WorldWideScience

Sample records for base cg frequency

  1. Visualization of reaction mechanism by CG based on quantum ...

    African Journals Online (AJOL)

    In this work, the change in the molecular configuration in fundamental chemical reactions such as, F + HCl ¨ HF + Cl, I + H2¨ HI + H, OH- + CH3Cl ¨ CH3OH + Cl-, and esterification of acetic acid and ethyl alcohol were visualized by the quantum chemical calculation MOPAC with PM5 Hamiltonian. The CG teaching material ...

  2. Production and testing of HENDL-2.1/CG coarse-group cross-section library based on ENDF/B-VII.0

    International Nuclear Information System (INIS)

    Xu Dezheng; He Zhaozhong; Zou Jun; Zeng Qin

    2010-01-01

    A coarse-group coupled neutron and photon (27n + 21γ) cross-section library HENDL-2.1/CG, based on ENDF/B-VII.0 evaluate data source, has been produced by FDS Team in Institute of Plasma Physics, Chinese Academy of Sciences (ASIPP). HENDL-2.1/CG containing 350 nuclide cross-section files (from 1 H to 252 Cf) was generated in MATXS format with the NJOY processing system and then by compiling coarse-group problem-dependent format using the TRANSX code. In order to verify the availability and reliability of the HENDL-2.1/CG data library, requisite benchmark calculations were performed and compared with HENDL-2.0/MG fine-group coupled neutron and photon (175n + 42γ) cross-section library. In general, results using the coarse-group library showed similarly believable as fine-group library.

  3. DW_CG-832

    Data.gov (United States)

    Department of Homeland Security — Flat file data from the Office of Resource Management - Financial Analysis Division, CG-832 used for reporting cost allocation models within the Coast Guard Business...

  4. radio frequency based radio frequency based water level monitor

    African Journals Online (AJOL)

    eobe

    ABSTRACT. This paper elucidates a radio frequency (RF) based transmission and reception system used to remotely monitor and .... range the wireless can cover but in this prototype, it ... power supply to the system, the sensed water level is.

  5. Ultrasensitive colorimetric immunoassay for hCG detection based on dual catalysis of Au@Pt core-shell nanoparticle functionalized by horseradish peroxidase

    Science.gov (United States)

    Wang, Weiguo; Zou, Yake; Yan, Jinwu; Liu, Jing; Chen, Huixiong; Li, Shan; Zhang, Lei

    2018-03-01

    In this paper, an ultrasensitive colorimetric biosensor for human chorionic gonadotrophin (hCG) detection was designed from bottom-up method based on the dual catalysis of the horseradish peroxidase (HRP) and Au@Pt nanoparticles (NPs) relative to H2O2-TEM system. HRP and monoclonal mouse anti-hCG antibody (β-submit, mAb1) were co-immobilized onto the Au@Pt NP surface to improve catalytic efficiency and specificity, which formed a dual functionalized Au@Pt-HRP probe with the mean size of 42.8 nm (D50). The colorimetric immunoassay was developed for the hCG detection, and the Au@Pt-HRP probe featured a higher sensitivity in the concentration range of 0.4-12.8 IU L- 1 with a low limit of detection (LOD) of 0.1 IU L- 1 compared with the LODs of 0.8 IU L- 1 for BA-ELISA and of 2.0 IU L- 1 for Au@Pt, which indicated that the Au@Pt-HRP probe possessed higher catalytic efficiency with 2.8-fold increase over Au@Pt and 33.8-fold increase over HRP. Also, the Au@Pt-HRP probe exhibited good precision and reproducibility, high specificity and acceptable accuracy with CV being less than 15%. The dual functionalized Au@Pt-HRP probe as a type of signal amplified method was firstly applied in the colorimetric immunoassay for the hCG detection.

  6. Mechanisms of strand break formation in DNA due to the direct effect of ionizing radiation: the dependency of free base release on the length of alternating CG oligodeoxynucleotides.

    Science.gov (United States)

    Sharma, Kiran K; Razskazovskiy, Yuriy; Purkayastha, Shubhadeep; Bernhard, William A

    2009-06-11

    The question of how NA base sequence influences the yield of DNA strand breaks produced by the direct effect of ionizing radiation was investigated in a series of oligodeoxynucleotides of the form (d(CG)(n))(2) and (d(GC)(n))(2). The yields of free base release from X-irradiated DNA films containing 2.5 waters/nucleotide were measured by HPLC as a function of oligomer length. For (d(CG)(n))(2), the ratio of the Gua yield to Cyt yield, R, was relatively constant at 2.4-2.5 for n = 2-4 and it decreased to 1.2 as n increased from 5 to 10. When Gua was moved to the 5' end, for example going from d(CG)(5) to d(GC)(5), R dropped from 1.9 +/- 0.1 to 1.1 +/- 0.1. These effects are poorly described if the chemistry at the oligomer ends is assumed to be independent of the remainder of the oligomer. A mathematical model incorporating charge transfer through the base stack was derived to explain these effects. In addition, EPR was used to measure the yield of trapped-deoxyribose radicals at 4 K following X-irradiation at 4 K. The yield of free base release was substantially greater, by 50-100 nmol/J, than the yield of trapped-deoxyribose radicals. Therefore, a large fraction of free base release stems from a nonradical intermediate. For this intermediate, a deoxyribose carbocation formed by two one-electron oxidations is proposed. This reaction pathway requires that the hole (electron loss site) transfers through the base stack and, upon encountering a deoxyribose hole, oxidizes that site to form a deoxyribose carbocation. This reaction mechanism provides a consistent way of explaining both the absence of trapped radical intermediates and the unusual dependence of free base release on oligomer length.

  7. SU-E-T-64: CG-Based Radiation Therapy Simulator with Physical Modeling for Avoidance of Collisions Between Gantry and Couch Or Patient

    International Nuclear Information System (INIS)

    Yamanouchi, M; Arimura, H; Yuda, I

    2014-01-01

    Purpose: It is time-consuming and might cause re-planning to check couch-gantry and patient-gantry collisions on a radiotherapy machine when using couch rotations for non-coplanar beam angles. The aim of this study was to develop a computer-graphics (CG)-based radiation therapy simulator with physical modeling for avoidance of collisions between gantry and couch or patient on a radiotherapy machine. Methods: The radiation therapy simulator was three-dimensionally constructed including a radiotherapy machine (Clinac iX, Varian Medical Systems), couch, and radiation treatment room according to their designs by using a physical-modeling-based computer graphics software (Blender, free and open-source). Each patient was modeled by applying a surface rendering technique to their planning computed tomography (CT) images acquired from 16-slice CT scanner (BrightSpeed, GE Healthcare). Immobilization devices for patients were scanned by the CT equipment, and were rendered as the patient planning CT images. The errors in the collision angle of the gantry with the couch or patient between gold standards and the estimated values were obtained by fixing the gantry angle for the evaluation of the proposed simulator. Results: The average error of estimated collision angles to the couch head side was -8.5% for gantry angles of 60 to 135 degree, and -5.5% for gantry angles of 225 to 300 degree. Moreover, the average error of estimated collision angles to the couch foot side was -1.1% for gantry angles of 60 to 135 degree, and 1.4% for gantry angles of 225 to 300 degree. Conclusion: The CG-based radiation therapy simulator could make it possible to estimate the collision angle between gantry and couch or patient on the radiotherapy machine without verifying the collision angles in the radiation treatment room

  8. GHz band frequency hopping PLL-based frequency synthesizers

    Institute of Scientific and Technical Information of China (English)

    XU Yong; WANG Zhi-gong; GUAN Yu; XU Zhi-jun; QIAO Lu-feng

    2005-01-01

    In this paper we describe a full-integrated circuit containing all building blocks of a completed PLL-based synthesizer except for low pass filter(LPF).The frequency synthesizer is designed for a frequency hopping (FH) transceiver operating up to 1.5 GHz as a local oscillator. The architecture of Voltage Controlled Oscillator (VCO) is optimized to get better performance, and a phase noise of -111.85-dBc/Hz @ 1 MHz and a tuning range of 250 MHz are gained at a centre frequency of 1.35 GHz.A novel Dual-Modulus Prescaler(DMP) is designed to achieve a very low jitter and a lower power.The settling time of PLL is 80 μs while the reference frequency is 400 KHz.This monolithic frequency synthesizer is to integrate all main building blocks of PLL except for the low pass filter,with a maximum VCO output frequency of 1.5 GHz,and is fabricated with a 0.18 μm mixed signal CMOS process. Low power dissipation, low phase noise, large tuning range and fast settling time are gained in this design.

  9. Model-Based Least Squares Reconstruction of Coded Source Neutron Radiographs: Integrating the ORNL HFIR CG1D Source Model

    Energy Technology Data Exchange (ETDEWEB)

    Santos-Villalobos, Hector J [ORNL; Gregor, Jens [University of Tennessee, Knoxville (UTK); Bingham, Philip R [ORNL

    2014-01-01

    At the present, neutron sources cannot be fabricated small and powerful enough in order to achieve high resolution radiography while maintaining an adequate flux. One solution is to employ computational imaging techniques such as a Magnified Coded Source Imaging (CSI) system. A coded-mask is placed between the neutron source and the object. The system resolution is increased by reducing the size of the mask holes and the flux is increased by increasing the size of the coded-mask and/or the number of holes. One limitation of such system is that the resolution of current state-of-the-art scintillator-based detectors caps around 50um. To overcome this challenge, the coded-mask and object are magnified by making the distance from the coded-mask to the object much smaller than the distance from object to detector. In previous work, we have shown via synthetic experiments that our least squares method outperforms other methods in image quality and reconstruction precision because of the modeling of the CSI system components. However, the validation experiments were limited to simplistic neutron sources. In this work, we aim to model the flux distribution of a real neutron source and incorporate such a model in our least squares computational system. We provide a full description of the methodology used to characterize the neutron source and validate the method with synthetic experiments.

  10. GnRH agonist ovulation trigger and hCG-based, progesterone-free luteal support: a proof of concept study

    DEFF Research Database (Denmark)

    Kol, Shahar; Humaidan, Peter; Itskovitz-Eldor, Joseph

    2011-01-01

    in normal responder IVF patients. We here present a novel approach for luteal support after a GnRHa trigger. METHODS Normal responder patients who failed at least one previous IVF attempt, during which a conventional hCG trigger was used, were consecutively enrolled in the study. A GnRH antagonist...

  11. The comparison of microdose flare-up and multiple dose antagonist protocols based on hCG day estradiol (E2), progesterone (P) and P/E2 ratio among poor responder patients in ICSI-ET cycles.

    Science.gov (United States)

    Cicek, M N; Kahyaoglu, I; Kahyaoglu, S

    2015-02-01

    Elevated progesterone levels surpassing exact treshold values impede endometrial receptivity and decrease clinical pregnancy rates in different responder patients during assisted reproductive techniques. A progesterone (P): estradiol (E2) ratio of > 1 on the day of hCG administration has also been suggested to be a manifestation of low ovarian reserve. The clinical significance of P/E2 ratio on the day of hCG administration was investigated among poor responder patients. Based on the ESHRE Bologna consensus criteria related to poor ovarian response diagnosis, 48 poor responder patients were treated with the microdose flare-up regimen and 34 patients were treated with the multiple-dose GnRH antagonist protocol. All patients were destined to perform a ICSI-ET procedure at the end of the stimulation protocols. Progesterone levels and P/E2 ratios have been detected during controlled ovarian hyperstimulation. In the microdose flare-up group; the duration of stimulation, total gonadotropin dose used and hCG day E2 levels were significantly higher than the multiple dose antagonist group. However, the mean hCG day P/E2 rate in the microdose flare-up group was less than that in the multiple-dose antagonist group. The clinical pregnancy rates were non significantly higher in the multiple dose antagonist protocol group than in microdose flare-up group. Impaired endometrial receptivity caused by elevated P levels results with lower pregnancy rates. Regardless of the selected stimulation protocol, poor responder patients are not prone to exhibit high P and E2 secretion. Increased P/E2 ratio of > 1 on hCG day has limited value to predict cycle outcomes in poor responder patients because of ovarian follicle depletion.

  12. Coast Guard Enterprise Project Management (CG-EPM)

    Data.gov (United States)

    Department of Homeland Security — CG-EPM provides the following capabilities: A Project Center, Portfolio Analysis Tools, Project Planning Tool, Web-based Project Plan Updater, Project Collaboration...

  13. Parallel preconditioning techniques for sparse CG solvers

    Energy Technology Data Exchange (ETDEWEB)

    Basermann, A.; Reichel, B.; Schelthoff, C. [Central Institute for Applied Mathematics, Juelich (Germany)

    1996-12-31

    Conjugate gradient (CG) methods to solve sparse systems of linear equations play an important role in numerical methods for solving discretized partial differential equations. The large size and the condition of many technical or physical applications in this area result in the need for efficient parallelization and preconditioning techniques of the CG method. In particular for very ill-conditioned matrices, sophisticated preconditioner are necessary to obtain both acceptable convergence and accuracy of CG. Here, we investigate variants of polynomial and incomplete Cholesky preconditioners that markedly reduce the iterations of the simply diagonally scaled CG and are shown to be well suited for massively parallel machines.

  14. Frequency Based Fault Detection in Wind Turbines

    DEFF Research Database (Denmark)

    Odgaard, Peter Fogh; Stoustrup, Jakob

    2014-01-01

    In order to obtain lower cost of energy for wind turbines fault detection and accommodation is important. Expensive condition monitoring systems are often used to monitor the condition of rotating and vibrating system parts. One example is the gearbox in a wind turbine. This system is operated...... in parallel to the control system, using different computers and additional often expensive sensors. In this paper a simple filter based algorithm is proposed to detect changes in a resonance frequency in a system, exemplified with faults resulting in changes in the resonance frequency in the wind turbine...... gearbox. Only the generator speed measurement which is available in even simple wind turbine control systems is used as input. Consequently this proposed scheme does not need additional sensors and computers for monitoring the condition of the wind gearbox. The scheme is evaluated on a wide-spread wind...

