 -type cytochrome
Energy Technology Data Exchange (ETDEWEB)
Schmidt, M W [GSF - Forschungszentrum fuer Umwelt und Gesundheit, Remlingen (Germany). Forschungsbergwerk Asse; Fruth, R [GSF - Forschungszentrum fuer Umwelt und Gesundheit, Remlingen (Germany). Forschungsbergwerk Asse; Stockmann, N [GSF - Forschungszentrum fuer Umwelt und Gesundheit, Remlingen (Germany). Forschungsbergwerk Asse; Birthler, H [Gesellschaft fuer Anlagen- und Reaktorsicherheit mbH Greece, Braunschweig (Germany). Fachbereich Endlagersicherheitsforschung; Boese, B [Gesellschaft fuer Anlagen- und Reaktorsicherheit mbH Greece, Braunschweig (Germany). Fachbereich Endlagersicherheitsforschung; Storck, R [Gesellschaft fuer Anlagen- und Reaktorsicherheit mbH Greece, Braunschweig (Germany). Fachbereich Endlagersicherheitsforschung; Sitz, P [Technische Univ. Bergakademie Freiberg (Germany). Inst. fuer Bergbau; Krausse, A [Technische Univ. Bergakademie Freiberg (Germany). Inst. fuer Bergbau; Eulenberger, K H [Technische Univ. Bergakademie Freiberg (Germany). Inst. fuer Bergbau; Schleinig, J P [Technische Univ. Bergakademie Freiberg (Germany). Inst. fuer Bergbau; Duddeck, H [Technische Univ. Braunschweig (Germany). Inst. fuer Statik; Ahrens, H [Technische Univ. Braunschweig (Germany). Inst. fuer Statik; Menzel, W [IfG Inst. fuer Gebirgsmechanik GmbH, Leipzig (Germany); Salzer, K [IfG Inst. fuer Gebirgsmechanik GmbH, Leipzig (Germany); Minkley, W [IfG Inst. fuer Gebirgsmechanik GmbH, Leipzig (Germany); Busche, H [Kali und Salz AG, Kassel (Germany); Lindloff, U [Kali und Salz AG, Kassel (Germany); Gierenz, S [Kali und Salz AG, Kassel (Germany)
1996-12-31
This preparatory study, ``Shaft barriers for underground waste repositories in abandoned salt mines``, was to demonstrate the current scientific and technological know-how based on a comprehensive analysis of the barrier design concepts or established structures intended to serve as barriers in abandoned shafts of potash or rock salt mines. Taking as a basis the current regulatory regime and the available know-how on barrier systems in underground waste repositories taken into account so far in plan approval and licensing procedures, as well as the state of the art, concepts are developed as technical guides and models of barrier systems for mine shafts. The required research work for the various components of a shaft barrier is shown, particularly relating to aspects such as materials suitability and technical realisation. Immediate demand for research activities is shown with regard to the available potentials of mathematic and numeric geotechnical and hydrogeologic calculation models required in order to give proof of the long-term workability of shaft barriers. The authors are of the opinion that the following activities are required in order to meet the research demand quantified: (1) Laboratory and bench-scale experiments for determination of the efficiency of various sealing materials and backfilling materials, and (2) an in-situ, large-scale experiment in order to demonstrate the suitability of low-consolidation shotter columns, or constructional technologies. The laboratory work can be done in the facilities of the GSF research mine of Asse, the Freiburg Mining Academy, and the Institut fuer Gebirgsmechanik in Leipzig, and the benchmark experiments also at the Asse site in the research mine. The Kali und Salz Beteiligungs AG is prepared to offer its mine Salzdetfurth II as a site for the large-scale experiment. (orig.) [Deutsch] Im Rahmen der Vorstudie ``Schachtverschluesse fuer Untertagedeponien in Salzbergwerken`` wird ausgehend von einer umfangreichen Analyse der bisher realisierten bzw. konzipierten Verschlussmassnahmen von Schaechten des Kali- und Steinsalzbergbaues der gegenwaertige Stand von Wissenschaft und Technik abgeleitet. Auf der Grundlage der vorhandenen gesetzlichen Regelwerke und des mit zu beruecksichtigenden Kenntnisstandes zu Verschlusssystemen fuer UTD in bisher durchgefuehrten Planfeststellungs- und Genehmigungsverfahren sowie des Standes von Wissenschaft und Technik wurden Konzepte fuer die technischen Loesungen von Verschlusssystemen fuer Schaechte entwickelt. Der sich daraus ableitende Forschungsbedarf zu den einzelnen Elementen eines Schachtverschlusses, insbesondere unter dem Aspekt der Materialauswahl und der technischen Realisierbarkeit, wird ausgewiesen. Im Hinblick auf den Nachweis der langzeitlichen Funktionsfaehigkeit von Schachtverschluessen werden die vorhandenen Moeglichkeiten mathematisch-numerischer geotechnischer und hydrogeologischer Berechnungsmodelle dargestellt. Dabei besteht ein unmittelbarer Forschungsbedarf. Die Verfasser sind der Auffassung, dass zur Abarbeitung des ermittelten Forschungsbedarfes 1. Labor - und Technikumsversuche zur Wirksamkeit verschiedener Dichtmaterialien und Widerlagerbaustoffe sowie 2. ein In-situ-Grossversuch zur Klaerung der Einsatzmoeglichkeiten setzungsarmer Schottersaeulen und Einbautechnologien der Verschlussbauwerke erforderlich sind. Fuer die Laboruntersuchungen stehen die labortechnischen Einrichtungen des GSF-Forschungsbergwerkes Asse, der Bergakademie Freiberg und des Institutes fuer Gebirgsmechanik, Leipzig, sowie fuer die Technikumsversuche das Forschungsbergwerk Asse zur Verfuegung. Als Versuchsort fuer den In-situ-Grossversuch bietet die Kali und Salz Beteiligungs AG den Schacht Salzdetfurth II an. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Lukner, C
1985-01-01
The fact that the fossil fuel resources are limited requires the exploration and use of renewable and new sources of energy. To distinguish between feasible and utopian projects it is necessary to take recourse to secured technical knowledge in the discussion. The author treats 85 important terms used in the energy discussion, e.g. upwind power plants, energy experiments house, solar furnaces, wave power. He uses descriptive popular language.
Energy Technology Data Exchange (ETDEWEB)
Kleiber, A W
1987-01-01
The dictionary contains approximately 40 000 entries covering all aspects of welding technology. It is based on the evaluation of numerous English, American and German sources. This comprehensive and up to date dictionary will be a reliable and helpful aid in evaluation and translating. The dictionary covers the following areas: Welding: gas welding, arc welding, gas shielded welding, resistance welding, welding of plastics, special welding processes; Cutting: flame cutting, arc cutting and special thermal cutting processes; Soldering: brazing and soldering; Other topics: thermal spraying, metal to metal adhesion, welding filler materials and other consumables, test methods, plant and equipment, accessories, automation, welding trade, general welding terminology.
2010-01-01
... set forth or referred to in this section and its management and daily business operations are... affiliation with the CDC or any other business enterprise owned by the CDC, unless the Administrator... primary SIC code. (e) SBA does not deem an individual involved in the management or daily business...
Energy Technology Data Exchange (ETDEWEB)
Behling, G.; Koller, U.; Rauh, K.; Haury, H.J. [comps.
1999-11-01
Experts from science and administration informed the participants about recent results of scientific research and the applicable laws and regulations. Potential health hazards and recommended protective measures have been discussed. The publication presents the lectures held at the seminar. (orig./CB) [German] Fachleute aus Wissenschaft und von Behoerden informierten ueber aktuelle Erkenntnisse sowie das gesetzliche Regelwerk. Aus unterschiedlichen Blickwinkeln wurden moegliche gesundheitliche Risiken und vorgeschlagene Sicherheitsempfehlungen diskutiert. Der vorliegende Band enthaelt die ausgearbeiteten Vortraege. (orig./MG)
International Nuclear Information System (INIS)
Beiki, D.; Weibe, L.I.; Kumar, P.
2002-01-01
Viable tumors cells that reside in hypoxic cellular environment are 3 times more resistant to ionizing radiation than oxygenated cells. A non-invasive approach to study the extent of hypoxia involves the use of radio-tracer that selectively accumulates in hypoxic cells and does not damage normal cells. Hypoxia-selective uptake of 5-a- [125 I] iodo azomycin arabinoside (5-a-IAZA) has been demonstrated in a number of patient with varying pathological disorders including cancer, diabetes, arthritis and peripheral vascular disease, making it the most widely studied hypoxia marker in clinical research. The primary alkyl iodide of 5-a-IAZA is much more susceptible to heterodendria than secondary iodides and the compound undergoes d iodination, which necessarily increases the radiation dose to the thyroid gland and also contributes to undesired background radioactivity in later time images 2. It is also known that 5-a- IAZA, is not transported by cellular nucleoside transporters 3, where as, many B-arabinosyl nucleosides are efficiently internalized by these transporters. The present study reports the synthesis of a novel iodo azomycin arabinoside (B-2-IAZA), which designed to be chemically more stable than 5-a-IAZA by reducing extent of deiodination and poli c cleavage of the nucleoside bond by introducing steric bulk near the site of hydrolysis to be a substrate for cellular trans-membrane transport. The previous method for the thesis of B - azomycin arabinoside involves direct coupling of benzylated sugar with thylin moiety. The disadvantages of this method are formation of a - anomers which is 5 times than B-Anomers and the low chemical yield. This investigation also describes the synthesis B- azomycin arabinoside by C-2, inversion of centrifugation of the corresponding B-nucleoside and the resulting change made it possible to obtain only one anomers (B-anomers) reasonable yield. Microwave-assisted radio halogenation of these compounds gave higher of relatively pure products in shorter time compare to the conventional heating method
Energy Technology Data Exchange (ETDEWEB)
1988-01-01
High-speed magnetic levitation technology opens up a new dimension for long-distance passenger transport with speeds ranging between ground travel and flying. The status of development and test results of the German TRANSRAPID magnetic levitation system and corresponding activities abroad will be reported on. Both the new vehicle technology of the TRANSRAPID 07 and results of application studies at home and abroad will be presented. High-speed magnetic railway technology - status and development perspectives; readiness for service, safety and reliability, application studies. The book comprises 11 papers read at the symposium on the subject of high-speed trains. 14 papers have been recorded separately in this database. (orig./HW).
Energy Technology Data Exchange (ETDEWEB)
Ray, G F [National Institute of Economic and Social Research, London (UK)
1979-01-01
A group of European economic research institutes as well as a group of sociologists working in the Social Sciences Department of the University of Hamburg examined the industrial innovation process in companies situated in the Federal Republic of Germany, Great Britain, and Sweden. The following institutes were members of the group of economic research institutes: The Ifo-Institute for Economic Research at Munich, which also assumed coordinating responsibilities, the National Institute of Economic and Social Research, London, as well as the Industriens Utredningsinstitut, Stockholm. The purpose of this multinational project was to examine the process of research work in development and application of technologies using cases of innovation found in the energy industry. The study was intended to lead innovation research out of its methodical and scientific isolation to bridge certain gaps found in the existing innovation research work and thus to provide politicians and innovators in the major industrialized countries of the Western World with useful tools for decision making. Volume 3 contains the general development of the world energy situation and of problems of energy policy to be found in the three countries. Furthermore, it contains detailed studies of the innovation process of the latest major individual technologies to be found in this field.
Energy Technology Data Exchange (ETDEWEB)
Lissner, J
1979-01-01
The present volume 2 of the radiology compendium discusses clinical radiology with the list of subjects to be studied in the 2nd section of clinical training. It is dealing with the following themes: Internal medicine, paediatrics, urology, general surgery, radiological methods in gynaecology and obstetrics, orthopaedics, neurology, ophthalmology, otolaryngology, dentistry and orthodontology, radiotherapy in dermatology.
Energy Technology Data Exchange (ETDEWEB)
Kohmanns, B. [comp.; Koller, U. [comp.; Klemmer, A. [comp.; Haury, H.J. [comp.
1995-09-01
On 11 May 1995 the Central Information Bureau for Environmental Consulting in Bavaria held its sixth seminar. The seminar was dedicated to the subject `Concepts of Ecological Construction`. It attracted some 80 representatives of environmental consulting offices and other authorities assigned to environmental consulting tasks. Leading scientists from research institutions and the administration presented the current state of research into the ecological aspects of construction and planning. The lecturers dealt with diverse topics ranging from building site selection over questions on energy to aspects of building materials and illustrated the new possibilities of environmentally adapted construction by reference to practical examples. (orig./HW) [Deutsch] Am 11. Mai 1995 veranstaltete die Zentrale Informationsstelle, Umweltberatung Bayern ihr sechstes Seminar. Thema der Seminarveranstaltung, an der rund 80 Vertreterinnen und Vertreter von Umweltberatungsstellen und anderen mit Umweltberatung beauftragten Behoerden teilnahmen, war `Oekologisches Bauen`. Fuehrende Wissenschaftler und Wissenschaftlerinnen aus Forschung und Behoerden stellten den aktuellen Stand der Forschung oekologischer Aspekte des Bauens und Planens dar. Beginnend mit Kriterien fuer die Standortsuche von Bauvorhaben ueber Energiefragen und Aspekte oekologischer Baustoffe fuehrten die Referentinnen und Referenten schliesslich auch an praktischen Beispielen neue Moeglichkeiten des umweltgerechten Bauens vor. (orig./HW)
International Nuclear Information System (INIS)
Terrier, H.
2005-04-01
LHCb experiment has been designed in order to do precise measurements of CP violation and rare decays with B mesons. In 2000, the collaboration decided to modify the spectrometer in order to minimize the amount of matter seen by particles and to optimize the trigger. This thesis was done in this context and is divided into 3 parts. The first part is relative to the electron identification and to the recovery of Bremsstrahlung photons emitted by electrons when they pass through matter. Electron identification is mainly based on information provided by calorimeter system but also uses RICH and muon system. A method based on reference histograms had been developed which combine information provided by these detectors. Electron identification efficiency, for electrons in ECAL acceptance is 95% and the pion mis-identification rates 0.8% with a 65% purity of electron sample. Bremsstrahlung recovery allows the selection of J/φ decaying in e + e - pair and of B d 0 → J/φ(ee)K S 0 channel which are described in the second part. The selection of this channel was developed in order to get an acceptable selection efficiency with a good rejection of background. A set of kinematic and topological cuts were designed and total selection efficiency is 0.176%, corresponding to 28000 untagged events reconstructed by year, with a ratio B/S belonging to [0.017;0.069] (at 90% of confidence level) for inclusive bb-bar background. In the third part, B meson flavour tagging is presented. The addition of information provided by the vertex locator allows to reject electron coming from conversion and to improve slightly the performances. The LHCb sensibility to sin(2β) from B 0 → J/ψK S 0 decay is also determined. The statistical error, expected after one year of data collecting, corresponding to an integrated luminosity of 2 fb -1 and bb-bar pair cross section of 0.5 mb, varies from 0.015 to 0.020 according to the values of sin(2β), |λ f | and B/S. (author)
Energy Technology Data Exchange (ETDEWEB)
Clark, Brett W. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Diaz, Kimberly A. [Georgia Inst. of Technology, Atlanta, GA (United States); Ochiobi, Chinaza Darlene [Georgia Inst. of Technology, Atlanta, GA (United States); Paynabar, Kamran [Georgia Inst. of Technology, Atlanta, GA (United States)
2015-09-01
3D printing originally known as additive manufacturing is a process of making 3 dimensional solid objects from a CAD file. This ground breaking technology is widely used for industrial and biomedical purposes such as building objects, tools, body parts and cosmetics. An important benefit of 3D printing is the cost reduction and manufacturing flexibility; complex parts are built at the fraction of the price. However, layer by layer printing of complex shapes adds error due to the surface roughness. Any such error results in poor quality products with inaccurate dimensions. The main purpose of this research is to measure the amount of printing errors for parts with different geometric shapes and to analyze them for finding optimal printing settings to minimize the error. We use a Design of Experiments framework, and focus on studying parts with cone and ellipsoid shapes. We found that the orientation and the shape of geometric shapes have significant effect on the printing error. From our analysis, we also determined the optimal orientation that gives the least printing error.
Lu, P.; Asseri, A.H.O.; Kremer, Martijn; Maaskant, Janneke; Ummels, Roy; Lill, H.; Bald, D.
2018-01-01
Mycobacterial energy metabolism currently attracts strong attention as new target space for development of anti-tuberculosis drugs. The imidazopyridine Q203 targets the cytochrome bcc complex of the respiratory chain, a key component in energy metabolism. Q203 blocks growth of Mycobacterium
A roadmap to control penguin effects in B-d(0) -> J/psi K-S(0) and B-s(0) -> J/psi phi
De Bruyn, K.; Fleischer, R.
2015-01-01
Abstract: Measurements of CP violation in B
Fountoulakis, Konstantinos N; Young, Allan; Yatham, Lakshmi; Grunze, Heinz; Vieta, Eduard; Blier, Pierre; Moeller, Hans Jurgen; Kasper, Siegfried
2017-02-01
This paper includes a short description of the important clinical aspects of Bipolar Disorder with emphasis on issues that are important for the therapeutic considerations, including mixed and psychotic features, predominant polarity, and rapid cycling as well as comorbidity. The workgroup performed a review and critical analysis of the literature concerning grading methods and methods for the development of guidelines. The workgroup arrived at a consensus to base the development of the guideline on randomized controlled trials and related meta-analyses alone in order to follow a strict evidence-based approach. A critical analysis of the existing methods for the grading of treatment options was followed by the development of a new grading method to arrive at efficacy and recommendation levels after the analysis of 32 distinct scenarios of available data for a given treatment option. The current paper reports details on the design, method, and process for the development of CINP guidelines for the treatment of Bipolar Disorder. The rationale and the method with which all data and opinions are combined in order to produce an evidence-based operationalized but also user-friendly guideline and a specific algorithm are described in detail in this paper. © The Author 2016. Published by Oxford University Press on behalf of CINP.
Czech Academy of Sciences Publication Activity Database
Kiran, E.; Harmanec, P.; Degirmenci, O.L.; Wolf, M.; Nemravová, J.; Šlechta, Miroslav; Koubský, Pavel
2016-01-01
Roč. 587, March (2016), A127/1-A127/9 ISSN 0004-6361 Grant - others:GA ČR(CZ) GAP209/10/0715; GA(CZ) GA15-02112S Program:GA Institutional support: RVO:67985815 Keywords : binaries * eclipsing * fundamental parameters Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 4.378, year: 2014
Gerthsen, Tarsilla
2008-01-01
Dieses Buch beinhaltet zunächst eine kurze Einführung in die Organische Chemie. Organische Grundkenntnisse sind die Voraussetzung, um nicht nur Kraftstoffe und Schmierstoffe zu verstehen, sondern im Besonderen die Polymerchemie für Polymerwerkstoffe. Die Vorlesung "Polymerwerkstoffe" wird im Maschinenbaustudium in einem höheren Semester angeboten. Allgemeine chemische Grundkenntnisse für Chemie im Nebenfach findet man im Buch 1 "Chemie für Maschinenbau - Anorganische Chemie f...
单端还是推挽?终极问题的答案 欧博Cyber 300B PSE和Cyber 300BD
Institute of Scientific and Technical Information of China (English)
欧阳文(编译)
2007-01-01
我曾经测试过欧博的水滴CDP5.0 CD机和LP5.0唱盘机,这两个产品都给我留下了极深刻的印象。浏览欧博的网站,发现他们发布了一系列的高端电子管功放,其中就包括一对300B单管单端的双单声道后级。它与我自己的Audio Note Quest Silvers后级可以说是一个完美的对照。于是我和欧博进行了例行的沟通,两周之后收到了欧博寄给我的两个厚重的箱子。
Energy Technology Data Exchange (ETDEWEB)
Schmidt, M.W. [GSF - Forschungszentrum fuer Umwelt und Gesundheit, Remlingen (Germany). Forschungsbergwerk Asse; Fruth, R. [GSF - Forschungszentrum fuer Umwelt und Gesundheit, Remlingen (Germany). Forschungsbergwerk Asse; Stockmann, N. [GSF - Forschungszentrum fuer Umwelt und Gesundheit, Remlingen (Germany). Forschungsbergwerk Asse; Birthler, H. [Gesellschaft fuer Anlagen- und Reaktorsicherheit mbH Greece, Braunschweig (Germany). Fachbereich Endlagersicherheitsforschung; Boese, B. [Gesellschaft fuer Anlagen- und Reaktorsicherheit mbH Greece, Braunschweig (Germany). Fachbereich Endlagersicherheitsforschung; Storck, R. [Gesellschaft fuer Anlagen- und Reaktorsicherheit mbH Greece, Braunschweig (Germany). Fachbereich Endlagersicherheitsforschung; Sitz, P. [Technische Univ. Bergakademie Freiberg (Germany). Inst. fuer Bergbau; Krausse, A. [Technische Univ. Bergakademie Freiberg (Germany). Inst. fuer Bergbau; Eulenberger, K.H. [Technische Univ. Bergakademie Freiberg (Germany). Inst. fuer Bergbau; Schleinig, J.P. [Technische Univ. Bergakademie Freiberg (Germany). Inst. fuer Bergbau; Duddeck, H. [Technische Univ. Braunschweig (Germany). Inst. fuer Statik; Ahrens, H. [Technische Univ. Braunschweig (Germany). Inst. fuer Statik; Menzel, W. [IfG Inst. fuer Gebirgsmechanik GmbH, Leipzig (Germany); Salzer, K. [IfG Inst. fuer Gebirgsmechanik GmbH, Leipzig (Germany); Minkley, W. [IfG Inst. fuer Gebirgsmechanik GmbH, Leipzig (Germany); Busche, H. [Kali und Salz AG, Kassel (Germany); Lindloff, U. [Kali und Salz AG, Kassel (Germany); Gierenz, S. [Kali und Salz AG, Kassel (Germany)
1995-12-31
This preparatory study, ``Shaft barriers for underground waste repositories in abandoned salt mines``, was to demonstrate the current scientific and technological know-how based on a comprehensive analysis of the barrier design concepts or established structures intended to serve as barriers in abandoned shafts of potash or rock salt mines. Taking as a basis the current regulatory regime and the available know-how on barrier systems in underground waste repositories taken into account so far in plan approval and licensing procedures, as well as the state of the art, concepts are developed as technical guides and models of barrier systems for mine shafts. The required research work for the various components of a shaft barrier is shown, particularly relating to aspects such as materials suitability and technical realisation. Immediate demand for research activities is shown with regard to the available potentials of mathematic and numeric geotechnical and hydrogeologic calculation models required in order to give proof of the long-term workability of shaft barriers. The authors are of the opinion that the following activities are required in order to meet the research demand quantified: (1) Laboratory and bench-scale experiments for determination of the efficiency of various sealing materials and backfilling materials, and (2) an in-situ, large-scale experiment in order to demonstrate the suitability of low-consolidation shotter columns, or constructional technologies. The laboratory work can be done in the facilities of the GSF research mine of Asse, the Freiburg Mining Academy, and the Institut fuer Gebirgsmechanik in Leipzig, and the benchmark experiments also at the Asse site in the research mine. The Kali und Salz Beteiligungs AG is prepared to offer its mine Salzdetfurth II as a site for the large-scale experiment. (orig.) [Deutsch] Im Rahmen der Vorstudie ``Schachtverschluesse fuer Untertagedeponien in Salzbergwerken`` wird ausgehend von einer umfangreichen Analyse der bisher realisierten bzw. konzipierten Verschlussmassnahmen von Schaechten des Kali- und Steinsalzbergbaues der gegenwaertige Stand von Wissenschaft und Technik abgeleitet. Auf der Grundlage der vorhandenen gesetzlichen Regelwerke und des mit zu beruecksichtigenden Kenntnisstandes zu Verschlusssystemen fuer UTD in bisher durchgefuehrten Planfeststellungs- und Genehmigungsverfahren sowie des Standes von Wissenschaft und Technik wurden Konzepte fuer die technischen Loesungen von Verschlusssystemen fuer Schaechte entwickelt. Der sich daraus ableitende Forschungsbedarf zu den einzelnen Elementen eines Schachtverschlusses, insbesondere unter dem Aspekt der Materialauswahl und der technischen Realisierbarkeit, wird ausgewiesen. Im Hinblick auf den Nachweis der langzeitlichen Funktionsfaehigkeit von Schachtverschluessen werden die vorhandenen Moeglichkeiten mathematisch-numerischer geotechnischer und hydrogeologischer Berechnungsmodelle dargestellt. Dabei besteht ein unmittelbarer Forschungsbedarf. Die Verfasser sind der Auffassung, dass zur Abarbeitung des ermittelten Forschungsbedarfes 1. Labor - und Technikumsversuche zur Wirksamkeit verschiedener Dichtmaterialien und Widerlagerbaustoffe sowie 2. ein In-situ-Grossversuch zur Klaerung der Einsatzmoeglichkeiten setzungsarmer Schottersaeulen und Einbautechnologien der Verschlussbauwerke erforderlich sind. Fuer die Laboruntersuchungen stehen die labortechnischen Einrichtungen des GSF-Forschungsbergwerkes Asse, der Bergakademie Freiberg und des Institutes fuer Gebirgsmechanik, Leipzig, sowie fuer die Technikumsversuche das Forschungsbergwerk Asse zur Verfuegung. Als Versuchsort fuer den In-situ-Grossversuch bietet die Kali und Salz Beteiligungs AG den Schacht Salzdetfurth II an. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Behling, G; Koller, U; Klemmer, A; Haury, H J [comps.
1998-08-01
The spectrum of problems relating to endocrine-disrupting environmental chemicals was presented by competent experts from public authorities and scientific institutions. The lecturers described the current stage and future tasks of research. Their lectures focused on effects of hormone-like substances on humans and animals and an assessment of risk factors on the basis of data from scientific tests and current environmental exposure. There was also a contribution presenting the chemical industry`s view of the matter. [Deutsch] Kompetente Sachverstaendige aus Behoerden und wissenschaftlichen Einrichtungen stellten das Themenspektrum vor, fuehrten in den Forschungsstand ein und zeigten den Forschungsbedarf auf. Der Schwerpunkt lag in der Darstellung der der Auswirkungen hormonell wirksamer Substanzen, wie z.B. DDT, Dioxinen und PCBs, auf Mensch und Tier sowie in der Abschaetzung der Risikofaktoren anhand der bekannten Daten aus wissenschaftlichen Tests sowie der aktuellen Exposition in der Umwelt. Mit einem Beitrag der chemischen Industrie wurde auch deren Einschaetzung der Umweltproblematik aufgezeigt. (orig./MG) m9
International Nuclear Information System (INIS)
Viaud, B.
2003-10-01
The Standard Model predicts the same time-dependant CP asymmetry in both B d 0 -> J/ψK S 0 and B d 0 → φK S 0 decays. This asymmetry is proportional to sin(2*β). Any difference between the CP asymmetries measured in these 2 channels would indicate the presence of new phenomena beyond the Standard Model. We study the sensitivity of the LHCb experiment to this effect. To that end, we estimate the statistical error on the measurement of sin(2*β) in the B d 0 → φK S 0 channel by LHCb. We do that with the LHCb classic detector, and then with the re-optimized detector. The number of simulated background events is too small with respect to the annual statistics to obtain precise evaluations. We developed several methods to improve these evaluations. In the most optimistic case, we predict that sin(2*β) would be measured in the LHCb classic configuration with a statistical error equal to 0.56. With the re-optimized detector, this error is further improved: 0.29. (author)
Energy Technology Data Exchange (ETDEWEB)
Scharp, Michael (ed.)
2009-02-15
The objective of the research project 'The world of renewable energies: Powerado' was to improve communication aimed at conveying renewable energies to children. In order to achieve his aim, materials for different age groups and multipliers have been developed. These helped determining successful strategies for communicating renewable energies. There were several reasons for the need of such a project. It may be the case that renewable energies have been included into the syllabus of primary schools, but they still have no prominent role at schools. Additionally, the training of multipliers for renewable energies shows severe deficits. The project consisted of ten interconnected modules which explicitly are described. Overall, the powerado project was a huge success. 58,000 estimated multipliers, children, adolescents and persons generally being interested in renewable energies have been reached by the project and its modules. So the powerado project achieved its main objective improving communication of renewable energies.
Guillem Rainol d’At, “Quant aug chantar lo gal sus en l’erbos” (BdT 231.4)
Linda Paterson
2010-01-01
Despite appearing in several editions and interpretations, this piece continues to pose problems. To what poetic genre does it belong? Should it be regarded as ‘fictive’ in some sense? How coherent is it, and to what should be attributed any incoherence? Are the interlocutors married or not? How many ‘dramatis personae’ are involved and who are they? It is argued here that any apparent incoherence derives from the manuscript transmission and the difficulties posed by the unusual vocabulary an...
Guillem Rainol d’At, “Quant aug chantar lo gal sus en l’erbos” (BdT 231.4
Directory of Open Access Journals (Sweden)
Linda Paterson
2010-06-01
Full Text Available Despite appearing in several editions and interpretations, this piece continues to pose problems. To what poetic genre does it belong? Should it be regarded as ‘fictive’ in some sense? How coherent is it, and to what should be attributed any incoherence? Are the interlocutors married or not? How many ‘dramatis personae’ are involved and who are they? It is argued here that any apparent incoherence derives from the manuscript transmission and the difficulties posed by the unusual vocabulary and popularising register, the narrative situation is simpler than has been previously thought, and wordplay or semantic ambivalence works primarily as humour rather than jongleuresque display. The piece would appear to be designed for performance as a comic sketch, imaginable in dramatised form with appropriate costumes, props and gestures, with the troubadour possibly coming on stage in his own persona as a ‘knight’, being interrupted by a ‘woman’ whose part could have been sung and acted by another man, a woman, or even the troubadour himself. The text may be aptly described as a 'fabliau' in dialogue form.
Directory of Open Access Journals (Sweden)
2010-08-01
The causal agent of border disease is a pestivirus, which is closely related to a similar virus of cattle called bovine virus diarrhea virus (BVDV. Clinical manifestations of the disease include: infertility, low fertility, mummified fetuses, abortion and still birth, the birth of small weak lambs with tremor and abnormalities of hair coat. This study was conducted in winter of 2008 by referring to sheep farms around Tabriz with a history of abortion especially the Ligwan area as a main sheep rearing area and selection of 4000 sheep as the sample population. Blood samples were drawn from the jugular vein by venoject from 10% of each sheep herd population, the samples were transferred to laboratory in ice and after obtaining serum, the sera were freezed in –20 in order to measure antibody levels with (LSI KIT FRANCE. From a total of 373 sheep including 333 ewes and 40 rams, 282 (75.6% sheep were considered positive and 91 (24.4% were negative for Border antivirus - antibody serum. According to sample separation 252 (75.6% ewes showed positive serum and 81 (24.4% ewes showed negative serum, 30 (75% rams showed positive serum and 10 (25% rams showed negative serum. The results indicate that 75.6% of sheep in Tabriz area are challenged with BDV virus and probably Border virus in one of the main factors in reduction of sheep herds reproduction performance in Tabriz.
Energy Technology Data Exchange (ETDEWEB)
Leclaire, T; Schiefer, C; Bergmann, S; Hrabovski, Z [Institut fuer Umwelttechnologie und Umweltanalytik e.V. (IUTA), Duisburg (Germany)
1998-08-01
For more than two decades now experiences of ozone reduction have been made in the USA. In many regions great efforts for VOC control are made to reduce their high ozone concentrations in ambient air that in some cases reach up to more than twice the German peak concentrations. This report places focus on small stationary sources and products, for these sources actually contribute more than half of the VOC emissions in Germany and are still not regulated under the German Immission Control Law. Therefore, main aim of this examination was to determine the major elements of VOC control strategies in the U.S. and to consider, whether strategies and measures are transferable taking into account German circumstances. Volume 1 describes the strategies and measures for ozone control in the U.S. (national) as well as in five regions with high ozone concentrations in ambient air. The authorities and responsbilities at federal, state, regional, and local levels are highlighted, legislation and different types of regulations are explained, priorities concerning VOC versus NO{sub x} related control are mentioned and the control measures on different sources for reducing VOC and NO{sub x} are summarized briefly. Volume 2 contains a detailed description of control measures for reducing VOC emissions from products and stationary sources, namely the proposed national VOC emission standards for coatings and consumer products, the California Consumer Products Regulations, the state-wide requirements for industrial and commercial sources in California and the VOC related rules of the South Coast Air Quality Management District (LA and surrounded Countries). The South Coast Rules were chosen as an example for District Rules for they were generally the most stringent because of the extreme ozone concentration in this area. Moreover, the regulations for VOC emission control in Europe concerning small stationary sources and products are mentioned. The different approaches to control VOC emissions are compared and discussed. Advantages and disadvantages of the described strategies are highlighted. Based on the actual VOC emission inventory of Germany suggestions for future reduction measures are supposed. (orig.) [Deutsch] In den USA liegen Erfahrungen aus der Ozonbekaempfung ueber einen Zeitraum von 20 bis 30 Jahren vor. Aufgrund besonders hoher Ozonbelastungen in vielen Regionen werden grosse Anstrengungen zur VOC-Minderung unternommen. Wesentliches Ziel des Vorhabens war es, die Schwerpunkt im Hinblick auf die Minderung von VOC-Emissionen herauzufinden und zu pruefen, ob und inwieweit eine Uebertragung von Strategien und Massnahmen auf die Verhaeltnisse in Deutschland moeglich ist. Hauptaugenmerk wurde auf kleinere Anlagen und Produkte gelegt, weil in diesen Bereichen in Deutschland momentan vordringlich Handlungsbedarf gesehen wird. Im ersten Band sind die Strategien und Massnahmen zur Ozonminderung in den USA (bundesweit) sowie in fuenf Regionen mit besonders hoher Ozonimmissionsbelastung beschrieben. Hierzu erfolgte eine Darstellung der Zustaendigkeitsbereiche auf nationaler, einzelstaatlicher, regionaler und lokaler Ebene, der Gesetzgebung und Regelwerke, der Schwerpunktsetzung hinsichtlich NO{sub x}- und VOC-Minderung und eine kurze Darstellung der quellenbezogenen Massnahmen auf nationaler Ebene und in den betrachteten Regionen. In Band 2 erfolgt eine ausfuehrliche Beschreibung der Massnahmen zur VOC-Emissionsminderung bei Produkten und im gewerblichen Bereich in den USA anhand der nationalen Regelungen fuer Anstrichstoffe und Konsumgueter, der von der kalifornischen Luftreinhaltebehoerde erlassenen VOC-bezogenen Regelungen fuer Anstrichstoffe, Konsumgueter und Gewerbebetriebe sowie der Regelungen des suedkalifornischen South Coast Air Quality Management Districts (Los Angeles und Umgebung). Zur Darstellung der regionalen Bestimmung wurde diese Region ausgewaehlt, da die Regelungen dort aufgrund der besonders hohen Immissionsbelastung grundsaetzlich am weitesten gehen. Darueber hinaus werden die Regelungen zur VOC-Emissionsminderung fuer den Bereich der Kleinanlagen und Produkte in Europa dargestellt. Die unterschiedlichen Ansaetze zur VOC-Emissionsminderung werden zusammenfassend diskutiert, Vor-und Nachteile herausgearbeitet und unter Beruecksichtigung der derzeitigen VOC-Emissionssituation in Deutschland Ansatzpunkte fuer zukuenftige Massnahmenschwerpunkte aufgezeigt. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Ruedel, H.; Lepper, P.; Sohn, H.; Steinhanses, J.; Boehmer, W.; Bruckert, H.J.; Wenzel, A.
1999-11-01
In the context of this research project analytic methods for the quantitative determination of alkylphenols (4-nonylphenol, 4NP; 4-tert.-octylphenol, 4tOP) and alkylphenol ethoxylates (4-nonlyphenol monoethoxylate, 4NP1EO; 4-tert.-octylphenol monoethoxylate, 4tOP1EO), bisphenol A (BPhA) as well as tin-organic compounds (tributyl tin, TBT; dibutyl tin, DBT, monobutyl tin, MBT; triphenyl tin, TPhT) in different biological matrices were adapted and optimised. The methods were documented in form of standard operating procedures (SOP). Following these methods samples from the German federal environmental specimen bank were investigated. Brown algae, (bay) mussels, eel pouts, sea gull eggs from the marine ecological systems of the North Sea and Baltic Sea and zebra mussels and bream muscles from fresh water ecological systems (Elbe, Mulde, Saale, Thine, Saar, Bornhoeveder lake district) of different years were analysed. Alkylphenols: The contents of 4NP and 4NP1EO mostly were in both, the marine and the fresh water, ecological systems above the contents of 4tOP and 4tOP1EO. In the marine samples the mussels were higher loaded than the other matrices. The contents in the samples from fresh water ecological systems were clearly higher than those of the samples from the marine ecological systems. The highest concentration for 4NP1EO with 324 {mu}g/kg fresh weight was measured in bream muscles from the Saar near Guedingen. Bisphenol A: the content of BPhA in the examined samples generally was low. The analyses resulted in concentrations of 1-2.5 {mu}g/ BPhA/kg in zebra mussel; only in zebra mussels from the river Saar near Rehlingen a higher value of approx. 5 {mu}g/kg was detected. The BPhA concentration in bream muscles was always below the limit of determination (LOD). The lowest content of BPhA in marine samples was found for mussels (concentration
Directory of Open Access Journals (Sweden)
George C. Nitzburg
2015-03-01
Conclusions: MSCEIT deficits were found in SSD but not BD− or BD+, suggesting that social cognition may represent an underlying difference between SSD and BD. However, variance in MSCEIT performance among BD patients may also suggest latent BD subgroups characterized by social-cognitive deficits. Findings can help inform future investigations into how social cognition and social brain development differ between SSD and BD.
Katrina Historical Page - Office of Satellite and Product Operations
. Floater Imagery August 28/1745Z to 29/0245Z: Image: AVN | BD | FT | IR | IR2 | JSL | RB | RGB | VIS | WV Image (w/ Latitude & Longitude): AVN | BD | FT | IR | IR2 | JSL | RB | RGB | VIS | WV Loop: AVN | BD : AVN | BD | FT | IR | IR2 | JSL | RB | RGB | VIS | WV Image (w/ Latitude & Longitude): AVN | BD
Energy Technology Data Exchange (ETDEWEB)
Brohmann, B; Cames, M
2000-06-01
The aim of the project was to identify areas in households and the tertiary sector in which changes in behaviour could result in energy conservation and thus a reduction of greenhouse gas emissions, and to quantify the potentials for 1995, 2005 and 2020. A second focus was on the analysis and evaluation of programmes and instruments to realise the potentials. With literature evaluation, expert interviews, and a household servey potentials and further technical development have been identified. In sum, behavioural measures can contribute to the CO2 reduction by 64 million tons in 1995 in households and 27 in the commercial sector in which the potential decreases to 18 million tons in 2020 due to the autonomous technical development. Adequate promotion programmes can help to realise 20-30% of the potential by 2020. (orig.) [German] Ziel des Vorhabens war, im Sektor private Haushalte und Kleinverbrauch Bereiche zu identifizieren, in denen Verhaltensaenderungen zur Energieeinsparung fuehren koennen, und diese Potenziale fuer 1995, 2005 und 2020 zu quantifizieren. Darauf aufbauend waren Programme und Instrumente zur Umsetzung aufzuzeigen und zu bewerten. Gestuetzt auf Literaturrecherchen und Expertengespraeche wurden Einzelpotenziale, Rahmenbedingungen, Entwicklungstrends in der Technik und im Ausstattungsgrad ermittelt. Insgesamt koennten Verhaltensmassnahmen im Haushaltssektor die CO2-Emissionen im Basisjahr 1995 um 64 Mio, im Kleinverbrauch um 27 Mio t vermindern. Bis 2020 bleibt dieses Potenzial im Haushaltssektor in etwa gleich. Im Kleinverbrauch sinkt es infolge der autonomen Technikentwicklung auf 18 Mio t ab. Durch geeignete Programme koennen bis 2020 etwa 20-30% des Potenzials erreicht werden. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Mannhardt, K H
1981-01-01
This technical dictionary, compiled in everyday practice, gives an outline of the terminology and phraseology of a modern field of engineering. Users should have some basic knowledge of the English language and also of engineering as well as access to standard-language dictionaries. Core subjects of the dictionary are nuclear power, reactor engineering, fusion technology, solar energy, wind energy, tidal energy, radiation protection, nuclear safety, coal gasification and coal liquefaction, cooperative agreements and managerial problems.
Energy Technology Data Exchange (ETDEWEB)
1987-01-01
This dictionary is a compilation of German and English technical terms of power plant engineering as far as power plants, turbine-generators and assembly engineering are concerned. It is the result of a joint effort by the Kraftwerk Union AG (KWU) and Utility Power Corp. (UPC). The entire content has been revised and approx. 6000 new terms have been added. The dictionary is meant to form a basis for uniform terminology on technical documents as well as correspondence between KWU, UPC and licensees. This computer aided dictionary is printed in capital/low case letters. Only nouns, terms with an article and proper names are capitalized in German. Some terms are written differently in American and British English and are marked with (US) or (GB).
Energy Technology Data Exchange (ETDEWEB)
Appenzeller, Immo; Dubbers, Dirk; Siebig, Hans-Georg; Winnacker, Albrecht (eds.)
2017-07-01
The following topics are dealt with: Memories of the physics from 1945 until 1970, from the atomic nucleus until the fission of uranium, the emergence of the physics of the atomic nuclei, 43 years of elementary-particle physics, 60 years of research, elementary particles and forces of physics. (HSI)
Energy Technology Data Exchange (ETDEWEB)
Koller, U.; Behling, G.; Klemmer, A.; Haury, H.J. [comps.
1998-12-31
On 25/26 November, 1997, Zentrale Informationsstelle, Umweltberatung Bayern held its 11th seminar under the title ``Sustainable development - theory and practice of environmental consulting. Subjects related to the Agenda 21 were discussed in lectures and workshops. [Deutsch] Am 25. und 26. November 1997 veranstaltete die Zentrale Informationsstelle, Umweltberatung Bayern ihr elftes Seminar mit dem Thema ``Nachhaltige Entwicklung- Theorie und Praxis fuer die Umweltberatung``. In Fachvortraegen und Workshops wurden Themen zur Agenda 21 behandelt. (ABI)
Energy Technology Data Exchange (ETDEWEB)
Moeller, T.B. [Caritas-Krankenhaus, Dillingen (Germany); Reif, E. [Caritas-Krankenhaus, Dillingen (Germany)
1993-12-31
Using the nomenclature relating to X-ray findings, the paperback atlas provides a concise, yet accurate description of fine anatomical structures visualized by sectional imaging procedures. Each of the approx. 250 sample images shown for the regions of the head (including neurocranium), vertebral column, neck, thorax, abdomen and muscosceletal system (including joints) is supplemented with a drawing that permits an immediate identification of any structure of interest. (orig.) [Deutsch] Der Taschenatlas beschreibt komprimiert und unter Verwendung der roentgenspezifischen Nomenklatur die anatomischen Details der Schnittbilddiagnostik. Jedem der rund 250 exemplarischen Schnittbilder aus den Bereichen Kopf (inkl. Neurokranium), Wirbelsaeule, Hals, Thorax, Abdomen und muskuloskeletalem System (inkl. Gelenke) ist eine Zeichnung zugeordnet, die das rasche Auffinden der jeweils gesuchten Struktur ermoeglicht. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Kaiser, W; Rogazewski, P; Schindler, M [TUeV Anlagentechnik GmbH, Berlin-Schoeneberg (Germany). Unternehmensgruppe TUeV Rheinland/Berlin-Brandenburg; Acikalin, A; Albrecht, M; Lambert, M; Steinbach, J [Technische Univ. Berlin (Germany)
2000-07-01
At present there are used various of procedures, calculation methods, models and model equations for hazardous incident scenarios. The procedure on principle is varying often. This guideline explains in one main part and six appendixes the methodical procedure to select specifications and assumptions on hazardous incident scenarios and their processing. Hazardous incident scenarios lead to information on emergency preparedness planning. Both general viewpoints and possibilities are shown, how to find necessary basic assumptions on a hazardous incident scenario from information on hazardous substances, on comparable hazardous incidents and on conditions of the site and the plant. Appendixes deal with precise instructions distinguished between substance release, explosion and fire (app. 1: Assessment of source terms, app. 2: Assessment of dispersion, app. 3: Assessment of effects). Appendix 4 gives explanations to appendixes 1, 2 and 3. Appendix 5 contains a collection of 15 examples of hazardous incident scenarios, which illustrate and comment the methodical procedure. Appendix 6 describes and comments software available on German market which assists the calculating of hazardous incidents. Volume 2 determines procedures with regard to methods of calculation, current models and model equations from scientists point of view. (orig.) [German] Derzeit wird eine Vielzahl von Vorgehensweisen, Berechnungsmethoden, Modellen und Modellgleichungen fuer Stoerfallablaufszenarien verwendet. Das prinzipielle Vorgehen ist haeufig unterschiedlich. Dieser Leitfaden enthaelt in einem Hauptteil und sechs Anhaengen das methodische Vorgehen zur Auswahl von Angaben und Annahmen fuer Stoerfallablaufszenarien sowie deren Bearbeitung. Stoerfallablaufszenarien fuehren zu Angaben fuer die Gefahrenabwehrplanung. Fuer das Ableiten von Stoerfallablaufszenarien sind sowohl allgemeine Gesichtspunkte als auch Moeglichkeiten dargelegt, wie man aus Angaben zu Gefahrstoffen, zu vergleichbaren Stoerfaellen sowie zu Bedingungen des Standortes und der Anlage die erforderlichen Grundannahmen zum Stoerfallablauf gewinnen kann. Unterschieden nach Stofffreisetzungen, Explosionen und Braenden wird jeweils auf die konkreteren Hinweise im Anhang 1 zur Abschaetzung von Quelltermen, im Anhang 2 zur Abschaetzung der Ausbreitung und im Anhang 3 zur Abschaetzung der Auswirkungen verwiesen. Der Anhang 4 enthaelt einige Erlaeuterungen zu den Anhaengen 1 bis 3. Mit einer Sammlung von 15 Beispielen fuer Stoerfallablaufszenarien wird im Anhang 5 das im Leitfaden beschriebene methodische Vorgehen veranschaulicht und erlaeutert. Im Anhang 6 werden die auf dem deutschen Markt erhaeltlichen DV-Programme (Software) zur Berechnung von Stoerfallablaufszenarien beschrieben und kommentiert. Der Band 2 untermauert das Vorgehen im Hinblick auf Berechnungsmethoden, aktuelle Modelle und Modellgleichungen aus wissenschaftlicher Sicht. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Koller, U.; Behling, G.; Rauh, K.; Haury, H.J. (comps.)
1999-08-01
Scientists of Germany's major climate research institutes and an expert of the world climate research programme presented current information on climate trends. They informed on the results of international efforts to prevent global warming after the Buenos Aires conference and presented global climate scenarios of the future. Further issues were local air pollution abatement (energy management, thermal insulation), communal air pollution abatement concepts, and state funding in Bavaria and elsewhere. [German] Wissenschaftler aus den bedeutendsten Instituten deutscher Klimaforschung sowie ein Vertreter des Weltklimaforschungsprogramms stellten aktuelle Erkenntnisse zur Entwicklung unseres Klimas vor. Sie informierten ueber Ergebnisse internationaler Klimaschutzpolitik nach der Klimakonferenz in Buenos Aires und praesentierten Szenarien fuer das globale Klima der Zukunft. Sie widmeten sich ausserdem Fragen des lokalen Klimaschutzes unter den Aspekten Energiemanagement, Waermeschutz und diskutierten ueber kommunale Klimaschutzkonzepte sowie Foerdermoeglichkeiten in und ausserhalb Bayerns. (orig.)
Timbal-Doclaux, Louis; And Others
1994-01-01
Four activities for classroom French instruction are described: a board game for children's vocabulary development; a sentence and dialogue construction exercise using comic strips (existing or student-made); a discussion of the treatment of the notion of "event" in different journalistic contexts; and an exercise in debating skills and language.…
Energy Technology Data Exchange (ETDEWEB)
Michaelis, H
1986-01-01
The Chernobyl accident has given a new drive to the public debate about nuclear energy. Frequently, lack of information on the technical background can be observed, which makes the debate look somewhat fruitless. The present edition of the nuclear energy reference book is a completely revised and up-dated version of the standard work and offers a wealth of information about all aspects of nuclear energy. The material presented explains technical and physical fundamentals, the various reactor types, the fuel cycle, and the whole complex of reactor safety and protection of the environment, as this is a major issue in the debate. Finally, the current situation after the Chernobyl accident is analysed in detail, also dealing with the reactions of the general public, politicans, and the power industry.
Fountoulakis, Konstantinos N; Vieta, Eduard; Young, Allan; Yatham, Lakshmi; Grunze, Heinz; Blier, Pierre; Moeller, Hans Jurgen; Kasper, Siegfried
2017-02-01
The current fourth paper on the International College of Neuropsychopharmacology guidelines for the treatment of bipolar disorder reports on the unmet needs that became apparent after an extensive review of the literature and also serves as a conclusion to the project of the International College of Neuropsychopharmacology workgroup. The systematic review of the literature that was performed to develop the International College of Neuropsychopharmacology guidelines for bipolar disorder identified and classified a number of potential shortcomings. Problems identified concerned the reliability and validity of the diagnosis of bipolar disorder and especially of bipolar depression. This, in turn, has profound consequences for early detection and correct treatment of the disorder. Another area that needs improvement is the unsatisfactory efficacy and effectiveness of therapeutic options, especially in special populations such as those with mixed features and rapid cycling course. Gender issues and adherence problems constitute an additional challenge. The literature suggests that while treatment providers are concerned more with treatment-related issues, patients and their caregivers worry more about issues pertaining to the availability of services and care, quality of life, and various types of burden. The workgroup identified additional unmet needs related to the current standard of research in bipolar disorder. These include the fragmentation of bipolar disorder into phases that are handled as being almost absolutely independent from each other, and thus the development of an overall therapeutic strategy on the basis of the existing evidence is very difficult. Trials are not always designed in a way that outcomes cover the most important aspects of bipolar disorder, and often the reporting of the results is biased and unsatisfactory. The data on combination treatments and high dosages are sparse, whereas they are common in real world practice. The workgroup endorses the full release of raw study data to the scientific community, and the development of uniform clinical trial standards (also including more realistic outcomes) and the reporting of results. The 2 large appendices summarize the results of this systematic review with regard to the areas of lack of knowledge where further focused research is necessary. © The Author 2016. Published by Oxford University Press on behalf of CINP.
Energy Technology Data Exchange (ETDEWEB)
1986-01-01
Since 1970 the energy consumption of air-conditioning systems has almost been reduced by half. This has been achieved by means of improved technologies and on the basis of a change in technological awareness. Revised DIN Standards have contributed to this as well. The application of the standards compiled in the DIN pocket book No. 217 'Raumlufttechnik 1' (Air-conditioning Technology 1) will secure the associated systems to actually generate the desired air-conditioning effects. With its major DIN Standards for the calculation and design of air-conditioning systems, this DIN pocket book turns out to be a valuable guide and tool for planners, manufacturers and operators. In addition, its annex supplies substantiated information on the control of HVAC systems (VDI/VDE 3525 BI) and contains the guideline for the acceptance testing of HVAC systems (VDI/2079), the draft for the building inspection guideline on fire protection requirements on ventilation systems, and annotations for air-conditioning installations in public buildings.
DEFF Research Database (Denmark)
Johansen, Sys Stybe; Windberg, Charlotte Norup
2011-01-01
. The sample preparation of whole blood involved protein precipitation by acidic methanol. Urine samples were diluted and evaluated in relation to a control at the cutoff concentration. Hexadeutero GHB (GHB-d(6)) was used as the internal standard. Separation was achieved by reversed-phase chromatography...... to investigations on suspected drug-facilitated sexual assaults, driving under the influence of drugs, and general intoxication with these substances....
Energy Technology Data Exchange (ETDEWEB)
Kaiser, W.; Rogazewski, P.; Schindler, M. [TUeV Anlagentechnik GmbH, Berlin-Schoeneberg (Germany). Unternehmensgruppe TUeV Rheinland/Berlin-Brandenburg; Acikalin, A.; Albrecht, M.; Lambert, M.; Steinbach, J. [Technische Univ. Berlin (Germany)
2000-07-01
At present there are used various procedures, calculation methods, models and model equations for hazardous incident scenarios. The procedure on principle is varying often. This guideline explains in one main part and six appendixes the methodical procedure to select specifications and assumptions on hazardous incident scenarios and their processing. Hazardous incident scenarios lead to information on emergency preparedness planning. Both general viewpoints and possibilities are shown, how to find necessary basic assumptions on a hazardous incident scenario from information on hazardous substances, on comparable hazardous incidents and on conditions of the site and the plant. Appendixes deal with precise instructions distinguished between substance release, explosion and fire (App. 1: Assessment of source terms, App. 2: Assessment of dispersion, App. 3: Assessment of effects). Appendix 4 gives explanations to appendixes 1, 2 and 3. Appendix 5 contains a collection of 15 examples of hazardous incident scenarios, which illustrate and comment the methodical procedure. Appendix 6 describes and comments software available on German market which assists the calculating of hazardous incidents. Volume 2 determines procedures with regard to methods of calculation, current models and model equations from scientists' point of view. (orig.) [German] Derzeit wird eine Vielzahl von Vorgehensweisen, Berechnungsmethoden, Modellen und Modellgleichungen fuer Stoerfallablaufszenarien verwendet. Das prinzipielle Vorgehen ist haeufig unterschiedlich. Dieser Leitfaden enthaelt in einem Hauptteil und sechs Anhaengen das methodische Vorgehen zur Auswahl von Angaben und Annahmen fuer Stoerfallablaufszenarien sowie deren Bearbeitung. Stoerfallablaufszenarien fuehren zu Angaben fuer die Gefahrenabwehrplanung. Fuer das Ableiten von Stoerfallablaufszenarien sind sowohl allgemeine Gesichtspunkte als auch Moeglichkeiten dargelegt, wie man aus Angaben zu Gefahrstoffen, zu vergleichbaren Stoerfaellen sowie zu Bedingungen des Standortes und der Anlage die erforderlichen Grundannahmen zum Stoerfallablauf gewinnen kann. Unterschieden nach Stofffreisetzungen, Explosionen und Braenden wird jeweils auf die konkreteren Hinweise im Anhang 1 zur Abschaetzung von Quelltermen, im Anhang 2 zur Abschaetzung der Ausbreitung und im Anhang 3 zur Abschaetzung der Auswirkungen verwiesen. Der Anhang 4 enthaelt einige Erlaeuterungen zu den Anhaengen 1 bis 3. Mit einer Sammlung von 15 Beispielen fuer Stoerfallablaufszenarien wird im Anhang 5 das im Leitfaden beschriebene methodische Vorgehen veranschaulicht und erlaeutert. Im Anhang 6 werden die auf dem deutschen Markt erhaeltlichen DV-Programme (Software) zur Berechnung von Stoerfallablaufszenarien beschrieben und kommentiert. Der Band 2 untermauert das Vorgehen im Hinblick auf Berechnungsmethoden, aktuelle Modelle und Modellgleichungen aus wissenschaftlicher Sicht. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Brater, M; Hemmer, C; Maurus, A; Munz, C; Schluchter,
1991-06-01
Based on 124 interviews with experts in national, state and communal departments of ecological relevance the tasks and fields of responsibility for ecological experts are examined as far as the field of public administration is concerned. Subsequently; these fields of responsibility are studied as to their specific tasks: air pollution abatement; protection of water, soil and nature; protection against noise and radiation; chemicals; waste management land use and regional planning. Furthermore, these fields of action are subject of research as to their qualificational demands. They are compared to the existing profiles within the educational system. Special consideration is given to the profile of disciplines/subjects like biology, chemistry, geology, geography, mechanical engineering process technology environmental engineering law and administration. Connections are established to the new profiles within ecology and ecological counseling. Center of the question: Vocational work and vocational education - what's their form/organization in order to create forms of ecological progression instead of destruction. (orig.).
Energy Technology Data Exchange (ETDEWEB)
NONE
1999-07-01
This fourth GVC congress again deals with all aspects of industrial and municipal waste water and sludge treatment; the spectrum ranges from unit operations and segmets of the process line over special treatments of problematic constituents, adapted solutions for measuring and control-technical problems to innovative overall concepts and the operating results of executed plants. Novel programme elements are process-integrated measures for water and waste water treatment aiming to minimize the consumption of the water resource and to recycle it. (orig.) [German] Auch dieser 4. GVC-Abwasser-Kongress behandelt die volle Breite der industriellen und kommunalen Abwasser- und Schlammbehandlung; das Spektrum reicht von den unit operations und Prozessstrecken, ueber die spezielle Behandlung von problematischen Inhaltstoffen, ueber adaptierte messtechnische und regelungstechnische Problemloesungen bis hin zu innovativen Gesamtkonzepten und den Betriebsergebnissen von ausgefuehrten Anlagen. Neu im Programm sind die produktionsintegrierten Massnahmen zur Wasser- und Abwasserbehandlung, die darauf abzielen, die Ressource Wasser zu minimieren und zu recyclieren. (orig.)
Directory of Open Access Journals (Sweden)
Tomeu Vidal
2012-03-01
Full Text Available We present a case of citizen participation to design some public spaces in Baró de Viver, a neighbourhood of the city of Barcelona. Our aim is to reflect on the ways to understand citizen participation in political and academic agenda, the role of different actors (citizens, professionals, politicians... and strategies and methods used in participatory urban planning. The experience showed in this paper is located in a scale of urban design very close and well known to the people. We begin with a brief historical overview of the neighborhood where the project arose. Then we give an account of the stages of the participatory process, showing the main milestones, features and methods. Finally we propose some ideas to rethink the conceptual and methodological aspects of the intervention and urban research in environmental psychology and people-environment studies.
Energy Technology Data Exchange (ETDEWEB)
Peters, H.J.
1995-12-31
The present book contains all regulations relevant to EIA in compact form: The EU EIA Directive; the Federal Law on the EIA; the Procedural Rules of Atomic Energy Law; the Ninth Ordinance on the Federal Emissions Control Law including the pertinent general administrative regulation; the Federal Mining Law; the Federal Building Law; the Federal Regional Planning Law; and the EIA laws of the Laender such as implementing regulations, the Land EIA Laws, and the Land Planning Laws. There is a basic introduction to EIA law preceding this collection of regulations and laws. (orig./HP) [Deutsch] Das Buch bietet alle UVP-Vorschriften in kompakter Form, die UVPRL der EU, das UVPG, die Atomrechtliche Verfahrensverordnung (AtVfV) und die 9. BImSchV einschliesslich der entsprechenden Allgemeinen Verwaltungsvorschrift sowie das BBergG, das BauGB, das ROG bis hin zum UVP-Recht der Laender wie DurchfuehrungsVO, LUVPG und Landesplanungsgesetzen. Vorangestellt ist diesen Vorschriften eine grundlegende Einfuehrung in das Recht des UVP. (orig./HP)
Energy Technology Data Exchange (ETDEWEB)
NONE
2001-07-01
The proceedings of the 27th MPA Seminar on 'Safety and Reliability in Energy Technology' were issued in two volumes. The main topics of the second volume are: 1. Material behaviour in the creep regime; 2. Fracture machanics; 3. Reliability analysis and 4. Failure analysis.
Yatham, Lakshmi; Grunze, Heinz; Vieta, Eduard; Young, Allan; Blier, Pierre; Kasper, Siegfried; Moeller, Hans Jurgen
2017-01-01
Abstract Background: The current paper includes a systematic search of the literature, a detailed presentation of the results, and a grading of treatment options in terms of efficacy and tolerability/safety. Material and Methods: The PRISMA method was used in the literature search with the combination of the words ‘bipolar,’ ‘manic,’ ‘mania,’ ‘manic depression,’ and ‘manic depressive’ with ‘randomized,’ and ‘algorithms’ with ‘mania,’ ‘manic,’ ‘bipolar,’ ‘manic-depressive,’ or ‘manic depression.’ Relevant web pages and review articles were also reviewed. Results: The current report is based on the analysis of 57 guideline papers and 531 published papers related to RCTs, reviews, posthoc, or meta-analysis papers to March 25, 2016. The specific treatment options for acute mania, mixed episodes, acute bipolar depression, maintenance phase, psychotic and mixed features, anxiety, and rapid cycling were evaluated with regards to efficacy. Existing treatment guidelines were also reviewed. Finally, Tables reflecting efficacy and recommendation levels were created that led to the development of a precise algorithm that still has to prove its feasibility in everyday clinical practice. Conclusions: A systematic literature search was conducted on the pharmacological treatment of bipolar disorder to identify all relevant random controlled trials pertaining to all aspects of bipolar disorder and graded the data according to a predetermined method to develop a precise treatment algorithm for management of various phases of bipolar disorder. It is important to note that the some of the recommendations in the treatment algorithm were based on the secondary outcome data from posthoc analyses. PMID:27816941
Energy Technology Data Exchange (ETDEWEB)
Gassner, Robert [Institut fuer Zukunftsstudien und Technologiebewertung gGmbH (IZT), Berlin (Germany)
2013-04-15
This project was carried out by a consortium by the Institute for Futures Studies and Technology Assessment (Berlin, Federal Republic of Germany) and German Institute of Urban Affairs (Berlin, Federal Republic of Germany) in the period between December 2009 and November 2012. The project deals with the design of sustainable urban living environments. In a preliminary planning phase, the policy challenges and actors with their interests and future expectations for the project phase have been developed. In the main phase of the project, a systematic, participatory scenario process is used. In this, first normative scenarios for the Sustainable City 2030 Council were developed. From this, options for action, elements of strategy and practical networking approaches for integrated sustainability policies were derived and substantiated with respect to the operational implementation and practical cooperation in the environmental department.
Energy Technology Data Exchange (ETDEWEB)
Verbuecheln, Maic; Grabow, Busso; Uttke, Angela; Schwausch, Mandy [Deutsches Inst. fuer Urbanistik (DiFu), Berlin (Germany); Gassner, Robert [Institut fuer Zukunftsstudien und Technologiebewertung gGmbH (IZT), Berlin (Germany)
2013-04-15
The partial report ''Recycling City 2030'' was prepared for the Federal Environment Agency (Dessau, Federal Republic of Germany) as a part of the project ''Scenarios for an integrated sustainability policy - the example of 'The Sustainable City 2030 '''. This partial report is based on research activities of the German Institute of Urban Affairs (Berlin, Federal Republic of Germany) and Institute for Futures Studies and Technology Assessment (Berlin, Federal Republic of Germany). The objectives of this partial report are: (1) Description of the challenges and trends in urban regions; (2) Recycling city and its importance in the current debate on sustainability; (3) Identification and optimization of existing cycle approaches in urban habitats; (4) Analysis of the actual state as well as designation of developments and constraints; (5) Discussion on the interface between the sectors; (6) Options for action for the interaction between the actors in interdisciplinary topics; (7) Outline of ways and perspectives of the implementation of the ''Recycling City 2030''.