  15. Transcription factor CgMTF-1 regulates CgZnT1 and CgMT expression in Pacific oyster (Crassostrea gigas) under zinc stress

    Energy Technology Data Exchange (ETDEWEB)

    Meng, Jie; Zhang, Linlin [Institute of Oceanology, Chinese Academy of Sciences, Qingdao 266071, Shandong (China); Li, Li, E-mail: lili@qdio.ac.cn [Institute of Oceanology, Chinese Academy of Sciences, Qingdao 266071, Shandong (China); Li, Chunyan; Wang, Ting [Institute of Oceanology, Chinese Academy of Sciences, Qingdao 266071, Shandong (China); University of Chinese Academy of Sciences, Beijing 100039 (China); Zhang, Guofan, E-mail: gfzhang@qdio.ac.cn [Institute of Oceanology, Chinese Academy of Sciences, Qingdao 266071, Shandong (China)

    2015-08-15

    Highlights: • CgMTF-1 and CgZnT1 were first identified in oysters. • CgMTF-1 localized in cell nucleus under unstressed conditions. • CgMTF-1 proteins could bind with the typical MRE motif. • CgMTF-1 activated CgZnT1, CgMT1 and CgMT4 promoters and regulated their expressions under zinc exposure. - Abstract: Oysters accumulate zinc at high tissue concentrations, and the metal response element (MRE)-binding transcription factor (MTF) functions as the cellular zinc sensor that coordinates the expression of genes involved in zinc efflux and storage, as well as those that protect against metal toxicity. In this study, we cloned MTF-1 in oysters and examined its regulation mechanism for its classic target genes, including MTs and ZnT1 under zinc exposure conditions. We cloned CgMTF-1 and determined the subcellular locations of its protein product in HEK293 cells. CgMTF-1 has a 2826 bp open reading frame that encodes a predicted polypeptide with 707 amino acid residues, showing six well-conserved zinc finger domains that are required for metal binding. In HEK293 cell lines, CgMTF-1 primarily localizes in the cell nucleus under unstressed conditions and nuclear translocation was not critical for the activation of this gene. We searched for CgMTF-1-regulated genes in oysters using RNA interference. Decreased expression levels of CgMT1, CgMT4, and CgZnT1 were observed after CgMTF-1 interference (>70% inhibition) under zinc exposure, indicating the critical role of CgMTF-1 in the regulation of these genes. We searched for a direct regulation mechanism involving CgMTF-1 for CgMT1, CgMT4, and CgZnT1 in vitro. EMSA experiments indicated that CgMTF-1 can bind with the MREs found in the CgZnT1, CgMT1 and CgMT4 promoter regions. Additionally, luciferase reporter gene experiments indicated that CgMTF-1 could activate the CgMT1, CgMT4, and CgZnT1 promoters. Overall, our results suggest that CgMTF-1 directly coordinates the regulation of CgMTs and CgZnT1 expression and plays

  16. Transcription factor CgMTF-1 regulates CgZnT1 and CgMT expression in Pacific oyster (Crassostrea gigas) under zinc stress

    International Nuclear Information System (INIS)

    Meng, Jie; Zhang, Linlin; Li, Li; Li, Chunyan; Wang, Ting; Zhang, Guofan

    2015-01-01

    Highlights: • CgMTF-1 and CgZnT1 were first identified in oysters. • CgMTF-1 localized in cell nucleus under unstressed conditions. • CgMTF-1 proteins could bind with the typical MRE motif. • CgMTF-1 activated CgZnT1, CgMT1 and CgMT4 promoters and regulated their expressions under zinc exposure. - Abstract: Oysters accumulate zinc at high tissue concentrations, and the metal response element (MRE)-binding transcription factor (MTF) functions as the cellular zinc sensor that coordinates the expression of genes involved in zinc efflux and storage, as well as those that protect against metal toxicity. In this study, we cloned MTF-1 in oysters and examined its regulation mechanism for its classic target genes, including MTs and ZnT1 under zinc exposure conditions. We cloned CgMTF-1 and determined the subcellular locations of its protein product in HEK293 cells. CgMTF-1 has a 2826 bp open reading frame that encodes a predicted polypeptide with 707 amino acid residues, showing six well-conserved zinc finger domains that are required for metal binding. In HEK293 cell lines, CgMTF-1 primarily localizes in the cell nucleus under unstressed conditions and nuclear translocation was not critical for the activation of this gene. We searched for CgMTF-1-regulated genes in oysters using RNA interference. Decreased expression levels of CgMT1, CgMT4, and CgZnT1 were observed after CgMTF-1 interference (>70% inhibition) under zinc exposure, indicating the critical role of CgMTF-1 in the regulation of these genes. We searched for a direct regulation mechanism involving CgMTF-1 for CgMT1, CgMT4, and CgZnT1 in vitro. EMSA experiments indicated that CgMTF-1 can bind with the MREs found in the CgZnT1, CgMT1 and CgMT4 promoter regions. Additionally, luciferase reporter gene experiments indicated that CgMTF-1 could activate the CgMT1, CgMT4, and CgZnT1 promoters. Overall, our results suggest that CgMTF-1 directly coordinates the regulation of CgMTs and CgZnT1 expression and plays

  17. Optimal depth-based regional frequency analysis

    Directory of Open Access Journals (Sweden)

    H. Wazneh

    2013-06-01

    Full Text Available Classical methods of regional frequency analysis (RFA of hydrological variables face two drawbacks: (1 the restriction to a particular region which can lead to a loss of some information and (2 the definition of a region that generates a border effect. To reduce the impact of these drawbacks on regional modeling performance, an iterative method was proposed recently, based on the statistical notion of the depth function and a weight function φ. This depth-based RFA (DBRFA approach was shown to be superior to traditional approaches in terms of flexibility, generality and performance. The main difficulty of the DBRFA approach is the optimal choice of the weight function ϕ (e.g., φ minimizing estimation errors. In order to avoid a subjective choice and naïve selection procedures of φ, the aim of the present paper is to propose an algorithm-based procedure to optimize the DBRFA and automate the choice of ϕ according to objective performance criteria. This procedure is applied to estimate flood quantiles in three different regions in North America. One of the findings from the application is that the optimal weight function depends on the considered region and can also quantify the region's homogeneity. By comparing the DBRFA to the canonical correlation analysis (CCA method, results show that the DBRFA approach leads to better performances both in terms of relative bias and mean square error.

  18. Optimal depth-based regional frequency analysis

    Science.gov (United States)

    Wazneh, H.; Chebana, F.; Ouarda, T. B. M. J.

    2013-06-01

    Classical methods of regional frequency analysis (RFA) of hydrological variables face two drawbacks: (1) the restriction to a particular region which can lead to a loss of some information and (2) the definition of a region that generates a border effect. To reduce the impact of these drawbacks on regional modeling performance, an iterative method was proposed recently, based on the statistical notion of the depth function and a weight function φ. This depth-based RFA (DBRFA) approach was shown to be superior to traditional approaches in terms of flexibility, generality and performance. The main difficulty of the DBRFA approach is the optimal choice of the weight function ϕ (e.g., φ minimizing estimation errors). In order to avoid a subjective choice and naïve selection procedures of φ, the aim of the present paper is to propose an algorithm-based procedure to optimize the DBRFA and automate the choice of ϕ according to objective performance criteria. This procedure is applied to estimate flood quantiles in three different regions in North America. One of the findings from the application is that the optimal weight function depends on the considered region and can also quantify the region's homogeneity. By comparing the DBRFA to the canonical correlation analysis (CCA) method, results show that the DBRFA approach leads to better performances both in terms of relative bias and mean square error.

  19. hCG Test (Pregnancy Test)

    Science.gov (United States)

    ... Acidosis and Alkalosis Adrenal Insufficiency and Addison Disease Alcoholism Allergies Alzheimer Disease Anemia Angina Ankylosing Spondylitis Anthrax ... Patient Resources For Health Professionals Subscribe Search hCG Pregnancy Send Us Your Feedback Choose Topic At a ...

  20. Thermal-Diffusivity-Based Frequency References in Standard CMOS

    NARCIS (Netherlands)

    Kashmiri, S.M.

    2012-01-01

    In recent years, a lot of research has been devoted to the realization of accurate integrated frequency references. A thermal-diffusivity-based (TD) frequency reference provides an alternative method of on-chip frequency generation in standard CMOS technology. A frequency-locked loop locks the

  1. Prolog+CG: A Maintainer's Perspective

    DEFF Research Database (Denmark)

    Petersen, Ulrik

    2006-01-01

    Prolog+CG is an implementation of Prolog with Conceptual Graphs as first-class datastructures, on a par with terms. As such, it lends itself well to applications in which reasoning with Conceptual Graphs and/or ontologies plays a role. It  as originally developed by Prof. Dr. Adil Kabbaj, who......, we offer some general observations about the tenets that make Prolog+CG a success....

  2. SUBTLEX-ESP: Spanish Word Frequencies Based on Film Subtitles

    Science.gov (United States)

    Cuetos, Fernando; Glez-Nosti, Maria; Barbon, Analia; Brysbaert, Marc

    2011-01-01

    Recent studies have shown that word frequency estimates obtained from films and television subtitles are better to predict performance in word recognition experiments than the traditional word frequency estimates based on books and newspapers. In this study, we present a subtitle-based word frequency list for Spanish, one of the most widely spoken…

  3. Neural Network Based Load Frequency Control for Restructuring ...

    African Journals Online (AJOL)

    Neural Network Based Load Frequency Control for Restructuring Power Industry. ... an artificial neural network (ANN) application of load frequency control (LFC) of a Multi-Area power system by using a neural network controller is presented.

  4. Biological functions of hCG and hCG-related molecules

    Directory of Open Access Journals (Sweden)

    Cole Laurence A

    2010-08-01

    Full Text Available Abstract Background hCG is a term referring to 4 independent molecules, each produced by separate cells and each having completely separate functions. These are hCG produced by villous syncytiotrophoblast cells, hyperglycosylated hCG produced by cytotrophoblast cells, free beta-subunit made by multiple primary non-trophoblastic malignancies, and pituitary hCG made by the gonadotrope cells of the anterior pituitary. Results and discussion hCG has numerous functions. hCG promotes progesterone production by corpus luteal cells; promotes angiogenesis in uterine vasculature; promoted the fusion of cytotrophoblast cell and differentiation to make syncytiotrophoblast cells; causes the blockage of any immune or macrophage action by mother on foreign invading placental cells; causes uterine growth parallel to fetal growth; suppresses any myometrial contractions during the course of pregnancy; causes growth and differentiation of the umbilical cord; signals the endometrium about forthcoming implantation; acts on receptor in mother's brain causing hyperemesis gravidarum, and seemingly promotes growth of fetal organs during pregnancy. Hyperglycosylated hCG functions to promote growth of cytotrophoblast cells and invasion by these cells, as occurs in implantation of pregnancy, and growth and invasion by choriocarcinoma cells. hCG free beta-subunit is produced by numerous non-trophoblastic malignancies of different primaries. The detection of free beta-subunit in these malignancies is generally considered a sign of poor prognosis. The free beta-subunit blocks apoptosis in cancer cells and promotes the growth and malignancy of the cancer. Pituitary hCG is a sulfated variant of hCG produced at low levels during the menstrual cycle. Pituitary hCG seems to mimic luteinizing hormone actions during the menstrual cycle.

  5. Low velocity target detection based on time-frequency image for high frequency ground wave radar

    Institute of Scientific and Technical Information of China (English)

    YAN Songhua; WU Shicai; WEN Biyang

    2007-01-01

    The Doppler spectral broadening resulted from non-stationary movement of target and radio-frequency interference will decrease the veracity of target detection by high frequency ground wave(HEGW)radar.By displaying the change of signal energy on two dimensional time-frequency images based on time-frequency analysis,a new mathematical morphology method to distinguish target from nonlinear time-frequency curves is presented.The analyzed results from the measured data verify that with this new method the target can be detected correctly from wide Doppler spectrum.

  6. Target organ of hCG

    International Nuclear Information System (INIS)

    Yanaginuma, Tsutomu; Kobayashi, Takuro

    1974-01-01

    The author and his associated gave intravenous infusions of hCG labeled with 125 I to female rats and investigated its distribution in their brains. The results showed a significantly higher radioactivity in the median eminence than in the other parts of the brain. This indicated that there were receptors of hCG in the median eminence of the hypothalamus of a female rat. The mechanism of gonadotropin action was also discussed in this report. By giving 125 I and 125 I-BSA to the same rats which had been used in the study of hCG distribution in the brain, and by investigating the radioactivity of their ovaries, the author explained the receptor of gonadotropin in corpora lutea. (Serizawa, K.)

  7. cgHeliParm : analysis of dsDNA helical parameters for coarse-grained MARTINI molecular dynamics simulations

    NARCIS (Netherlands)

    Faustino, Ignacio; Marrink, S. J.

    2017-01-01

    Summary: We introduce cgHeliParm, a python program that provides the conformational analysis of Martini-based coarse-grained double strand DNA molecules. The software calculates the helical parameters such as base, base pair and base pair step parameters. cgHeliParm can be used for the analysis of

  8. Brain-computer interface based on intermodulation frequency

    Science.gov (United States)

    Chen, Xiaogang; Chen, Zhikai; Gao, Shangkai; Gao, Xiaorong

    2013-12-01

    Objective. Most recent steady-state visual evoked potential (SSVEP)-based brain-computer interface (BCI) systems have used a single frequency for each target, so that a large number of targets require a large number of stimulus frequencies and therefore a wider frequency band. However, human beings show good SSVEP responses only in a limited range of frequencies. Furthermore, this issue is especially problematic if the SSVEP-based BCI takes a PC monitor as a stimulator, which is only capable of generating a limited range of frequencies. To mitigate this issue, this study presents an innovative coding method for SSVEP-based BCI by means of intermodulation frequencies. Approach. Simultaneous modulations of stimulus luminance and color at different frequencies were utilized to induce intermodulation frequencies. Luminance flickered at relatively large frequency (10, 12, 15 Hz), while color alternated at low frequency (0.5, 1 Hz). An attractive feature of the proposed method was that it would substantially increase the number of targets at a single flickering frequency by altering color modulated frequencies. Based on this method, the BCI system presented in this study realized eight targets merely using three flickering frequencies. Main results. The online results obtained from 15 subjects (14 healthy and 1 with stroke) revealed that an average classification accuracy of 93.83% and information transfer rate (ITR) of 33.80 bit min-1 were achieved using our proposed SSVEP-based BCI system. Specifically, 5 out of the 15 subjects exhibited an ITR of 40.00 bit min-1 with a classification accuracy of 100%. Significance. These results suggested that intermodulation frequencies could be adopted as steady responses in BCI, for which our system could be used as a practical BCI system.