Tesnier, Grégory
2005-01-01
2005 has been delcared "Year of Physics" by UNESCO and ONU to celebrate the 100th anniversary of the theory of relativity, elaborated by Einstein (who lived in Bern). To hon. Einstein, an historical comic strip has been published (1 page)
Energy Technology Data Exchange (ETDEWEB)
Gassner, Robert [Institut fuer Zukunftsstudien und Technologiebewertung gGmbH (IZT), Berlin (Germany)
2013-04-15
On behalf of the German Federal Environment Agency, this project was supposed to enhance the further development of an integrated sustainability policy in Germany. Focus of the project was the design of sustainable urban living environments, as everyday life related views of for example citizens, consumers, employees, traffic participants etc. can serve as a consistency check for an integrated sustainability policy. Political topics and stakeholders within the German environment department and beyond were analyzed in order to enhance an effective integrated sustainability policy and to identify potential synergies. For this as well as for the resolution of possible trade-offs a systematic and empirically based scenario process has been used. In the introductory empirical and planning phase the fundamentals were elaborated: Desk research, interviews and workshops were conducted to identify political topics and strategic fields, which then were checked for trade-offs and potential cooperations. For this first phase of the project stakeholders, as well as their motivations and underlying expectations for the future were identified. In the main phase of the project two complementary topics (''Recycling City'' and ''Sustainable Economy in the City'') were jointly selected and elaborated in two parallel conducted systematic and participatory scenario processes to generate integrated images of the future in 2030. Furthermore, options for action, strategic elements and potentials for networking were derived and concretized with regard to practical cooperation in the German Department of the Environment.
Brain Death in Pediatric Patients in Japan: Diagnosis and Unresolved Issues.
Araki, Takashi; Yokota, Hiroyuki; Fuse, Akira
2016-01-01
Brain death (BD) is a physiological state defined as complete and irreversible loss of brain function. Organ transplantation from a patient with BD is controversial in Japan because there are two classifications of BD: legal BD in which the organs can be donated and general BD in which the organs cannot be donated. The significance of BD in the terminal phase remains in the realm of scientific debate. As indicated by the increasing number of organ transplants from brain-dead donors, certain clinical diagnosis for determining BD in adults is becoming established. However, regardless of whether or not organ transplantation is involved, there are many unresolved issues regarding BD in children. Here, we will discuss the historical background of BD determination in children, pediatric emergencies and BD, and unresolved issues related to pediatric BD.
Bataille, Arnaud; Fong, Jonathan J; Cha, Moonsuk; Wogan, Guinevere O U; Baek, Hae Jun; Lee, Hang; Min, Mi-Sook; Waldman, Bruce
2013-08-01
Population declines and extinctions of amphibians have been attributed to the chytrid fungus Batrachochytrium dendrobatidis (Bd), especially one globally emerging recombinant lineage ('Bd-GPL'). We used PCR assays that target the ribosomal internal transcribed spacer region (ITS) of Bd to determine the prevalence and genetic diversity of Bd in South Korea, where Bd is widely distributed but is not known to cause morbidity or mortality in wild populations. We isolated Korean Bd strains from native amphibians with low infection loads and compared them to known worldwide Bd strains using 19 polymorphic SNP and microsatellite loci. Bd prevalence ranged between 12.5 and 48.0%, in 11 of 17 native Korean species, and 24.7% in the introduced bullfrog Lithobates catesbeianus. Based on ITS sequence variation, 47 of the 50 identified Korean haplotypes formed a group closely associated with a native Brazilian Bd lineage, separated from the Bd-GPL lineage. However, multilocus genotyping of three Korean Bd isolates revealed strong divergence from both Bd-GPL and the native Brazilian Bd lineages. Thus, the ITS region resolves genotypes that diverge from Bd-GPL but otherwise generates ambiguous phylogenies. Our results point to the presence of highly diversified endemic strains of Bd across Asian amphibian species. The rarity of Bd-GPL-associated haplotypes suggests that either this lineage was introduced into Korea only recently or Bd-GPL has been outcompeted by native Bd strains. Our results highlight the need to consider possible complex interactions among native Bd lineages, Bd-GPL and their associated amphibian hosts when assessing the spread and impact of Bd-GPL on worldwide amphibian populations. © 2013 John Wiley & Sons Ltd.
Family Functioning, Social Impairment, and Symptoms Among Adolescents with Bipolar Disorder
Keenan-Miller, Danielle; Peris, Tara; Axelson, David; Kowatch, Robert A.; Miklowitz, David J.
2012-01-01
Objective: Impaired social functioning is common among youth with bipolar disorder (BD), emerges in multiple settings, and persists over time. However, little is known about factors associated with poor peer and family functioning in the early-onset form of BD. Using a sample of adolescents with BD I or II, we examined which symptoms of BD,…
Lifescience Database Archive (English)
Full Text Available of isoprenoid content, compostition and metabolism. 54 0.004 1 BD224357 |BD224357.1 Materials and methods fo...SSA008C03 : 5' end, single read. 50 0.002 2 BD272997 |BD272997.1 Materials and methods for the modification
Udal, Anne H.; Oygarden, Bjorg; Egeland, Jens; Malt, Ulrik F.; Groholt, Berit
2012-01-01
Differentiating between early-onset bipolar disorder (BD) and attention-deficit/hyperactivity disorder (ADHD) can be difficult. Memory problems are commonly reported in BD, and forgetfulness is among the diagnostic criteria for ADHD. We compared children and adolescents with BD (n = 23), ADHD combined type (ADHD-C; n = 26), BD + ADHD-C (n = 15),…
Prokaryotic expression of antimicrobial ovine β- defensin-1 in ...
African Journals Online (AJOL)
AJB_YOMI
2011-09-05
Sep 5, 2011 ... 10213. Table 1. PCR primers for amplification of sBD-1, mature (msBD-1) and .... Antimicrobial properties of recombinant psBD-1 and msBD-1 were .... the structure and function of ovispirin/novispirin antimicrobial peptides.
Comorbid obsessive-compulsive disorder with bipolar disorder: A distinct form?
Ozdemiroglu, Filiz; Sevincok, Levent; Sen, Gulnur; Mersin, Sanem; Kocabas, Oktay; Karakus, Kadir; Vahapoglu, Fatih
2015-12-30
We examined whether the patients with Bipolar Disorder (BD) and Obsessive-Compulsive Disorder (OCD) comorbidity may represent a distinct form of BD. The subjects diagnosed with BD (n=48), OCD (n=61), and BD with OCD (n=32) were compared in terms of several socio-demographic and clinical characteristics. Previous history of suicidal attempts was more likely to be higher in BD-OCD group compared to the other two groups. A more episodic course of OCD, higher rates of rapid cycling, and the seasonality were found in BD-OCD patients. The frequency of bipolar II and NOS subtypes was more prevalent in patients with BD-OCD than in OCD patients. The first diagnosed illness was BD in the majority of BD-OCD cases. It was found that first affective episode was major depression in half of BD-OCD patients. Age at onset of BD was found to be earlier in BD-OCD group compared to pure BD patients. Bipolarity may not have a specific effect on the phenomenology of OC symptoms. The episodic course of OCD, seasonality, rapid cycling, earlier onset of BD, and impulsivity in BD-OCD patients may be indicative for a distinct form of BD. Copyright © 2015 Elsevier Ireland Ltd. All rights reserved.
Lifescience Database Archive (English)
Full Text Available =3 Row=J, DNA sequence. 46 0.68 1 BD265981 |BD265981.1 Schizophrenia associated genes, proteins and bialleli...c markers. 40 0.80 2 BD265980 |BD265980.1 Schizophrenia associated genes, proteins and biallelic markers. 40
de Almeida, Jorge Renner Cardoso; Phillips, Mary Louise
2012-01-01
Differentiating bipolar disorder (BD) from recurrent unipolar depression (UD) is a major clinical challenge. Main reasons for this include the higher prevalence of depressive relative to hypo/manic symptoms during the course of BD illness and the high prevalence of subthreshold manic symptoms in both BD and UD depression. Identifying objective markers of BD might help improve accuracy in differentiating between BD and UD depression, to ultimately optimize clinical and functional outcome for a...
Rivera, César; Monsalve, Francisco; Salas, Juan; Morán, Andrea; Suazo, Iván
2013-12-01
Platelet preparations promote bone regeneration by inducing cell migration, proliferation and differentiation in the area of the injury, which are essential processes for regeneration. In addition, several studies have indicated that simvastatin (SIMV), widely used for the treatment of hypercholesterolemia, stimulates osteogenesis. The objective of this study was to evaluate the effects of treatment with either platelet-rich plasma (PRP) or plasma rich in growth factors (PRGF) in combination with SIMV in the regeneration and repair of alveolar bone. The jaws of Sprague Dawley rats (n=18) were subjected to rotary instrument-induced bone damage (BD). Animals were divided into six groups: BD/H 2 O (n=3), distilled water without the drug and alveolar bone damage; BD/H 2 O/PRP (n=3), BD and PRP; BD/H 2 O/PRGF (n=3), BD and PRGF; BD/SIMV (n=3), BD and water with SIMV; BD/SIMV/PRP (n=3), BD, PRP and SIMV; and BD/SIMV/PRGF (n=3), BD, PRGF and SIMV. Conventional histological analysis (hematoxylin and eosin staining) revealed that the BD/SIMV group showed indicators for mature bone tissue, while the BD/SIMV/PRP and BD/SIMV/PRGF groups showed the coexistence of indicators for mature and immature bone tissue, with no statistical differences between the platelet preparations. Simvastatin did not improve the effect of platelet-rich plasma and plasma rich in growth factors. It was not possible to determine which platelet preparation produced superior effects.
The use of the Clock Drawing Test in bipolar disorder with or without dementia of Alzheimer’s type
Directory of Open Access Journals (Sweden)
Ivan Aprahamian
2014-12-01
Full Text Available There is limited data regarding the cognitive profile from screening tests of older adults with bipolar disorder (BD with dementia. Objective To investigate the Clock Drawing Test (CDT among older adults with BD with and without Alzheimer’s disease (AD. Method 209 older adults (79 with BD without dementia and 70 controls; 60 with AD, being 27 with BD were included to evaluate the performance of three CDT scoring scales, beyond the Mini-Mental State Examination (MMSE and verbal fluency (VFT. Results Patients with BD without dementia presented with lower scores in MMSE, VF and one CDT scoring scale than controls. Patients with BD and AD presented with lower scores in VF and CDT scoring scales than patients with only AD. All CDT scales presented similar sensitivity and specificity for BD and non-BD groups. Conclusion Elderly subjects with BD showed greater impairment in CDT in both groups of normal cognition and AD.
Martínez-Ortega, José M.; Goldstein, Benjamin I.; Gutiérrez-Rojas, Luis; Sala, Regina; Wang, Shuai; Blanco, Carlos
2013-01-01
Bipolar disorder (BD) and nicotine dependence (ND) often co-occur. However, the mechanisms underlying this association remain unclear. We aimed to examine, for the first time in a national and representative sample, the magnitude and direction of the temporal relationship between BD and ND; and to compare, among individuals with lifetime ND and BD, the sociodemographic and clinical characteristics of individuals whose onset of ND preceded the onset of BD (ND-prior) with those whose onset of ND followed the onset of BD (BD-prior). The sample included individuals with lifetime BD type I or ND (n=7958) from the National Epidemiologic Survey on Alcohol and Related Conditions (NESARC, n=43093). Survival analyses and logistic regression models were computed to study the temporal association between ND and BD, and to compare ND-prior (n=135) and BD-prior (n=386) individuals. We found that ND predicted the onset of BD and BD also predicted the onset of ND. Furthermore, the risk of developing one disorder following the other one was greatest early in the course of illness. Most individuals with lifetime ND and BD were BD-prior (72.6%). BD-prior individuals had an earlier onset of BD and a higher number of manic episodes. By contrast, ND-prior individuals had an earlier onset of both daily smoking and ND, and an increased prevalence of alcohol use disorder. In conclusion, ND and BD predict the development of each other. The phenomenology and course of ND and BD varied significantly depending on which disorder had earlier onset. PMID:23582710
Directory of Open Access Journals (Sweden)
Tara Chestnut
Full Text Available Biodiversity losses are occurring worldwide due to a combination of stressors. For example, by one estimate, 40% of amphibian species are vulnerable to extinction, and disease is one threat to amphibian populations. The emerging infectious disease chytridiomycosis, caused by the aquatic fungus Batrachochytrium dendrobatidis (Bd, is a contributor to amphibian declines worldwide. Bd research has focused on the dynamics of the pathogen in its amphibian hosts, with little emphasis on investigating the dynamics of free-living Bd. Therefore, we investigated patterns of Bd occupancy and density in amphibian habitats using occupancy models, powerful tools for estimating site occupancy and detection probability. Occupancy models have been used to investigate diseases where the focus was on pathogen occurrence in the host. We applied occupancy models to investigate free-living Bd in North American surface waters to determine Bd seasonality, relationships between Bd site occupancy and habitat attributes, and probability of detection from water samples as a function of the number of samples, sample volume, and water quality. We also report on the temporal patterns of Bd density from a 4-year case study of a Bd-positive wetland. We provide evidence that Bd occurs in the environment year-round. Bd exhibited temporal and spatial heterogeneity in density, but did not exhibit seasonality in occupancy. Bd was detected in all months, typically at less than 100 zoospores L(-1. The highest density observed was ∼3 million zoospores L(-1. We detected Bd in 47% of sites sampled, but estimated that Bd occupied 61% of sites, highlighting the importance of accounting for imperfect detection. When Bd was present, there was a 95% chance of detecting it with four samples of 600 ml of water or five samples of 60 mL. Our findings provide important baseline information to advance the study of Bd disease ecology, and advance our understanding of amphibian exposure to free
International Nuclear Information System (INIS)
Yanamala, Naveena; Hatfield, Meghan K.; Farcas, Mariana T.; Schwegler-Berry, Diane; Hummer, Jon A.; Shurin, Michael R.; Birch, M. Eileen; Gutkin, Dmitriy W.; Kisin, Elena; Kagan, Valerian E.; Bugarski, Aleksandar D.; Shvedova, Anna A.
2013-01-01
The use of biodiesel (BD) or its blends with petroleum diesel (D) is considered to be a viable approach to reduce occupational and environmental exposures to particulate matter (PM). Due to its lower particulate mass emissions compared to D, use of BD is thought to alleviate adverse health effects. Considering BD fuel is mainly composed of unsaturated fatty acids, we hypothesize that BD exhaust particles could induce pronounced adverse outcomes, due to their ability to readily oxidize. The main objective of this study was to compare the effects of particles generated by engine fueled with neat BD and neat petroleum-based D. Biomarkers of tissue damage and inflammation were significantly elevated in lungs of mice exposed to BD particulates. Additionally, BD particulates caused a significant accumulation of oxidatively modified proteins and an increase in 4-hydroxynonenal. The up-regulation of inflammatory cytokines/chemokines/growth factors was higher in lungs upon BD particulate exposure. Histological evaluation of lung sections indicated presence of lymphocytic infiltrate and impaired clearance with prolonged retention of BD particulate in pigment laden macrophages. Taken together, these results clearly indicate that BD exhaust particles could exert more toxic effects compared to D. - Highlights: • Exposure of mice to BDPM caused higher pulmonary toxicity compared to DPM. • Oxidative stress and inflammation were higher in BD vs to D exposed mice. • Inflammatory lymphocyte infiltrates were seen only in lungs of mice exposed to BD. • Ineffective clearance, prolonged PM retention was present only after BD exposure
McCormack, C; Green, M J; Rowland, J E; Roberts, G; Frankland, A; Hadzi-Pavlovic, D; Joslyn, C; Lau, P; Wright, A; Levy, F; Lenroot, R K; Mitchell, P B
2016-03-01
Impairments in key neuropsychological domains (e.g. working memory, attention) and social cognitive deficits have been implicated as intermediate (endo) phenotypes for bipolar disorder (BD), and should therefore be evident in unaffected relatives. Neurocognitive and social cognitive ability was examined in 99 young people (age range 16-30 years) with a biological parent or sibling diagnosed with the disorder [thus deemed to be at risk (AR) of developing BD], compared with 78 healthy control (HC) subjects, and 52 people with a confirmed diagnosis of BD. Only verbal intelligence and affective response inhibition were significantly impaired in AR relative to HC participants; the BD participants showed significant deficits in attention tasks compared with HCs. Neither AR nor BD patients showed impairments in general intellectual ability, working memory, visuospatial or language ability, relative to HC participants. Analysis of BD-I and BD-II cases separately revealed deficits in attention and immediate memory in BD-I patients (only), relative to HCs. Only the BD (but not AR) participants showed impaired emotion recognition, relative to HCs. Selective cognitive deficits in the capacity to inhibit negative affective information, and general verbal ability may be intermediate markers of risk for BD; however, the extent and severity of impairment in this sample was less pronounced than has been reported in previous studies of older family members and BD cases. These findings highlight distinctions in the cognitive profiles of AR and BD participants, and provide limited support for progressive cognitive decline in association with illness development in BD.
Energy Technology Data Exchange (ETDEWEB)
Yanamala, Naveena, E-mail: wqu1@cdc.gov [Pathology and Physiology Research Branch/NIOSH/CDC, Morgantown, WV 26505 (United States); Hatfield, Meghan K., E-mail: wla4@cdc.gov [Pathology and Physiology Research Branch/NIOSH/CDC, Morgantown, WV 26505 (United States); Farcas, Mariana T., E-mail: woe7@cdc.gov [Pathology and Physiology Research Branch/NIOSH/CDC, Morgantown, WV 26505 (United States); Schwegler-Berry, Diane [Pathology and Physiology Research Branch/NIOSH/CDC, Morgantown, WV 26505 (United States); Hummer, Jon A., E-mail: qzh3@cdc.gov [Office of Mine Safety and Health Research/NIOSH/CDC, Pittsburgh, PA 15236 (United States); Shurin, Michael R., E-mail: shurinmr@upmc.edu [Department of Pathology, University of Pittsburgh Medical Center, Pittsburgh, PA (United States); Birch, M. Eileen, E-mail: mib2@cdc.gov [NIOSH/CDC, 4676 Columbia Parkway, Cincinnati, OH 45226 (United States); Gutkin, Dmitriy W., E-mail: dwgutkin@hotmail.com [Department of Pathology, University of Pittsburgh Medical Center, Pittsburgh, PA (United States); Kisin, Elena, E-mail: edk8@cdc.gov [Pathology and Physiology Research Branch/NIOSH/CDC, Morgantown, WV 26505 (United States); Kagan, Valerian E., E-mail: kagan@pitt.edu [Department of Environmental and Occupational Health, University of Pittsburgh, PA (United States); Bugarski, Aleksandar D., E-mail: zjl1@cdc.gov [Office of Mine Safety and Health Research/NIOSH/CDC, Pittsburgh, PA 15236 (United States); Shvedova, Anna A., E-mail: ats1@cdc.gov [Pathology and Physiology Research Branch/NIOSH/CDC, Morgantown, WV 26505 (United States); Department Physiology and Pharmacology, WVU, Morgantown, WV 26505 (United States)
2013-10-15
The use of biodiesel (BD) or its blends with petroleum diesel (D) is considered to be a viable approach to reduce occupational and environmental exposures to particulate matter (PM). Due to its lower particulate mass emissions compared to D, use of BD is thought to alleviate adverse health effects. Considering BD fuel is mainly composed of unsaturated fatty acids, we hypothesize that BD exhaust particles could induce pronounced adverse outcomes, due to their ability to readily oxidize. The main objective of this study was to compare the effects of particles generated by engine fueled with neat BD and neat petroleum-based D. Biomarkers of tissue damage and inflammation were significantly elevated in lungs of mice exposed to BD particulates. Additionally, BD particulates caused a significant accumulation of oxidatively modified proteins and an increase in 4-hydroxynonenal. The up-regulation of inflammatory cytokines/chemokines/growth factors was higher in lungs upon BD particulate exposure. Histological evaluation of lung sections indicated presence of lymphocytic infiltrate and impaired clearance with prolonged retention of BD particulate in pigment laden macrophages. Taken together, these results clearly indicate that BD exhaust particles could exert more toxic effects compared to D. - Highlights: • Exposure of mice to BDPM caused higher pulmonary toxicity compared to DPM. • Oxidative stress and inflammation were higher in BD vs to D exposed mice. • Inflammatory lymphocyte infiltrates were seen only in lungs of mice exposed to BD. • Ineffective clearance, prolonged PM retention was present only after BD exposure.
The first ICRANet catalog of binary-driven hypernovae
Directory of Open Access Journals (Sweden)
Pisani G. B.
2018-01-01
Thanks to this novel theoretical and observational understanding, it was possible for ICRANet scientists to build the firstst BdHNe catalog, composed by the 345 BdHNe identified up to the end of 2016.
Dicty_cDB: Contig-U06538-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 38 0.090 2 ( DJ207695 ) Method for identification of useful proteins deri... 38 0.090 2 ( BD343987 ) Method of monitoring... gene expression. 38 0.090 2 ( BD341931 ) Method of monitoring gene
Huge femoral artery pseudoaneurysm in a patient with Behçet’s disease
Directory of Open Access Journals (Sweden)
Tarlaan Hasanaghaei
2017-10-01
Conclusion: Arterial pseudoaneurysm is life-threatening in BD and should be kept in mind to prevent major complications. Vascular involvement in BD patients is probably associated with hyperhomocysteinemia.
Takeuchi, Masaru; Karasawa, Yoko; Harimoto, Kohzou; Tanaka, Atsushi; Shibata, Masaki; Sato, Tomohito; Caspi, Rachel R; Ito, Masataka
2017-02-01
To examine antigen-stimulated cytokine production by Behçet disease patients (BD) before and after infliximab infusion. PBMCs were obtained before and after infliximab infusion in BD patients with or without recurrent uveitis during at least 1 year of infliximab therapy, and from healthy subjects. PBMCs were cultured with IRBP, and Th-related cytokines in cultures were measured. Levels of IL-4, IL-6, IL-10 IL-17A, IL-17F, IL-31, IFN-γ, and TNFα were higher in BD before infliximab infusion than in healthy subjects, and these levels were the highest in BD with recurrent uveitis. After infliximab infusion, these cytokine levels were reduced to a greater extent in BD without recurrent uveitis than in BD with recurrence. Th-related cytokines produced by IRBP-stimulated PBMCs were elevated in BD, and infliximab infusion suppressed these cytokines to a greater extent in BD without recurrent uveitis than in those with recurrence.
29 CFR 1910.1051 - 1,3-Butadiene.
2010-07-01
.... I. You should not keep food, beverages, or smoking materials in areas where there is BD exposure... lesions at multiple target sites in mice and rats. A recent study of BD-exposed workers showed that...
The relationship between genetic risk variants with brain structure and function in bipolar disorder
DEFF Research Database (Denmark)
Pereira, Licia P; Köhler, Cristiano A; de Sousa, Rafael T
2017-01-01
Genetic-neuroimaging paradigms could provide insights regarding the pathophysiology of bipolar disorder (BD). Nevertheless, findings have been inconsistent across studies. A systematic review of gene-imaging studies involving individuals with BD was conducted across electronic major databases fro...
Zhang, Liwen; Opmeer, Esther M.; Ruhe, Henricus G.; Aleman, Andre; van der Meer, Lisette
2015-01-01
Objectives: Reflecting on the self and on others activates specific brain areas and contributes to metacognition and social cognition. The aim of the current study is to investigate brain activation during self-and other-reflection in patients with bipolar disorder (BD). In addition, we examined whether potential abnormal brain activation in BD patients could distinguish BD from patients with schizophrenia (SZ). Methods: During functional magnetic resonance imaging (fMRI), 17 BD patients, 17 ...
Platelet Activation after Presyncope by Lower Body Negative Pressure in Humans
2014-12-29
Data acquisition was performed on BD FACS CANTO using FACSDiva software (BD FACSDIVA 6.0 software , BD FACSCanto Flow Cytometry, BD Biosciences, CA... software integrated in SigmaPlot (version 11.0; Systat Software ). The probability of observing chance effects on the dependent variables of interest...FD, Gosselin RC, et al. (2001) Platelet activation and function after trauma. J Trauma 51: 639–647. 11. Libre EP, Cowan DH, Watkins SP Jr, Shulman NR
17 CFR 405.2 - Reports to be made by registered government securities brokers and dealers.
2010-04-01
... government securities broker or dealer shall file Part I of Form BD-Y2K (§ 249.618 of this title) prepared as..., shall file Part II of Form BD-Y2K (§ 249.618 of this title). Part II of Form BD-Y2K shall address each... registered government securities broker or dealer that was not required to file Part II of Form BD-Y2K under...
Corry, Justine; Green, Melissa; Roberts, Gloria; Fullerton, Janice M.; Schofield, Peter R.; Mitchell, Philip B.
2017-01-01
Background Bipolar disorder (BD) and the anxiety disorders are highly comorbid. The present study sought to examine perfectionism and goal attainment values as potential mechanisms of known associations between anxiety, stress and BD symptomatology. Measures of perfectionism and goal attainment values were administered to 269 members of BD pedigrees, alongside measures of anxiety and stress, and BD mood symptoms. Regression analyses were used to determine whether perfectionism and goal attain...
The influence of social support on psychological distress in Canadian adults with bipolar disorder.
Warren, Christie D; Fowler, Ken; Speed, David; Walsh, Anna
2018-05-08
Individuals with bipolar I disorder (BD-I) and bipolar II disorder (BD-II) are at higher risk for experiencing high levels of psychological distress and low levels of social support. The primary objectives of this study were to examine perceived social support and psychological distress among Canadian adults with self-reported BD-I or BD-II as diagnosed by a health professional and explore the relationship between types of social support and psychological distress within this sample. Using a cross-sectional, national datafile, 563 Canadian male and female adults (20-64 years) who reported being diagnosed with BD-I or BD-II were investigated using the Social Provisions Scale (SPS), and the Kessler Psychological Distress Scale (K10). It was observed that while the BD-I or BD-II sample had significantly lower SPS scores and significantly higher K10 scores than the overall Canadian sample, age and support in the form of reassurance of worth and social integration were associated with decreased psychological distress. Further, a diagnosis of BD-I and BD-II was found to moderate the effect of social support on psychological distress. Despite the limitations, which include self-reported diagnosis of BD-I and BD-II and potential exclusion of those who are not diagnosed but have BD-I or BD-II, these findings suggest that reassurance of worth and social integration may act as protective factors for psychological distress among individuals with BD-I or BD-II.
Spatiotemporal pattern of bacillary dysentery in China from 1990 to 2009: what is the driver behind?
Directory of Open Access Journals (Sweden)
Zhiwei Xu
Full Text Available Little is known about the spatiotemporal pattern of bacillary dysentery (BD in China. This study assessed the geographic distribution and seasonality of BD in China over the past two decades.Data on monthly BD cases in 31 provinces of China from January 1990 to December 2009 obtained from Chinese Center for Disease Control and Prevention, and data on demographic and geographic factors, as well as climatic factors, were compiled. The spatial distributions of BD in the four periods across different provinces were mapped, and heat maps were created to present the seasonality of BD by geography. A cosinor function combined with Poisson regression was used to quantify the seasonal parameters of BD, and a regression analysis was conducted to identify the potential drivers of morbidity and seasonality of BD.Although most regions of China have experienced considerable declines in BD morbidity over the past two decades, Beijing and Ningxia still had high BD morbidity in 2009. BD morbidity decreased more slowly in North-west China than other regions. BD in China mainly peaked from July to September, with heterogeneity in peak time between regions. Relative humidity was associated with BD morbidity and peak time, and latitude was the major predictor of BD amplitude.The transmission of BD was heterogeneous in China. Improved sanitation and hygiene in North-west China, and better access to clean water and food in the big floating population in some metropolises could be the focus of future preventive interventions against BD. BD control efforts should put more emphasis on those dry areas in summer.
The nailfold videocapillaroscopy findings of Behçet's syndrome
Directory of Open Access Journals (Sweden)
Sevil Alan
2016-06-01
Conclusion: In this study, the BD group had significantly more capillaroscopic pathological findings than did the healthy control group. However, the detected capillaroscopic pathology rate in BD patients was significantly lower than that of three previously published studies. Further studies are needed to clarify the diagnostic and prognostic value of capillaroscopy in BD.
Maldi-Tof /Tof-MS Reveals Elevated Serum Haptoglobin and Amyloid A in Behcet's Disease
Mao, L.; Dong, H.; Yang, P.; Zhou, H.; Huang, X.; Lin, X.; Kijlstra, A.
2008-01-01
Behcet¿s disease (BD) is a multisystemic autoimmune disease with unclear etiology and pathogenesis. To screen aberrant serum proteins in BD, serum samples were obtained from eight male BD patients with active uveitis and eight male healthy volunteers with informed consent. The serum samples from
Olsavsky, Aviva K.; Brotman, Melissa A.; Rutenberg, Julia G.; Muhrer, Eli J.; Deveney, Christen M.; Fromm, Stephen J.; Towbin, Kenneth; Pine, Daniel S.; Leibenluft, Ellen
2012-01-01
Objective: Youth at familial risk for bipolar disorder (BD) show deficits in face emotion processing, but the neural correlates of these deficits have not been examined. This preliminary study tests the hypothesis that, relative to healthy comparison (HC) subjects, both BD subjects and youth at risk for BD (i.e., those with a first-degree BD…
Distinct and Shared Endophenotypes of Neural Substrates in Bipolar and Major Depressive Disorders.
Directory of Open Access Journals (Sweden)
Toshio Matsubara
Full Text Available Little is known about disorder-specific biomarkers of bipolar disorder (BD and major depressive disorder (MDD. Our aim was to determine a neural substrate that could be used to distinguish BD from MDD. Our study included a BD group (10 patients with BD, 10 first-degree relatives (FDRs of individuals with BD, MDD group (17 patients with MDD, 17 FDRs of individuals with MDD, and 27 healthy individuals. Structural and functional brain abnormalities were evaluated by voxel-based morphometry and a trail making test (TMT, respectively. The BD group showed a significant main effect of diagnosis in the gray matter (GM volume of the anterior cingulate cortex (ACC; p = 0.01 and left insula (p < 0.01. FDRs of individuals with BD showed significantly smaller left ACC GM volume than healthy subjects (p < 0.01, and patients with BD showed significantly smaller ACC (p < 0.01 and left insular GM volume (p < 0.01 than healthy subjects. The MDD group showed a tendency toward a main effect of diagnosis in the right and left insular GM volume. The BD group showed a significantly inverse correlation between the left insular GM volume and TMT-A scores (p < 0.05. Our results suggest that the ACC volume could be a distinct endophenotype of BD, while the insular volume could be a shared BD and MDD endophenotype. Moreover, the insula could be associated with cognitive decline and poor outcome in BD.
DEFF Research Database (Denmark)
Tesli, Martin; Koefoed, Pernille; Athanasiu, Lavinia
2011-01-01
Genetic variants in ankyrin 3 (ANK3) have recently been shown to be associated with bipolar disorder (BD). We genotyped three ANK3 SNPs previously found to be associated with BD (rs10994336, rs1938526, and rs9804190) in a Scandinavian BD case–control sample (N¿=¿854/2,614). Due to evidence...
Weissman, Adam S.; Bates, Marsha E.
2010-01-01
Bipolar (BD) symptomatology is prevalent in children with autism spectrum disorders (ASD) and may lead to increased impairment. The current study compared clinical and neurocognitive impairment in children (7-13 years) diagnosed with ASD (n=55), BD (n=34), ASD + BD (n=23), and a non-clinical control group (n=27). Relative to the ASD group, the ASD…
Hoeger, Simone; Reisenbuechler, Anke; Gottmann, Uwe; Doyon, Fabian; Braun, Claude; Kaya, Ziya; Seelen, Marc A.; van Son, Willem J.; Waldherr, Ruediger; Schnuelle, Peter; Yard, Benito A.
Brain death (BD) is associated with tissue inflammation. As dopamine treatment of BD donor rats reduces renal monocyte infiltration, we tested if this treatment affects renal function and inflammation in recipients. BD was induced in F344 rats and was maintained for 6 h in all experiments. Dopamine
Original Research Original Research
African Journals Online (AJOL)
User
Organics must form an indispensable component o any crop. The present study was designed to stud. (BD) compost on biochemical parameters of soya be and 75th day after sowing. The protein content was m of BD compost) on 30th, 45th, 60th and 75 found to be maximum in T1 (3.5 kg of BD compost) day.
A rare case of juvenile-onset Behçet's disease: Fournier's gangrene ...
African Journals Online (AJOL)
Behçet's disease (BD) is a multisystemic, inflammatory disease with still unknown etiology and rarely seen in childhood. BD has worse prognosis in young, male patients. BD exacerbations may be triggered by viral, bacterial, and other undefined antigenic stimuli in genetically predisposed individuals. Fournier's gangrene ...
Rita Historical Page - Office of Satellite and Product Operations
Advisory Archive. Floater Imagery September 24/0015Z to 24/1345Z: Image: AVN | BD | FT | IR | IR2 | JSL | RB | RGB | VIS | WV Image (w/ Latitude & Longitude): AVN | BD | FT | IR | IR2 | JSL | RB | RGB | VIS | WV Loop: AVN | BD | FT | IR | IR2 | JSL | RB | RGB | VIS | WV Gulf Of Mexico Imagery September
Wilma Historical Page - Office of Satellite and Product Operations
Report and Advisory Archive. Floater Imagery October 24/0715Z to 24/1415Z: Image: AVN | BD | FT | IR | IR2 | JSL | RB | RGB | VIS | WV Image (w/ Latitude & Longitude): AVN | BD | FT | IR | IR2 | JSL | RB | RGB | VIS | WV Loop: AVN | BD | FT | IR | IR2 | JSL | RB | RGB | VIS | WV Gulf Of Mexico Imagery
Jongbloed, A.W.; Maiorano, R.; Wagenaars, C.
2007-01-01
A challenge experiment was carried out which comprised six treatment groups each consisting of 12 individually housed piglets. Each group received one of the following pelleted diets: 1) Basal Diet (BD; Negative control); 2) BD + Yeast product (Positive control, 2.5 g/kg diet); 3) BD + Product SW 7
Energy Technology Data Exchange (ETDEWEB)
NONE
1999-08-01
The first volume is dedicated to the safety and reliability of plant technology with special emphasis on the integrity and life management. The main topic in the volume is the contribution of nondestructive testing to the reactor safety from an international point of view. All 20 papers are separately analyzed for this database. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Bandholtz, T.
2003-05-01
Encouraged by the success of the thesaurus-based automatic indexing of environmental information provided by the German Environmental Information Network (gein {sup trademark}, http://www.gein.de), the terminology collections of gein {sup trademark} have been integrated and cross-networked in a comprehensive Topic Map. On this base, the text analysis module could be considerably enhanced. Any access to the terminology and its methods has been provided by means of Web Services. gein {sup trademark} (starting with version 2003) incorporates these Web Services in the productive installation. Besides that, SNS provides basic functionality for terminology editors. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Mannhardt, K H
1981-01-01
This technical dictionary, compiled in everyday practice, gives an outline of the terminology and phraseology of a modern field of engineering. Users should have some basic knowledge of the Spanish language and also of engineering as well as access to standard-language dictionaries. Core subjects of the dictionary are nuclear power, reactor engineering, fusion technology, solar energy, wind energy, tidal energy, radiation protection, nuclear safety, coal gasification and coal liquefaction, cooperative agreements and managerial problems.
Energy Technology Data Exchange (ETDEWEB)
Mannhardt, K H
1981-01-01
This technical dictionary, compiled in everyday practice, gives an outline of the terminology and phraseology of a modern field of engineering. Users should have some basic knowledge of the French language and also of engineering as well as access to standard-language dictionaries. Core subjects of the dictionary are nuclear power, reactor engineering, fusion technology, solar energy, wind energy, tidal energy, radiation protection, nuclear safety, coal gasification and coal liquefaction, cooperative agreements and managerial problems.
Energy Technology Data Exchange (ETDEWEB)
1977-01-01
In map No. III of the atlas on the develpment of Rhenish coal mining, the ownership in brown coal deposits and planning, resettlement, ground water and an area balance are presented. Map No. IV discusses coal economy, rock economy, energy economy, structure and development. Details are described in the text.
Energy Technology Data Exchange (ETDEWEB)
Rentz, O; Schleef, H J; Dorn, R; Sasse, H; Karl, U
1997-05-01
The first volume of the report covers the state of implementation of primary and secondary measures for SO{sub 2}- and NO{sub x} control applied in the most important industrial sectors in Germany. Integrated pollution abatement techniques, called primary measures in this report, such as process integrated measures and low emission processes, have gained increased importance in recent years. The end-of-pipe processes, described here as secondary measures, are generally highly effective. They represent mature technologies, which are capable of achieving significant reductions in SO{sub 2}- and NO{sub x} emissions, and which have been used in particular for retrofitting existing plants. At first, an overview is given regarding the development of SO{sub 2}- and NO{sub x} emissions in selected European countries during the last 20 years and in Europe. Current national and European emission limits and emission guidelines on SO{sub 2}- and NO{sub x} emissions from stationary sources are discussed as well. The state of implementation of measures for the reduction of SO{sub 2}- and NO{sub x} emissions is analysed for each relevant industrial sector and primary emission reduction options are described. Special units designede for direct contact of flame and process materials are dealt with in the different sector descriptions, while external combustion processes providing process heat and power are dealt with in a separate chapter. In the final section an overview of secondary emission reduction measures covering SO{sub 2}- and NO{sub x} control technology is given. For the various sectors, examples of investments and costs for installed emission reduction measures are given, which have to be considered as highly case specific. In addition, the suppliers of the various control technologies have given specific aspects related to specific process layout of their systems as well as references. (orig.) [Deutsch] Der erste Band des Berichts beschreibt den Anwendungsstand von Primaer- und Sekundaermassnahmen in den emissionsrelevanten Industriesektoren fuer SO{sub 2}- und NO{sub x} in Deutschland. Der Bericht gibt einen Ueberblick ueber die Entwicklung der SO{sub 2}- und NO{sub x}-Emissionen in ausgewaehlten europaeischen Laendern waehrend der letzten 20 Jahre und in Europa. Daran schliessen sich aktuelle nationale und europaeische Grenzwerte und Richtlinien zu der SO{sub 2}- und NO{sub x} Emissionen aus stationaeren Quellen an. Der Anwendungsstand von Massnahmen zur Minderung der SO{sub 2}- und NO{sub x}-Emissionen wird fuer jeden relevanten Industriesektor untersucht und primaere Minderungsoptionen beschrieben. Spezielle Prozesseinheiten mit direktem Kontakt von Flamme und Prozessgut werden in den einzelnen Prozessen diskutiert, waehrend externe Verbrennungsprozesse zur ausschliesslichen Bereitstellung von Prozesswaerme und elektrischer Energie sektoruebergreifend in einem separaten Kapitel behandelt werden. Der Bericht schliesst mit einem Ueberblick ueber die zur Verfuegung stehenden sekundaeren Minderungsmassnahmen. Fuer die einzelnen Sektoren werden Beispiele fuer Investitionen und Kosten fuer installierte Minderungstechnologien gegeben, die als einzelfallabhaengig anzusehen sind. Zusaetzlich stellten die Anbieter von Emissionsminderungstechnologien Verfahrensbeschreibungen ihrer Produkte einschliesslich Referenzen zur Verfuegung, die im Bericht enthalten sind. (orig.)
Energy Technology Data Exchange (ETDEWEB)
1987-03-01
The Enquete Commission submits volumes in which part of its previous uncompleted stages of work, experience gained and knowledge regarding the procedure of estimating and assessing technical consequences and the problems examined is documented. Volume 2 documents the following events of the Enquete Commission: Public hearing on the subject of 'Human creativity and artificial intelligence'; symposium on the subject of 'Parliament and the challenge from technology'; colloquium on 'Legal aspects of estimating technical consequences'; and the working paper prepared for this. The latter represents a working up of this group of subjects, which will be of great importance for the work of future parliamentary estimates and assessments of technical consequences. (orig./HSCH).
Energy Technology Data Exchange (ETDEWEB)
NONE
1998-11-01
This book is dedicated to the components of nuclear and conventional power plants with special emphasis on the behaviour of pressurized components and systems. The following topics are discussed: 1. integrity of pipes, vessels, and components and 2. fracture mechanics
Energy Technology Data Exchange (ETDEWEB)
1999-09-01
The second volume is dedicated to the safety and reliability of plant technology with special emphasis on the integrity and life management. The following topics are discussed: 1. Integrity of vessels, pipes and components. 2. Fracture mechanics. 3. Measures for the extension of service life, and 4. Online Monitoring. All 30 contributions are separately analyzed for this database. (orig.)
Energy Technology Data Exchange (ETDEWEB)
NONE
1998-11-01
This book is dedicated to the components of nuclear and conventional power plants with special emphasis on the behaviour of pressurized components and systems. The following topics are discussed: 1. structure and safety analysis, 2. aging phenomena, 3. nondestructive testing, and 4. optimization of in-service inspection.
Energy Technology Data Exchange (ETDEWEB)
Kemski, J.; Klingel, R.; Siehl, A.; Neznal, M.; Matolin, M.
2012-03-15
The final report on report on ground air radon measurements includes the following chapters: Scope of the research program; Concept of the research project; Development of a passive method for ground air measurement; Sampling and measuring methods; Measured areas; Field measurements; results of geophysical investigations: Castle Lede, Messdorfer Field; Lounovice; Procedural method; Results of ground air radon concentration measurements, meteorological and geophysical parameters; Evaluation, discussion and conclusions.
International Nuclear Information System (INIS)
Rospabe, G.
2008-11-01
LHCb has been designed in order to perform precise measurements of CP violation and rare decays with B mesons. At the LHC start-up, one of the first tasks will be to check the expected apparatus performances. This thesis looks to the first recorded data by the LHCb experiment for two of the subjects developed: the photon reconstruction in the electromagnetic calorimeter assuming different experimental situations, and the calibration of the calorimeter. A photon identification tool is developed based on a Fisher discriminant method using informations from all the calorimeter sub-detectors (SPD, PS, ECAL, HCAL). The reconstructed photons are used for π 0 mass reconstruction parameters, able to evaluate the overall calibration level. For individual cell calibration, the constraint from the reconstructed π 0 mass is used. A 1% calibration can be achieved even starting from a 30% spread cell to cell calibration within a few tenth hours at the LHCb nominal luminosity. Two physics channels, for which the calorimeter calibration and neutral mesons decaying into photon pair reconstruction are key points, are studied. The channel B d 0 →p J/ψπ to measure β angle, where unexpected contributions beyond the standard model may occur. The channel B s 0 → J/ψη measures the χ angle. (author)
Energy Technology Data Exchange (ETDEWEB)
NONE
1998-11-01
The book contains the lecture series given within the framework of the 7th Economy Forum ``Economy, science and environment``, organized jointly by the Zentralstelle fuer Forschungs- und Entwicklungstransfer und Wissenschaftliche Weiterbildung (FET and WW) of Essen University and the chamber of industry and trade for Essen, Muelheim/Ruhr and Oberhausen in Essen. The lectures were delivered at the following events at the Essen University: `Sustainability and social benefits of the planning of green areas and landscapes versus their curtailment` (5 June 1997); and `Lifestyles as a challenge to and an opportunity for economy` (13 November 1997). (orig.) [Deutsch] Der Bericht gibt die Vortraege der Veranstaltungsreihe Wirtschaftsforum VII `Wirtschaft, Wissenschaft und Umwelt` wieder, veranstaltet von der FET and WW Zentralstelle fuer Forschungs- und Entwicklungstransfer und Wissenschaftliche Weiterbildung der Universitaet-GH Essen in Zusammenarbeit mit der Industrie- und Handelskammer fuer Essen, Muelheim an der Ruhr, Oberhausen zu Essen. Die Vortraege sind auf folgenden Veranstaltungen an der Universitaet-GH Essen gehalten worden:`Nachhaltigkeit und gesellschaftlicher Nutzen von Gruenordnungsplanung und Landschaftsplanung kontra Reduktion` am 5. Juni 1997 und `Lebensstile als Herausforderung und Chance fuer die Wirtschaft` am 13. November 1997. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Boede, U; Gruber, E [Fraunhofer-Institut fuer Systemtechnik und Innovationsforschung (ISI), Karlsruhe (Germany); Deutscher, P; Elsberger, M; Rouvel, L [Technische Univ., Muenchen (Germany). Lehrstuhl fuer Energiewirtschaft und Innovationsforschung; Brakhage, A; Jaekel, M [Abacus, Trier (Germany); Renner, G [Innovative Energieberatung, Koeln (Germany); Brohmann, B; Cames, M; Herold, A
2000-08-01
The aim of the project was to identify areas in households and the tertiary sector in which changes in behaviour could result in energy conservation and thus a reduction of greenhouse gas emissions, and to quantify the potentials for 1995, 2005 and 2020. A second focus was on the analysis and evaluation of programmes and instruments to realise the potentials. With literature evaluation, expert interviews, and a household servey potentials and further technical development have been identified. In sum, behavioural measures can contribute to the CO2 reduction by 64 million tons in 1995 in households and 27 in the commercial sector in which the potential decreases to 18 million tons in 2020 due to the autonomous technical development. Adequate promotion programmes can help to realise 20-30% of the potential by 2020. (orig.) [German] Ziel des Vorhabens war, im Sektor private Haushalte und Kleinverbrauch Bereiche zu identifizieren, in denen Verhaltensaenderungen zur Energieeinsparung fuehren koennen, und diese Potenziale fuer 1995, 2005 und 2020 zu quantifizieren. Darauf aufbauend waren Programme und Instrumente zur Umsetzung aufzuzeigen und zu bewerten. Gestuetzt auf Literaturrecherchen und Expertengespraeche wurden Einzelpotenziale, Rahmenbedingungen, Entwicklungstrends in der Technik und im Ausstattungsgrad ermittelt. Insgesamt koennten Verhaltensmassnahmen im Haushaltssektor die CO2-Emissionen im Basisjahr 1995 um 64 Mio, im Kleinverbrauch um 27 Mio t vermindern. Bis 2020 bleibt dieses Potenzial im Haushaltssektor in etwa gleich. Im Kleinverbrauch sinkt es infolge der autonomen Technikentwicklung auf 18 Mio t ab. Durch geeignete Programme koennen bis 2020 etwa 20-30% des Potenzials erreicht werden. (orig.)
DEFF Research Database (Denmark)
Sydenham, Thomas Vognbjerg; Bek-Thomsen, Malene; Andersen, Signe Dalsgaard
2018-01-01
laboratory technician "hands on" time but also the laboratory turnaround time is of interest. OBJECTIVES: We evaluated the performance of the VIASURE Flu A, B & RSV Real Time RT-PCR Detection Kit (CerTest Biotec) for detecting Influenza A and B viruses. STUDY DESIGN: During the 2016/17 influenza season 532...
Luts-Sootak, Marju, 1966-
2011-01-01
Arvustus: Dimitri Steinke. Die Zivilrechtsordnungen des Baltikums unter dem Einfluss ausländischer, insbesondere deutscher Rechtsquellen. (Osnabrücker Schriften zur Rechtsgeschichte ; 16). Göttingen, 2009
Energy Technology Data Exchange (ETDEWEB)
Stroh, K.; Behling, G.; Koller, U.; Lattner, A. (comps.)
2001-09-01
Apart from waste, exhaust and waste heat, also products should be regarded as 'emissions' of the production process, as the environment is burdened both by their use and disposal. An integrated product policy involves optimization of products through their whole product life and the cooperation of all parties involved (politics, industry, trade, consumers, waste managers). Competent experts from all groups discussed this problem in scientific and practical lectures, which are contained in this proceedings volume. [German] Heute geraten neben den Abfaellen, Abgasen oder Abwaessern auch die Produkte als groesste ''Emission'' aus dem Produktionsprozess ins Blickfeld der Umweltpolitik. Besonders in der Phase der Produktnutzung und -entsorgung entstehen bedeutende Umweltbelastungen. Daher ist es das Ziel einer integrierten Produktpolitik, die Produkte bereits bei der Neuentwicklung fuer ihren gesamten Lebenzyklus, also ''von der Wiege bis zur Bahre'', in ihren Umweltauswirkungen zu optimieren. In diesen Prozess sollen alle Beteiligten (Politik, Wirtschaft, Handel, Verbraucher, Entsorger) eingebunden werden. Ueber dieses breite Thema informierten kompetente Referenten aus den relevanten Akteursgruppen. Neben wissenschaftlichen Vortraegen wurden vor allem anhand zahlreicher Beispiele aus der Praxis der Schwierigkeiten und Chancen von umweltfreundlichen Produktneuentwicklungen diskutiert. Im vorliegenden Seminarband sind die Vortraege schriftlich wiedergegeben. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Heinisch, E.; Kettrup, A.; Bergheim, W.; Wenzel, S.
2003-07-01
Evaluating the analytical data of DDT and its metabolites, the isomers of HCH as well as (sometimes) of aldrin and dieldrin in surface water, suspended matter, eels, breams and roaches from the rivers Rhine, Neckar, Kocher, Enz, Main (upto km 360), Weschnitz, Modau, Schwarzbach, Hengstbach, Grundbach, Nidda, Rodau, Kinzig, Werra, Diemel, Lahn, Nahe, Mosel, Sauer, Saar, Ahr, Kyll, Sieg and Laacher See distance profiles (partly from Konstanz till Markermeer) and time series (partly from 1984-2001) were elaborated. The primary data come from about 15 mainly regional investigation departments, the IKSR and the Environmental Specimen Bank. The chemical enterprises in Rheinfelden, Grenzach, Ludwigshafen, Lampertheim, Gernsheim, Darmstadt, Hoechst, Kelsterbach, Offenbach, Ingelheim, Loelsdorf, Leverkusen, Elberfeld, Krefeld-Uerdingen and Huels could partly be made transparent by the course of the sDDT and sHCH values and the profiles of the constituents and isomers, resp., in the distance profiles (especially from the river Rhine) mainly from 1990/92. The corresponding graph for the year 2000 shows that there is no longer a human and ecotoxicological relevance of the compounds to be expected. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Grabow, Busso; Hollbach-Groemig, Beate; Groepler, Nicolai; Rechenberg, Christoph [Deutsches Inst. fuer Urbanistik (DiFu), Berlin (Germany); Gassner, Robert [Institut fuer Zukunftsstudien und Technologiebewertung gGmbH (IZT), Berlin (Germany)
2013-04-15
The partial report,Sustainability economic activity in the City 2030' was performed as a part of a project of the Federal Environment Agency (Dessau-Rosslau, Federal Republic of Germany) entitled 'Scenarios for an integrated sustainability policy - exemplified by using,Sustainable City 2030''. The objectives of this partial report are: (a) Presentation of the topic and its importance in the current debate on sustainability; (b) Answering the questions: What are the interfaces to the municipal level? What is about the capability of acting at the municipal level? Which framework conditions are necessary on the part of the Federal Government and the State Governments?; (c) Rough outline of the current situation; (d) Outlining the opportunities and perspectives up to the implementation of the sustainable economic activity.
Energy Technology Data Exchange (ETDEWEB)
Gassner, Robert [Institut fuer Zukunftsstudien und Technologiebewertung gGmbH (IZT), Berlin (Germany)
2013-04-15
This project was carried out by a consortium by the Institute for Futures Studies and Technology Assessment (Berlin, Federal Republic of Germany) and German Institute of Urban Affairs (Berlin, Federal Republic of Germany) in the period between December 2009 and November 2012. The project deals with the design of sustainable urban living environments. In a preliminary planning phase, the policy challenges and actors with their interests and future expectations for the project phase have been developed. In the main phase of the project, a systematic, participatory scenario process is used. In this, first normative scenarios for the Sustainable City 2030 Council were developed. From this, options for action, elements of strategy and practical networking approaches for integrated sustainability policies were derived and substantiated with respect to the operational implementation and practical cooperation in the environmental department.
Energy Technology Data Exchange (ETDEWEB)
Verbuecheln, Maic; Grabow, Busso; Uttke, Angela; Schwausch, Mandy [Deutsches Inst. fuer Urbanistik (DiFu), Berlin (Germany); Gassner, Robert [Institut fuer Zukunftsstudien und Technologiebewertung gGmbH (IZT), Berlin (Germany)
2013-04-15
The partial report ''Recycling City 2030'' was prepared for the Federal Environment Agency (Dessau, Federal Republic of Germany) as a part of the project ''Scenarios for an integrated sustainability policy - the example of 'The Sustainable City 2030 '''. This partial report is based on research activities of the German Institute of Urban Affairs (Berlin, Federal Republic of Germany) and Institute for Futures Studies and Technology Assessment (Berlin, Federal Republic of Germany). The objectives of this partial report are: (1) Description of the challenges and trends in urban regions; (2) Recycling city and its importance in the current debate on sustainability; (3) Identification and optimization of existing cycle approaches in urban habitats; (4) Analysis of the actual state as well as designation of developments and constraints; (5) Discussion on the interface between the sectors; (6) Options for action for the interaction between the actors in interdisciplinary topics; (7) Outline of ways and perspectives of the implementation of the ''Recycling City 2030''.
Energy Technology Data Exchange (ETDEWEB)
Heinisch, E.; Kettrup, A.; Gebefuegi, I.; Martens, D.; Bergheim, W.; Wenzel, S.
2001-07-01
Evaluating the primary data from ARGE ELBE, LAU Halle/Saale and the Environmental Specimen Banking (Umweltprobenbank) as well from publications from the Czech Republic (CHMU) the concentrations of the following low volatile chlorinated hydrocarbons were established for surface water, sediment, breams and eels from the rivers Elbe, Schwarze Elster, Mulde and Saale partly from 1989 till 1999: DDT and its metabolites DDE and DDD, partly as 2,4'- and 4,4' isomers; HCH ({alpha}-, {beta}-, {gamma}- and {delta} isomers); chlorinated benzenes with 1-6 Cl atoms and octachlorostyrene. The data evaluated were drawn up into tables - comprehensive in a separate supplement, in short versions within the text - and consolidated into graphs. Aim of the paper was a cause-oriented monitoring. The by far most important emission sources, found from the distance and time profiles as well as from special assessments of the substance patterns, were chemical plants. (orig.) [German] Durch Auswertung von Primaerdaten der ARGE ELBE, des LAU Halle/Saale und der Umweltprobenbank sowie von Publikationen aus Tschechien (CHMU) wurden fuer Oberflaechenwasser, Sediment, Brassen/Bleien und Aale aus der Elbe, Schwarzen Elster, Mulde und Saale fuer die Jahre von z.T. 1989 bis 1999 die Konzentrationen der folgenden schwerfluechtigen Kohlenwasserstoffe (SCKW) ermittelt: DDT und seine Metabolite DDE und DDD, z.T. als 2,4'- und 4,4'-Isomere; HCH ({alpha}-, {beta}-, {gamma}- und {delta}-Isomere); chlorierte Benzole mit 1-6 Cl-Atomen und Octachlorstyrol. Die ausgewerteten Daten wurden zu Tabellen - ausfuehrlich in einem gesonderten Tabellenanhang und verkuerzt im Textteil - zusammengestellt sowie zu Grafiken verdichtet. Ziel der Arbeit war ein ursachenorientiertes Monitoring. Als mit Abstand wesentlichste Emissionsquellen konnten anhand von Streckenprofilen und Zeitrastern sowie durch spezielle Auswertungen der Stoffmusterverteilungen Chemibetriebe ermittelt werden. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Hoetzl, H. [ed.] [Karlsruhe Univ. (T.H.) (Germany). Lehrstuhl fuer Angewandte Geologie; Reichert, B. [ed.] [Karlsruhe Univ. (T.H.) (Germany). Lehrstuhl fuer Angewandte Geologie
1996-12-31
The present volume deals with studies performed in the experimental area of `Boeckinger Wiesen` and the results obtained there. The purpose of the research project was to examine the behaviour of different pollutant groups along the course of a natural bank filtration stretch given comparable conditions. Particular consideration was given to the adsorption and remobilisation of pollutants as a function of soil composition and medial factors. The aim was to elaborate quantitative parameters for describing the kinetics of chemical and biogeochemical processes. Organic and inorganic pollutants as well as microbial components were included in the study for comparison. In addition, various isotopes and environmentally consequential chemicals were studied to facilitate a quantification of degradation mechanisms, transport processes, and retention times relating to bank filtration. In order to determine the dispersion behaviour of pollutants along the course of a natural bank filtration stretch it proved necessary to consider changing exfiltration and infiltration conditions. (orig./SR) [Deutsch] Der vorliegende Band befasst sich mit Untersuchungen und Ergebnissen des Versuchsgebietes `Boeckinger Wiesen`. Mit dem Forschungsvorhaben wurde das Verhalten verschiedener Schadstoffgruppen entlang einer natuerlichen Uferfiltratstrecke unter vergleichbaren Voraussetzungen untersucht. Besondere Aufmerksamkeit wurde der Adsorption und Remobilisierung der Schadstoffe in Abhaengigkeit von Bodenaufbau und Milieufaktoren gewidmet. Angestrebt wurde die Erarbeitung von quantitativen Parametern, und die Kinetik der chemischen und biogeochemischen Vorgaenge zu beschreiben. In die Vergleichsuntersuchungen einbezogen wurden sowohl organische und anorganische Schadstoffe als auch mikrobielle Komponenten. Hinzugezogen wurden verschiedene Isotopen und Umweltchemikalien, um die Abbaumechanismen, Transportvorgaenge und Verweilzeiten bei der Uferfiltration zu quantifizieren. Fuer die Erfassung des Ausbreitungsverhaltens von Schadstoffen entlang einer natuerlichen Uferfiltratstrecke war es notwendig, wechselnde Ex- und Infiltrationsbedingungen zu untersuchen. (orig./SR)
Energy Technology Data Exchange (ETDEWEB)
Jobmann, M.; Fischer, S.; Voet, M.
2000-01-01
Fiber optic sensors have been developed or further developed, for specific tasks of the research project reported, as for instance detecting and signalling changes of geophysical or geochemical parameters in underground waste storage sites which are of relevance to operating safety. Such changes include e.g. materials dislocations, extensions, temperatures, humidity, pH value and presence of gaseous carbon dioxide and hydrogen. The measuring principle chosen is the fiber Bragg Grating method, as a particularly versatile method easy to integrate into fiber optic networks. After development and successful lab-scale testing of all sensors, except for the gas sensors, field test systems have been made for underground applications and have been tested in situ in the experimental Konrad mine of DBE. Most of the problems discovered with these tests could be resolved wihtin the given project period, so that finally field-test proven sensing systems are available for further activities. The report explains the system performance with a concrete example which shows inter alia beneficial aspects of the system with respect to on-site operation, and the potentials offered in establishing more direct connections between numerical safety analyses and measured results. (orig./CB) [German] Im Rahmen dieses Forschungsprojektes wurden faseroptische Sensoren entwickelt bzw. weiterentwickelt, die in der Lage sind, Veraenderungen relevanter geophysikalischer und geochemischer Groessen im Bereich der Grubenraeume zu signalisieren, die zu einer Gefaehrdung der Betriebssicherheit fuehren koennten. Im einzelnen sind dies Verschiebungen, Dehnungen, Temperatur, Feuchtigkeit, pH-Werte und Gasgehalte an Kohlendioxid und Wasserstoff. Als Messprinzip wurde aus den moeglichen optischen Verfahren das 'Bragg-Gitter' Prinzip zur Entwicklung gewaehlt, da es besonders vielseitig ist und sich gut in groessere optische Netzwerke integrieren laesst. Nach Entwicklung und erfolgreichem Test der Sensoren im Labor wurden, mit Ausnahme der Gas-Sensoren, Testsysteme fuer einen untertaegigen Einsatz gefertigt und in der Schachtanlage Konrad der DBE in-situ getestet. Die im Rahmen dieser in-situ Tests aufgetretenen Probleme konnten zum groessten Teil noch innerhalb der Projektlaufzeit geloest werden, so dass am Ende Messsysteme zur Verfuegung stehen, die ihre Funktionalitaet unter in-situ Bedingungen bewiesen haben. Eine Anwendungsmoeglichkeit im Rahmen einer Endlagerueberwachung wird fuer ein vorgegebenes Grubengebaeude aufgezeigt, die neben betrieblichen Vorteilen auch eine engere Verknuepfung zwischen numerischen Sicherheitsanalysen und messtechnischer Beobachtung ermoeglicht. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Appenzeller, Immo; Dubbers, Dirk; Siebig, Hans-Georg; Winnacker, Albrecht (eds.)