  9. Towards the Realization of Graphene Based Flexible Radio Frequency Receiver

    Directory of Open Access Journals (Sweden)

    Maruthi N. Yogeesh

    2015-11-01

    Full Text Available We report on our progress and development of high speed flexible graphene field effect transistors (GFETs with high electron and hole mobilities (~3000 cm2/V·s, and intrinsic transit frequency in the microwave GHz regime. We also describe the design and fabrication of flexible graphene based radio frequency system. This RF communication system consists of graphite patch antenna at 2.4 GHz, graphene based frequency translation block (frequency doubler and AM demodulator and graphene speaker. The communication blocks are utilized to demonstrate graphene based amplitude modulated (AM radio receiver operating at 2.4 GHz.

  10. Water based fluidic radio frequency metamaterials

    Science.gov (United States)

    Cai, Xiaobing; Zhao, Shaolin; Hu, Mingjun; Xiao, Junfeng; Zhang, Naibo; Yang, Jun

    2017-11-01

    Electromagnetic metamaterials offer great flexibility for wave manipulation and enable exceptional functionality design, ranging from negative refraction, anomalous reflection, super-resolution imaging, transformation optics to cloaking, etc. However, demonstration of metamaterials with unprecedented functionalities is still challenging and costly due to the structural complexity or special material properties. Here, we demonstrate for the first time the versatile fluidic radio frequency metamaterials with negative refraction using a water-embedded and metal-coated 3D architecture. Effective medium analysis confirms that metallic frames create an evanescent environment while simultaneously water cylinders produce negative permeability under Mie resonance. The water-metal coupled 3D architectures and the accessory devices for measurement are fabricated by 3D printing with post electroless deposition. Our study also reveals the great potential of fluidic metamaterials and versatility of the 3D printing process in rapid prototyping of customized metamaterials.

  11. Circumvention of noise contributions in fiber laser based frequency combs.

    Science.gov (United States)

    Benkler, Erik; Telle, Harald; Zach, Armin; Tauser, Florian

    2005-07-25

    We investigate the performance of an Er:fiber laser based femtosecond frequency comb for precision metrological applications. Instead of an active stabilization of the comb, the fluctuations of the carrier-envelope offset phase, the repetition phase, and the phase of the beat from a comb line with an optical reference are synchronously detected. We show that these fluctuations can be effectively eliminated by exploiting their known correlation. In our experimental scheme, we utilize two identically constructed frequency combs for the measurement of the fluctuations, rejecting the influence of a shared optical reference. From measuring a white frequency noise level, we demonstrate that a fractional frequency instability better than 1.4 x 10(-14) for 1 s averaging time can be achieved in frequency metrology applications using the Er:fiber based frequency comb.

  12. On frequency-weighted coprime factorization based controller reduction

    OpenAIRE

    Varga, Andras

    2003-01-01

    We consider the efficient solution of a class of coprime factorization based controller approximation problems by using frequency-weighted balancing related model reduction approaches. It is shown that for some special stability enforcing frequency-weights, the computation of the frequency-weighted controllability and observability grammians can be done by solving reduced order Lyapunov equations. The new approach can be used in conjunction with accuracy enhancing square-root and balancing-fr...

  13. Prestress Force Identification for Externally Prestressed Concrete Beam Based on Frequency Equation and Measured Frequencies

    Directory of Open Access Journals (Sweden)

    Luning Shi

    2014-01-01

    Full Text Available A prestress force identification method for externally prestressed concrete uniform beam based on the frequency equation and the measured frequencies is developed. For the purpose of the prestress force identification accuracy, we first look for the appropriate method to solve the free vibration equation of externally prestressed concrete beam and then combine the measured frequencies with frequency equation to identify the prestress force. To obtain the exact solution of the free vibration equation of multispan externally prestressed concrete beam, an analytical model of externally prestressed concrete beam is set up based on the Bernoulli-Euler beam theory and the function relation between prestress variation and vibration displacement is built. The multispan externally prestressed concrete beam is taken as the multiple single-span beams which must meet the bending moment and rotation angle boundary conditions, the free vibration equation is solved using sublevel simultaneous method and the semi-analytical solution of the free vibration equation which considered the influence of prestress on section rigidity and beam length is obtained. Taking simply supported concrete beam and two-span concrete beam with external tendons as examples, frequency function curves are obtained with the measured frequencies into it and the prestress force can be identified using the abscissa of the crosspoint of frequency functions. Identification value of the prestress force is in good agreement with the test results. The method can accurately identify prestress force of externally prestressed concrete beam and trace the trend of effective prestress force.

  14. Silicon-Chip-Based Optical Frequency Combs

    Science.gov (United States)

    2015-10-26

    fiber-based polarization controllers and a polarization beam splitter , and the output power is monitored with a sensitive photodiode. We use a...a single CW laser beam coupled to a microresonators can produce stabilized, octave-spanning combs through highly cascaded four-wave mixing (FWM...resonator designs , the resonator and the coupling waveguide are monolithically integrated. Thus, the entire on-chip configuration of CMOS-compatible

  15. A Kalman-based Fundamental Frequency Estimation Algorithm

    DEFF Research Database (Denmark)

    Shi, Liming; Nielsen, Jesper Kjær; Jensen, Jesper Rindom

    2017-01-01

    Fundamental frequency estimation is an important task in speech and audio analysis. Harmonic model-based methods typically have superior estimation accuracy. However, such methods usually as- sume that the fundamental frequency and amplitudes are station- ary over a short time frame. In this pape...

  16. SUBTLEX- AL: Albanian word frequencies based on film subtitles

    Directory of Open Access Journals (Sweden)

    Dr.Sc. Rrezarta Avdyli

    2013-06-01

    Full Text Available Recently several studies have shown that word frequency estimation based on subtitle files explains better the variance in word recognition performance than traditional words frequency estimates did. The present study aims to show this frequency estimate in Albanian from more than 2M words coming from film subtitles. Our results show high correlation between the RT from a LD study (120 stimuli and the SUBTLEX- AL, as well as, high correlation between this and the unique existing frequency list of a hundred more frequent Albanian words. These findings suggest that SUBTLEX-AL it is good frequency estimation, furthermore, this is the first database of frequency estimation in Albanian larger than 100 words.

  17. USA hCG reference service, 10-year report.

    Science.gov (United States)

    Cole, Laurence A; Laidler, Laura L; Muller, Carolyn Y

    2010-08-01

    The USA hCG Reference Service has been dealing with cases of persistent low levels of hCG and gestational trophoblastic diseases for 10years. Here we present the complete experience. Total hCG in serum and urine was measured using the Siemen's Immulite 1000 assay. Hyperglycosylated hCG, nicked hCG, free ss-subunit and ss-core fragment were measured using microtiterplate assays with antibodies B152, B151, FBT11 and B210, respectively. The USA hCG Reference Service has identified 83 cases of false-positive hCG, 71 cases of aggressive gestational trophoblastic disease (GTD), 52 cases of minimally invasive GTD, 168 cases of quiescent GTD and 22 cases of placenta site trophoblastic tumor (PSTT). In addition, 103 cases of pituitary hCG have been identified, 60 cases of nontrophoblastic tumor, 4 cases of inherited hCG and 2 cases of Munchausen's syndrome. This is 565 cases total. Multiple new methods are described and tested for diagnosing all of these disorders. The USA hCG Reference Service experience shows new methods for detecting multiple hCG-related disorders and recommends new approaches for detecting these hCG-related disorders. 2010 The Canadian Society of Clinical Chemists. Published by Elsevier Inc. All rights reserved.

  18. Frequency Based Real-time Pricing for Residential Prosumers

    Science.gov (United States)

    Hambridge, Sarah Mabel

    This work is the first to explore frequency based pricing for secondary frequency control as a price-reactive control mechanism for residential prosumers. A frequency based real-time electricity rate is designed as an autonomous market control mechanism for residential prosumers to provide frequency support as an ancillary service. In addition, prosumers are empowered to participate in dynamic energy transactions, therefore integrating Distributed Energy Resources (DERs), and increasing distributed energy storage onto the distributed grid. As the grid transitions towards DERs, a new market based control system will take the place of the legacy distributed system and possibly the legacy bulk power system. DERs provide many benefits such as energy independence, clean generation, efficiency, and reliability to prosumers during blackouts. However, the variable nature of renewable energy and current lack of installed energy storage on the grid will create imbalances in supply and demand as uptake increases, affecting the grid frequency and system operation. Through a frequency-based electricity rate, prosumers will be encouraged to purchase energy storage systems (ESS) to offset their neighbor's distributed generation (DG) such as solar. Chapter 1 explains the deregulation of the power system and move towards Distributed System Operators (DSOs), as prosumers become owners of microgrids and energy cells connected to the distributed system. Dynamic pricing has been proposed as a benefit to prosumers, giving them the ability to make decisions in the energy market, while also providing a way to influence and control their behavior. Frequency based real-time pricing is a type of dynamic pricing which falls between price-reactive control and transactive control. Prosumer-to-prosumer transactions may take the place of prosumer-to-utility transactions, building The Energy Internet. Frequency based pricing could be a mechanism for determining prosumer prices and supporting

  19. [Children with hyperthyroidism due to elevated hCG levels].

    Science.gov (United States)

    Jöbsis, Jasper J; van Trotsenburg, A S Paul; Merks, Johannes H M; Kamp, Gerdine A

    2014-01-01

    We describe two children with hyperthyroidism secondary to elevated hCG levels: one patient with gestational trophoblastic disease and one patient with choriocarcinoma. hCG resembles other glycoproteins that can lead to hyperthyroidism through TSH receptor activation. Also, through its LH-mimicking effect, hCG can induce high oestradiol levels, resulting in stormy pubertal development. False negative hCG tests due to the high-dose hook effect may complicate the diagnostic process. In patients with antibody-negative thyrotoxicosis, the diagnosis of hCG-induced hyperthyroidism must be considered.

  20. The neural bases of spatial frequency processing during scene perception

    Science.gov (United States)

    Kauffmann, Louise; Ramanoël, Stephen; Peyrin, Carole

    2014-01-01

    Theories on visual perception agree that scenes are processed in terms of spatial frequencies. Low spatial frequencies (LSF) carry coarse information whereas high spatial frequencies (HSF) carry fine details of the scene. However, how and where spatial frequencies are processed within the brain remain unresolved questions. The present review addresses these issues and aims to identify the cerebral regions differentially involved in low and high spatial frequency processing, and to clarify their attributes during scene perception. Results from a number of behavioral and neuroimaging studies suggest that spatial frequency processing is lateralized in both hemispheres, with the right and left hemispheres predominantly involved in the categorization of LSF and HSF scenes, respectively. There is also evidence that spatial frequency processing is retinotopically mapped in the visual cortex. HSF scenes (as opposed to LSF) activate occipital areas in relation to foveal representations, while categorization of LSF scenes (as opposed to HSF) activates occipital areas in relation to more peripheral representations. Concomitantly, a number of studies have demonstrated that LSF information may reach high-order areas rapidly, allowing an initial coarse parsing of the visual scene, which could then be sent back through feedback into the occipito-temporal cortex to guide finer HSF-based analysis. Finally, the review addresses spatial frequency processing within scene-selective regions areas of the occipito-temporal cortex. PMID:24847226

  1. PICTURE, 2-D Slices Through 3-D CG of MORSE, QAD-CG

    International Nuclear Information System (INIS)

    1994-01-01

    1 - Description of program or function: Picture generates plots of two-dimensional slices through the three-dimensional geometry described by the combinatorial geometry (CG) package used in such codes as MORSE and QAD-CG. These plots are printed on a standard line printer. 2 - Method of solution: Several different ways are available to obtain a two-dimensional slice through the geometry. The geometry ray tracing capability is tested by forcing the geometry package to execute the routines and logic of the Monte Carlo random walk or kernel integration algorithms. 3 - Restrictions on the complexity of the problem: None tested besides those listed in the input descriptions

  2. Cooperative Game Study of Airlines Based on Flight Frequency Optimization

    Directory of Open Access Journals (Sweden)

    Wanming Liu

    2014-01-01

    Full Text Available By applying the game theory, the relationship between airline ticket price and optimal flight frequency is analyzed. The paper establishes the payoff matrix of the flight frequency in noncooperation scenario and flight frequency optimization model in cooperation scenario. The airline alliance profit distribution is converted into profit distribution game based on the cooperation game theory. The profit distribution game is proved to be convex, and there exists an optimal distribution strategy. The results show that joining the airline alliance can increase airline whole profit, the change of negotiated prices and cost is beneficial to profit distribution of large airlines, and the distribution result is in accordance with aviation development.

  3. Frequency Estimator Performance for a Software-Based Beacon Receiver

    Science.gov (United States)

    Zemba, Michael J.; Morse, Jacquelynne Rose; Nessel, James A.; Miranda, Felix

    2014-01-01

    As propagation terminals have evolved, their design has trended more toward a software-based approach that facilitates convenient adjustment and customization of the receiver algorithms. One potential improvement is the implementation of a frequency estimation algorithm, through which the primary frequency component of the received signal can be estimated with a much greater resolution than with a simple peak search of the FFT spectrum. To select an estimator for usage in a QV-band beacon receiver, analysis of six frequency estimators was conducted to characterize their effectiveness as they relate to beacon receiver design.

  4. Determination of hCG-alpha subunit in threatened pregnancy

    International Nuclear Information System (INIS)

    Talas, M.; Pohanka, J.; Fingerova, H.; Janouskova, M.; Krikal, Z.; Prasilova, J.; Zupkova, H.