2018-04-01
The following topics are dealt with: 50 years theoretical astrophysics, nuclear physics after the discovery of the shell model, from the small van de Graaf to the large HERA, from ''chamber physics'' to big research, reminiscences on physical research in Heidelberg. (HSI)
Energy Technology Data Exchange (ETDEWEB)
Bigalke, K. [Hamburg Univ. (Germany). Meteorologisches Inst.; Schluenzen, K.H. [METCON Umweltmeteorologische Beratung, Pinneberg (Germany)
2001-09-01
The project focused on the development of a low-cost planning tool for authorities and consulting engineers which meets the envisaged national quality standards (VDI standards). The program system METRAS{sup +} consists of four components for preparation, implementation and quality assurance of mesoscale model calculations, all under Windows. The program system will not be commercialized; instead, it will be made available to interested users at a small fee by the Meteorological Institute of Hamburg University. [German] Ziel war die Bereitstellung eines kostenguenstigen Planungsinstrumentes fuer Behoerden und Beratungsunternehmen, das geplante nationale Qualitaetsnormen (VDI-Richtlinie) erfuellt. Vergleichbare Modelle existieren bislang nur im wissenschaftlichen Bereich, sind kaum qualitaetsgesichert und werden u.a. aus wirtschaftlichen Erwaegungen nur in Ausnahmefaellen eingesetzt. Das Programmsystem METRAS{sup +} setzt sich aus vier Programmkomponenten zusammen, die der Vorbereitung, Durchfuehrung und Qualitaetssicherung mesoskaliger Modellrechnungen dienen. Alle Programmkomponenten laufen unter einer gemeinsamen, anwenderfreundlichen Windowsoberflaeche. Um die breite Anwendung qualifizierter Untersuchungsmethoden im Umweltconsulting zu foerdern, ist geplant, METRAS{sup +} nicht kommerziell zu vertreiben und das Programmsystem interessierten Anwendern gegen einen geringen Kostenbeitrag zur Verfuegung zu stellen. Vertrieb und Oeffentlichkeitsarbeit sollen vom Meteorologischen Institut der Universitaet Hamburg geleistet werden. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Hacker, J [ed.; Biermann, J; Locke, R; Meyer, K
1991-01-01
Volume 2 of this report indicates two goals: (3): Development and implementation of concrete heat supply models for public facilities in Berlin; (4): Development of models for cooperation between the heat utility and Berlin trade enterprises. (HW) [Deutsch] Der Berichtsband 2 weist 2 Teilziele auf: Teilziel 3: Erarbeitung und Gestaltung konkreter Waermelieferungsmodelle fuer oeffenliche Einrichtungen in Berlin; Teilziel 4: Gestaltung von Kooperationsmoeglichkeiten zwischen Waermeversorgungsgesellschaft und Handwerksbetrieben in Berlin. (HW)
Energy Technology Data Exchange (ETDEWEB)
Hacker, J [ed.; Biermann, J; Koehler, U; Locke, R; Meyer, K
1993-12-31
Volume 1 of the report indicates two goals: (1): Investigation of the boundary conditions for heat supply models, using the example of the states of Berlin (West) and Niedersachsen. (2): Investigation of the available potential in Berlin (West). (HW) [Deutsch] Der Berichtsband 1 weist 2 Teilziele auf: Teilziel 1: Untersuchung der Rahmenbedingungen fuer Waermelieferungsmodelle am Beispiel des Stadtstaates Berlin (West) und des Flaechenstaates Niedersachsen. Teilziel 2: Potentialermittlung in Berlin (West). (HW)
Energy Technology Data Exchange (ETDEWEB)
Krause, C.; Chutsch, M.; Henke, M.; Huber, M.; Kliem, C.; Schulz, C.; Schwarz, E.
1989-09-01
This volume contains a description of studies under the research project entitled `Environment and Health - Measurement and Analysis of Environmental Exposure Factors in the Federal Republic of Germany 1985/86` (Environmental Survey), as well as a description of concentrations of a number of elements and some compounds in blood, urine and hair. This description represents the first of five parts of the analysis of the entire data base. The aim of this analysis was to give, as far as possible, a precise assessment of the corporal exposure to pollutants of the general population in Germany. The estimated distribution of the concentrations calculated for the study population, as well as for subpopulations classified by age, sex, community size, land, smoking habits and the consumption of fish. The descriptive part is divided by the 3 types of sample material such as blood, (morning) urine and hair. Within these groups, all analyzed elements and compounds (Al, As, Ba, Pb, B, Cd, Ca, Cu, Fe, Mg, P, Hg, Sr, Zn, creatinine, cotinine and PCP) are reported separately. A short characterization is followed by thetables giving the estimated statistical parameters such as percentile values (10, 50, 90, 95 and 98), maximum value, geometric (GM) and arithmetic (AM) mean, the standard error of AM and the sample standard deviation. Additionally, the measurements are represented in the form of histograms and scatterdiagrams. (orig./MG) With 66 figs., 167 tabs., 11 attachments. [Deutsch] Der vorliegende Berichtsband enthaelt zum einen die Studienbeschreibung des Forschungsvorhabens `Messung und Analyse von Umweltbelastungsfaktoren in der Bundesrepublik Deutschland 1985/86 - Umwelt und Gesundheit` (Umwelt-Survey) und zum anderen die Deskription der Gehalte zahlreicher Elemente und einiger Verbindungen in Blut, Urin und Haar. Die vorliegende Deskription stellt den ersten von insgesamt fuenf Auswertungsteilen des gesamten Datensatzes dar. Funktion und Zielsetzung dieses ersten Auswertungsteils besteht in der moeglichst praezisen Schaetzung der tatsaechlichen korporalen Schadstoffbelastung der Allgemeinbevoelkerung (26- bis 69jaehrig) in der Bundesrepublik Deutschland waehrend der Jahre 1985/86. Es werden die geschaetzten Verteilungen der gemessenen Gehalte in der Gesamtpopulation und in nach Alter, Geschlecht, Gemeindegroessenklassen, Bundesland, teilweise Rauchen und Fischverzehr gebildeten Teilpopulationen wiedergegeben. Die Deskription ist nach den Probenarten (Blut, Morgen-Urin, Haar) und innerhalb dieser nach den gemessenen Elementen (Al, As, Ba, Pb, B, Cd, Ca, Fe, Cu, Mg, P, Hg, Sr, Zn, Creatinin, Cotinin und PCP) gegliedert. Sie enthaelt eine kurze textliche Beschreibung zu den Tabellen, die die Kennwerte: 10., 50., 90., 95., 98. Perzentil, Maximal-Wert, geometrischer Mittelwert, arithmetischer Mittelwert (AM), Standardfehler des AM und Standardabweichung enthalten. Zusaetzlich werden die Messwerte in Form von Haeufigkeitsverteilungen und Streudiagrammen dargestellt. (orig./MG) With 66 figs., 167 tabs., 11 attachments.
Energy Technology Data Exchange (ETDEWEB)
Behrend, H; Blaha, H; Loew, M; Schermuly, W; Schneider, V
1978-01-01
The present volume IX/5a represents a further addition to the series of Encyclopedia on radiodiagnostics of the escophagus and respiratory systems, the respiratory tract, and the mediastinum. The section on 'Pulmonary Tuberculosis' containing excellent illustrations was compiled with ample and objective criticism by H. Blaha. The pathologic, radiologic, and clinical aspects of 'Sarcoidosis' were effectively treated by W. Schermuly and H. Behrend who produced a comprehensive review that will remain authoritative for several years to come and will serve as an excellent reference source. The chapter on 'Lymphogranulomatosis of the Thoracic Organs' by M. Loew takes the entire region of the body into consideration and summarizes the current state of knowledge. With his extensive article on 'Tumors of the Chest Wall,' V. Schneider has rendered a great service not only to radiologists but also to all specialists who must concern themselves with diagnostic problems involving the thorax and its organs. The topographic approach to all tumors and a critical differential diagnostic evaluation of the X-ray findings are of assistance in practical clinical work. All of the articles report on the current knowledge of radiologic, pathologic-anatomic, and clinical aspects of the specific disorders or disease groups. The many illustrations included are graphically descriptive of the radiologic examination methods and also serve to point out the diagnostic and differential diagnostic difficulties. This first comprehensive radiologic treatment of frequently occurring pulmonary diseases and their differential diagnostics will remain a standard work in world literature. (MG/orig.).
Energy Technology Data Exchange (ETDEWEB)
Roos, E. (comp.)
2004-07-01
The 30th MPA-seminar on ''Safety and Availability in Energy Engineering'' was held in conjuction with the 9th German-Japanese Seminar. The 52 contributions were published in two volumes. Volume 1 contains the contributions to the following sessions: fracture mechanics, fatigue, welding, environmental impact and European research projects. Volume 2 contains contributions of sessions 6-9: high-temperature application, modelling-simulation, ageing management and non-destructive testing. (uke)
Energy Technology Data Exchange (ETDEWEB)
Roos, E. (comp.)
2004-07-01
he 30th MPA-seminar on ''Safety and Availability in Energy Engineering'' was held in conjuction with the 9th German-Japanese Seminar. The 52 contributions were published in two volumes. Volume 1 contains the contributions to the following sessions: fracture mechanics, fatigue, welding, environmental impact and European research projects. Volume 2 contains contributions of sessions 6-9: high-temperature application, modelling-simulation, ageing management and non-destructive testing. (uke)
Energy Technology Data Exchange (ETDEWEB)
Bigalke, K. [METCON Umweltmeteorologische Beratung, Pinneberg (Germany); Schluenzen, K.H. [Hamburg Univ. (Germany). Meteorologisches Inst.
2001-09-01
The project focused on the development of a low-cost planning tool for authorities and consulting engineers which meets the envisaged national quality standards (VDI standards). The program system METRAS{sup +} consists of four components for preparation, implementation and quality assurance of mesoscale model calculations, all under Windows. The program system will not be commercialized; instead, it will be made available to interested users at a small fee by the Meteorological Institute of Hamburg University. [German] Ziel war die Bereitstellung eines kostenguenstigen Planungsinstrumentes fuer Behoerden und Beratungsunternehmen, das geplante nationale Qualitaetsnormen (VDI-Richtlinie) erfuellt. Vergleichbare Modelle existieren bislang nur im wissenschaftlichen Bereich, sind kaum qualitaetsgesichert und werden u.a. aus wirtschaftlichen Erwaegungen nur in Ausnahmefaellen eingesetzt. Das Programmsystem METRAS{sup +} setzt sich aus vier Programmkomponenten zusammen, die der Vorbereitung, Durchfuehrung und Qualitaetssicherung mesoskaliger Modellrechnungen dienen. Alle Programmkomponenten laufen unter einer gemeinsamen, anwenderfreundlichen Windowsoberflaeche. Um die breite Anwendung qualifizierter Untersuchungsmethoden im Umweltconsulting zu foerdern, ist geplant, METRAS{sup +} nicht kommerziell zu vertreiben und das Programmsystem interessierten Anwendern gegen einen geringen Kostenbeitrag zur Verfuegung zu stellen. Vertrieb und Oeffentlichkeitsarbeit sollen vom Meteorologischen Institut der Universitaet Hamburg geleistet werden. (orig.)
Directory of Open Access Journals (Sweden)
Bacal Nydia S.
2001-01-01
Full Text Available A quantificação das células CD34+ em sangue periférico é utilizada para determinar o melhor momento de iniciar a aférese, enquanto que na leucoaférese e no sangue de cordão umbilical determinam a quantidade de células CD34+ para o transplante de células progenitoras. O objetivo deste trabalho foi comparar três diferentes metodologias de quantificação de células CD34+. Foram utilizados três diferentes tipos de amostras: a 32 amostras de sangue periférico, coletadas de pacientes estimulados com G-CSF 50 mg/Kg/dose total, sem quimioterapia na mobilização. b 31 amostras de produto de aférese de pacientes estimulados com o mesmo protocolo de G-CSF. c 20 amostras de sangue de cordão coletadas em CPDA-1, por punção de veia umbilical. As amostras permaneceram à temperatura ambiente no máximo até 24h da análise. O citômetro de fluxo utilizado foi o Epics XL-MCL (Coulter com os protocolos de dupla plataforma: ISHAGE e Mulhouse modificado para análise de maior numero de eventos, e o citômetro Imagn 2000 (Biometric Imaging de plataforma única, conforme técnicas recomendadas. Os anticorpos monoclonais utilizados foram: CD45-FITC, CD34-PE, e isotipo IgG1-PE da Immunotech. As análises estatísticas foram: ANOVA e correlação de teste t de Student. Os resultados não apresentaram diferenças estatisticamente significativas nos três métodos.
Dell'Osso, Bernardo; Shah, Saloni; Do, Dennis; Yuen, Laura D; Hooshmand, Farnaz; Wang, Po W; Miller, Shefali; Ketter, Terence A
2017-12-01
Bipolar disorder (BD) is a chronic, frequently comorbid condition characterized by high rates of mood episode recurrence and suicidality. Little is known about prospective longitudinal characterization of BD type II (BD II) versus type I (BD I) in relation to time to depressive recurrence and recovery from major depressive episode. We therefore assessed times to depressive recurrence/recovery in tertiary clinic-referred BD II versus I patients. Outpatients referred to Stanford BD Clinic during 2000-2011 were assessed with Systematic Treatment Enhancement Program for BD (STEP-BD) Affective Disorders Evaluation and with Clinical Monitoring Form during up to 2 years of naturalistic treatment. Prevalence and clinical correlates of bipolar subtype in recovered (euthymic ≥8 weeks) and depressed patients were assessed. Kaplan-Meier analyses assessed the relationships between bipolar subtype and longitudinal depressive severity, and Cox proportional hazard analyses assessed the potential mediators. BD II versus BD I was less common among 105 recovered (39.0 vs. 61.0%, p = 0.03) and more common among 153 depressed (61.4 vs. 38.6%, p = 0.006) patients. Among recovered patients, BD II was associated with 6/25 (24.0%) baseline unfavorable illness characteristics/mood symptoms/psychotropics and hastened depressive recurrence (p = 0.015). Among depressed patients, BD II was associated with 8/25 (33.0%) baseline unfavorable illness characteristics/mood symptoms/psychotropics, but only non-significantly associated with delayed depressive recovery. BD II versus BD I was significantly associated with current depression and hastened depressive recurrence, but only non-significantly associated with delayed depressive recovery. Research on bipolar subtype relationships with depressive recurrence/recovery is warranted to enhance clinical management of BD patients.
Historical amphibian declines and extinctions in Brazil linked to chytridiomycosis.
Carvalho, Tamilie; Becker, C Guilherme; Toledo, Luís Felipe
2017-02-08
The recent increase in emerging fungal diseases is causing unprecedented threats to biodiversity. The origin of spread of the frog-killing fungus Batrachochytrium dendrobatidis ( Bd ) is a matter of continued debate. To date, the historical amphibian declines in Brazil could not be attributed to chytridiomycosis; the high diversity of hosts coupled with the presence of several Bd lineages predating the reported declines raised the hypothesis that a hypervirulent Bd genotype spread from Brazil to other continents causing the recent global amphibian crisis. We tested for a spatio-temporal overlap between Bd and areas of historical amphibian population declines and extinctions in Brazil. A spatio-temporal convergence between Bd and declines would support the hypothesis that Brazilian amphibians were not adapted to Bd prior to the reported declines, thus weakening the hypothesis that Brazil was the global origin of Bd emergence. Alternatively, a lack of spatio-temporal association between Bd and frog declines would indicate an evolution of host resistance in Brazilian frogs predating Bd 's global emergence , further supporting Brazil as the potential origin of the Bd panzootic. Here, we Bd -screened over 30 000 museum-preserved tadpoles collected in Brazil between 1930 and 2015 and overlaid spatio-temporal Bd data with areas of historical amphibian declines. We detected an increase in the proportion of Bd -infected tadpoles during the peak of amphibian declines (1979-1987). We also found that clusters of Bd -positive samples spatio-temporally overlapped with most records of amphibian declines in Brazil's Atlantic Forest. Our findings indicate that Brazil is post epizootic for chytridiomycosis and provide another piece to the puzzle to explain the origin of Bd globally. © 2017 The Author(s).
Energy Technology Data Exchange (ETDEWEB)
Song, Y.R. [Department of Neurology, The First Affiliated Hospital of Chongqing Medical University, Chongqing (China); Chongqing Key Laboratory of Neurobiology, Chongqing (China); Institute of Neuroscience and the Collaborative Innovation Center for Brain Science, Chongqing Medical University, Chongqing (China); Wu, B. [Chongqing Key Laboratory of Neurobiology, Chongqing (China); Institute of Neuroscience and the Collaborative Innovation Center for Brain Science, Chongqing Medical University, Chongqing (China); Yang, Y.T.; Chen, J. [Department of Neurology, The First Affiliated Hospital of Chongqing Medical University, Chongqing (China); Chongqing Key Laboratory of Neurobiology, Chongqing (China); Institute of Neuroscience and the Collaborative Innovation Center for Brain Science, Chongqing Medical University, Chongqing (China); Zhang, L.J.; Zhang, Z.W. [Chongqing Key Laboratory of Neurobiology, Chongqing (China); Institute of Neuroscience and the Collaborative Innovation Center for Brain Science, Chongqing Medical University, Chongqing (China); Shi, H.Y. [Department of Neurology, The First Affiliated Hospital of Chongqing Medical University, Chongqing (China); Chongqing Key Laboratory of Neurobiology, Chongqing (China); Institute of Neuroscience and the Collaborative Innovation Center for Brain Science, Chongqing Medical University, Chongqing (China); Huang, C.L.; Pan, J.X. [Chongqing Key Laboratory of Neurobiology, Chongqing (China); Institute of Neuroscience and the Collaborative Innovation Center for Brain Science, Chongqing Medical University, Chongqing (China); Xie, P. [Department of Neurology, The First Affiliated Hospital of Chongqing Medical University, Chongqing (China); Chongqing Key Laboratory of Neurobiology, Chongqing (China); Institute of Neuroscience and the Collaborative Innovation Center for Brain Science, Chongqing Medical University, Chongqing (China)
2015-09-08
Bipolar disorder (BD) is a common psychiatric mood disorder affecting more than 1-2% of the general population of different European countries. Unfortunately, there is no objective laboratory-based test to aid BD diagnosis or monitor its progression, and little is known about the molecular basis of BD. Here, we performed a comparative proteomic study to identify differentially expressed plasma proteins in various BD mood states (depressed BD, manic BD, and euthymic BD) relative to healthy controls. A total of 10 euthymic BD, 20 depressed BD, 15 manic BD, and 20 demographically matched healthy control subjects were recruited. Seven high-abundance proteins were immunodepleted in plasma samples from the 4 experimental groups, which were then subjected to proteome-wide expression profiling by two-dimensional electrophoresis and matrix-assisted laser desorption/ionization-time-of-flight/time-of-flight tandem mass spectrometry. Proteomic results were validated by immunoblotting and bioinformatically analyzed using MetaCore. From a total of 32 proteins identified with 1.5-fold changes in expression compared with healthy controls, 16 proteins were perturbed in BD independent of mood state, while 16 proteins were specifically associated with particular BD mood states. Two mood-independent differential proteins, apolipoprotein (Apo) A1 and Apo L1, suggest that BD pathophysiology may be associated with early perturbations in lipid metabolism. Moreover, down-regulation of one mood-dependent protein, carbonic anhydrase 1 (CA-1), suggests it may be involved in the pathophysiology of depressive episodes in BD. Thus, BD pathophysiology may be associated with early perturbations in lipid metabolism that are independent of mood state, while CA-1 may be involved in the pathophysiology of depressive episodes.
International Nuclear Information System (INIS)
Song, Y.R.; Wu, B.; Yang, Y.T.; Chen, J.; Zhang, L.J.; Zhang, Z.W.; Shi, H.Y.; Huang, C.L.; Pan, J.X.; Xie, P.
2015-01-01
Bipolar disorder (BD) is a common psychiatric mood disorder affecting more than 1-2% of the general population of different European countries. Unfortunately, there is no objective laboratory-based test to aid BD diagnosis or monitor its progression, and little is known about the molecular basis of BD. Here, we performed a comparative proteomic study to identify differentially expressed plasma proteins in various BD mood states (depressed BD, manic BD, and euthymic BD) relative to healthy controls. A total of 10 euthymic BD, 20 depressed BD, 15 manic BD, and 20 demographically matched healthy control subjects were recruited. Seven high-abundance proteins were immunodepleted in plasma samples from the 4 experimental groups, which were then subjected to proteome-wide expression profiling by two-dimensional electrophoresis and matrix-assisted laser desorption/ionization-time-of-flight/time-of-flight tandem mass spectrometry. Proteomic results were validated by immunoblotting and bioinformatically analyzed using MetaCore. From a total of 32 proteins identified with 1.5-fold changes in expression compared with healthy controls, 16 proteins were perturbed in BD independent of mood state, while 16 proteins were specifically associated with particular BD mood states. Two mood-independent differential proteins, apolipoprotein (Apo) A1 and Apo L1, suggest that BD pathophysiology may be associated with early perturbations in lipid metabolism. Moreover, down-regulation of one mood-dependent protein, carbonic anhydrase 1 (CA-1), suggests it may be involved in the pathophysiology of depressive episodes in BD. Thus, BD pathophysiology may be associated with early perturbations in lipid metabolism that are independent of mood state, while CA-1 may be involved in the pathophysiology of depressive episodes
Substance Use Disorders and Suicide Attempts in Bipolar Subtypes
Sublette, M. Elizabeth; Carballo, Juan J.; Moreno, Carmen; Galfalvy, Hanga C.; Brent, David A.; Birmaher, Boris; Mann, J. John; Oquendo, Maria A.
2009-01-01
1. Abstract Bipolar disorder (BD) is associated with high rates of suicide attempt and completion. Substance use disorders (SUD) have been identified as potent risk factors for suicidal behavior in BD. However, little is known concerning differences between BD subtypes with regard to SUD as a risk factor for suicidal behavior. We studied previous suicidal behavior in adults with a major depressive episode in context of BD type I (BD-I; N=96) or BD type II (BD-II; N=42), with and without history of SUD. Logistic regressions assessed the association between SUD and suicide attempt history by BD type, and exploratory analyses examined the effects of other clinical characteristics on these relationships. SUD were associated with suicide attempt in BD-I but not BD-II, an effect not attributable to sample size differences. The higher suicide attempt rate associated with alcoholism in BD-I was mostly explained by higher aggression scores, and earlier age of BD onset increased the likelihood that alcohol use disorder would be associated with suicide attempt(s). The higher suicide attempt rate associated with other drug use disorders in BD-I was collectively explained by higher impulsivity, hostility, and aggression scores. The presence of both alcohol and drug use disorders increased odds of a history of suicide attempt in a multiplicative fashion: 97% of BD-I who had both comorbid drug and alcohol use disorders had made a suicide attempt. A critical next question is how to target SUD and aggressive traits for prevention of suicidal behavior in BD-I. PMID:18590916
Historical amphibian declines and extinctions in Brazil linked to chytridiomycosis
Carvalho, Tamilie; Becker, C. Guilherme
2017-01-01
The recent increase in emerging fungal diseases is causing unprecedented threats to biodiversity. The origin of spread of the frog-killing fungus Batrachochytrium dendrobatidis (Bd) is a matter of continued debate. To date, the historical amphibian declines in Brazil could not be attributed to chytridiomycosis; the high diversity of hosts coupled with the presence of several Bd lineages predating the reported declines raised the hypothesis that a hypervirulent Bd genotype spread from Brazil to other continents causing the recent global amphibian crisis. We tested for a spatio-temporal overlap between Bd and areas of historical amphibian population declines and extinctions in Brazil. A spatio-temporal convergence between Bd and declines would support the hypothesis that Brazilian amphibians were not adapted to Bd prior to the reported declines, thus weakening the hypothesis that Brazil was the global origin of Bd emergence. Alternatively, a lack of spatio-temporal association between Bd and frog declines would indicate an evolution of host resistance in Brazilian frogs predating Bd's global emergence, further supporting Brazil as the potential origin of the Bd panzootic. Here, we Bd-screened over 30 000 museum-preserved tadpoles collected in Brazil between 1930 and 2015 and overlaid spatio-temporal Bd data with areas of historical amphibian declines. We detected an increase in the proportion of Bd-infected tadpoles during the peak of amphibian declines (1979–1987). We also found that clusters of Bd-positive samples spatio-temporally overlapped with most records of amphibian declines in Brazil's Atlantic Forest. Our findings indicate that Brazil is post epizootic for chytridiomycosis and provide another piece to the puzzle to explain the origin of Bd globally. PMID:28179514
What is bizarre in bizarre delusions? A critical review
DEFF Research Database (Denmark)
Cermolacce, Michel René Joseph; Jensen, Lars Meldgaard Sass; Parnas, J
2010-01-01
or incomprehensible. Then, we provide a critical review of contemporary studies on the reliability of BD and their methodological and conceptual limitations. Current approaches have focused intensely on BD's reliability and have defined BD strictly in terms of delusional content--mainly in terms of the physical...... to delusional contents alone and requires taking into account the subjective side of BD (how altered experience manifests itself) as well as the conditions of intersubjective encounter (how BD are expressed to and experienced by the clinician). The notion of "bizarreness" in schizophrenia is not purely...
Big Data viewed through the lens of management fashion theory
Madsen, Dag Øivind; Stenheim, Tonny
2016-01-01
Big Data (BD) is currently one of the most talked about management ideas in the business community. Many call it the “buzzword of the day.” In books and media articles, BD has been referred to as a “revolution” and “new era.” There is lots of optimistic and upbeat rhetoric surrounding BD. This has led some to question whether BD is a hyped-up management fashion. In this paper, the BD phenomenon is viewed through the lens of management fashion theory. Management fashion provides an analytical ...
Wang, Xiao-Fang; Cao, Rui-Ming; Li, Jing; Wu, Jing; Wu, Sheng-Mei; Chen, Tong-Xin
2014-03-14
Human milk provides infants with various immune molecules. The objective of the present study was to measure human β-defensin-1 (hBD-1) and human β-defensin-2 (hBD-2) levels in the colostrum and mature milk of healthy Han Chinese, to identify factors regulating milk hBD-1 and hBD-2 expression and to explore the potential protective effect of milk hBD-1 and hBD-2 on infants. A total of 100 mothers and their babies were recruited into the study. Sociodemographic characteristics and other factors were obtained by a questionnaire. Babies were followed up for a period of 6 months. Colostrum samples (n 100) and mature milk samples (n 82) were collected by hand expression. The hBD-1 and hBD-2 concentrations were measured by ELISA. The hBD-1 and hBD-2 levels differed in the colostrum and mature milk. In the colostrum, the concentration ranges of hBD-1 and hBD-2 were 1·04-12·81 μg/ml and 0·31-19·12 ng/ml, respectively. In mature milk, the hBD-1 and hBD-2 levels were 1·03-31·76 ng/ml and 52·65-182·29 pg/ml, respectively. Several independent factors influence their production. The multivariable analysis showed a strong association between pre-pregnancy BMI and hBD-1 levels in the colostrum (P=0·001), mode of delivery was significantly associated with hBD-2 levels in the colostrum (P=0·006) and gestational age was significantly associated with hBD-1 levels in mature milk (P= 0·010). During the first 6 months of life, the incidence rate of upper respiratory infection was found to be less in the high-colostrum hBD-1 group than in the low-colostrum hBD-1 group (χ²=4·995, P=0·025). The present study suggested that the abundance of hBD-1 in the colostrum may have a protective function against upper respiratory infection for infants younger than 6 months.
Cossel, John; Lindquist, Erik; Craig, Heather; Luthman, Kyle
2014-11-13
The pathogenic fungus Batrachochytrium dendrobatidis (Bd) has been associated with amphibian declines worldwide but has not been well-studied among Critically Endangered amphibian species in Bolivia. We sampled free-living marbled water frogs Telmatobius marmoratus (Anura: Leptodactylidae) from Isla del Sol, Bolivia, for Bd using skin swabs and quantitative polymerase chain reactions. We detected Bd on 44% of T. marmoratus sampled. This is the first record of Bd in amphibians from waters associated with Lake Titicaca, Bolivia. These results further confirm the presence of Bd in Bolivia and substantiate the potential threat of this pathogen to the Critically Endangered, sympatric Titicaca water frog T. culeus and other Andean amphibians.
Wolfe, Wendy L; Patterson, Kaitlyn
2017-01-01
Researchers have investigated the efficacy of a gratitude intervention for decreasing body dissatisfaction (BD) in an internet treatment-seeking sample and demonstrated it worked equally well to decrease BD as cognitive restructuring. We extend this research by testing the efficacy of a gratitude intervention on BD, along with common sequelae of BD: dysfunctional eating, negative mood, and depressive symptoms. Females were randomly assigned to Gratitude, Cognitive Restructuring, or Control conditions. Pre- to post-intervention period comparisons found the gratitude intervention to perform better than the other conditions at increasing body esteem, decreasing BD, reducing dysfunctional eating, and reducing depressive symptoms.
Genetic Association of , and - with Behcet's Disease in Saudi Patients
Directory of Open Access Journals (Sweden)
Fahda Al-Okaily
2016-01-01
Full Text Available Background HLA-B*51 has been universally associated with Behcet's disease (BD susceptibility, while different alleles of HLA-A have also been identified as independent BD susceptibility loci in various ethnic populations. The objective of this study was to investigate associations of HLA-A and - B alleles with BD in Saudi patients. Materials and Methods Genotyping for HLA-A and HLA-B was performed using HLA genotyping kit (Lab type (R SSO in 120 Saudi subjects, including 60 BD patients and 60 matched healthy controls. Results Our results revealed that frequencies of HLA-A*26, -A*31 , and - B*51 were significantly higher in BD patients than in controls, suggesting that HLA-A*26, -A*31 , and - B*51 are associated with BD. The frequency of HLA-B*15 was significantly lower in BD patients than in controls. Stratification of genotyping results into active and nonactive forms of BD revealed that the frequency of HLA-A*31 was significantly higher in the nonactive form than in the active form of BD, while there was no significant difference in the distribution of other alleles between the two forms of BD. Conclusion This study suggests that HLA-A*26, -A*31 , and - B*51 are associated with susceptibility risk to BD, while HLA-B*15 may be protective in Saudi patients. However, larger scale studies are needed to confirm these findings.
Bletz, Molly C.; Rosa, Gonçalo M.; Andreone, Franco; Courtois, Elodie A.; Schmeller, Dirk S.; Rabibisoa, Nirhy H. C.; Rabemananjara, Falitiana C. E.; Raharivololoniaina, Liliane; Vences, Miguel; Weldon, Ché; Edmonds, Devin; Raxworthy, Christopher J.; Harris, Reid N.; Fisher, Matthew C.; Crottini, Angelica
2015-01-01
Amphibian chytridiomycosis, an emerging infectious disease caused by the fungus Batrachochytrium dendrobatidis (Bd), has been a significant driver of amphibian declines. While globally widespread, Bd had not yet been reported from within Madagascar. We document surveys conducted across the country between 2005 and 2014, showing Bd's first record in 2010. Subsequently, Bd was detected in multiple areas, with prevalence reaching up to 100%. Detection of Bd appears to be associated with mid to high elevation sites and to have a seasonal pattern, with greater detectability during the dry season. Lineage-based PCR was performed on a subset of samples. While some did not amplify with any lineage probe, when a positive signal was observed, samples were most similar to the Global Panzootic Lineage (BdGPL). These results may suggest that Bd arrived recently, but do not exclude the existence of a previously undetected endemic Bd genotype. Representatives of all native anuran families have tested Bd-positive, and exposure trials confirm infection by Bd is possible. Bd's presence could pose significant threats to Madagascar's unique “megadiverse” amphibians. PMID:25719857
Vinberg, Maj; Mikkelsen, Rie Lambaek; Kirkegaard, Thomas; Christensen, Ellen Margrethe; Kessing, Lars Vedel
2017-01-15
In a naturalistic clinical study of patients in the early stages of bipolar disorders the aim was to assess differences between patients with bipolar I (BD I) and bipolar II (BD II) disorders on clinical characteristics including affective symptoms, subjective cognitive complaints, functional level, the presence of comorbid personality disorders and coping strategies. Diagnoses were confirmed using the Structured Clinical Interview for DSM-IV Disorders. Clinical symptoms were rated with the Young Mania Rating Scale and the Hamilton Depression Rating Scale, and functional status using the Functional Assessment Short Test. Cognitive complaints were assessed using the Massachusetts General Hospital Cognitive and Physical Functioning Questionnaire, the presence of comorbid personality disorders using the Standardized Assessment of Personality - Abbreviated Scale and coping style using the Coping Inventory for Stressful Situations. In total, 344 patients were included (BD I (n=163) and BD II (n=181). Patients with BD II presented with significantly more depressive symptoms, more cognitive complaints, lower overall functioning, and a higher prevalence of comorbid personality disorders. Finally, they exhibited a trend towards using less adaptive coping styles. It cannot be omitted that some patients may have progressed from BD II to BD I. Most measures were based on patient self report. Overall, BD II was associated with a higher disease burden. Clinically, it is important to differentiate BD II from BD I and research wise, there is a need for tailoring and testing specific interventions towards BD II. Copyright © 2016 Elsevier B.V. All rights reserved.
The association between school exam grades and subsequent development of bipolar disorder
DEFF Research Database (Denmark)
Pedersen, Steffie Damgaard; Østergaard, Søren Dinesen; Petersen, Liselotte
2018-01-01
and bipolar I disorder (BD-I) has not been studied. Therefore, we aimed to study the association between school exam grades and subsequent development of BD and BD-I while adjusting for parental history of mental disorder. METHODS: We conducted a register-based nationwide cohort study following 505 688......OBJECTIVE: Prior studies have indicated that both high and low school grades are associated with development of bipolar disorder (BD), but these studies have not adjusted for parental history of mental disorder, which is a likely confounder. Furthermore, the association between school grades...... individuals born in Denmark between 1987 and 1995. We investigated the association between school exam grades and development of BD or BD-I with a Cox model adjusting for family history of mental disorder and other potential confounders. RESULTS: During follow-up, 900 individuals were diagnosed with BD...
What is bizarre in bizarre delusions? A critical review
DEFF Research Database (Denmark)
Cermolacce, Michel René Joseph; Jensen, Lars Meldgaard Sass; Parnas, J
2010-01-01
. These studies provide highly heterogenous results because they are based on different experimental paradigms, in terms of definition, clinical sample, and number of raters. Here, we first discuss the psychopathological sources of the concept of BD, which were initially described as either nonsensical...... or incomprehensible. Then, we provide a critical review of contemporary studies on the reliability of BD and their methodological and conceptual limitations. Current approaches have focused intensely on BD's reliability and have defined BD strictly in terms of delusional content--mainly in terms of the physical...... impossibility or the cultural or historical incomprehensibility of the delusional claims. These approaches have neglected formal features of experience that underlie BD and the crucial issue of the nature and validity of BD. In the discussion, we argue that clinical diagnosis of BD cannot be limited...
Cerebral vein thrombosis in a four year old with Behçet's disease.
Hacihamdioglu, Duygu Ovunc; Demiriz, Murat; Sobaci, Gungor; Kocaoglu, Murat; Demirkaya, Erkan; Gok, Faysal
2014-01-01
Behçet's disease (BD) is a multisystem disorder. The main pathology in BD is vasculitis that involves arteries and veins of all calibers. Central nervous system involvement occurs in 5-10% of patients. Increased morbidity and mortality is rarely observed in children. The mean age at onset in pediatric BD is approximately 7 years. Neurologic involvement in BD is usually observed after 3-6 years. We report the case of a four-year-old Turkish boy with BD with sagittal sinus thrombosis treated with infliximab. The patient presented papilledema without neurologic signs. Although long-term efficacy evaluations are needed in this case, infliximab therapy may be a good option in childhood BD with refractory sinus thrombosis. This is the youngest case of BD with sagittal sinus thrombosis reported so far. Copyright © 2012 Elsevier España, S.L. All rights reserved.
Directory of Open Access Journals (Sweden)
Joshua H Daskin
Full Text Available Chytridiomycosis, caused by the fungus Batrachochytrium dendrobatidis (Bd, is a widespread disease of amphibians responsible for population declines and extinctions. Some bacteria from amphibians' skins produce antimicrobial substances active against Bd. Supplementing populations of these cutaneous antifungal bacteria might help manage chytridiomycosis in wild amphibians. However, the activity of protective bacteria may depend upon environmental conditions. Biocontrol of Bd in nature thus requires knowledge of how environmental conditions affect their anti-Bd activity. For example, Bd-driven amphibian declines have often occurred at temperatures below Bd's optimum range. It is possible these declines occurred due to reduced anti-Bd activity of bacterial symbionts at cool temperatures. Better understanding of the effects of temperature on chytridiomycosis development could also improve risk evaluation for amphibian populations yet to encounter Bd. We characterized, at a range of temperatures approximating natural seasonal variation, the anti-Bd activity of bacterial symbionts from the skins of three species of rainforest tree frogs (Litoria nannotis, Litoria rheocola, and Litoria serrata. All three species declined during chytridiomycosis outbreaks in the late 1980s and early 1990s and have subsequently recovered to differing extents. We collected anti-Bd bacterial symbionts from frogs and cultured the bacteria at constant temperatures from 8 °C to 33 °C. Using a spectrophotometric assay, we monitored Bd growth in cell-free supernatants (CFSs from each temperature treatment. CFSs from 11 of 24 bacteria showed reduced anti-Bd activity in vitro when they were produced at cool temperatures similar to those encountered by the host species during population declines. Reduced anti-Bd activity of metabolites produced at low temperatures may, therefore, partially explain the association between Bd-driven declines and cool temperatures. We show that to
Foley, Peter; Garrett, Sinead; Ryttig, Lasse
2018-01-24
Calcipotriol 50 µg/g and betamethasone 0.5 mg/g dipropionate (Cal/BD) aerosol foam formulation provides greater effectiveness and improved patient preference compared with traditional Cal/BD formulations for the topical treatment of plaque psoriasis. To determine the cost-effectiveness of Cal/BD foam compared with Cal/BD gel from the Australian perspective. A Markov model was developed to evaluate the cost-effectiveness of topical Cal/BD foam and gel for the treatment of people with plaque psoriasis. Treatment effectiveness, safety, and utilities were based on a randomized control trial, resource use was informed by expert opinion, and unit costs were obtained from public sources. Outcomes were reported in terms of 1-year costs, quality-adjusted life years, and incremental cost-effectiveness ratios. All costs were reported in 2017 Australian Dollars. The model showed that patients using Cal/BD foam had more QALYs and higher costs over 1 year compared with patients using Cal/BD gel, resulting in a cost of $13,609 per QALY gained at 4-weeks. When 4 weeks of Cal/BD foam was compared with 8 weeks of Cal/BD gel treatment, Cal/BD foam was $8 less expensive and resulted in 0.006 more QALYs gained. Sensitivity analyses showed that, compared with Cal/BD ointment, Cal/BD foam was associated with an incremental cost of $15,091 per QALY gained. Cal/BD foam is the most cost-effective Cal/BD formulation for the topical treatment of patients with plaque psoriasis.
Directory of Open Access Journals (Sweden)
Yongjian Wu
2018-02-01
Full Text Available Beta-defensins 2 and 3 (BD2 and BD3 are inducible peptides present at the sites of infection, and they are well characterized for their antimicrobial activities and immune-regulatory functions. However, no study has thoroughly investigated their immunomodulatory effects on macrophage-mediated immune responses against Pseudomonas aeruginosa (PA. Here, we use THP-1 and RAW264.7 cell lines and demonstrate that BD2 and BD3 suppressed macrophage autophagy but enhanced the engulfment of PA and Zymosan bioparticles as well as the formation of phagolysosomes, using immunofluorescence staining and confocal microscopy. Plate count assay showed that macrophage-mediated phagocytosis and intracellular killing of PA were promoted by BD2 and BD3. Furthermore, microarray and real-time PCR showed that the expression of two genes, early growth response gene-1 (EGR1 and c-FOS, was attenuated by BD2 and BD3. Western blot revealed that BD2 and BD3 inhibited the expression and nuclear translocation of EGR1 and c-FOS. Knockdown of EGR1 and c-FOS by siRNA transfection suppressed macrophage autophagy before and after PA infection; while overexpression of these two transcription factors enhanced autophagy but reversed the role of BD2 and BD3 on macrophage-mediated PA eradication. Together, these results demonstrate a novel immune defense activity of BD2 and BD3, which promotes clearance of PA by inhibiting macrophage autophagy through downregulation of EGR1 and c-FOS.
Daskin, Joshua H; Bell, Sara C; Schwarzkopf, Lin; Alford, Ross A
2014-01-01
Chytridiomycosis, caused by the fungus Batrachochytrium dendrobatidis (Bd), is a widespread disease of amphibians responsible for population declines and extinctions. Some bacteria from amphibians' skins produce antimicrobial substances active against Bd. Supplementing populations of these cutaneous antifungal bacteria might help manage chytridiomycosis in wild amphibians. However, the activity of protective bacteria may depend upon environmental conditions. Biocontrol of Bd in nature thus requires knowledge of how environmental conditions affect their anti-Bd activity. For example, Bd-driven amphibian declines have often occurred at temperatures below Bd's optimum range. It is possible these declines occurred due to reduced anti-Bd activity of bacterial symbionts at cool temperatures. Better understanding of the effects of temperature on chytridiomycosis development could also improve risk evaluation for amphibian populations yet to encounter Bd. We characterized, at a range of temperatures approximating natural seasonal variation, the anti-Bd activity of bacterial symbionts from the skins of three species of rainforest tree frogs (Litoria nannotis, Litoria rheocola, and Litoria serrata). All three species declined during chytridiomycosis outbreaks in the late 1980s and early 1990s and have subsequently recovered to differing extents. We collected anti-Bd bacterial symbionts from frogs and cultured the bacteria at constant temperatures from 8 °C to 33 °C. Using a spectrophotometric assay, we monitored Bd growth in cell-free supernatants (CFSs) from each temperature treatment. CFSs from 11 of 24 bacteria showed reduced anti-Bd activity in vitro when they were produced at cool temperatures similar to those encountered by the host species during population declines. Reduced anti-Bd activity of metabolites produced at low temperatures may, therefore, partially explain the association between Bd-driven declines and cool temperatures. We show that to avoid
Directory of Open Access Journals (Sweden)
Jiashu Yao
Full Text Available Bipolar disorder types I (BD I and II (BD II behave differently in clinical manifestations, normal personality traits, responses to pharmacotherapies, biochemical backgrounds and neuroimaging activations. How the varied emotional states of BD I and II are related to the comorbid personality disorders remains to be settled.We therefore administered the Plutchick - van Praag Depression Inventory (PVP, the Mood Disorder Questionnaire (MDQ, the Hypomanic Checklist-32 (HCL-32, and the Parker Personality Measure (PERM in 37 patients with BD I, 34 BD II, and in 76 healthy volunteers.Compared to the healthy volunteers, patients with BD I and II scored higher on some PERM styles, PVP, MDQ and HCL-32 scales. In BD I, the PERM Borderline style predicted the PVP scale; and Antisocial predicted HCL-32. In BD II, Borderline, Dependent, Paranoid (- and Schizoid (- predicted PVP; Borderline predicted MDQ; Passive-Aggressive and Schizoid (- predicted HCL-32. In controls, Borderline and Narcissistic (- predicted PVP; Borderline and Dependent (- predicted MDQ.Besides confirming the different predictability of the 11 functioning styles of personality disorder to BD I and II, we found that the prediction was more common in BD II, which might underlie its higher risk of suicide and poorer treatment outcome.
Valencia-Aguilar, Anyelet; Ruano-Fajardo, Gustavo; Lambertini, Carolina; da Silva Leite, Domingos; Toledo, Luís Felipe; Mott, Tamí
2015-05-11
The fungus Batrachochytrium dendrobatidis (Bd) is among the main causes of declines in amphibian populations. This fungus is considered a generalist pathogen because it infects several species and spreads rapidly in the wild. To date, Bd has been detected in more than 100 anuran species in Brazil, mostly in the southern portion of the Atlantic forest. Here, we report survey data from some poorly explored regions; these data considerably extend current information on the distribution of Bd in the northern Atlantic forest region. In addition, we tested the hypothesis that Bd is a generalist pathogen in this biome. We also report the first positive record for Bd in an anuran caught in the wild in Amazonia. In total, we screened 90 individuals (from 27 species), of which 39 individuals (from 22 species) were Bd-positive. All samples collected in Bahia (2 individuals), Pernambuco (3 individuals), Pará (1 individual), and Minas Gerais (1 individual) showed positive results for Bd. We found a positive correlation between anuran richness per family and the number of infected species in the Atlantic forest, supporting previous observations that Bd lacks strong host specificity; of 38% of the anuran species in the Atlantic forest that were tested for Bd infection, 25% showed positive results. The results of our study exemplify the pandemic and widespread nature of Bd infection in amphibians.
Galimberti, Daniela; Prunas, Cecilia; Paoli, Riccardo A; Dell'Osso, Bernardo; Fenoglio, Chiara; Villa, Chiara; Palazzo, Carlotta; Cigliobianco, Michela; Camuri, Giulia; Serpente, Maria; Scarpini, Elio; Altamura, A Carlo
2014-11-01
Recent data have shown that genetic variability in the progranulin (GRN) gene may contribute to the susceptibility to developing bipolar disorder (BD). However, in regard to patients with BD, no information is available on the role of genetic variability and plasma progranulin levels in different types of this disorder. In this study, we performed an association analysis of GRN in an Italian population consisting of 134 patients with BD and 232 controls to evaluate progranulin plasma levels. The presence of the polymorphic variant of the rs5848 single nucleotide polymorphism is protective for the development of bipolar I disorder (BD-I) (odds ratio = 0.55, 95% confidence interval: 0.33-0.93; p = 0.024) but not bipolar II disorder (BD-II) (p > 0.05). In addition, plasma progranulin levels are significantly decreased in BD [mean ± standard deviation (SD) 112 ± 35 versus 183 ± 93 ng/mL in controls; p < 0.001]. Regarding the influence of GRN variability on BD susceptibility, the predisposing genetic background differs between BD-I and BD-II, possibly implying that pathogenic mechanisms differ between the two subtypes of BD. © 2014 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.
Kim, Ji Na; Kwak, Sang Gyu; Choe, Jung-Yoon; Kim, Seong-Kyu
2017-01-01
The aim of this study is to identify the prevalence of Behçet's disease (BD) from data in the Healthcare Bigdata Hub of the Health Insurance Review & Assessment (HIRA) Service from 2011 to 2015 in Korea. This study collected information on primary and auxiliary diagnoses of BD (M352) by physicians according to the Korean Standard Classification of Diseases (KCD) codes. The prevalence of BD was assessed on the basis of age, sex, and geographical distribution. We used time series analysis, using the ARIMA model for the expected prevalence of BD from 2016 to 2025. The overall prevalence of BD was gradually increased, ranging from 32.8 to 35.7 per 100,000 population over the study period. The male to female ratio of BD ranged from 0.54:1 to 0.56:1, revealing a female predominance from 2011 to 2015. Among five districts in Korea, the prevalence in the Seoul Metropolitan district was the highest, with a slowly increasing trend for the study period, accounting for about 60.3% of total BD patients. The expected prevalence of BD patients was estimated to range from 36.9 (95% CI 35.0 - 39.0) to 44.7 (95% CI 40.2 - 49.6) between 2016 and 2025. This study found that the overall prevalence of BD is estimated to be approximately 35.0 per 100,000 population, with female predominance, and predicts gradually increased prevalence of BD in Korea.
Moreno, Doris Hupfeld; Bio, Danielle Soares; Petresco, Sandra; Petresco, Denise; Gutt, Elisa Kijner; Soeiro-de-Souza, Márcio Gerhardt; Moreno, Ricardo Alberto
2012-12-20
Bipolar disorder (BD) is a highly incapacitating disease typically associated with high rates of familial dysfunction. Despite recent literature suggesting that maternal care is an important environmental factor in the development of behavioral disorders, it is unclear how much maternal care is dysfunctional in BD subjects. The objective of this study was to characterize maternal care in DSM-IV/SCID diagnosed BD type I subjects compared to healthy controls with (PD) and without (NPD) other psychiatric diagnoses. Thirty-four BD mothers and 106 controls underwent an interview about family planning and maternal care, obstetrical complications, and mother-child interactions. K-SADS-PL questions about violence exposure were used to ascertain domestic violence and physical/sexual abuse. BD mothers were less likely to have stable unions (45.5%; pmothers. Due to BD mothers' symptoms, 33.3% of offspring suffered physical and/or psychological abuse. Post hoc analysis, and the use of questions as a surrogate of symptoms as opposed to validated instruments. This is one of few reports confirming that maternal care given by BD women is dysfunctional. BD psychopathology can lead to poor maternal care and both should be considered important environmental risk factors in BD, suggesting that BD psychoeducation should include maternal care orientation. Copyright © 2012 Elsevier B.V. All rights reserved.
Awareness of breast density and its impact on breast cancer detection and risk.
Rhodes, Deborah J; Radecki Breitkopf, Carmen; Ziegenfuss, Jeanette Y; Jenkins, Sarah M; Vachon, Celine M
2015-04-01
Legislation mandating disclosure of breast density (BD) information has passed in 21 states; however, actual awareness of BD and knowledge of its impact on breast cancer detection and risk are unknown. We conducted a national cross-sectional survey administered in English and Spanish using a probability-based sample of screening-age women, with oversampling of Connecticut, the only state with BD legislation in effect for > 1 year before the survey. Of 2,311 women surveyed, 65% responded. Overall, 58% of women had heard of BD, 49% knew that BD affects breast cancer detection, and 53% knew that BD affects cancer risk. After multivariable adjustment, increased BD awareness was associated with white non-Hispanic race/ethnicity (Hispanic v white non-Hispanic: odds ratio [OR], 0.23; P awareness and knowledge exist by race/ethnicity, education, and income. BD legislation seems to be effective in increasing knowledge of BD impact on breast cancer detection. These findings support continued and targeted efforts to improve BD awareness and knowledge among women eligible for screening mammography. © 2015 by American Society of Clinical Oncology.
Directory of Open Access Journals (Sweden)
Jae Woo Park
Full Text Available OBJECTIVES: The aim of this study was to identify psychosocial factors related to the onset of bipolar I disorder (BD. To do so, the Bipolar Disorder Etiology Scale (BDES, based on psychological behaviorism, was developed and validated. Using the BDES, common factors related to both major depressive disorder (MDD and BD and specific factors related only to BD were investigated. METHOD: The BDES, which measures 17 factors based on psychological behaviorism hypotheses, was developed and validated. This scale was administered to 113 non-clinical control subjects, 30 subjects with MDD, and 32 people with BD. ANOVA and post hoc analyses were conducted. Subscales on which MDD and BD groups scored higher than controls were classified as common factors, while those on which the BD group scored higher than MDD and control groups were classified as specific factors. RESULTS: The BDES has acceptable reliability and validity. Twelve common factors influence both MDD and BD and one specific factor influences only BD. Common factors include the following: learning grandiose self-labeling, learning dangerous behavior, reinforcing impulsive behavior, exposure to irritability, punishment of negative emotional expression, lack of support, sleep problems, antidepressant problems, positive arousal to threat, lack of social skills, and pursuit of short-term pleasure. The specific factor is manic emotional response. CONCLUSIONS: Manic emotional response was identified as a specific factor related to the onset of BD, while parents' grandiose labeling is a candidate for a specific factor. Many factors are related to the onset of both MDD and BD.
Park, Jae Woo; Park, Kee Hwan
2014-01-01
The aim of this study was to identify psychosocial factors related to the onset of bipolar I disorder (BD). To do so, the Bipolar Disorder Etiology Scale (BDES), based on psychological behaviorism, was developed and validated. Using the BDES, common factors related to both major depressive disorder (MDD) and BD and specific factors related only to BD were investigated. The BDES, which measures 17 factors based on psychological behaviorism hypotheses, was developed and validated. This scale was administered to 113 non-clinical control subjects, 30 subjects with MDD, and 32 people with BD. ANOVA and post hoc analyses were conducted. Subscales on which MDD and BD groups scored higher than controls were classified as common factors, while those on which the BD group scored higher than MDD and control groups were classified as specific factors. The BDES has acceptable reliability and validity. Twelve common factors influence both MDD and BD and one specific factor influences only BD. Common factors include the following: learning grandiose self-labeling, learning dangerous behavior, reinforcing impulsive behavior, exposure to irritability, punishment of negative emotional expression, lack of support, sleep problems, antidepressant problems, positive arousal to threat, lack of social skills, and pursuit of short-term pleasure. The specific factor is manic emotional response. Manic emotional response was identified as a specific factor related to the onset of BD, while parents' grandiose labeling is a candidate for a specific factor. Many factors are related to the onset of both MDD and BD.
Marshall, David F; Walker, Sara J; Ryan, Kelly A; Kamali, Masoud; Saunders, Erika F H; Weldon, Anne L; Adams, Kenneth M; McInnis, Melvin G; Langenecker, Scott A
2012-12-30
Measures of cognitive dysfunction in Bipolar Disorder (BD) have identified state and trait dependent metrics. An influence of substance abuse (SUD) on BD has been suggested. This study investigates potential differential, additive, or interactive cognitive dysfunction in bipolar patients with or without a history of SUD. Two hundred fifty-six individuals with BD, 98 without SUD and 158 with SUD, and 97 Healthy Controls (HC) completed diagnostic interviews, neuropsychological testing, and symptom severity scales. The BD groups exhibited poorer performance than the HC group on most cognitive factors. The BD with SUD exhibited significantly poorer performance than BD without SUD in visual memory and conceptual reasoning/set-shifting. In addition, a significant interaction effect between substance use and depressive symptoms was found for auditory memory and emotion processing. BD patients with a history of SUD demonstrated worse visual memory and conceptual reasoning skills above and beyond the dysfunction observed in these domains among individuals with BD without SUD, suggesting greater impact on integrative, gestalt-driven processing domains. Future research might address longitudinal outcome as a function of BD, SUD, and combined BD/SUD to evaluate neural systems involved in risk for, and effects of, these illnesses. Published by Elsevier Ireland Ltd.
Directory of Open Access Journals (Sweden)
Takuya Ishida
2017-06-01
Full Text Available Background: Little is known regarding interhemispheric functional connectivity (FC abnormalities via the corpus callosum in subjects with bipolar disorder (BD, which might be a key pathophysiological basis of emotional processing alterations in BD. Methods: We performed tract-based spatial statistics (TBSS using diffusion tensor imaging (DTI in 24 healthy control (HC and 22 BD subjects. Next, we analyzed the neural networks with independent component analysis (ICA in 32HC and 25 BD subjects using resting-state functional magnetic resonance imaging. Results: In TBSS analysis, we found reduced fractional anisotropy (FA in the corpus callosum of BD subjects. In ICA, functional within-connectivity was reduced in two clusters in the sensorimotor network (SMN (right and left primary somatosensory areas of BD subjects compared with HCs. FC between the two clusters and FA values in the corpus callosum of BD subjects was significantly correlated. Further, the functional within-connectivity was related to Young Mania Rating Scale (YMRS total scores in the right premotor area in the SMN of BD subjects. Limitations: Almost all of our BD subjects were taking several medications which could be a confounding factor. Conclusions: Our findings suggest that interhemispheric FC dysfunction in the SMN is associated with the impaired nerve fibers in the corpus callosum, which could be one of pathophysiological bases of emotion processing dysregulation in BD patients. Keywords: Neuroscience, Medical imaging, Psychiatry
Using theatre to address mental illness stigma: a knowledge translation study in bipolar disorder.
Michalak, Erin E; Livingston, James D; Maxwell, Victoria; Hole, Rachelle; Hawke, Lisa D; Parikh, Sagar V
2014-01-01
Reduction of the stigma of mental illness is an international priority; arts- and contact-based approaches represent a promising mode of intervention. This project was designed to explore the impact of a one-woman theatrical performance on attitudes towards bipolar disorder (BD) on people with BD and healthcare providers. A playwright and actress who lives with BD developed a stage performance - 'That's Just Crazy Talk' - targeting stigmatizing attitudes towards BD. Prospective, longitudinal and sequential mixed methods were used to assess the impact of the performance on people with BD (n = 80) and healthcare providers (n = 84). Qualitative interviews were conducted with 33 participants (14 people with BD and 19 healthcare providers). Quantitatively, healthcare providers showed significantly improved attitudes immediately post-performance, but this change was not maintained over time; people with BD showed little quantitative change. Qualitatively, both people with BD and BD healthcare providers showed enduring and broadly positive changes. A theatrical presentation designed to reduce stigma produced immediate impact on healthcare providers quantitatively and significant qualitative impact on people with BD and healthcare providers. Additionally, the utility of using mixed-method approaches in mental health research was demonstrated.
Thyroid Autoimmunity and Behçet’s Disease: Is There a Significant Association?
Directory of Open Access Journals (Sweden)
Filiz Cebeci
2013-01-01
Full Text Available Background. Behcet’s disease (BD could be regarded as an autoimmune disease in many aspects. Autoimmune thyroid disease (ATD is frequently accompanied by other various autoimmune diseases. Nevertheless, there is not still enough data showing the association between BD and ATD. In addition, no controlled study is present in the PubMed, which evaluates thyroidal autoimmunity using antithyroid peroxidase antibody in a large series of patients with BD. Methods. We aimed to investigate the frequency of ATD in patients with BD. The study included 124 patients with BD and 99 age- and sex-matched healthy volunteers. Results. Autoimmune thyroiditis was noted in 21 cases (16.9% with BD. In the control group, 22 cases (22.22% were diagnosed as autoimmune thyroiditis. There was no difference between the groups in respect to thyroid autoantibodies (. There were no statistically significant differences between baseline TSH levels of the BD patients and of the controls (. Statistically, the mean serum free T4 levels of the patients with BD were higher than those of the controls (. Conclusions. No association could be found between BD and ATD. Therefore, it is not of significance to investigate thyroid autoimmunity in BD.
Yao, Jiashu; Xu, You; Qin, Yanhua; Liu, Jing; Shen, Yuedi; Wang, Wei; Chen, Wei
2015-01-01
Background Bipolar disorder types I (BD I) and II (BD II) behave differently in clinical manifestations, normal personality traits, responses to pharmacotherapies, biochemical backgrounds and neuroimaging activations. How the varied emotional states of BD I and II are related to the comorbid personality disorders remains to be settled. Methods We therefore administered the Plutchick – van Praag Depression Inventory (PVP), the Mood Disorder Questionnaire (MDQ), the Hypomanic Checklist-32 (HCL-32), and the Parker Personality Measure (PERM) in 37 patients with BD I, 34 BD II, and in 76 healthy volunteers. Results Compared to the healthy volunteers, patients with BD I and II scored higher on some PERM styles, PVP, MDQ and HCL-32 scales. In BD I, the PERM Borderline style predicted the PVP scale; and Antisocial predicted HCL-32. In BD II, Borderline, Dependant, Paranoid (-) and Schizoid (-) predicted PVP; Borderline predicted MDQ; Passive-Aggressive and Schizoid (-) predicted HCL-32. In controls, Borderline and Narcissistic (-) predicted PVP; Borderline and Dependant (-) predicted MDQ. Conclusion Besides confirming the different predictability of the 11 functioning styles of personality disorder to BD I and II, we found that the prediction was more common in BD II, which might underlie its higher risk of suicide and poorer treatment outcome. PMID:25625553
Executive functioning and alcohol binge drinking in university students.
Parada, María; Corral, Montserrat; Mota, Nayara; Crego, Alberto; Rodríguez Holguín, Socorro; Cadaveira, Fernando
2012-02-01
Binge drinking (BD) is prevalent among college students. Studies on alcoholism have shown that the prefrontal cortex is vulnerable to the neurotoxic effects of alcohol. The prefrontal cortex undergoes both structural and functional changes during adolescence and young adulthood. Sex differences have been observed in brain maturation and in alcohol-induced damage. The objective of the present study was to analyze the relationship between BD and cognitive functions subserved by the prefrontal cortex in male and female university students. The sample comprised 122 undergraduates (aged 18 to 20 years): 62 BD (30 females) and 60 non-BD (29 females). Executive functions were assessed by WMS-III (Backward Digit Span and Backward Spatial Span), SOPT (abstract designs), Letter Fluency (PMR), BADS (Zoo Map and Key Search) and WCST-3. BD students scored lower in the Backward Digit Span Subtest and generated more perseverative responses in the SOPT In relation to interaction BD by sex, BD males scored lower in the Backward Digit Span test than BD females and non-BD males. BD is associated with poorer performance of executive functions subserved by the dorsolateral prefrontal cortex. The results do not support enhanced vulnerability of women to alcohol neurotoxic effects. These difficulties may reflect developmental delay or frontal lobe dysfunction. Copyright © 2011 Elsevier Ltd. All rights reserved.
Assessment of the hepatitis B birth dose vaccination program, Papua New Guinea, 2014.
Wiesen, Eric; Lagani, William; Sui, Gerard; Arava, Johnnie; Reza, Salim; Diorditsa, Sergey; Lin, Yung-Ching
2016-01-12
Papua New Guinea (PNG) implemented hepatitis B birth dose (BD) vaccination in 2005 yet since that time coverage has remained low, allowing mother-to-child transmission to occur. We conducted a field assessment of the BD vaccination program to develop strategies for improving the BD coverage. We selected five provinces with higher hepatitis B prevalence and five with lower prevalence based on the results of a 2013 hepatitis B serological survey. Within each province, we interviewed district and provincial health officers, health workers, village volunteers, and caregivers from ten randomly selected health facilities. Data were collected on knowledge, practice, vaccine management and data recording/reporting. To identify enabling factors and barriers, we compared health facilities with higher BD coverage with those with lower coverage, and compared caregivers whose children received BD with those whose children did not. Overall timely BD coverage was 31% and BD vaccination was taking place in 81% of sampled health facilities. Lack of cold chain and vaccine were the major reasons for not providing the BD. Insufficiencies in supervision, vaccine management, community outreach, and data management were identified as obstacles to achieving high timely hepatitis B BD coverage. Good supervision, knowledge of hepatitis B and hepatitis B vaccination, antenatal care including information about the hepatitis B BD, provision of vaccine refrigerators in maternity wards, and outreach vaccination for home deliveries were associated with higher timely BD coverage. Several steps will likely be effective in improving BD coverage: strengthening training and supervision among health workers and officers, educating caregivers on the benefits of the BD and delivery in health facilities, improving vaccine management, and improving data quality. Considerable effort and leadership will be needed to achieve these steps. Copyright © 2015. Published by Elsevier Ltd.
Park, Jong Myoung; Song, Hyohak; Lee, Hee Jong; Seung, Doyoung
2013-09-01
Klebsiella oxytoca naturally produces a large amount of 2,3-butanediol (2,3-BD), a promising bulk chemical with wide industrial applications, along with various byproducts. In this study, the in silico gene knockout simulation of K. oxytoca was carried out for 2,3-BD overproduction by inhibiting the formation of byproducts. The knockouts of ldhA and pflB genes were targeted with the criteria of maximization of 2,3-BD production and minimization of byproducts formation. The constructed K. oxytoca ΔldhA ΔpflB strain showed higher 2,3-BD yields and higher final concentrations than those obtained from the wild-type and ΔldhA strains. However, the simultaneous deletion of both genes caused about a 50 % reduction in 2,3-BD productivity compared with K. oxytoca ΔldhA strain. Based on previous studies and in silico investigation that the agitation speed during 2,3-BD fermentation strongly affected cell growth and 2,3-BD synthesis, the effect of agitation speed on 2,3-BD production was investigated from 150 to 450 rpm in 5-L bioreactors containing 3-L culture media. The highest 2,3-BD productivity (2.7 g/L/h) was obtained at 450 rpm in batch fermentation. Considering the inhibition of acetoin for 2,3-BD production, fed-batch fermentations were performed using K. oxytoca ΔldhA ΔpflB strain to enhance 2,3-BD production. Altering the agitation speed from 450 to 350 rpm at nearly 10 g/L of acetoin during the fed-batch fermentation allowed for the production of 113 g/L 2,3-BD, with a yield of 0.45 g/g, and for the production of 2.1 g/L/h of 2,3-BD.