    1987-01-01

    Radioimmunoassay of the hCG-alpha subunit was made using an antibody anti hCG-alpha serum, highly purified hCG-alpha for 125 I-labelling and the standard hCG-alpha. Sera of healthy pregnant women sampled throughout the whole pregnancies were used to determine x-bar±S.D. of hCG-alpha for 14-day intervals. Included in the study were groups of women with high risk of premature labor, late toxemia of pregnancy, twins and fetal hypotrophy. It was shown that increased hCG-alpha is found in pregnant women in whom signs of late toxemia of pregnancy are combined with high risk of premature labor, or with twin pregnancies, while in those with fetal hypotrophy hCG-alpha is within normal limits. (author). 3 figs., 7 refs

  5. Analysis list: CG8478 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available CG8478 Cell line,Embryo,Pupae + dm3 http://dbarchive.biosciencedbc.jp/kyushu-u/dm3/...target/CG8478.1.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/dm3/target/CG8478.5.tsv http://dbarchive.bioscience...dbc.jp/kyushu-u/dm3/target/CG8478.10.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/dm3/colo/CG8478.Ce...ll_line.tsv,http://dbarchive.biosciencedbc.jp/kyushu-u/dm3/colo/CG8478.Embryo.tsv,http://dbarchive.bioscie...ncedbc.jp/kyushu-u/dm3/colo/CG8478.Pupae.tsv http://dbarchive.biosciencedbc.jp/kyus

  6. Microresonator-Based Optical Frequency Combs: A Time Domain Perspective

    Science.gov (United States)

    2016-04-19

    AFRL-AFOSR-VA-TR-2016-0165 (BRI) Microresonator-Based Optical Frequency Combs: A Time Domain Perspective Andrew Weiner PURDUE UNIVERSITY 401 SOUTH...Optical Frequency Combs: A Time Domain Perspective 5a. CONTRACT NUMBER 5b. GRANT NUMBER FA9550-12-1-0236 5c. PROGRAM ELEMENT NUMBER 6. AUTHOR(S...average 1 hour per response, including the time for reviewing instructions, searching existing data sources, gathering and maintaining the data

  7. Frequency of Testing for Dyslipidemia: An Evidence-Based Analysis

    Science.gov (United States)

    2014-01-01

    Background Dyslipidemias include high levels of total cholesterol, low-density lipoprotein (LDL) cholesterol, and triglycerides and low levels of high-density lipoprotein (HDL) cholesterol. Dyslipidemia is a risk factor for cardiovascular disease, which is a major contributor to mortality in Canada. Approximately 23% of the 2009/11 Canadian Health Measures Survey (CHMS) participants had a high level of LDL cholesterol, with prevalence increasing with age, and approximately 15% had a total cholesterol to HDL ratio above the threshold. Objectives To evaluate the frequency of lipid testing in adults not diagnosed with dyslipidemia and in adults on treatment for dyslipidemia. Research Methods A systematic review of the literature set out to identify randomized controlled trials (RCTs), systematic reviews, health technology assessments (HTAs), and observational studies published between January 1, 2000, and November 29, 2012, that evaluated the frequency of testing for dyslipidemia in the 2 populations. Results Two observational studies assessed the frequency of lipid testing, 1 in individuals not on lipid-lowering medications and 1 in treated individuals. Both studies were based on previously collected data intended for a different objective and, therefore, no conclusions could be reached about the frequency of testing at intervals other than the ones used in the original studies. Given this limitation and generalizability issues, the quality of evidence was considered very low. No evidence for the frequency of lipid testing was identified in the 2 HTAs included. Canadian and international guidelines recommend testing for dyslipidemia in individuals at an increased risk for cardiovascular disease. The frequency of testing recommended is based on expert consensus. Conclusions Conclusions on the frequency of lipid testing could not be made based on the 2 observational studies. Current guidelines recommend lipid testing in adults with increased cardiovascular risk, with

  8. Separation of musical instruments based on amplitude and frequency comodulation

    Science.gov (United States)

    Jacobson, Barry D.; Cauwenberghs, Gert; Quatieri, Thomas F.

    2002-05-01

    In previous work, amplitude comodulation was investigated as a basis for monaural source separation. Amplitude comodulation refers to similarities in amplitude envelopes of individual spectral components emitted by particular types of sources. In many types of musical instruments, amplitudes of all resonant modes rise/fall, and start/stop together during the course of normal playing. We found that under certain well-defined conditions, a mixture of constant frequency, amplitude comodulated sources can unambiguously be decomposed into its constituents on the basis of these similarities. In this work, system performance was improved by relaxing the constant frequency requirement. String instruments, for example, which are normally played with vibrato, are both amplitude and frequency comodulated sources, and could not be properly tracked under the constant frequency assumption upon which our original algorithm was based. Frequency comodulation refers to similarities in frequency variations of individual harmonics emitted by these types of sources. The analytical difficulty is in defining a representation of the source which properly tracks frequency varying components. A simple, fixed filter bank can only track an individual spectral component for the duration in which it is within the passband of one of the filters. Alternatives are therefore explored which are amenable to real-time implementation.

  9. Acoustic frequency filter based on anisotropic topological phononic crystals

    KAUST Repository

    Chen, Zeguo

    2017-11-02

    We present a design of acoustic frequency filter based on a two-dimensional anisotropic phononic crystal. The anisotropic band structure exhibits either a directional or a combined (global + directional) bandgap at certain frequency regions, depending on the geometry. When the time-reversal symmetry is broken, it may introduce a topologically nontrivial bandgap. The induced nontrivial bandgap and the original directional bandgap result in various interesting wave propagation behaviors, such as frequency filter. We develop a tight-binding model to characterize the effective Hamiltonian of the system, from which the contribution of anisotropy is explicitly shown. Different from the isotropic cases, the Zeeman-type splitting is not linear and the anisotropic bandgap makes it possible to achieve anisotropic propagation characteristics along different directions and at different frequencies.

  10. Acoustic frequency filter based on anisotropic topological phononic crystals

    KAUST Repository

    Chen, Zeguo; Zhao, Jiajun; Mei, Jun; Wu, Ying

    2017-01-01

    We present a design of acoustic frequency filter based on a two-dimensional anisotropic phononic crystal. The anisotropic band structure exhibits either a directional or a combined (global + directional) bandgap at certain frequency regions, depending on the geometry. When the time-reversal symmetry is broken, it may introduce a topologically nontrivial bandgap. The induced nontrivial bandgap and the original directional bandgap result in various interesting wave propagation behaviors, such as frequency filter. We develop a tight-binding model to characterize the effective Hamiltonian of the system, from which the contribution of anisotropy is explicitly shown. Different from the isotropic cases, the Zeeman-type splitting is not linear and the anisotropic bandgap makes it possible to achieve anisotropic propagation characteristics along different directions and at different frequencies.

  11. CG13250, a novel bromodomain inhibitor, suppresses proliferation of multiple myeloma cells in an orthotopic mouse model

    International Nuclear Information System (INIS)

    Imayoshi, Natsuki; Yoshioka, Makoto; Chauhan, Jay; Nakata, Susumu; Toda, Yuki; Fletcher, Steven; Strovel, Jeffrey W.; Takata, Kazuyuki; Ashihara, Eishi

    2017-01-01

    Multiple myeloma (MM) is characterized by the clonal proliferation of neoplastic plasma cells. Despite a stream of new molecular targets based on better understanding of the disease, MM remains incurable. Epigenomic abnormalities contribute to the pathogenesis of MM. bromodomain 4 (BRD4), a member of the bromodomain and extraterminal (BET) family, binds to acetylated histones during M/G1 transition in the cell cycle promoting progression to S phase. In this study, we investigated the effects of a novel BET inhibitor CG13250 on MM cells. CG13250 inhibited ligand binding to BRD4 in a dose-dependent manner and with an IC 50 value of 1.1 μM. It inhibited MM proliferation in a dose-dependent manner and arrested cells in G1, resulting in the induction of apoptosis through caspase activation. CG13250 inhibited the binding of BRD4 to c-MYC promoter regions suppressing the transcription of the c-MYC gene. Administered in vivo, CG13250 significantly prolonged survival of an orthotopic MM-bearing mice. In conclusion, CG13250 is a novel bromodomain inhibitor that is a promising molecular targeting agent against MM. - Highlights: • A novel bromodomain inhibitor CG13250 suppresses MM cell proliferation. • CG13250 decreases C-MYC expression, resulting in the induction of apoptosis. • CG13250 prolongs the survivals of MM-bearing mice.

  12. Carbon nanotube transistor based high-frequency electronics

    Science.gov (United States)

    Schroter, Michael

    At the nanoscale carbon nanotubes (CNTs) have higher carrier mobility and carrier velocity than most incumbent semiconductors. Thus CNT based field-effect transistors (FETs) are being considered as strong candidates for replacing existing MOSFETs in digital applications. In addition, the predicted high intrinsic transit frequency and the more recent finding of ways to achieve highly linear transfer characteristics have inspired investigations on analog high-frequency (HF) applications. High linearity is extremely valuable for an energy efficient usage of the frequency spectrum, particularly in mobile communications. Compared to digital applications, the much more relaxed constraints for CNT placement and lithography combined with already achieved operating frequencies of at least 10 GHz for fabricated devices make an early entry in the low GHz HF market more feasible than in large-scale digital circuits. Such a market entry would be extremely beneficial for funding the development of production CNTFET based process technology. This talk will provide an overview on the present status and feasibility of HF CNTFET technology will be given from an engineering point of view, including device modeling, experimental results, and existing roadblocks. Carbon nanotube transistor based high-frequency electronics.

  13. Frequency-Wavenumber (FK)-Based Data Selection in High-Frequency Passive Surface Wave Survey

    Science.gov (United States)

    Cheng, Feng; Xia, Jianghai; Xu, Zongbo; Hu, Yue; Mi, Binbin

    2018-04-01

    Passive surface wave methods have gained much attention from geophysical and civil engineering communities because of the limited application of traditional seismic surveys in highly populated urban areas. Considering that they can provide high-frequency phase velocity information up to several tens of Hz, the active surface wave survey would be omitted and the amount of field work could be dramatically reduced. However, the measured dispersion energy image in the passive surface wave survey would usually be polluted by a type of "crossed" artifacts at high frequencies. It is common in the bidirectional noise distribution case with a linear receiver array deployed along roads or railways. We review several frequently used passive surface wave methods and derive the underlying physics for the existence of the "crossed" artifacts. We prove that the "crossed" artifacts would cross the true surface wave energy at fixed points in the f-v domain and propose a FK-based data selection technique to attenuate the artifacts in order to retrieve the high-frequency information. Numerical tests further demonstrate the existence of the "crossed" artifacts and indicate that the well-known wave field separation method, FK filter, does not work for the selection of directional noise data. Real-world applications manifest the feasibility of the proposed FK-based technique to improve passive surface wave methods by a priori data selection. Finally, we discuss the applicability of our approach.

  14. Frequency-Wavenumber (FK)-Based Data Selection in High-Frequency Passive Surface Wave Survey

    Science.gov (United States)

    Cheng, Feng; Xia, Jianghai; Xu, Zongbo; Hu, Yue; Mi, Binbin

    2018-07-01

    Passive surface wave methods have gained much attention from geophysical and civil engineering communities because of the limited application of traditional seismic surveys in highly populated urban areas. Considering that they can provide high-frequency phase velocity information up to several tens of Hz, the active surface wave survey would be omitted and the amount of field work could be dramatically reduced. However, the measured dispersion energy image in the passive surface wave survey would usually be polluted by a type of "crossed" artifacts at high frequencies. It is common in the bidirectional noise distribution case with a linear receiver array deployed along roads or railways. We review several frequently used passive surface wave methods and derive the underlying physics for the existence of the "crossed" artifacts. We prove that the "crossed" artifacts would cross the true surface wave energy at fixed points in the f- v domain and propose a FK-based data selection technique to attenuate the artifacts in order to retrieve the high-frequency information. Numerical tests further demonstrate the existence of the "crossed" artifacts and indicate that the well-known wave field separation method, FK filter, does not work for the selection of directional noise data. Real-world applications manifest the feasibility of the proposed FK-based technique to improve passive surface wave methods by a priori data selection. Finally, we discuss the applicability of our approach.

  15. VAM3D-CG configuration management plan

    International Nuclear Information System (INIS)

    Langford, D.W.

    1994-01-01

    The VAM3D-CG computer code has been licensed for use at Hanford, from HydroGeologic, Inc., of Herndon, VA. Version 2.4b has been installed on the 3200GWW workstations, and is currently under configuration management. The purpose of this report is to describe the installation and configuration management of VAM3D-CG on the Hanford Computer System. VAM3D-CG is written in standard FORTRAN F77

  16. Variation, Evolution, and Correlation Analysis of C+G Content and Genome or Chromosome Size in Different Kingdoms and Phyla

    Science.gov (United States)

    Li, Xiu-Qing; Du, Donglei

    2014-01-01

    C+G content (GC content or G+C content) is known to be correlated with genome/chromosome size in bacteria but the relationship for other kingdoms remains unclear. This study analyzed genome size, chromosome size, and base composition in most of the available sequenced genomes in various kingdoms. Genome size tends to increase during evolution in plants and animals, and the same is likely true for bacteria. The genomic C+G contents were found to vary greatly in microorganisms but were quite similar within each animal or plant subkingdom. In animals and plants, the C+G contents are ranked as follows: monocot plants>mammals>non-mammalian animals>dicot plants. The variation in C+G content between chromosomes within species is greater in animals than in plants. The correlation between average chromosome C+G content and chromosome length was found to be positive in Proteobacteria, Actinobacteria (but not in other analyzed bacterial phyla), Ascomycota fungi, and likely also in some plants; negative in some animals, insignificant in two protist phyla, and likely very weak in Archaea. Clearly, correlations between C+G content and chromosome size can be positive, negative, or not significant depending on the kingdoms/groups or species. Different phyla or species exhibit different patterns of correlation between chromosome-size and C+G content. Most chromosomes within a species have a similar pattern of variation in C+G content but outliers are common. The data presented in this study suggest that the C+G content is under genetic control by both trans- and cis- factors and that the correlation between C+G content and chromosome length can be positive, negative, or not significant in different phyla. PMID:24551092

  17. Classification of hydromagnetic emissions based on frequency--time spectra

    International Nuclear Information System (INIS)

    Fukunishi, H.; Toya, T.; Koike, K.; Kuwashima, M.; Kawamura, M.