Byrne, Allison Q; Rothstein, Andrew P; Poorten, Thomas J; Erens, Jesse; Settles, Matthew L; Rosenblum, Erica Bree
2017-11-01
One of the most devastating emerging pathogens of wildlife is the chytrid fungus, Batrachochytrium dendrobatidis (Bd), which affects hundreds of amphibian species around the world. Genomic data from pure Bd cultures have advanced our understanding of Bd phylogenetics, genomic architecture and mechanisms of virulence. However, pure cultures are laborious to obtain and whole-genome sequencing is comparatively expensive, so relatively few isolates have been genetically characterized. Thus, we still know little about the genetic diversity of Bd in natural systems. The most common noninvasive method of sampling Bd from natural populations is to swab amphibian skin. Hundreds of thousands of swabs have been collected from amphibians around the world, but Bd DNA collected via swabs is often low in quality and/or quantity. In this study, we developed a custom Bd genotyping assay using the Fluidigm Access Array platform to amplify 192 carefully selected regions of the Bd genome. We obtained robust sequence data for pure Bd cultures and field-collected skin swabs. This new assay has the power to accurately discriminate among the major Bd clades, recovering the basic tree topology previously revealed using whole-genome data. Additionally, we established a critical value for initial Bd load for swab samples (150 Bd genomic equivalents) above which our assay performs well. By leveraging advances in microfluidic multiplex PCR technology and the globally distributed resource of amphibian swab samples, noninvasive skin swabs can now be used to address critical spatial and temporal questions about Bd and its effects on declining amphibian populations. © 2017 John Wiley & Sons Ltd.
Behcet disease combined with Sjogren syndrome: A unique case report and literature review.
Ju, Fang-He; Xu, Ting-Zhen; Hong, Hui-Hua; Mao, He; Wang, Meng; Wang, Zhen
2018-03-01
Behcet disease(BD) and Sjogren syndrome(SS) are separate conditions that rarely concomitantly affect an individual. In theory,mild symptoms of patients with BD or SS are easy to igore and,thus,remain undiagnosed. There,it is reasonable to believe there may be some clinical cases of combined diseases that go undiscovered and which needs to be taken seriously. In addition,it has been suggested that herpes simplex virus(HSV) types 1 and 2 are associated with BD,but have not been shown to be correlated to the direct pathogenesis of BD. The role of HSV in BD needs more research and attention. Here,we report a young woman who had both BD and SS. The first symptom of the disease was fever. However,the HSV type 1 IgG and HSV type 2 IgM antibody results were positive in our case and,which rendered this case unique. BD and SS concomitantly affect the individual,and BD was the acute type. IV methylprednisolone was used for 9 days and then oral glucocorticoids was used to instead,and the treatment works very well. BD and SS can concomitantly affect an individual,and we believe that HSV-2 may be directly related to the pathogenesis of BD. The nature of BD as an auto-inflammatory disorder, autoimmune disorder, or both, is controversial. If we can find more patients who combined affected these two disease, it might helpful for us to understand the nature of BD. For patients with clinical diagnosis of BD or SS,we need to be alert that it may combinded the other disease. Long term follow up and detailed inspection are important means to avoid undiscovered.
Kahan, Natan R; Silverman, Barbara; Liphshitz, Irena; Waitman, Dan-Andrei; Ben-Zion, Itzhak; Ponizovsky, Alexander M; Weizman, Abraham; Grinshpoon, Alexander
2018-03-01
An association between bipolar disorder (BD) and cancer risk has been reported. The purpose of this study was to investigate this association through linkage analysis of a national HMO database and a national cancer registry. All members of the Leumit Health Services (LHS) HMO of Israel from 2000 to 2012 were included. Members with a recorded diagnosis of BD and a record of at least one written or dispensed prescription for pharmacotherapy for treatment of BD were classified as patients with BD. We linked the LHS population with the Israel National Cancer Registry database to capture all cases of cancer reported. Standardized incidence ratios (SIRs) for cancer in the BD population as compared with non-BD LHS members were calculated. A total of 870 323 LHS members were included in the analysis; 3304 of whom met the criteria for inclusion in the BD arm. We identified 24 515 and 110 cancer cases among members without BD and with BD, respectively. Persons with BD were no more likely than other HMO members to be diagnosed with cancer during the follow-up period [SIR, males=0.91, 95% confidence interval (CI): 0.66-1.22; SIR, females=1.15, 95% CI: 0.89-1.47]. Sensitivity analysis using different criteria for positive BD classification (lithium treatment alone or registered physician diagnosis) had no effect on the estimate of cancer risk. A nonstatistically significant association between breast cancer and BD among women was observed (SIR=1.24, 95% CI: 0.79-1.86). These findings do not corroborate previously reported associations between BD and elevated cancer risk.
Lauhkonen, Eero; Riikonen, Riikka; Törmänen, Sari; Koponen, Petri; Nuolivirta, Kirsi; Helminen, Merja; Toikka, Jyri; Korppi, Matti
2018-05-01
The transition from early childhood wheezing to persistent asthma is linked to lung function impairment over time. Little is known how the methods used to study lung function at different ages correlate longitudinally. Sixty-four children with a history of hospitalization for bronchiolitis before 6 months of age were prospectively studied with impulse oscillometry (IOS) at the mean age of 6.3 years and these preschool IOS results were compared with flow-volume spirometry (FVS) measurements at mean age of 11.4 years. The baseline respiratory system resistance at 5 Hz (Rrs5) showed a modest statistically significant correlation with all baseline FVS parameters except FVC. The post-bronchodilator (post-BD) Rrs5 showed a modest statistically significant correlation with post-BD FEV 1 and FEV 1 /FVC. The bronchodilator-induced decrease in Rrs5 showed a modest statistically significant correlation with the percent increase in FEV 1 . Baseline and post-BD respiratory reactance at 5 Hz (Xrs5) showed a modest statistically significant correlation with baseline and post-BD FVS parameters except post-BD FEV 1 /FVC, respectively, and post-BD Xrs5 showed a strong correlation with post-BD FVC (ρ = 0.61) and post-BD FEV 1 (ρ = 0.59). In adjusted linear regression, preschool Xrs5 remained as a statistically significant independent predictor of FVS parameters in adolescence; the one-unit decrease in the Z-score of preschool post-BD Xrs5 predicted 9.6% lower post-BD FEV 1 , 9.3% lower post-BD FVC, and 9.7% lower post-BD MEF 50 when expressed as %-predicted parameters. Persistent post-BD small airway impairment in children with a history of bronchiolitis detected with IOS at preschool age predicted FVS results measured in early adolescence. © 2018 Wiley Periodicals, Inc.
Expression of host defense peptides in the intestine of Eimeria-challenged chickens.
Su, S; Dwyer, D M; Miska, K B; Fetterer, R H; Jenkins, M C; Wong, E A
2017-07-01
Avian coccidiosis is caused by the intracellular protozoan Eimeria, which produces intestinal lesions leading to weight gain depression. Current control methods include vaccination and anticoccidial drugs. An alternative approach involves modulating the immune system. The objective of this study was to profile the expression of host defense peptides such as avian beta-defensins (AvBDs) and liver expressed antimicrobial peptide 2 (LEAP2), which are part of the innate immune system. The mRNA expression of AvBD family members 1, 6, 8, 10, 11, 12, and 13 and LEAP2 was examined in chickens challenged with either E. acervulina, E. maxima, or E. tenella. The duodenum, jejunum, ileum, and ceca were collected 7 d post challenge. In study 1, E. acervulina challenge resulted in down-regulation of AvBD1, AvBD6, AvBD10, AvBD11, AvBD12, and AvBD13 in the duodenum. E. maxima challenge caused down-regulation of AvBD6, AvBD10, and AvBD11 in the duodenum, down-regulation of AvBD10 in the jejunum, but up-regulation of AvBD8 and AvBD13 in the ceca. E. tenella challenge showed no change in AvBD expression in any tissue. In study 2, which involved challenge with only E. maxima, there was down-regulation of AvBD1 in the ileum, AvBD11 in the jejunum and ileum, and LEAP2 in all 3 segments of the small intestine. The expression of LEAP2 was further examined by in situ hybridization in the jejunum of chickens from study 2. LEAP2 mRNA was expressed similarly in the enterocytes lining the villi, but not in the crypts of control and Eimeria challenged chickens. The lengths of the villi in the Eimeria challenged chickens were less than those in the control chickens, which may in part account for the observed down-regulation of LEAP2 mRNA quantified by PCR. Overall, the AvBD response to Eimeria challenge was not consistent; whereas LEAP2 was consistently down-regulated, which suggests that LEAP2 plays an important role in modulating an Eimeria infection. Published by Oxford University Press on
Chestnut, Tara E.; Anderson, Chauncey; Popa, Radu; Blaustein, Andrew R.; Voytek, Mary; Olson, Deanna H.; Kirshtein, Julie
2014-01-01
Biodiversity losses are occurring worldwide due to a combination of stressors. For example, by one estimate, 40% of amphibian species are vulnerable to extinction, and disease is one threat to amphibian populations. The emerging infectious disease chytridiomycosis, caused by the aquatic fungus Batrachochytrium dendrobatidis (Bd), is a contributor to amphibian declines worldwide. Bd research has focused on the dynamics of the pathogen in its amphibian hosts, with little emphasis on investigating the dynamics of free-living Bd. Therefore, we investigated patterns of Bd occupancy and density in amphibian habitats using occupancy models, powerful tools for estimating site occupancy and detection probability. Occupancy models have been used to investigate diseases where the focus was on pathogen occurrence in the host. We applied occupancy models to investigate free-living Bd in North American surface waters to determine Bd seasonality, relationships between Bd site occupancy and habitat attributes, and probability of detection from water samples as a function of the number of samples, sample volume, and water quality. We also report on the temporal patterns of Bd density from a 4-year case study of a Bd-positive wetland. We provide evidence that Bd occurs in the environment year-round. Bd exhibited temporal and spatial heterogeneity in density, but did not exhibit seasonality in occupancy. Bd was detected in all months, typically at less than 100 zoospores L−1. The highest density observed was ∼3 million zoospores L−1. We detected Bd in 47% of sites sampled, but estimated that Bd occupied 61% of sites, highlighting the importance of accounting for imperfect detection. When Bd was present, there was a 95% chance of detecting it with four samples of 600 ml of water or five samples of 60 mL. Our findings provide important baseline information to advance the study of Bd disease ecology, and advance our understanding of amphibian exposure
Wang, Ai-Hong; Ma, Qian; Wang, Xin; Xu, Gui-Hua
2018-02-01
Inflammation has a role in the cerebral injury induced by ischemia and the present study aimed to determine the mechanism of the protective effect of beef decoction (BD) with carnosine against it. A rat model of permanent middle cerebral artery occlusion was established using a suture method in the vehicle and each of the BD groups. In experiment 1, 72 Sprague Dawley (SD) rats were randomly divided into three groups: Sham, vehicle and BD-treated group. Rats in the BD group were given 600 mg/kg BD by oral gavage for 1, 3 and 7 days. The sham and vehicle group rats received an equivalent amount of normal saline. In experiment 2, 60 SD rats were randomly divided into six groups: Sham-operated I, sham-operated II, vehicle, low-dose BD, medium-dose BD and high-dose BD group. Rats in the low-, medium- and high-dose BD groups were given BD at the dose of 200, 400 and 600 mg/kg, respectively, by oral gavage for 7 days. Rats in the sham-operated II group were given 600 mg/kg BD. Rats in the sham-operated I group and vehicle group were given the same volume of normal saline by oral gavage. The body weight, neurological deficits and infarct volume were recorded at 1, 3 and 7 days after the operation. Furthermore, the effect of different doses of BD on interleukin-6 (IL-6), tumor necrosis factor-α (TNF-α), interferon-γ (IFN-γ) and interleukin-4 (IL-4) levels in peripheral blood was measured at 7 days. BD-treated rats showed less neurological deficits and a smaller infarct volume at 7 days. BD at 400 and 600 mg/kg significantly decreased the infarct volume in rats. At 600 mg/kg BD, a decline in IL-6, TNF-α, IFN-γ and an increase in IL-4 expression was observed in the BD groups, while no difference in body weight and neurological dysfunction was detected. In conclusion, BD is a neuroprotective agent that may be used as a supplement treatment of ischemic stroke.
Evidence for acquisition of virulence effectors in pathogenic chytrids
Directory of Open Access Journals (Sweden)
Summers Kyle
2011-07-01
Full Text Available Abstract Background The decline in amphibian populations across the world is frequently linked to the infection of the chytrid fungus Batrachochytrium dendrobatidis (Bd. This is particularly perplexing because Bd was only recently discovered in 1999 and no chytrid fungus had previously been identified as a vertebrate pathogen. Results In this study, we show that two large families of known virulence effector genes, crinkler (CRN proteins and serine peptidases, were acquired by Bd from oomycete pathogens and bacteria, respectively. These two families have been duplicated after their acquisition by Bd. Additional selection analyses indicate that both families evolved under strong positive selection, suggesting that they are involved in the adaptation of Bd to its hosts. Conclusions We propose that the acquisition of virulence effectors, in combination with habitat disruption and climate change, may have driven the Bd epidemics and the decline in amphibian populations. This finding provides a starting point for biochemical investigations of chytridiomycosis.
Bobo, William V; Na, Peter J; Geske, Jennifer R; McElroy, Susan L; Frye, Mark A; Biernacka, Joanna M
2018-01-01
To compare the relative influence (RI) of individual predictors for lifetime attempted suicide between adults with bipolar I (BDBD-I) and bipolar II disorder (BDBD-II). We conducted an analysis of data from 1465 enrollees in the Mayo Clinic Bipolar Disorder Biobank. Demographic and clinical variables and history of attempted suicide were ascertained using standardized questionnaires. Height and weight were assessed to determine body mass index (BMI); obesity was defined as BMI ≥30kg/m 2 . The frequencies of these variables were compared between persons with and without self-reported lifetime suicide attempts both overall, and within BD-I and BD-II subgroups. Gradient boosting machine (GBM) models were used to quantify the RI of study variables on the risk of lifetime attempted suicide. Nearly one-third of patients reported having a lifetime suicide attempt. Attempted suicide rates were higher in patients with BD-I than BD-II, but absolute differences were small. Lifetime attempted suicide was associated with female sex, BD-I subtype, psychiatric and substance use comorbidities, binge eating behavior, lifetime history of rapid cycling, other indicators of adverse illness course, and early age of bipolar illness onset in the entire cohort. Differences in the rank-ordering of RI for predictors of attempted suicide between BD-I and BD-II patients were modest. Rapid cycling was a strong risk factor for attempted suicide, particularly in men with BD-I. Actively psychotic or suicidal patients needing psychiatric hospitalization were initially excluded, but were approached after these acute psychiatric problems resolved. The prevalence of lifetime attempted suicide was significantly higher in BD-I than BD-II in this large, cross-sectional cohort. Predictors of attempted suicide were similar in BD-I and BD-II subgroups. Copyright © 2017. Published by Elsevier B.V.
DEFF Research Database (Denmark)
Andreassen, Ole A; Thompson, Wesley K; Schork, Andrew J
2013-01-01
are currently lacking. Here, we use a genetic pleiotropy-informed conditional false discovery rate (FDR) method on GWAS summary statistics data to identify new loci associated with schizophrenia (SCZ) and bipolar disorders (BD), two highly heritable disorders with significant missing heritability...... associated with both SCZ and BD (conjunction FDR). Together, these findings show the feasibility of genetic pleiotropy-informed methods to improve gene discovery in SCZ and BD and indicate overlapping genetic mechanisms between these two disorders....
Yoshimi, Noriko; Futamura, Takashi; Kakumoto, Keiji; Salehi, Alireza M.; Sellgren, Carl M.; Holmén-Larsson, Jessica; Jakobsson, Joel; Pålsson, Erik; Landén, Mikael; Hashimoto, Kenji
2016-01-01
Background: Bipolar disorder (BD) is a severe and debilitating psychiatric disorder. However, the precise biological basis remains unknown, hampering the search for novel biomarkers. We performed a metabolomics analysis to discover novel peripheral biomarkers for BD. Methods: We quantified serum levels of 116 metabolites in mood-stabilized male BD patients (n = 54) and age-matched male healthy controls (n = 39). Results: After multivariate logistic regression, serum levels of pyruvate, N-acet...
Right hilar mass with hemoptysis: An unusual presentation of uncommon disorder
Directory of Open Access Journals (Sweden)
Asmita A Mehta
2011-01-01
Full Text Available Common differential diagnosis of lung and hilar opacity includes infectious pathology or a mitotic lesion. Behcet′s disease (BD is a rarely diagnosed disease in Indian subcontinent. BD is a multisystem inflammatory disorder that presents with recurrent orogenital ulceration, uveitis, and erythema nodosum. We present here the case of a patient who presented with recurrent hemoptysis with radiological picture of hilar mass, during the evaluation of which the diagnosis of BD was established.
Biatriosporin D displays anti-virulence activity through decreasing the intracellular cAMP levels
Energy Technology Data Exchange (ETDEWEB)
Zhang, Ming; Chang, Wenqiang; Shi, Hongzhuo; Zhou, Yanhui; Zheng, Sha; Li, Ying; Li, Lin; Lou, Hongxiang, E-mail: louhongxiang@sdu.edu.cn
2017-05-01
Candidiasis has long been a serious human health problem, and novel antifungal approaches are greatly needed. During both superficial and systemic infection, C. albicans relies on a battery of virulence factors, such as adherence, filamentation, and biofilm formation. In this study, we found that a small phenolic compound, Biatriosporin D (BD), isolated from an endolichenic fungus, Biatriospora sp., displayed anti-virulence activity by inhibiting adhesion, hyphal morphogenesis and biofilm formation of C. albicans. Of note is the high efficacy of BD in preventing filamentation with a much lower dose than its MIC value. Furthermore, BD prolonged the survival of worms infected by C. albicans in vivo. Quantitative real-time PCR analysis, exogenous cAMP rescue experiments and intracellular cAMP measurements revealed that BD regulates the Ras1-cAMP-Efg1 pathway by reducing cAMP levels to inhibit the hyphal formation. Further investigation showed that BD could upregulate Dpp3 to synthesize much more farnesol, which could inhibit the activity of Cdc35 and reduce the generation of cAMP. Taken together, these findings indicate that BD stimulates the expression of Dpp3 to synthesize more farnesol that directly inhibits the Cdc35 activity, reducing intracellular cAMP and thereby disrupting the morphologic transition and attenuating the virulence of C. albicans. Our study uncovers the underlying mechanism of BD as a prodrug in fighting against pathogenic C. albicans and provides a potential application of BD in fighting clinically relevant fungal infections by targeting fungal virulence. - Highlights: • BD inhibits the filamentation of C. albicans in multiple hypha-inducing conditions. • BD can prolong the survival of nematodes infected by C. albicans. • BD stimulates the expression of Dpp3 to synthesize more farnesol. • BD reduces intracellular cAMP and regulates Ras1-cAMP-PKA pathway.
The Effect of Human Impact on Batrachochytrium dendrobatidis prevalence in Taricha torosa
Deng, V.; Macario, E.; Tumey, C.
2014-12-01
Batrachochytrium dendrobatidis (Bd) is emerging as a major cause of the amphibian extinction. As amphibians serve an important role as indicator species in their ecosystem and play a vital role in the food chain, Bd will not only affect the amphibian population but also the health of the environment. Bd is an aquatic fungus that blocks the porous skin of amphibians which interrupts electrolyte, gas and water transfer. This imbalances the electrolyte system which causes cells and organs to malfunction, therefore killing the amphibian. While frogs are more common for Bd, it is not often found in newts. However, Dr. Vance Vredenburg recently found an outbreak of Bd in Taricha torosa in Marin Headlands, California. This location was used in the research as the sample site with most human impact and was expected to have the highest prevalence according to the proposed hypothesis that more human impact will correspond with a higher prevalence of Bd. Decreasing the level of human impact, Fairfield Osborn Preserve and Galbreath Preserve were picked as the other sample sites. After the samples went through qPCR, all of them came back negative for Bd. These results did not support the hypothesis, however, it contributed data to explaining the dynamics of Bd when combined with Dr. Vance Vredenburg's data from 2 months earlier. Within the two months, there was a huge difference in the prevalence of Bd as it dropped from 88% to 0%. This shows that Taricha torosa does in fact get Bd. However, it is rarely detected because Bd is fast-acting and has high mortality rates. Therefore, it is least likely for current nonspecific surveys to swab the newts during a short but lethal Bd outbreak.
Directory of Open Access Journals (Sweden)
Liwen Zhang
2015-01-01
Conclusions: BD patients showed less activation in the PCC/precuneus during other-reflection. This may support an account of impaired integration of emotion and memory (evaluation of past and current other-related information in BD patients. Correlation differences of the PCC/precuneus activation with the cognitive insight in patients with BD and SZ might reflect an important difference between these disorders, which may help to further explore potentially distinguishing markers.
Dima, Danai; de Jong, Simone; Breen, Gerome; Frangou, Sophia
2016-01-01
Genome-wise association studies have identified a number of common single-nucleotide polymorphisms (SNPs), each of small effect, associated with risk to bipolar disorder (BD). Several risk-conferring SNPs have been individually shown to influence regional brain activation thus linking genetic risk for BD to altered brain function. The current study examined whether the polygenic risk score method, which models the cumulative load of all known risk-conferring SNPs, may be useful in the identification of brain regions whose function may be related to the polygenic architecture of BD. We calculated the individual polygenic risk score for BD (PGR-BD) in forty-one patients with the disorder, twenty-five unaffected first-degree relatives and forty-six unrelated healthy controls using the most recent Psychiatric Genomics Consortium data. Functional magnetic resonance imaging was used to define task-related brain activation patterns in response to facial affect and working memory processing. We found significant effects of the PGR-BD score on task-related activation irrespective of diagnostic group. There was a negative association between the PGR-BD score and activation in the visual association cortex during facial affect processing. In contrast, the PGR-BD score was associated with failure to deactivate the ventromedial prefrontal region of the default mode network during working memory processing. These results are consistent with the threshold-liability model of BD, and demonstrate the usefulness of the PGR-BD score in identifying brain functional alternations associated with vulnerability to BD. Additionally, our findings suggest that the polygenic architecture of BD is not regionally confined but impacts on the task-dependent recruitment of multiple brain regions.
BIG DATA ANALYTICS USE IN CUSTOMER RELATIONSHIP MANAGEMENT: ANTECEDENTS AND PERFORMANCE IMPLICATIONS
Suoniemi, Samppa; Meyer-Waarden, Lars; Munzel, Andreas
2016-01-01
Customer information plays a key role in managing successful relationships with valuable customers. Big data analytics use (BD use), i.e., the extent to which customer information derived from big data analytics guides marketing decisions, helps firms better meet customer needs for competitive advantage. This study aims to (1) determine whether organizational BD use improves customer-centric and financial outcomes, and (2) identify the factors influencing BD use. Drawing primarily from market...
Perry, William; McIlwain, Meghan; Kloezeman, Karen; Henry, Brook L.; Minassian, Arpi
2016-01-01
Increased energy or activity is now an essential feature of the mania of Bipolar Disorder (BD) according to DSM-5. This study examined whether objective measures of increased energy can differentiate manic BD individuals and provide greater diagnostic accuracy compared to rating scales, extending the work of previous studies with smaller samples. We also tested the relationship between objective measures of energy and rating scales. 50 hospitalized manic BD patients were compared to healthy s...
Efficacy of infliximab in refractory posterior uveitis in Behcet's disease patients
Ayman K. El Garf; Amira A. Shahin; Sherif A. Shawky; Mohammed A. Azim; Dina A. Effat; Sherry K. Abdelrahman
2018-01-01
Aim of the work: Ocular manifestations are the main cause of morbidity in Behcet's disease (BD). Infliximab (IFX), a chimeric monoclonal antibody directed against tumor necrosis factor-alpha, may be efficient in refractory uveitis due to BD. The aim of this study was to assess the efficacy and safety of IFX in the treatment of patients with BD-associated refractory posterior uveitis (PU). Patient and Methods: Twenty patients with refractory Behcet's PU received IFX therapy as intravenous infu...
Bipolar II disorder as a risk factor for postpartum depression.
Mandelli, Laura; Souery, Daniel; Bartova, Lucie; Kasper, Siegfried; Montgomery, Stuart; Zohar, Joseph; Mendlewicz, Julien; Serretti, Alessandro
2016-11-01
There is evidence for a bipolar diathesis in postpartum depression (PPD) and women presenting with a first PPD frequently receive a diagnosis of bipolar type II disorder (BD-II). However formal evidence for an association between BD-II and PPD has not yet been reported. In the present study we tested a potential association between BD-II and PPD. Parous women with a diagnosis of bipolar type I disorder (BD-I) (n=93), BD-II (n=36) or major depressive disorder (MDD) (n=444) were considered in the present study. All women were retrospectively evaluated for history of PPD (DSM-IV criteria) and other clinical and socio-demographic features. Women with a history of PDD (n=139, 24%) were younger, younger at illness onset and had more family history for BD compared to women without history of PPD (n=436, 75.9%). Half of BD-II women reported PPD (50%), compared to less than one-third of BD-I and MDD women (respectively 27.5% and 21.6%) (p=0.004). Limitations include the retrospective assessment of PPD and no available data about the timing of postpartum episodes, illness onset or psychiatric care before or after childbirth, and the number of postpartum episodes. BD-II may confer a remarkable risk for PPD, which may be even higher than that of women affected by BD-I disorder. Careful monitoring of BD-II women during the pregnancy and postpartum period, as well as assessment of bipolar features in women with a PPD without a current diagnosis of BD are recommended. Copyright © 2016 Elsevier B.V. All rights reserved.
Sexual behavior in women with bipolar disorder.
Mazza, Marianna; Harnic, Desiree; Catalano, Valeria; Di Nicola, Marco; Bruschi, Angelo; Bria, Pietro; Daniele, Antonio; Mazza, Salvatore
2011-06-01
There is a lack of studies regarding sexuality and sexual behavior in women with bipolar disorder. The aim of this study is to investigate sexual behavior in women affected by bipolar disorder in order to stimulate interest and debate in this area of care. Sixty women (30 BD I and 30 BD II) consent to participate in the study and were included in the sample. Moreover, sixty female healthy subjects without histories of psychiatric disorders were recruited as normal controls. Patients and healthy subjects were given the Sexual Interest and Sexual Performance Questionnaire, a questionnaire devised to explore various aspects of sexual behavior. The results of the present study suggest an increase of sexual interest in patients with BD I as compared both with BD II patients and healthy controls. In women with BD I such increase of interest was detected on some items of section I of the Sexual Interest and Sexual Performance Questionnaire, in particular "Actual Value of Sexuality" and "Implicit Sexual Interest", which implicitly explore sexual interest without overtly focusing upon sexual problems. Moreover, we observed a higher desired frequency of intercourse in women with BD I than BD II and a higher occurrence of repeated sexual intercourse in women with BD I than BD II. The main finding of the present study was an increase of sexual interest in BD I as compared with BD II female patients and normal controls. This result was detected when sexual interest was explored implicitly. Our study is limited by the small size of our subject groups. Further investigations on larger subject samples are needed to better clarify particular aspects of sexual behavior of BD patients. Copyright © 2010 Elsevier B.V. All rights reserved.
Circadian Phase Preference in Pediatric Bipolar Disorder
Directory of Open Access Journals (Sweden)
Kerri L. Kim
2014-03-01
Full Text Available Pediatric bipolar disorder (BD rates have notably increased over the past three decades. Given the significant morbidity and mortality associated with BD, efforts are needed to identify factors useful in earlier detection to help address this serious public health concern. Sleep is particularly important to consider given the sequelae of disrupted sleep on normative functioning and that sleep is included in diagnostic criteria for both Major Depressive and Manic Episodes. Here, we examine one component of sleep—i.e., circadian phase preference with the behavioral construct of morningness/eveningness (M/E. In comparing 30 BD and 45 typically developing control (TDC participants, ages 7–17 years, on the Morningness-Eveningness Scale for Children (MESC, no between-group differences emerged. Similar results were found when comparing three groups (BD−ADHD; BD+ADHD; TDC. Consistent with data available on circadian phase preference in adults with BD, however, we found that BD adolescents, ages 13 years and older, endorsed significantly greater eveningness compared to their TDC peers. While the current findings are limited by reliance on subjective report and the high-rate of comorbid ADHD among the BD group, this finding that BD teens demonstrate an exaggerated shift towards eveningness than would be developmentally expected is important. Future studies should compare the circadian rhythms across the lifespan for individuals diagnosed with BD, as well as identify the point at which BD youth part ways with their healthy peers in terms of phase preference. In addition, given our BD sample was overall euthymic, it may be that M/E is more state vs. trait specific in latency age youth. Further work would benefit from assessing circadian functioning using a combination of rating forms and laboratory-based measures. Improved understanding of sleep in BD may identify behavioral targets for inclusion in prevention and intervention protocols.
Vasconcelos-Moreno, Mirela P.; Bücker, Joana; Bürke, Kelen P.; Czepielewski, Leticia; Santos, Barbara T.; Fijtman, Adam; Passos, Ives C.; Kunz, Mauricio; Bonnín, Caterina del Mar; Vieta i Pascual, Eduard, 1963-; Kapczinski, Flávio; Rosa, Adriane R.; Kauer-Sant'Anna, Marcia
2016-01-01
Objective: To assess cognitive performance and psychosocial functioning in patients with bipolar disorder (BD), in unaffected siblings, and in healthy controls. Methods: Subjects were patients with BD (n=36), unaffected siblings (n=35), and healthy controls (n=44). Psychosocial functioning was accessed using the Functioning Assessment Short Test (FAST). A sub-group of patients with BD (n=21), unaffected siblings (n=14), and healthy controls (n=22) also underwent a battery of neuropsychologic...
Energy Technology Data Exchange (ETDEWEB)
Wybranski, Christian, E-mail: Christian.Wybranski@uk-koeln.de [University Hospital of Cologne, Department of Diagnostic and Interventional Radiology (Germany); Pech, Maciej [Otto-von-Guericke University Medical School, Department of Radiology and Nuclear Medicine (Germany); Lux, Anke [Otto-von-Guericke University Medical School, Institute of Biometry and Medical Informatics (Germany); Ricke, Jens; Fischbach, Frank; Fischbach, Katharina [Otto-von-Guericke University Medical School, Department of Radiology and Nuclear Medicine (Germany)
2017-06-15
ObjectiveTo assess the feasibility of a hybrid approach employing MRI-guided bile duct (BD) puncture for subsequent fluoroscopy-guided biliary interventions in patients with non-dilated (≤3 mm) or dilated BD (≥3 mm) but unfavorable conditions for ultrasonography (US)-guided BD puncture.MethodsA total of 23 hybrid interventions were performed in 21 patients. Visualization of BD and puncture needles (PN) in the interventional MR images was rated on a 5-point Likert scale by two radiologists. Technical success, planning time, BD puncture time and positioning adjustments of the PN as well as technical success of the biliary intervention and complication rate were recorded.ResultsVisualization even of third-order non-dilated BD and PN was rated excellent by both radiologists with good to excellent interrater agreement. MRI-guided BD puncture was successful in all cases. Planning and BD puncture times were 1:36 ± 2.13 (0:16–11:07) min. and 3:58 ± 2:35 (1:11–9:32) min. Positioning adjustments of the PN was necessary in two patients. Repeated capsular puncture was not necessary in any case. All biliary interventions were completed successfully without major complications.ConclusionA hybrid approach which employs MRI-guided BD puncture for subsequent fluoroscopy-guided biliary intervention is feasible in clinical routine and yields high technical success in patients with non-dilated BD and/or unfavorable conditions for US-guided puncture. Excellent visualization of BD and PN in near-real-time interventional MRI allows successful cannulation of the BD.
Biatriosporin D displays anti-virulence activity through decreasing the intracellular cAMP levels
International Nuclear Information System (INIS)
Zhang, Ming; Chang, Wenqiang; Shi, Hongzhuo; Zhou, Yanhui; Zheng, Sha; Li, Ying; Li, Lin; Lou, Hongxiang
2017-01-01
Candidiasis has long been a serious human health problem, and novel antifungal approaches are greatly needed. During both superficial and systemic infection, C. albicans relies on a battery of virulence factors, such as adherence, filamentation, and biofilm formation. In this study, we found that a small phenolic compound, Biatriosporin D (BD), isolated from an endolichenic fungus, Biatriospora sp., displayed anti-virulence activity by inhibiting adhesion, hyphal morphogenesis and biofilm formation of C. albicans. Of note is the high efficacy of BD in preventing filamentation with a much lower dose than its MIC value. Furthermore, BD prolonged the survival of worms infected by C. albicans in vivo. Quantitative real-time PCR analysis, exogenous cAMP rescue experiments and intracellular cAMP measurements revealed that BD regulates the Ras1-cAMP-Efg1 pathway by reducing cAMP levels to inhibit the hyphal formation. Further investigation showed that BD could upregulate Dpp3 to synthesize much more farnesol, which could inhibit the activity of Cdc35 and reduce the generation of cAMP. Taken together, these findings indicate that BD stimulates the expression of Dpp3 to synthesize more farnesol that directly inhibits the Cdc35 activity, reducing intracellular cAMP and thereby disrupting the morphologic transition and attenuating the virulence of C. albicans. Our study uncovers the underlying mechanism of BD as a prodrug in fighting against pathogenic C. albicans and provides a potential application of BD in fighting clinically relevant fungal infections by targeting fungal virulence. - Highlights: • BD inhibits the filamentation of C. albicans in multiple hypha-inducing conditions. • BD can prolong the survival of nematodes infected by C. albicans. • BD stimulates the expression of Dpp3 to synthesize more farnesol. • BD reduces intracellular cAMP and regulates Ras1-cAMP-PKA pathway.
Directory of Open Access Journals (Sweden)
Tuti Kusumaningsih
2016-12-01
Full Text Available Background: Beta-defensins (BD are antimicrobial peptides that play a role in defense against pathogens. Beta-defensins (BD are expressed by a variety of epithelial cells, including gingival epithelium, salivary glands, saliva and salivary duct. BD-1 is expressed constitutively, while BD-2 and BD-3 expressions can be induced by commensal bacteria. Probiotics are commensal bacteria, thus L. reuteri as probiotic bacteria may act as “inducer” for BD-2 in epithelial gingiva. S. mutans is the main bacteria causing dental caries and sensitive to BD-2. Purpose: This study was aimed to prove that the administration of probiotic L. reuteri may improve BD-2 expressions in the gingiva epithelium. Method: This study was conducted in vivo using twenty-four male Rattus norvegicus Wistar strains aged 10-12 weeks and weighed 120-150 g. Those rats were randomly divided into four groups, namely negative control group (not induced with L. reuteri or S. mutans, positive control group (induced with S. mutans for 14 days, treatment group 1 (induced with L. reuteri for 14 days and S. mutans for 7 days, and treatment group 2 (induced with L. reuteri and S. mutans for 14 days concurrently. The concentration of L. reuteri used was 4x108cfu/ml, while the concentration of S. mutans was 1x 1010cfu/ml. 0.1 ml of each was dropped in the region of the mandibular incisors. BD-2 expression was calculated using immunohistochemical method. The difference of BD-2 expressions in gingival epithelial cells in the respective groups was analyzed by Anova/SPSS. Results: There were significant differences in BD-2 expressions in gingival epithelial cells in each group based on the results of Anova test (p=0.001. Conclusion: The administration of probiotic L. reuteri is able to increase BD-2 expressions in gingival epithelial cells.
Exciplex formation and excited state deactivation of difluoroborondipyrromethene (Bodipy) dyads.
Benniston, Andrew C; Copley, Graeme; Lemmetyinen, Helge; Tkachenko, Nikolai V
2010-06-07
Two series of geometrically-related dyads are discussed based on the difluoroborondipyrromethene (Bodipy) unit, and incorporating covalently attached hydroquinone/quinone groups. These units are anchored directly, or via a phenylene spacer, to the Bodipy core at the meso position in one series (BD-MHQ, BD-MQ, BD-MPHQ, BD-MPQ), but for the second series the attachment site is the 2-position (BD-SHQ, BD-SQ, BD-SPHQ, BD-SPQ). The compounds show various levels of fluorescence depending on the oxidation state of the appended group and the substitution pattern. In non-polar solvents such as toluene, diethyl ether and dichlorobenzene, the S(1) state deactivation of the Bodipy unit in BD-SPQ and BD-MPQ is dominated by (1, 3)exciplex formation, which has not been reported for Bodipy derivatives so far. In the latter molecule, the decay of the exciplex is divided between population of the Bodipy triplet state (13 %-21 %) and ground state reformation. This partitioning is not seen for the side-on substituted derivative, BD-SPQ, and only ground state reformation is observed following decay of the exciplex. This difference in behavior is explained by the radical-pair inter-system-crossing mechanism, which more effectively operates in BD-MPQ because of the orthogonality of the donor-acceptor units. In the more polar solvent CH(3)CN all the quinone derivatives show fast formation of the charge-separated state (k(CS)) followed by slower charge recombination (k(CR)). The ratio k(CS)/k(CR)
Potential brain death organ donors - challenges and prospects: A single center retrospective review
Directory of Open Access Journals (Sweden)
Yousef Al-Maslamani
2014-01-01
Full Text Available Organ donation after brain death (BD is a major source for obtaining transplantable organs for patients with end-stage organ disease (ESOD. This retrospective, descriptive study was carried out on all potential BD patients admitted in different intensive care units (ICUs of the Hamad medical Corporation (HMC, Doha, Qatar during a period from January 2011 to April 2012. Our aim was to evaluate various demographic criteria and challenges of organ donation among potential BD organ donors and plan a strategy to improve the rate of organ donation in Qatar. Various aspects of BD patients in the ICUs and their possible effects on organ donation were studied. The time intervals analyzed to determine the possible causes of delay of organ retrieval were: time of diagnosing fixed dilated pupils in the ICU, to performing the first BD test, then to the second BD test, to family approach, to organ retrieval and/or circulatory death (CD without organ retrieval. There were a total of 116 potential BD organ donors of whom 96 (82.75% were males and 20 (17.25% were females. Brain hemorrhage and head injury contributed to 37 (31.9% and 32 (27.6% BD cases, respectively. Time interval between diagnosing fixed dilated pupil and performing the first test of BD was delayed >24 h in 79% of the cases and between the first and second BD tests was >6 h in 70.8% of the cases. This delay is not compatible with the Hamad Medical Corporation (HMC policy for BD diagnosis and resulted in a low number of organs retrieved. BD organ donation, a potential source for organs to save patients with ESOD has several pitfalls and every effort should be made to increase the awareness of the public as well as medical personnel to optimize donation efficacy.
Directory of Open Access Journals (Sweden)
Erica Bree Rosenblum
Full Text Available Emerging infectious diseases are of great concern for both wildlife and humans. Several highly virulent fungal pathogens have recently been discovered in natural populations, highlighting the need for a better understanding of fungal-vertebrate host-pathogen interactions. Because most fungal pathogens are not fatal in the absence of other predisposing conditions, host-pathogen dynamics for deadly fungal pathogens are of particular interest. The chytrid fungus Batrachochytrium dendrobatidis (hereafter Bd infects hundreds of species of frogs in the wild. It is found worldwide and is a significant contributor to the current global amphibian decline. However, the mechanism by which Bd causes death in amphibians, and the response of the host to Bd infection, remain largely unknown. Here we use whole-genome microarrays to monitor the transcriptional responses to Bd infection in the model frog species, Silurana (Xenopus tropicalis, which is susceptible to chytridiomycosis. To elucidate the immune response to Bd and evaluate the physiological effects of chytridiomycosis, we measured gene expression changes in several tissues (liver, skin, spleen following exposure to Bd. We detected a strong transcriptional response for genes involved in physiological processes that can help explain some clinical symptoms of chytridiomycosis at the organismal level. However, we detected surprisingly little evidence of an immune response to Bd exposure, suggesting that this susceptible species may not be mounting efficient innate and adaptive immune responses against Bd. The weak immune response may be partially explained by the thermal conditions of the experiment, which were optimal for Bd growth. However, many immune genes exhibited decreased expression in Bd-exposed frogs compared to control frogs, suggesting a more complex effect of Bd on the immune system than simple temperature-mediated immune suppression. This study generates important baseline data for ongoing
[Predicting bipolar disorder: What can we learn from prospective cohort studies?
Geoffroy , Pierre Alexis; Leboyer , Marion; Scott , Jan
2013-01-01
International audience; INTRODUCTION: Bipolar disorder (BD) is a life course illness; and there is increasing awareness of the many personal, social and economic consequences of the illness in older adults. However, it is important to emphasize that BD usually begins in late adolescence or early adulthood and 75 % cases have a first episode in this age period. This early onset and the associated level of disability mean that BD is the 4th leading cause of global disease burden in adolescents ...
Cardoso de Almeida, Jorge Renner; Phillips, Mary Louise
2013-01-15
Differentiating bipolar disorder (BD) from recurrent unipolar depression (UD) is a major clinical challenge. Main reasons for this include the higher prevalence of depressive relative to hypo/manic symptoms during the course of BD illness and the high prevalence of subthreshold manic symptoms in both BD and UD depression. Identifying objective markers of BD might help improve accuracy in differentiating between BD and UD depression, to ultimately optimize clinical and functional outcome for all depressed individuals. Yet, only eight neuroimaging studies to date have directly compared UD and BD depressed individuals. Findings from these studies suggest more widespread abnormalities in white matter connectivity and white matter hyperintensities in BD than UD depression, habenula volume reductions in BD but not UD depression, and differential patterns of functional abnormalities in emotion regulation and attentional control neural circuitry in the two depression types. These findings suggest different pathophysiologic processes, especially in emotion regulation, reward, and attentional control neural circuitry in BD versus UD depression. This review thereby serves as a call to action to highlight the pressing need for more neuroimaging studies, using larger samples sizes, comparing BD and UD depressed individuals. These future studies should also include dimensional approaches, studies of at-risk individuals, and more novel neuroimaging approaches, such as connectivity analysis and machine learning. Ultimately, these approaches might provide biomarkers to identify individuals at future risk for BD versus UD and biological targets for more personalized treatment and new treatment developments for BD and UD depression. Copyright © 2013 Society of Biological Psychiatry. Published by Elsevier Inc. All rights reserved.
Overdiagnosis of Bipolar Disorder: A Critical Analysis of the Literature
Directory of Open Access Journals (Sweden)
Amna A. Ghouse
2013-01-01
Full Text Available Bipolar disorder (BD is considered one of the most disabling mental conditions, with high rates of morbidity, disability, and premature death from suicide. Although BD is often misdiagnosed as major depressive disorder, some attention has recently been drawn to the possibility that BD could be overdiagnosed in some settings. The present paper focuses on a critical analysis of the overdiagnosis issue among bipolar patients. It includes a review of the available literature findings, followed by some recommendations aiming at optimizing the diagnosis of BD and increasing its reliability.
Pessôa, Marco T C; Alves, Silmara L G; Taranto, Alex G; Villar, José A F P; Blanco, Gustavo; Barbosa, Leandro A
2018-12-01
Digoxin and other cardiotonic steroids (CTS) exert their effect by inhibiting Na,K-ATPase (NKA) activity. CTS bind to the various NKA isoforms that are expressed in different cell types, which gives CTS their narrow therapeutic index. We have synthesised a series of digoxin derivatives (γ-Benzylidene digoxin derivatives) with substitutions in the lactone ring (including non-oxygen and ether groups), to obtain CTS with better NKA isoform specificity. Some of these derivatives show some NKA isoform selective effects, with BD-3, BD-8, and BD-13 increasing NKA α2 activity, BD-5 inhibiting NKA α1 and NKA α3, BD-10 reducing NKA α1, but stimulating NKA α2 and α3; and BD-14, BD-15, and BD-16 enhancing NKA α3 activity. A molecular-docking approach favoured NKA isoform specific interactions for the compounds that supported their observed activity. These results show that BD compounds are a new type of CTS with the capacity to target NKA activity in an isoform-specific manner.
Daskin, Joshua H; Alford, Ross A; Puschendorf, Robert
2011-01-01
Environmental conditions can alter the outcomes of symbiotic interactions. Many amphibian species have declined due to chytridiomycosis, caused by the pathogenic fungus Batrachochytrium dendrobatidis (Bd), but many others persist despite high Bd infection prevalence. This indicates that Bd's virulence is lower, or it may even be a commensal, in some hosts. In the Australian Wet Tropics, chytridiomycosis extirpated Litoria nannotis from high-elevation rain forests in the early 1990 s. Although the species is recolonizing many sites, no population has fully recovered. Litoria lorica disappeared from all known sites in the early 1990 s and was thought globally extinct, but a new population was discovered in 2008, in an upland dry forest habitat it shares with L. nannotis. All frogs of both species observed during three population censuses were apparently healthy, but most carried Bd. Frogs perch on sun-warmed rocks in dry forest streams, possibly keeping Bd infections below the lethal threshold attained in cooler rain forests. We tested whether short-term elevated temperatures can hamper Bd growth in vitro over one generation (four days). Simulating the temperatures available to frogs on strongly and moderately warmed rocks in dry forests, by incubating cultures at 33°C for one hour daily, reduced Bd growth below that of Bd held at 15°C constantly (representing rain forest habitats). Even small decreases in the exponential growth rate of Bd on hosts may contribute to the survival of frogs in dry forests.
Directory of Open Access Journals (Sweden)
Joshua H Daskin
Full Text Available Environmental conditions can alter the outcomes of symbiotic interactions. Many amphibian species have declined due to chytridiomycosis, caused by the pathogenic fungus Batrachochytrium dendrobatidis (Bd, but many others persist despite high Bd infection prevalence. This indicates that Bd's virulence is lower, or it may even be a commensal, in some hosts. In the Australian Wet Tropics, chytridiomycosis extirpated Litoria nannotis from high-elevation rain forests in the early 1990 s. Although the species is recolonizing many sites, no population has fully recovered. Litoria lorica disappeared from all known sites in the early 1990 s and was thought globally extinct, but a new population was discovered in 2008, in an upland dry forest habitat it shares with L. nannotis. All frogs of both species observed during three population censuses were apparently healthy, but most carried Bd. Frogs perch on sun-warmed rocks in dry forest streams, possibly keeping Bd infections below the lethal threshold attained in cooler rain forests. We tested whether short-term elevated temperatures can hamper Bd growth in vitro over one generation (four days. Simulating the temperatures available to frogs on strongly and moderately warmed rocks in dry forests, by incubating cultures at 33°C for one hour daily, reduced Bd growth below that of Bd held at 15°C constantly (representing rain forest habitats. Even small decreases in the exponential growth rate of Bd on hosts may contribute to the survival of frogs in dry forests.
Heat and UV light resistance of vegetative cells and spores of Bacillus subtilis rec-mutants
International Nuclear Information System (INIS)
Hanlin, J.H.; Lombardi, S.J.; Slepecky, R.A.
1985-01-01
The heat and UV light resistance of spores and vegetative cells of Bacillus subtilis BD170 (rec+) were greater than those of B. subtilis BD224 (recE4). Strain BD170 can repair DNA whereas BD224 is repair deficient due to the presence of the recE4 allele. Spores of a GSY Rec+ strain were more heat resistant than spores of GSY Rec- and Uvr- mutants. The overall level of heat and UV light resistance attained by spores may in part be determined by their ability to repair deoxyribonucleic acid after exposure to these two physical mutagens
Periodontal Wound Healing Responses to Varying Oxygen Concentrations and Atmospheric Pressures.
1986-05-01
DEFECT TO CEMENTO -ENAMEL JUNCTION 4. BD-CCT, BASE OF DEFECT TO MOST CORONAL CONNECTIVE TISSUE 5. SB-GM, SULCUS BASE TO GINGIVAL MARGIN 6. CCT-SB, MOST...connective tissue to alveolar bone* BD-GM, base of defect to gingival margin* BD-SB, base of defect to sulcus base* BD-CEJ, base of defect to cemento ... Cemento ,-namel Junction CcT - Most Coronal Connective Tissue Units = 20 microns AB - Alveolar Bcne -- -b! ,* S - 59 GROUP B DALY 1 RIGHT SIDE LMF
Bradley, Paul W; Gervasi, Stephanie S; Hua, Jessica; Cothran, Rickey D; Relyea, Rick A; Olson, Deanna H; Blaustein, Andrew R
2015-10-01
Contributing to the worldwide biodiversity crisis are emerging infectious diseases, which can lead to extirpations and extinctions of hosts. For example, the infectious fungal pathogen Batrachochytrium dendrobatidis (Bd) is associated with worldwide amphibian population declines and extinctions. Sensitivity to Bd varies with species, season, and life stage. However, there is little information on whether sensitivity to Bd differs among populations, which is essential for understanding Bd-infection dynamics and for formulating conservation strategies. We experimentally investigated intraspecific differences in host sensitivity to Bd across 10 populations of wood frogs (Lithobates sylvaticus) raised from eggs to metamorphosis. We exposed the post-metamorphic wood frogs to Bd and monitored survival for 30 days under controlled laboratory conditions. Populations differed in overall survival and mortality rate. Infection load also differed among populations but was not correlated with population differences in risk of mortality. Such population-level variation in sensitivity to Bd may result in reservoir populations that may be a source for the transmission of Bd to other sensitive populations or species. Alternatively, remnant populations that are less sensitive to Bd could serve as sources for recolonization after epidemic events. © 2015 Society for Conservation Biology.
The role of melatonin in post-partum psychosis and depression associated with bipolar disorder.
Anderson, George
2010-11-01
Recent data has highlighted the association of a bipolar disorder (BD) with an increased risk of post-partum psychosis and depression. It is suggested that genetic- and environmental-induced decrease in the levels of melatonin in BD contributes to post-partum disorders. Melatonin may also have some efficacy in the treatment of BD, especially in decreasing the side-effects associated with lithium and the neuroleptics. It is proposed that the optimization of melatonin levels, perhaps in conjunction with optimized vitamin D3 level, would decrease post-partum psychosis and depression associated with BD.
Attachment styles and psychopathology among adolescent children of parents with bipolar disorder.
Erkan, Mustafa; Gencoglan, Salih; Akguc, Leyla; Ozatalay, Esin; Fettahoglu, Emine Cigil
2015-04-16
The aim of this study was to compare attachment styles and psychopathology in adolescent children of parents with bipolar disorder (BD) with a healthy control group. We studied 25 adolescents who had at least 1 parent with BD (BD group) and 28 adolescents who had no parents with BD (control group). The adolescent participants were between the ages of 12 and 17 years. We used the Adolescent Relationship Scales Questionnaire (A-RSQ) for the adolescents in the BD vs. control groups, and we used the Schedule for Affective Disorders and Schizophrenia for School-age Children - present and lifetime version (K-SADS-PL). We used the Structured Clinical Interview for DSM-IV Axis I Disorders (SCID-I), Clinician Version for each parent of adolescents in the BD and control groups to rule out psychopathologies. Attachment styles of participants were assessed according to A-RSQ, dismissing attachment style scores of adolescents in BD group were found significantly higher compared to the healthy control group (padolescents (48%) out of 25 in the BD group and 5 adolescents (18%) out of 28 in the control group were given DSM-IV Axis I diagnosis, which is a statistically significant result (padolescent children of parents with BD have increased risk of developing mental illnesses, and that these adolescents adopt dismissing attachment styles.
Frontotemporal White Matter in Adolescents with, and at-Risk for, Bipolar Disorder
Directory of Open Access Journals (Sweden)
Sonja M. C. de Zwarte
2014-03-01
Full Text Available Frontotemporal neural systems are highly implicated in the emotional dysregulation characteristic of bipolar disorder (BD. Convergent genetic, postmortem, behavioral and neuroimaging evidence suggests abnormalities in the development of frontotemporal white matter (WM in the pathophysiology of BD. This review discusses evidence for the involvement of abnormal WM development in BD during adolescence, with a focus on frontotemporal WM. Findings from diffusion tensor imaging (DTI studies in adults and adolescents are reviewed to explore possible progressive WM abnormalities in the disorder. Intra- and interhemispheric frontotemporal abnormalities were reported in adults with BD. Although evidence in children and adolescents with BD to date has been limited, similar intrahemispheric and interhemispheric findings have also been reported. The findings in youths suggest that these abnormalities may represent a trait marker present early in the course of BD. Functional connectivity studies, demonstrating a relationship between WM abnormalities and frontotemporal dysfunction in BD, and DTI studies of vulnerability in first-degree relatives of individuals with BD, are discussed. Together, findings suggest the involvement of abnormal frontotemporal WM development in the pathophysiology of BD and that these abnormalities may be early trait markers of vulnerability; however, more studies are critically needed.
Ratios of B and D meson decay constants with heavy quarks symmetry
International Nuclear Information System (INIS)
Giri, A.K.; Maharana, L.; Mohanta, R.
1996-01-01
SU(3) flavor symmetry allows the decay constants f Ds , and f Dd as well as f Bs , and f Bd , to be equal. But due to SU(3) flavor symmetry breaking the ratios f Bs /f Bd and f Ds /f Dd are deviated from unity. We have estimated these ratios in the heavy quark effective theory and obtained f Bs /f Bd = 0.93, f Ds /f Dd = 0.94 and the double ratio (f Bs /f Bd )/(f Ds /f Dd ) = 0.99. (author). 22 refs
Soviet woes, Middle East crisis cut first half world crude oil production
International Nuclear Information System (INIS)
Beck, R.J.
1991-01-01
This paper reports that the Persian Gulf crisis and the faltering Soviet oil industry spawned a 2.8% dive in world oil production during first half 1991 compared with the same period a year ago. Total world flow averaged 59.781 million b/d, down 1.728 million b/d from first half 1990. First half Soviet production fell 1.13 million b/d from a year ago to 10.6 million b/d. Production among members of the Organization of Petroleum Exporting Countries in the first half averaged 22.927 million b/d, down 1.099 million b/d. Non-OPEC production averaged 36.854 million b/d, down from the 1990 first half average of 37.483 million b/d. OPEC's share of total world production fell to 38.4% for first half 1991 from 39.1% for first half last year. In 1979 OPEC production was 49.1% of total world production. OPEC's share dropped to 29.9% of the world total in 1985 and had been moving back up since then. OPEC set new production quotas totaling 22.31 million b/d, reflecting the curtailment of production from Kuwait and Iraq. Production in the first half of 1991 was 2.8% above quota
Advances in Inertial Navigation Systems and Components
1981-04-01
53. VonLaue, A "Zum Versuch von F. Harress ," Annalen der Physik, 4. Folge, Bd 62, Nr 13, 3.444-463 54. Sommerfeld, A., and Runge, Iris, Ann.d.Phys, 4te...Folge, Bd 35, S. 277-298 (1911) 55. Knopt, 0., "Die Versuche von F. Harress Ober Die Geschwindigkeit des Lichtes in Bewegten Korpern," App d. Phys...4te Folge, Bd 62, S 389-447 (1920) 56. Pogany, B., "Urber Eine Wiederholung des Harress Scher. Versuches, (II.Mitteilung)," Ann D. Phys, 4te Folge, Bd
Morphometric characterization of Binswanger's disease: Comparison with Alzheimer's disease
Energy Technology Data Exchange (ETDEWEB)
Shiino, Akihiko, E-mail: shiino@belle.shiga-med.ac.jpc.jp [Biomedical MR Science Center, Shiga University of Medical Science, Seta, Ohtsu, Shiga 520-2192 (Japan); Akiguchi, Ichiro; Watanabe, Toshiyuki; Shirakashi, Yoshitomo [Center of Neurological and Cerebrovascular Disease, Takeda Hospital (Japan); Nozaki, Kazuhiko [Department of Neurosurgery, Shiga University of Medical Science (Japan); Tooyama, Ikuo [Molecular Neuroscience Research Center, Shiga University of Medical Science (Japan); Inubushi, Toshiro [Biomedical MR Science Center, Shiga University of Medical Science, Seta, Ohtsu, Shiga 520-2192 (Japan)
2012-09-15
Background and purpose: Dementia due to hypertensive vascular disease is a potential target to treat prophylactively before it progresses insidiously. Binswanger's disease (BD) is a type of subcortical vascular dementia, but its clinical features and pathophysiology are still obscure. We therefore tried to find a topographic distribution of brain atrophy in BD by morphometric analysis. Methods: Twenty patients with BD, 50 patients with AD, and 80 elderly controls were recruited. We contrasted the gray matter atrophy of BD to that of AD to identify a pathognomic pattern using magnetic resonance imaging. We used DARTEL (diffeomorphic anatomical registration through exponential Lie algebra) for voxel-based morphometry, expecting that its sophisticated algorithm would work well to deal with the subjects with brain atrophy. Results: Atrophy of cortices was predominant in the posterior cortices in AD but was in the anterior cortices in BD. Atrophy of amygdala and hippocampus was similar in each disease. In contrast, thalamus, caudate nucleus, insula, anterior cingulate cortex, and frontal cortices were significantly more atrophied in BD than in AD (z-score >3). Conclusions: We demonstrated topographic patterns of brain atrophy in BD. Since affected regions of BD match with the anatomical connections of frontal–subcortical circuits, it seems reasonable to suppose that BD pathology is the result of hypertensive vascular disease and subsequent regression from the white matter injuries.
[Evaluation of medical students knowledge on brain death].
Bitencourt, Almir Galvão Vieira; Neves, Flávia Branco Cerqueira Serra; Durães, Larissa; Nascimento, Diego Teixeira; Neves, Nedy Maria Branco Cerqueira; Torreão, Lara de Araújo; Agareno, Sydney
2007-06-01
Because brain death (BD) is a new concept and little divulged, its not well accepted in general population, including doctors and Medical students. This study aims to evaluate the knowledge of a sample of Medical students on the Brazilian BD diagnosis protocol. Descriptive cross-sectional survey that evaluated students from two medical schools in Salvador-BA. We used a questionnaire composed by questions about technical and ethical knowledge contained in the Federal Council of Medicines Resolution nº 1480/97 that establishes the criteria for BD diagnosis. We evaluated 115 Medical students. In 14 questions about the knowledge of BD criteria, the mean of right answers were 6.7 ± 1.8, which were higher among the students that had attended some presentation on BD. Most of the students (87.4%) knew how to identify the candidates to the BD diagnosis protocol. However, only 5.2% and 16.1% of the students answered right, respectively, the clinical and complementary tests that should be accomplished during the diagnosis protocol. Facing a no-donor patient with confirmed diagnosis of BD, 66.4% referred that artificial life support should be suspended. Only 15% of the interviewed students had already evaluated a patient with BD, being this percentage higher among those who had already frequented ICU (38.2% versus 5.1%; p knowledge of the evaluated students on BD diagnosis criteria, mainly in relation to the practical approach of this condition.
Mechanism of 2,3-butanediol stereoisomers formation in a newly isolated Serratia sp. T241.
Zhang, Liaoyuan; Guo, Zewang; Chen, Jiebo; Xu, Quanming; Lin, Hui; Hu, Kaihui; Guan, Xiong; Shen, Yaling
2016-01-12
Serratia sp. T241, a newly isolated xylose-utilizing strain, produced three 2,3-butanediol (2,3-BD) stereoisomers. In this study, three 2,3-butanediol dehydrogenases (BDH1-3) and one glycerol dehydrogenase (GDH) involved in 2,3-BD isomers formation by Serratia sp. T241 were identified. In vitro conversion showed BDH1 and BDH2 could catalyzed (3S)-acetoin and (3R)-acetoin into (2S,3S)-2,3-BD and meso-2,3-BD, while BDH3 and GDH exhibited the activities from (3S)-acetoin and (3R)-acetoin to meso-2,3-BD and (2R,3R)-2,3-BD. Four encoding genes were assembled into E. coli with budA (acetolactate decarboxylase) and budB (acetolactate synthase), responsible for converting pyruvate into acetoin. E. coli expressing budAB-bdh1/2 produced meso-2,3-BD and (2S,3S)-2,3-BD. Correspondingly, (2R,3R)-2,3-BD and meso-2,3-BD were obtained by E. coli expressing budAB-bdh3/gdh. These results suggested four enzymes might contribute to 2,3-BD isomers formation. Mutants of four genes were developed in Serratia sp. T241. Δbdh1 led to reduced concentration of meso-2,3-BD and (2S,3S)-2,3-BD by 97.7% and 87.9%. (2R,3R)-2,3-BD with a loss of 73.3% was produced by Δbdh3. Enzyme activity assays showed the decrease of 98.4% and 22.4% by Δbdh1 and Δbdh3 compared with the wild strain. It suggested BDH1 and BDH3 played important roles in 2,3-BD formation, BDH2 and GDH have small effects on 2,3-BD production by Serratia sp. T241.
Murphy, P.J.; St-Hilaire, S.; Bruer, S.; Corn, P.S.; Peterson, C.R.
2009-01-01
The pathogen Batrachochytrium dendrobatidis (Bd), which causes the skin disease chytridiomycosis, has been linked to amphibian population declines and extinctions worldwide. Bd has been implicated in recent declines of boreal toads, Bufo boreas boreas, in Colorado but populations of boreal toads in western Wyoming have high prevalence of Bd without suffering catastrophic mortality. In a field and laboratory study, we investigated the prevalence of Bd in boreal toads from the Grand Teton ecosystem (GRTE) in Wyoming and tested the pathogenicity of Bd to these toads in several environments. The pathogen was present in breeding adults at all 10 sites sampled, with a mean prevalence of 67%. In an experiment with juvenile toadlets housed individually in wet environments, 106 zoospores of Bd isolated from GRTE caused lethal disease in all Wyoming and Colorado animals within 35 days. Survival time was longer in toadlets from Wyoming than Colorado and in toadlets spending more time in dry sites. In a second trial involving Colorado toadlets exposed to 35% fewer Bd zoospores, infection peaked and subsided over 68 days with no lethal chytridiomycosis in any treatment. However, compared with drier aquaria with dry refuges, Bd infection intensity was 41% higher in more humid aquaria and 81% higher without dry refuges available. Our findings suggest that although widely infected in nature, Wyoming toads may escape chytridiomycosis due to a slight advantage in innate resistance or because their native habitat hinders Bd growth or provides more opportunities to reduce pathogen loads behaviorally than in Colorado. ?? 2009 International Association for Ecology and Health.