    1981-01-01

    By using 3035 hydromagnetic emission events observed in the frequency range of 0.1--2.0 Hz at Syowa (Lapprox.6), HM emissions have been classified into eight subtypes based on their spectral structures, i.e., HM whistler, periodic HM emission, HM chorus, HM emission burst, IPDP, morning IPDP, Pc 1--2 band, and irregular HM emission. It is seen that each subtype has a preferential magnetic local time interval and also a frequency range for its occurrence. Morning IPDP events and irregular HM emissions occur in the magnetic morning hours, while dispersive periodic HM emissions and HM emission bursts occur around magnetic local noon, then HM chorus emissions occur in the afternoon hours and IPDP events occur in the evening hours. Furthermore, it is noticed that the mid-frequencies of these emissions vary from high frequencies in the morning hours to low frequencies in the afternoon hours. On the basis of these results, the generation mechanisms of each subtype are discussed

  18. Portable atomic frequency standard based on coherent population trapping

    Science.gov (United States)

    Shi, Fan; Yang, Renfu; Nian, Feng; Zhang, Zhenwei; Cui, Yongshun; Zhao, Huan; Wang, Nuanrang; Feng, Keming

    2015-05-01

    In this work, a portable atomic frequency standard based on coherent population trapping is designed and demonstrated. To achieve a portable prototype, in the system, a single transverse mode 795nm VCSEL modulated by a 3.4GHz RF source is used as a pump laser which generates coherent light fields. The pump beams pass through a vapor cell containing atom gas and buffer gas. This vapor cell is surrounded by a magnetic shield and placed inside a solenoid which applies a longitudinal magnetic field to lift the Zeeman energy levels' degeneracy and to separate the resonance signal, which has no first-order magnetic field dependence, from the field-dependent resonances. The electrical control system comprises two control loops. The first one locks the laser wavelength to the minimum of the absorption spectrum; the second one locks the modulation frequency and output standard frequency. Furthermore, we designed the micro physical package and realized the locking of a coherent population trapping atomic frequency standard portable prototype successfully. The short-term frequency stability of the whole system is measured to be 6×10-11 for averaging times of 1s, and reaches 5×10-12 at an averaging time of 1000s.

  19. Biometric identification based on novel frequency domain facial asymmetry measures

    Science.gov (United States)

    Mitra, Sinjini; Savvides, Marios; Vijaya Kumar, B. V. K.

    2005-03-01

    In the modern world, the ever-growing need to ensure a system's security has spurred the growth of the newly emerging technology of biometric identification. The present paper introduces a novel set of facial biometrics based on quantified facial asymmetry measures in the frequency domain. In particular, we show that these biometrics work well for face images showing expression variations and have the potential to do so in presence of illumination variations as well. A comparison of the recognition rates with those obtained from spatial domain asymmetry measures based on raw intensity values suggests that the frequency domain representation is more robust to intra-personal distortions and is a novel approach for performing biometric identification. In addition, some feature analysis based on statistical methods comparing the asymmetry measures across different individuals and across different expressions is presented.

  20. Development of Mycoplasma synoviae (MS) core genome multilocus sequence typing (cgMLST) scheme.

    Science.gov (United States)

    Ghanem, Mostafa; El-Gazzar, Mohamed

    2018-05-01

    Mycoplasma synoviae (MS) is a poultry pathogen with reported increased prevalence and virulence in recent years. MS strain identification is essential for prevention, control efforts and epidemiological outbreak investigations. Multiple multilocus based sequence typing schemes have been developed for MS, yet the resolution of these schemes could be limited for outbreak investigation. The cost of whole genome sequencing became close to that of sequencing the seven MLST targets; however, there is no standardized method for typing MS strains based on whole genome sequences. In this paper, we propose a core genome multilocus sequence typing (cgMLST) scheme as a standardized and reproducible method for typing MS based whole genome sequences. A diverse set of 25 MS whole genome sequences were used to identify 302 core genome genes as cgMLST targets (35.5% of MS genome) and 44 whole genome sequences of MS isolates from six countries in four continents were used for typing applying this scheme. cgMLST based phylogenetic trees displayed a high degree of agreement with core genome SNP based analysis and available epidemiological information. cgMLST allowed evaluation of two conventional MLST schemes of MS. The high discriminatory power of cgMLST allowed differentiation between samples of the same conventional MLST type. cgMLST represents a standardized, accurate, highly discriminatory, and reproducible method for differentiation between MS isolates. Like conventional MLST, it provides stable and expandable nomenclature, allowing for comparing and sharing the typing results between different laboratories worldwide. Copyright © 2018 The Authors. Published by Elsevier B.V. All rights reserved.

  1. Quantum mechanics/coarse-grained molecular mechanics (QM/CG-MM).

    Science.gov (United States)

    Sinitskiy, Anton V; Voth, Gregory A

    2018-01-07

    Numerous molecular systems, including solutions, proteins, and composite materials, can be modeled using mixed-resolution representations, of which the quantum mechanics/molecular mechanics (QM/MM) approach has become the most widely used. However, the QM/MM approach often faces a number of challenges, including the high cost of repetitive QM computations, the slow sampling even for the MM part in those cases where a system under investigation has a complex dynamics, and a difficulty in providing a simple, qualitative interpretation of numerical results in terms of the influence of the molecular environment upon the active QM region. In this paper, we address these issues by combining QM/MM modeling with the methodology of "bottom-up" coarse-graining (CG) to provide the theoretical basis for a systematic quantum-mechanical/coarse-grained molecular mechanics (QM/CG-MM) mixed resolution approach. A derivation of the method is presented based on a combination of statistical mechanics and quantum mechanics, leading to an equation for the effective Hamiltonian of the QM part, a central concept in the QM/CG-MM theory. A detailed analysis of different contributions to the effective Hamiltonian from electrostatic, induction, dispersion, and exchange interactions between the QM part and the surroundings is provided, serving as a foundation for a potential hierarchy of QM/CG-MM methods varying in their accuracy and computational cost. A relationship of the QM/CG-MM methodology to other mixed resolution approaches is also discussed.

  2. Quantum mechanics/coarse-grained molecular mechanics (QM/CG-MM)

    Science.gov (United States)

    Sinitskiy, Anton V.; Voth, Gregory A.

    2018-01-01

    Numerous molecular systems, including solutions, proteins, and composite materials, can be modeled using mixed-resolution representations, of which the quantum mechanics/molecular mechanics (QM/MM) approach has become the most widely used. However, the QM/MM approach often faces a number of challenges, including the high cost of repetitive QM computations, the slow sampling even for the MM part in those cases where a system under investigation has a complex dynamics, and a difficulty in providing a simple, qualitative interpretation of numerical results in terms of the influence of the molecular environment upon the active QM region. In this paper, we address these issues by combining QM/MM modeling with the methodology of "bottom-up" coarse-graining (CG) to provide the theoretical basis for a systematic quantum-mechanical/coarse-grained molecular mechanics (QM/CG-MM) mixed resolution approach. A derivation of the method is presented based on a combination of statistical mechanics and quantum mechanics, leading to an equation for the effective Hamiltonian of the QM part, a central concept in the QM/CG-MM theory. A detailed analysis of different contributions to the effective Hamiltonian from electrostatic, induction, dispersion, and exchange interactions between the QM part and the surroundings is provided, serving as a foundation for a potential hierarchy of QM/CG-MM methods varying in their accuracy and computational cost. A relationship of the QM/CG-MM methodology to other mixed resolution approaches is also discussed.

  3. High frequency electromechanical memory cells based on telescoping carbon nanotubes.

    Science.gov (United States)

    Popov, A M; Lozovik, Y E; Kulish, A S; Bichoutskaia, E

    2010-07-01

    A new method to increase the operational frequency of electromechanical memory cells based on the telescoping motion of multi-walled carbon nanotubes through the selection of the form of the switching voltage pulse is proposed. The relative motion of the walls of carbon nanotubes can be controlled through the shape of the interwall interaction energy surface. This allows the use of the memory cells in nonvolatile or volatile regime, depending on the structure of carbon nanotube. Simulations based on ab initio and semi-empirical calculations of the interwall interaction energies are used to estimate the switching voltage and the operational frequency of volatile cells with the electrodes made of carbon nanotubes. The lifetime of nonvolatile memory cells is also predicted.

  4. Order Tracking Based on Robust Peak Search Instantaneous Frequency Estimation

    International Nuclear Information System (INIS)

    Gao, Y; Guo, Y; Chi, Y L; Qin, S R

    2006-01-01

    Order tracking plays an important role in non-stationary vibration analysis of rotating machinery, especially to run-up or coast down. An instantaneous frequency estimation (IFE) based order tracking of rotating machinery is introduced. In which, a peak search algorithms of spectrogram of time-frequency analysis is employed to obtain IFE of vibrations. An improvement to peak search is proposed, which can avoid strong non-order components or noises disturbing to the peak search work. Compared with traditional methods of order tracking, IFE based order tracking is simplified in application and only software depended. Testing testify the validity of the method. This method is an effective supplement to traditional methods, and the application in condition monitoring and diagnosis of rotating machinery is imaginable

  5. Chromosomal localisation of the CD4cre transgene in B6·Cg-Tg(Cd4-cre)1Cwi mice.

    Science.gov (United States)

    Westendorf, Kerstin; Durek, Pawel; Ayew, Samia; Mashreghi, Mir-Farzin; Radbruch, Andreas

    2016-09-01

    The B6·Cg-Tg(Cd4-cre)1Cwi line expresses CRE recombinase under the control of the promoter and regulatory elements of the Cd4 gene. Here we show that CRE recombinase expression reduces the number and frequencies of CD4 positive subsets in a dose-dependent manner and localize the integration site of the transgenic construct to position 60335693-60341285 (qD) of chromosome 3. The insert contains at least 15 complete sequential copies of the transgenic construct. Based on this information we describe a novel PCR assay for genetic typing of transgenic mice. Copyright © 2016 Elsevier B.V. All rights reserved.

  6. The analysis of cable forces based on natural frequency

    Science.gov (United States)

    Suangga, Made; Hidayat, Irpan; Juliastuti; Bontan, Darwin Julius

    2017-12-01

    A cable is a flexible structural member that is effective at resisting tensile forces. Cables are used in a variety of structures that employ their unique characteristics to create efficient design tension members. The condition of the cable forces in the cable supported structure is an important indication of judging whether the structure is in good condition. Several methods have been developed to measure on site cable forces. Vibration technique using correlation between natural frequency and cable forces is a simple method to determine in situ cable forces, however the method need accurate information on the boundary condition, cable mass, and cable length. The natural frequency of the cable is determined using FFT (Fast Fourier Transform) Technique to the acceleration record of the cable. Based on the natural frequency obtained, the cable forces then can be determine by analytical or by finite element program. This research is focus on the vibration techniques to determine the cable forces, to understand the physical parameter effect of the cable and also modelling techniques to the natural frequency and cable forces.

  7. Declarative Programming with Temporal Constraints, in the Language CG

    Directory of Open Access Journals (Sweden)

    Lorina Negreanu

    2015-01-01

    Full Text Available Specifying and interpreting temporal constraints are key elements of knowledge representation and reasoning, with applications in temporal databases, agent programming, and ambient intelligence. We present and formally characterize the language CG, which tackles this issue. In CG, users are able to develop time-dependent programs, in a flexible and straightforward manner. Such programs can, in turn, be coupled with evolving environments, thus empowering users to control the environment’s evolution. CG relies on a structure for storing temporal information, together with a dedicated query mechanism. Hence, we explore the computational complexity of our query satisfaction problem. We discuss previous implementation attempts of CG and introduce a novel prototype which relies on logic programming. Finally, we address the issue of consistency and correctness of CG program execution, using the Event-B modeling approach.

  8. Declarative Programming with Temporal Constraints, in the Language CG.

    Science.gov (United States)

    Negreanu, Lorina

    2015-01-01

    Specifying and interpreting temporal constraints are key elements of knowledge representation and reasoning, with applications in temporal databases, agent programming, and ambient intelligence. We present and formally characterize the language CG, which tackles this issue. In CG, users are able to develop time-dependent programs, in a flexible and straightforward manner. Such programs can, in turn, be coupled with evolving environments, thus empowering users to control the environment's evolution. CG relies on a structure for storing temporal information, together with a dedicated query mechanism. Hence, we explore the computational complexity of our query satisfaction problem. We discuss previous implementation attempts of CG and introduce a novel prototype which relies on logic programming. Finally, we address the issue of consistency and correctness of CG program execution, using the Event-B modeling approach.

  9. MFAM: Multiple Frequency Adaptive Model-Based Indoor Localization Method.

    Science.gov (United States)

    Tuta, Jure; Juric, Matjaz B

    2018-03-24

    This paper presents MFAM (Multiple Frequency Adaptive Model-based localization method), a novel model-based indoor localization method that is capable of using multiple wireless signal frequencies simultaneously. It utilizes indoor architectural model and physical properties of wireless signal propagation through objects and space. The motivation for developing multiple frequency localization method lies in the future Wi-Fi standards (e.g., 802.11ah) and the growing number of various wireless signals present in the buildings (e.g., Wi-Fi, Bluetooth, ZigBee, etc.). Current indoor localization methods mostly rely on a single wireless signal type and often require many devices to achieve the necessary accuracy. MFAM utilizes multiple wireless signal types and improves the localization accuracy over the usage of a single frequency. It continuously monitors signal propagation through space and adapts the model according to the changes indoors. Using multiple signal sources lowers the required number of access points for a specific signal type while utilizing signals, already present in the indoors. Due to the unavailability of the 802.11ah hardware, we have evaluated proposed method with similar signals; we have used 2.4 GHz Wi-Fi and 868 MHz HomeMatic home automation signals. We have performed the evaluation in a modern two-bedroom apartment and measured mean localization error 2.0 to 2.3 m and median error of 2.0 to 2.2 m. Based on our evaluation results, using two different signals improves the localization accuracy by 18% in comparison to 2.4 GHz Wi-Fi-only approach. Additional signals would improve the accuracy even further. We have shown that MFAM provides better accuracy than competing methods, while having several advantages for real-world usage.

  10. MFAM: Multiple Frequency Adaptive Model-Based Indoor Localization Method

    Directory of Open Access Journals (Sweden)

    Jure Tuta

    2018-03-01

    Full Text Available This paper presents MFAM (Multiple Frequency Adaptive Model-based localization method, a novel model-based indoor localization method that is capable of using multiple wireless signal frequencies simultaneously. It utilizes indoor architectural model and physical properties of wireless signal propagation through objects and space. The motivation for developing multiple frequency localization method lies in the future Wi-Fi standards (e.g., 802.11ah and the growing number of various wireless signals present in the buildings (e.g., Wi-Fi, Bluetooth, ZigBee, etc.. Current indoor localization methods mostly rely on a single wireless signal type and often require many devices to achieve the necessary accuracy. MFAM utilizes multiple wireless signal types and improves the localization accuracy over the usage of a single frequency. It continuously monitors signal propagation through space and adapts the model according to the changes indoors. Using multiple signal sources lowers the required number of access points for a specific signal type while utilizing signals, already present in the indoors. Due to the unavailability of the 802.11ah hardware, we have evaluated proposed method with similar signals; we have used 2.4 GHz Wi-Fi and 868 MHz HomeMatic home automation signals. We have performed the evaluation in a modern two-bedroom apartment and measured mean localization error 2.0 to 2.3 m and median error of 2.0 to 2.2 m. Based on our evaluation results, using two different signals improves the localization accuracy by 18% in comparison to 2.4 GHz Wi-Fi-only approach. Additional signals would improve the accuracy even further. We have shown that MFAM provides better accuracy than competing methods, while having several advantages for real-world usage.

  11. Helium gas purity monitor based on low frequency acoustic resonance

    Science.gov (United States)

    Kasthurirengan, S.; Jacob, S.; Karunanithi, R.; Karthikeyan, A.

    1996-05-01

    Monitoring gas purity is an important aspect of gas recovery stations where air is usually one of the major impurities. Purity monitors of Katherometric type are commercially available for this purpose. Alternatively, we discuss here a helium gas purity monitor based on acoustic resonance of a cavity at audio frequencies. It measures the purity by monitoring the resonant frequency of a cylindrical cavity filled with the gas under test and excited by conventional telephone transducers fixed at the ends. The use of the latter simplifies the design considerably. The paper discusses the details of the resonant cavity and the electronic circuit along with temperature compensation. The unit has been calibrated with helium gas of known purities. The unit has a response time of the order of 10 minutes and measures the gas purity to an accuracy of 0.02%. The unit has been installed in our helium recovery system and is found to perform satisfactorily.

  12. Intermediate Frequency Digital Receiver Based on Multi-FPGA System

    Directory of Open Access Journals (Sweden)

    Chengchang Zhang

    2016-01-01

    Full Text Available Aiming at high-cost, large-size, and inflexibility problems of traditional analog intermediate frequency receiver in the aerospace telemetry, tracking, and command (TTC system, we have proposed a new intermediate frequency (IF digital receiver based on Multi-FPGA system in this paper. Digital beam forming (DBF is realized by coordinated rotation digital computer (CORDIC algorithm. An experimental prototype has been developed on a compact Multi-FPGA system with three FPGAs to receive 16 channels of IF digital signals. Our experimental results show that our proposed scheme is able to provide a great convenience for the design of IF digital receiver, which offers a valuable reference for real-time, low power, high density, and small size receiver design.

  13. Input signal shaping based on harmonic frequency response function for suppressing nonlinear optical frequency in frequency-scanning interferometry

    Science.gov (United States)

    Zhu, Yu; Liu, Zhigang; Deng, Wen; Deng, Zhongwen

    2018-05-01

    Frequency-scanning interferometry (FSI) using an external cavity diode laser (ECDL) is essential for many applications of the absolute distance measurement. However, owing to the hysteresis and creep of the piezoelectric actuator inherent in the ECDL, the optical frequency scanning exhibits a nonlinearity that seriously affects the phase extraction accuracy of the interference signal and results in the reduction of the measurement accuracy. To suppress the optical frequency nonlinearity, a harmonic frequency synthesis method for shaping the desired input signal instead of the original triangular wave is presented. The effectiveness of the presented shaping method is demonstrated through the comparison of the experimental results. Compared with an incremental Renishaw interferometer, the standard deviation of the displacement measurement of the FSI system is less than 2.4 μm when driven by the shaped signal.

  14. High Frequency Supercapacitors for Piezo-based Energy Harvesting

    Science.gov (United States)

    Ervin, Matthew; Pereira, Carlos; Miller, John; Outlaw, Ronald; Rastegar, Jay; Murray, Richard

    2013-03-01

    Energy harvesting is being investigated as an alternative to batteries for powering munition guidance and fuzing functions during flight. A piezoelectric system that generates energy from the oscillation of a mass on a spring (set in motion by the launch acceleration) is being developed. Original designs stored this energy in an electrolytic capacitor for use during flight. Here we replace the electrolytic capacitor with a smaller, lighter, and potentially more reliable electrochemical double layer capacitor (aka, supercapacitor). The potential problems with using supercapacitors in this application are that the piezoelectric output greatly exceeds the supercapacitor electrolyte breakdown voltage, and the frequency greatly exceeds the operating frequency of commercial supercapacitors. Here we have investigated the use of ultrafast vertically oriented graphene array-based supercapacitors for storing the energy in this application. We find that the electrolyte breakdown is not a serious limitation as it is either kinetically limited by the relatively high frequency of the piezoelectric output, or it is overcome by the self-healing nature of supercapacitors. We also find that these supercapacitors have sufficient dynamic response to efficiently store the generated energy.

  15. Single Frequency Network Based Distributed Passive Radar Technology

    Directory of Open Access Journals (Sweden)

    Wan Xian-rong

    2015-01-01

    Full Text Available The research and application of passive radar are heading from single transmitter-receiver pair to multiple transmitter-receiver pairs. As an important class of the illuminators of opportunity, most of modern digital broadcasting and television systems work on Single Frequency Network (SFN, which intrinsically determines that the passive radar based on such illuminators must be distributed and networked. In consideration of the remarkable working and processing mode of passive radar under SFN configuration, this paper proposes the concept of SFN-based Distributed Passive Radar (SDPR. The main characteristics and key problems of SDPR are first described. Then several potential solutions are discussed for part of the key technologies. The feasibility of SDPR is demonstrated by preliminary experimental results. Finally, the concept of four network convergence that includes the broadcast based passive radar network is conceived, and its application prospects are discussed.

  16. Radiative transport-based frequency-domain fluorescence tomography

    International Nuclear Information System (INIS)

    Joshi, Amit; Rasmussen, John C; Sevick-Muraca, Eva M; Wareing, Todd A; McGhee, John

    2008-01-01

    We report the development of radiative transport model-based fluorescence optical tomography from frequency-domain boundary measurements. The coupled radiative transport model for describing NIR fluorescence propagation in tissue is solved by a novel software based on the established Attila(TM) particle transport simulation platform. The proposed scheme enables the prediction of fluorescence measurements with non-contact sources and detectors at a minimal computational cost. An adjoint transport solution-based fluorescence tomography algorithm is implemented on dual grids to efficiently assemble the measurement sensitivity Jacobian matrix. Finally, we demonstrate fluorescence tomography on a realistic computational mouse model to locate nM to μM fluorophore concentration distributions in simulated mouse organs

  17. Frequency selective surfaces based high performance microstrip antenna

    CERN Document Server

    Narayan, Shiv; Jha, Rakesh Mohan

    2016-01-01

    This book focuses on performance enhancement of printed antennas using frequency selective surfaces (FSS) technology. The growing demand of stealth technology in strategic areas requires high-performance low-RCS (radar cross section) antennas. Such requirements may be accomplished by incorporating FSS into the antenna structure either in its ground plane or as the superstrate, due to the filter characteristics of FSS structure. In view of this, a novel approach based on FSS technology is presented in this book to enhance the performance of printed antennas including out-of-band structural RCS reduction. In this endeavor, the EM design of microstrip patch antennas (MPA) loaded with FSS-based (i) high impedance surface (HIS) ground plane, and (ii) the superstrates are discussed in detail. The EM analysis of proposed FSS-based antenna structures have been carried out using transmission line analogy, in combination with the reciprocity theorem. Further, various types of novel FSS structures are considered in desi...

  18. hCGbeta core fragment is a metabolite of hCG: evidence from infusion of recombinant hCG.

    Science.gov (United States)

    Norman, R J; Buchholz, M M; Somogyi, A A; Amato, F

    2000-03-01

    The availability of recombinant human chorionic gonadotrophin (r-hCG) has allowed us to measure its metabolic and renal clearance rates and to study the origin of the beta core fragment of hCG (hCGbetacf). Serum and urine samples were collected from six subjects, after an intravenous injection of 2 mg (equivalent to 44 000 IU Urinary hCG) r-hCG, and assayed for hCG and the beta subunit (hCGbeta). Urine from four of the subjects was also subjected to gel chromatography and assayed for hCGbetacf and hCG. r-hCG, administered as an intravenous dose, was distributed, initially in a volume of 3.4+/-0.7 l (mean+/-s.d.) and then in 6.5+/-1.15 l at steady-state. The disappearance of r-hCG from serum was bi-exponential, with an initial half-life of 4.5+/-0.7 h and a terminal half-life of 29.0+/-4.6 h. The mean residence time was 28. 6+/- 3.6 h and the total systemic clearance rate of r-hCG was 226+/-18 ml/h. The renal clearance rate was 28.75+/-6.2 ml/h (mean+/-s.d). hCGbetacf was detected in all urine samples collected at 6 h intervals. Over the 138 h period of urine collection, 12.9% (range 10.1-17.3% ) of r-hCG injected was recovered as the intact molecule and 1.7% (range 0.8-2.9%) was recovered as the hCGbetacf, in 4 subjects. The molar ratio of hCGbetacf to hCG in urine increased from 3.1+/-1.7%, on day 1, to 76+/-34.3% (mean+/-s.e.m.) on day 5, after r-hCG infusion, suggesting that hCGbetacf is a metabolic product of the infused r-hCG.

  19. Triple-Frequency GPS Precise Point Positioning Ambiguity Resolution Using Dual-Frequency Based IGS Precise Clock Products

    Directory of Open Access Journals (Sweden)

    Fei Liu

    2017-01-01

    Full Text Available With the availability of the third civil signal in the Global Positioning System, triple-frequency Precise Point Positioning ambiguity resolution methods have drawn increasing attention due to significantly reduced convergence time. However, the corresponding triple-frequency based precise clock products are not widely available and adopted by applications. Currently, most precise products are generated based on ionosphere-free combination of dual-frequency L1/L2 signals, which however are not consistent with the triple-frequency ionosphere-free carrier-phase measurements, resulting in inaccurate positioning and unstable float ambiguities. In this study, a GPS triple-frequency PPP ambiguity resolution method is developed using the widely used dual-frequency based clock products. In this method, the interfrequency clock biases between the triple-frequency and dual-frequency ionosphere-free carrier-phase measurements are first estimated and then applied to triple-frequency ionosphere-free carrier-phase measurements to obtain stable float ambiguities. After this, the wide-lane L2/L5 and wide-lane L1/L2 integer property of ambiguities are recovered by estimating the satellite fractional cycle biases. A test using a sparse network is conducted to verify the effectiveness of the method. The results show that the ambiguity resolution can be achieved in minutes even tens of seconds and the positioning accuracy is in decimeter level.

  20. Long distance measurement with a femtosecond laser based frequency comb

    Science.gov (United States)

    Bhattacharya, N.; Cui, M.; Zeitouny, M. G.; Urbach, H. P.; van den Berg, S. A.

    2017-11-01

    Recent advances in the field of ultra-short pulse lasers have led to the development of reliable sources of carrier envelope phase stabilized femtosecond pulses. The pulse train generated by such a source has a frequency spectrum that consists of discrete, regularly spaced lines known as a frequency comb. In this case both the frequency repetition and the carrier-envelope-offset frequency are referenced to a frequency standard, like an atomic clock. As a result the accuracy of the frequency standard is transferred to the optical domain, with the frequency comb as transfer oscillator. These unique properties allow the frequency comb to be applied as a versatile tool, not only for time and frequency metrology, but also in fundamental physics, high-precision spectroscopy, and laser noise characterization. The pulse-to-pulse phase relationship of the light emitted by the frequency comb has opened up new directions for long range highly accurate distance measurement.

  1. LPI Radar Waveform Recognition Based on Time-Frequency Distribution

    Directory of Open Access Journals (Sweden)

    Ming Zhang

    2016-10-01

    Full Text Available In this paper, an automatic radar waveform recognition system in a high noise environment is proposed. Signal waveform recognition techniques are widely applied in the field of cognitive radio, spectrum management and radar applications, etc. We devise a system to classify the modulating signals widely used in low probability of intercept (LPI radar detection systems. The radar signals are divided into eight types of classifications, including linear frequency modulation (LFM, BPSK (Barker code modulation, Costas codes and polyphase codes (comprising Frank, P1, P2, P3 and P4. The classifier is Elman neural network (ENN, and it is a supervised classification based on features extracted from the system. Through the techniques of image filtering, image opening operation, skeleton extraction, principal component analysis (PCA, image binarization algorithm and Pseudo–Zernike moments, etc., the features are extracted from the Choi–Williams time-frequency distribution (CWD image of the received data. In order to reduce the redundant features and simplify calculation, the features selection algorithm based on mutual information between classes and features vectors are applied. The superiority of the proposed classification system is demonstrated by the simulations and analysis. Simulation results show that the overall ratio of successful recognition (RSR is 94.7% at signal-to-noise ratio (SNR of −2 dB.

  2. A Frequency-Based Approach to Intrusion Detection

    Directory of Open Access Journals (Sweden)

    Mian Zhou

    2004-06-01

    Full Text Available Research on network security and intrusion detection strategies presents many challenging issues to both theoreticians and practitioners. Hackers apply an array of intrusion and exploit techniques to cause disruption of normal system operations, but on the defense, firewalls and intrusion detection systems (IDS are typically only effective in defending known intrusion types using their signatures, and are far less than mature when faced with novel attacks. In this paper, we adapt the frequency analysis techniques such as the Discrete Fourier Transform (DFT used in signal processing to the design of intrusion detection algorithms. We demonstrate the effectiveness of the frequency-based detection strategy by running synthetic network intrusion data in simulated networks using the OPNET software. The simulation results indicate that the proposed intrusion detection strategy is effective in detecting anomalous traffic data that exhibit patterns over time, which include several types of DOS and probe attacks. The significance of this new strategy is that it does not depend on the prior knowledge of attack signatures, thus it has the potential to be a useful supplement to existing signature-based IDS and firewalls.

  3. High Frequency Vibration Based Fatigue Testing of Developmental Alloys

    Science.gov (United States)

    Holycross, Casey M.; Srinivasan, Raghavan; George, Tommy J.; Tamirisakandala, Seshacharyulu; Russ, Stephan M.

    Many fatigue test methods have been previously developed to rapidly evaluate fatigue behavior. This increased test speed can come at some expense, since these methods may require non-standard specimen geometry or increased facility and equipment capability. One such method, developed by George et al, involves a base-excited plate specimen driven into a high frequency bending resonant mode. This resonant mode is of sufficient frequency (typically 1200 to 1700 Hertz) to accumulate 107 cycles in a few hours. One of the main limitations of this test method is that fatigue cracking is almost certainly guaranteed to be surface initiated at regions of high stress. This brings into question the validity of the fatigue test results, as compared to more traditional uniaxial, smooth-bar testing, since high stresses are subjecting only a small volume to fatigue damage. This limitation also brings into question the suitability of this method to screen developmental alloys, should their initiation life be governed by subsurface flaws. However, if applicable, the rapid generation of fatigue data using this method would facilitate faster design iterations, identifying more quickly, material and manufacturing process deficiencies. The developmental alloy used in this study was a powder metallurgy boron-modified Ti-6Al-4V, a new alloy currently being considered for gas turbine engine fan blades. Plate specimens were subjected to fully reversed bending fatigue. Results are compared with existing data from commercially available Ti-6Al-4V using both vibration based and more traditional fatigue test methods.

  4. Ultra High-Speed Radio Frequency Switch Based on Photonics.

    Science.gov (United States)

    Ge, Jia; Fok, Mable P

    2015-11-26

    Microwave switches, or Radio Frequency (RF) switches have been intensively used in microwave systems for signal routing. Compared with the fast development of microwave and wireless systems, RF switches have been underdeveloped particularly in terms of switching speed and operating bandwidth. In this paper, we propose a photonics based RF switch that is capable of switching at tens of picoseconds speed, which is hundreds of times faster than any existing RF switch technologies. The high-speed switching property is achieved with the use of a rapidly tunable microwave photonic filter with tens of gigahertz frequency tuning speed, where the tuning mechanism is based on the ultra-fast electro-optics Pockels effect. The RF switch has a wide operation bandwidth of 12 GHz and can go up to 40 GHz, depending on the bandwidth of the modulator used in the scheme. The proposed RF switch can either work as an ON/OFF switch or a two-channel switch, tens of picoseconds switching speed is experimentally observed for both type of switches.

  5. Fast LCMV-based Methods for Fundamental Frequency Estimation

    DEFF Research Database (Denmark)

    Jensen, Jesper Rindom; Glentis, George-Othon; Christensen, Mads Græsbøll

    2013-01-01

    peaks and require matrix inversions for each point in the search grid. In this paper, we therefore consider fast implementations of LCMV-based fundamental frequency estimators, exploiting the estimators' inherently low displacement rank of the used Toeplitz-like data covariance matrices, using...... with several orders of magnitude, but, as we show, further computational savings can be obtained by the adoption of an approximative IAA-based data covariance matrix estimator, reminiscent of the recently proposed Quasi-Newton IAA technique. Furthermore, it is shown how the considered pitch estimators can...... as such either the classic time domain averaging covariance matrix estimator, or, if aiming for an increased spectral resolution, the covariance matrix resulting from the application of the recent iterative adaptive approach (IAA). The proposed exact implementations reduce the required computational complexity...

  6. Tunable antenna radome based on graphene frequency selective surface

    Science.gov (United States)

    Qu, Meijun; Rao, Menglou; Li, Shufang; Deng, Li

    2017-09-01

    In this paper, a graphene-based frequency selective surface (FSS) is proposed. The proposed FSS exhibits a tunable bandpass filtering characteristic due to the alterable conductivity of the graphene strips which is controlled by chemical potential. Based on the reconfigurable bandpass property of the proposed FSS, a cylindrical antenna radome is designed using the FSS unit cells. A conventional omnidirectional dipole can realize a two-beam directional pattern when it is placed into the proposed antenna radome. Forward and backward endfire radiations of the dipole loaded with the radome is realized by properly adjusting the chemical potential. The proposed antenna radome is extremely promising for beam-scanning in terahertz and mid-infrared plasmonic devices and systems when the gain of a conventional antenna needs to be enhanced.

  7. Review: hCG, Preeclampsia and Regulatory T cells

    OpenAIRE

    Norris, Wendy; Nevers, Tania; Sharma, Surendra; Kalkunte, Satyan

    2011-01-01

    Human chorionic gonadotropin (hCG) is crucial for successful pregnancy. Its many functions include angiogenesis and immune regulation. Despite years of research, the etiology of preeclampsia remains unknown. Marked by insufficient trophoblast invasion and poor spiral artery remodeling, preeclampsia has also been linked to immune dysregulation. Here we discuss the roles of hCG in the context of endovascular cross-talk between trophoblasts and endothelial cells and immune tolerance. We propose ...

  8. Rydberg-atom based radio-frequency electrometry using frequency modulation spectroscopy in room temperature vapor cells.

    Science.gov (United States)

    Kumar, Santosh; Fan, Haoquan; Kübler, Harald; Jahangiri, Akbar J; Shaffer, James P

    2017-04-17

    Rydberg atom-based electrometry enables traceable electric field measurements with high sensitivity over a large frequency range, from gigahertz to terahertz. Such measurements are particularly useful for the calibration of radio frequency and terahertz devices, as well as other applications like near field imaging of electric fields. We utilize frequency modulated spectroscopy with active control of residual amplitude modulation to improve the signal to noise ratio of the optical readout of Rydberg atom-based radio frequency electrometry. Matched filtering of the signal is also implemented. Although we have reached similarly, high sensitivity with other read-out methods, frequency modulated spectroscopy is advantageous because it is well-suited for building a compact, portable sensor. In the current experiment, ∼3 µV cm-1 Hz-1/2 sensitivity is achieved and is found to be photon shot noise limited.

  9. Validation of 125I-hCG as a marker for elimination of hCG and stability of 125I-hCG after in vivo injection in humans

    OpenAIRE

    Christensen, T B; Marqversen, J; Engbaek, F; Berger, P; Bacher, T; Maase, H von der

    1999-01-01

    We have recently introduced 125I-hCG as an elimination marker in patients with human chorionic gonadotrophin (hCG) producing testicular cancer. 125I-hCG is a well-known reagent in clinical biochemistry and is used extensively in hCG assays. Previous studies have shown that the iodination process leaves the hCG molecule mainly intact. The iodination, purification and stability of 125I-hCG tracer are described. The aim of the present study was to determine whether or not 125I is associated with...

  10. Method for Assessing Grid Frequency Deviation Due to Wind Power Fluctuation Based on “Time-Frequency Transformation”

    DEFF Research Database (Denmark)

    Jin, Lin; Yuan-zhang, Sun; Sørensen, Poul Ejnar

    2012-01-01

    published studies are based entirely on deterministic methodology. This paper presents a novel assessment method based on Time-Frequency Transformation to overcome shortcomings of existing methods. The main contribution of the paper is to propose a stochastic process simulation model which is a better...... alternative of the existing dynamic frequency deviation simulation model. In this way, the method takes the stochastic wind power fluctuation into full account so as to give a quantitative risk assessment of grid frequency deviation to grid operators, even without using any dynamic simulation tool. The case...

  11. Negative βhCG and Molar Pregnancy: The Hook Effect

    Directory of Open Access Journals (Sweden)

    Isabel Lobo Antunes

    2017-09-01

    Full Text Available Molar pregnancy, included in gestational trophoblastic disease, is a benign pathology with ability to metastasize, usually occurring with excessively high βhCG levels. Clinical scenario is usually a woman in extremes of reproductive age presenting with amenorrhoea, pain and vaginal blood loss; signs derived from high βhCG levels may be present (hyperthyroidism, hyperemesis. Diagnosis is based on a positive pregnancy test – usually a qualitative urinary test. The limitation of this test results from its inability to become positive in presence of markedly high levels of βhCG, saturating the antigens used – known as the ‘hook effect’. With the widespread use of gynaecological ultrasound cases of molar pregnancy have been diagnosed in timely fashion. We describe a case referred as a degenerating fibroid, with a negative urinary pregnancy test. Transvaginal ultrasound was highly suggestive of molar pregnancy, which was confirmed with a quantitative βhCG test, allowing for timely treatment. The importance of a high index of suspicion for this pathology is tremendous to avoid the devastating consequences of a delayed diagnosis.

  12. Frequency of damage by external hazards based on geographical information

    Energy Technology Data Exchange (ETDEWEB)

    Becker, G. [RISA Sicherheitsanalysen GmbH, Berlin (Germany); Camarinopoulos, A.; Karali, T. [ERRA, Athens (Greece); Camarinopoulos, L. [Piraeus Univ. (Greece); Schubert, B. [VENE, Hamburg (Germany)

    2013-07-01

    External explosions can significantly contribute to risk of damage for industrial plants. External explosions may origin from other plants in the neighborhood, which store and operate with explosive substances, or from transport of such substances on road, rail, or water. In all cases, some accident is a necessary condition for a hazard. Another probabilistic element is the probability of ignition. If transport causes the explosion, the location of the accident will influence the consequences. If deflagration is involved, ignition will not necessarily occur at the place of the accident, but a cloud of a combustible gas-air mixture may develop, which will ignite at some distance depending on wind velocity. In order to avoid unnecessarily pessimistic approaches, geographical information can be used in addition to local weather statistics. Geographical information systems provide map material for sites, roads, rail and rivers on a computer. This information can be used to find frequencies of damage based on numerical integration or on Monte Carlo simulation. A probabilistic model has been developed. It is based on: - A joint probability density function for wind direction and wind speed, which has been estimated from local weather statistics, - Frequency of hazards for neighboring plants and various types of traffic, - Statistics on the amounts and types of explosive materials, - The model has been implemented using one numerical integrations method and two variants of Monte Carlo method. Data has been collected and applied for a nuclear power plant in Northern Germany as an example. The method, however, can be used for any type of plant subject to external explosion hazards. In its present form, it makes use of design criteria specific for nuclear power plants, but these could be replaced by different criteria. (orig.)

  13. Nano-resonator frequency response based on strain gradient theory

    International Nuclear Information System (INIS)

    Miandoab, Ehsan Maani; Yousefi-Koma, Aghil; Pishkenari, Hossein Nejat; Fathi, Mohammad

    2014-01-01

    This paper aims to explore the dynamic behaviour of a nano-resonator under ac and dc excitation using strain gradient theory. To achieve this goal, the partial differential equation of nano-beam vibration is first converted to an ordinary differential equation by the Galerkin projection method and the lumped model is derived. Lumped parameters of the nano-resonator, such as linear and nonlinear springs and damper coefficients, are compared with those of classical theory and it is demonstrated that beams with smaller thickness display greater deviation from classical parameters. Stable and unstable equilibrium points based on classic and non-classical theories are also compared. The results show that, regarding the applied dc voltage, the dynamic behaviours expected by classical and non-classical theories are significantly different, such that one theory predicts the un-deformed shape as the stable condition, while the other theory predicts that the beam will experience bi-stability. To obtain the frequency response of the nano-resonator, a general equation including cubic and quadratic nonlinearities in addition to parametric electrostatic excitation terms is derived, and the analytical solution is determined using a second-order multiple scales method. Based on frequency response analysis, the softening and hardening effects given by two theories are investigated and compared, and it is observed that neglecting the size effect can lead to two completely different predictions in the dynamic behaviour of the resonators. The findings of this article can be helpful in the design and characterization of the size-dependent dynamic behaviour of resonators on small scales. (paper)

  14. Frequency of damage by external hazards based on geographical information

    International Nuclear Information System (INIS)

    Becker, G.; Camarinopoulos, A.; Karali, T.; Camarinopoulos, L.; Schubert, B.

    2013-01-01

    External explosions can significantly contribute to risk of damage for industrial plants. External explosions may origin from other plants in the neighborhood, which store and operate with explosive substances, or from transport of such substances on road, rail, or water. In all cases, some accident is a necessary condition for a hazard. Another probabilistic element is the probability of ignition. If transport causes the explosion, the location of the accident will influence the consequences. If deflagration is involved, ignition will not necessarily occur at the place of the accident, but a cloud of a combustible gas-air mixture may develop, which will ignite at some distance depending on wind velocity. In order to avoid unnecessarily pessimistic approaches, geographical information can be used in addition to local weather statistics. Geographical information systems provide map material for sites, roads, rail and rivers on a computer. This information can be used to find frequencies of damage based on numerical integration or on Monte Carlo simulation. A probabilistic model has been developed. It is based on: - A joint probability density function for wind direction and wind speed, which has been estimated from local weather statistics, - Frequency of hazards for neighboring plants and various types of traffic, - Statistics on the amounts and types of explosive materials, - The model has been implemented using one numerical integrations method and two variants of Monte Carlo method. Data has been collected and applied for a nuclear power plant in Northern Germany as an example. The method, however, can be used for any type of plant subject to external explosion hazards. In its present form, it makes use of design criteria specific for nuclear power plants, but these could be replaced by different criteria. (orig.)

  15. Adaptive Window Zero-Crossing-Based Instantaneous Frequency Estimation

    Directory of Open Access Journals (Sweden)

    Sekhar S Chandra

    2004-01-01

    Full Text Available We address the problem of estimating instantaneous frequency (IF of a real-valued constant amplitude time-varying sinusoid. Estimation of polynomial IF is formulated using the zero-crossings of the signal. We propose an algorithm to estimate nonpolynomial IF by local approximation using a low-order polynomial, over a short segment of the signal. This involves the choice of window length to minimize the mean square error (MSE. The optimal window length found by directly minimizing the MSE is a function of the higher-order derivatives of the IF which are not available a priori. However, an optimum solution is formulated using an adaptive window technique based on the concept of intersection of confidence intervals. The adaptive algorithm enables minimum MSE-IF (MMSE-IF estimation without requiring a priori information about the IF. Simulation results show that the adaptive window zero-crossing-based IF estimation method is superior to fixed window methods and is also better than adaptive spectrogram and adaptive Wigner-Ville distribution (WVD-based IF estimators for different signal-to-noise ratio (SNR.

  16. CSI Frequency Domain Fingerprint-Based Passive Indoor Human Detection

    Directory of Open Access Journals (Sweden)

    Chong Han

    2018-04-01

    Full Text Available Passive indoor personnel detection technology is now a hot topic. Existing methods have been greatly influenced by environmental changes, and there are problems with the accuracy and robustness of detection. Passive personnel detection based on Wi-Fi not only solves the above problems, but also has the advantages of being low cost and easy to implement, and can be better applied to elderly care and safety monitoring. In this paper, we propose a passive indoor personnel detection method based on Wi-Fi, which we call FDF-PIHD (Frequency Domain Fingerprint-based Passive Indoor Human Detection. Through this method, fine-grained physical layer Channel State Information (CSI can be extracted to generate feature fingerprints so as to help determine the state in the scene by matching online fingerprints with offline fingerprints. In order to improve accuracy, we combine the detection results of three receiving antennas to obtain the final test result. The experimental results show that the detection rates of our proposed scheme all reach above 90%, no matter whether the scene is human-free, stationary or a moving human presence. In addition, it can not only detect whether there is a target indoors, but also determine the current state of the target.

  17. Power system frequency estimation based on an orthogonal decomposition method

    Science.gov (United States)

    Lee, Chih-Hung; Tsai, Men-Shen

    2018-06-01

    In recent years, several frequency estimation techniques have been proposed by which to estimate the frequency variations in power systems. In order to properly identify power quality issues under asynchronously-sampled signals that are contaminated with noise, flicker, and harmonic and inter-harmonic components, a good frequency estimator that is able to estimate the frequency as well as the rate of frequency changes precisely is needed. However, accurately estimating the fundamental frequency becomes a very difficult task without a priori information about the sampling frequency. In this paper, a better frequency evaluation scheme for power systems is proposed. This method employs a reconstruction technique in combination with orthogonal filters, which may maintain the required frequency characteristics of the orthogonal filters and improve the overall efficiency of power system monitoring through two-stage sliding discrete Fourier transforms. The results showed that this method can accurately estimate the power system frequency under different conditions, including asynchronously sampled signals contaminated by noise, flicker, and harmonic and inter-harmonic components. The proposed approach also provides high computational efficiency.

  18. Proportion hyperglycosylated hCG: a new test for discriminating gestational trophoblastic diseases.

    Science.gov (United States)

    Cole, Laurence A

    2014-11-01

    Hyperglycosylated human chorionic gonadotropin (hCG) is a variant of hCG with large oligosaccharide side chains. Although hCG is produced by syncytiotrophoblast cells, hyperglycosylated hCG marks cytotrophoblast cell. Hyperglycosylated hCG signals placental implantation. Total hCG in serum and urine is measured by the Siemens Immulite hCG pregnancy test; the result is in milli-international unit per milliliter. Hyperglycosylated hCG is determined by the B152 microtiter plate assay; the result is in nanogram per milliliter. Hyperglycosylated hCG results can be converted to milli-international unit per milliliter equivalents by multiplying by 11. The test measures proportion hyperglycosylated hCG, hyperglycosylated hCG / total hCG. Proportion hyperglycosylated hCG marks cases intent on developing persistent hydatidiform mole (68% detection at 17% false detection). Proportion hyperglycosylated hCG also marks persistent hydatidiform mole (100% detection at 5.1% false detection). Proportion hyperglycosylated hCG distinguishes choriocarcinoma and gestational trophoblastic neoplasm cases, absolutely discriminating aggressive cases and minimally aggressive cases. Proportion hyperglycosylated hCG identifies quiescent gestational trophoblastic disease cases. It recognizes quiescent cases that become persistent disease (100% detection at 0% false positive). Proportion hyperglycosylated hCG is an invaluable test for discriminating gestational trophoblastic diseases.

  19. Frequency domain based LS channel estimation in OFDM based Power line communications

    OpenAIRE

    Bogdanović, Mario

    2015-01-01

    This paper is focused on low voltage power line communication (PLC) realization with an emphasis on channel estimation techniques. The Orthogonal Frequency Division Multiplexing (OFDM) scheme is preferred technology in PLC systems because of its effective combat with frequency selective fading properties of PLC channel. As the channel estimation is one of the crucial problems in OFDM based PLC system because of a problematic area of PLC signal attenuation and interference, the improved LS est...

  20. A MEMS-based high frequency x-ray chopper

    Energy Technology Data Exchange (ETDEWEB)

    Siria, A; Schwartz, W; Chevrier, J [Institut Neel, CNRS-Universite Joseph Fourier Grenoble, BP 166, F-38042 Grenoble Cedex 9 (France); Dhez, O; Comin, F [ESRF, 6 rue Jules Horowitz, F-38043 Grenoble Cedex 9 (France); Torricelli, G [Department of Physics and Astronomy, University of Leicester, University Road, Leicester LE1 7RH (United Kingdom)

    2009-04-29

    Time-resolved x-ray experiments require intensity modulation at high frequencies (advanced rotating choppers have nowadays reached the kHz range). We here demonstrate that a silicon microlever oscillating at 13 kHz with nanometric amplitude can be used as a high frequency x-ray chopper. We claim that using micro-and nanoelectromechanical systems (MEMS and NEMS), it will be possible to achieve higher frequencies in excess of hundreds of megahertz. Working at such a frequency can open a wealth of possibilities in chemistry, biology and physics time-resolved experiments.

  1. Noise-based frequency offset modulation in wideband frequency-selective fading channels

    NARCIS (Netherlands)

    Meijerink, Arjan; Cotton, S.L.; Bentum, Marinus Jan; Scanlon, W.G.

    2009-01-01

    A frequency offset modulation scheme using wideband noise carriers is considered. The main advantage of such a scheme is that it enables fast receiver synchronization without channel adaptation, while providing robustness to multipath fading and in-band interference. This is important for low-power

  2. Demosaicking Based on Optimization and Projection in Different Frequency Bands

    Directory of Open Access Journals (Sweden)

    Omer OsamaA

    2008-01-01

    Full Text Available Abstract A fast and effective iterative demosaicking algorithm is described for reconstructing a full-color image from single-color filter array data. The missing color values are interpolated on the basis of optimization and projection in different frequency bands. A filter bank is used to decompose an initially interpolated image into low-frequency and high-frequency bands. In the low-frequency band, a quadratic cost function is minimized in accordance with the observation that the low-frequency components of chrominance slowly vary within an object region. In the high-frequency bands, the high-frequency components of the unknown values are projected onto the high-frequency components of the known values. Comparison of the proposed algorithm with seven state-of-the-art demosaicking algorithms showed that it outperforms all of them for 20 images on average in terms of objective quality and that it is competitive with them from the subjective quality and complexity points of view.

  3. Multi-frequency exciting and spectrogram-based ECT method

    CERN Document Server

    Chady, T

    2000-01-01

    The purpose of this paper is to experimentally demonstrate advantages of a multi-frequency ECT system. In this system, a precise crack imaging was achieved by using spectrograms obtained from an eddy-current probe multi-frequency response. A complex signal containing selected sinusoidal components was used as an excitation. The results of measurements for various test specimens are presented.

  4. Compact blue laser devices based on nonlinear frequency upconversion

    International Nuclear Information System (INIS)

    Risk, W.P.

    1989-01-01

    This paper reports how miniature sources of coherent blue radiation can be produced by using nonlinear optical materials for frequency upconversion of the infrared radiation emitted by laser diodes. Direct upconversion of laser diode radiation is possible, but there are several advantages to using the diode laser to pump a solid-state laser which is then upconverted. In either case, the challenge is to find combinations of nonlinear materials and laser for efficient frequency upconversion. Several examples have been demonstrated. These include intracavity frequency doubling of a diode-pumped 946-nm Nd:YAG laser, intracavity frequency mixing of a 809-nm GaAlAs laser diode with a diode- pumped 1064-nm Nd:YAG laser, and direct frequency doubling of a 994-nm strained-layer InGaAs laser diode

  5. Incident Light Frequency-Based Image Defogging Algorithm

    Directory of Open Access Journals (Sweden)

    Wenbo Zhang

    2017-01-01

    Full Text Available To solve the color distortion problem produced by the dark channel prior algorithm, an improved method for calculating transmittance of all channels, respectively, was proposed in this paper. Based on the Beer-Lambert Law, the influence between the frequency of the incident light and the transmittance was analyzed, and the ratios between each channel’s transmittance were derived. Then, in order to increase efficiency, the input image was resized to a smaller size before acquiring the refined transmittance which will be resized to the same size of original image. Finally, all the transmittances were obtained with the help of the proportion between each color channel, and then they were used to restore the defogging image. Experiments suggest that the improved algorithm can produce a much more natural result image in comparison with original algorithm, which means the problem of high color saturation was eliminated. What is more, the improved algorithm speeds up by four to nine times compared to the original algorithm.

  6. Extending the QUDA Library with the eigCG Solver

    Energy Technology Data Exchange (ETDEWEB)

    Strelchenko, Alexei [Fermilab; Stathopoulos, Andreas [William-Mary Coll.

    2014-12-12

    While the incremental eigCG algorithm [ 1 ] is included in many LQCD software packages, its realization on GPU micro-architectures was still missing. In this session we report our experi- ence of the eigCG implementation in the QUDA library. In particular, we will focus on how to employ the mixed precision technique to accelerate solutions of large sparse linear systems with multiple right-hand sides on GPUs. Although application of mixed precision techniques is a well-known optimization approach for linear solvers, its utilization for the eigenvector com- puting within eigCG requires special consideration. We will discuss implementation aspects of the mixed precision deflation and illustrate its numerical behavior on the example of the Wilson twisted mass fermion matrix inversions

  7. Data of evolutionary structure change: 1CG5B-2QU0C [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 0 C 2QU0C DLHAHKLRVDPence>...0 C 2QU0C FPHFD--LSHGSence...1CG5B-2QU0C 1CG5 2QU0 B C VKLSEDQEHYIKGVWKDVD--HKQITAKALERVFVVYPW... 1CG5 B 1CG5B ence>WKDVD--HKQIT... 384 THR CA 441 2QU0 C 2QU

  8. Data of evolutionary structure change: 1CG5B-2QU0A [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available Chain>A 2QU0A ence>AWGKVGGNAGAYence> 2QU0 A 2QU0A ence>DLHAHKLRVDP...0 A 2QU0A ence>YFPHF--DLSHG...1CG5B-2QU0A 1CG5 2QU0 B A VKLSEDQEHYIKGVWKDV--DHKQITAKALERVFVVYPW...dex>0 1CG5 B 1CG5B

  9. Data of evolutionary structure change: 1CG8B-2QU0A [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 0 A 2QU0A ence>DLHAHKLRVDP...0 A 2QU0A ence>YFPHF--DLSHG...1CG8B-2QU0A 1CG8 2QU0 B A VKLSEDQEHYIKGVWKDV--DHKQITAKALERVFVVYPW...> 1CG8 B 1CG8B ence>VWKDV--DHKQI...ine> ILE CA 383 2QU0 A 2QU

  10. Pulse frequency in pulsed brachytherapy based on tissue repair kinetics

    International Nuclear Information System (INIS)

    Sminia, Peter; Schneider, Christoph J.; Koedooder, Kees; Tienhoven, Geertjan van; Blank, Leo E.C.M.; Gonzalez Gonzalez, Dionisio

    1998-01-01

    Purpose: Investigation of normal tissue sparing in pulsed brachytherapy (PB) relative to continuous low-dose rate irradiation (CLDR) by adjusting pulse frequency based on tissue repair characteristics. Method: Using the linear quadratic model, the relative effectiveness (RE) of a 20 Gy boost was calculated for tissue with an α/β ratio ranging from 2 to 10 Gy and a half-time of sublethal damage repair between 0.1 and 3 h. The boost dose was considered to be delivered either in a number of pulses varying from 2 to 25, or continuously at a dose rate of 0.50, 0.80, or 1.20 Gy/h. Results: The RE of 20 Gy was found to be identical for PB in 25 pulses of 0.80 Gy each h and CLDR delivered at 0.80 Gy/h for any α/β value and for a repair half-time > 0.75 h. When normal tissue repair half-times are assumed to be longer than tumor repair half-times, normal tissue sparing can be obtained, within the restriction of a fixed overall treatment time, with higher dose per pulse and longer period time (time elapsed between start of pulse n and start of pulse n + 1). An optimum relative normal tissue sparing larger than 10% was found with 4 pulses of 5 Gy every 8 h. Hence, a therapeutic gain might be obtained when changing from CLDR to PB by adjusting the physical dose in such a way that the biological dose on the tumor is maintained. The normal tissue-sparing phenomenon can be explained by an increase in RE with longer period time for tissue with high α/β ratio and fast or intermediate repair half-time, and the RE for tissue with low α/β ratio and long repair half-time remains almost constant. Conclusion: Within the benchmark of the LQ model, advantage in normal tissue-sparing is expected when matching the pulse frequency to the repair kinetics of the normal tissue exposed. A period time longer than 1 h may lead to a reduction of late normal tissue complications. This theoretical advantage emphasizes the need for better knowledge of human tissue-repair kinetics

  11. Capacitance-Based Frequency Adjustment of Micro Piezoelectric Vibration Generator

    Directory of Open Access Journals (Sweden)

    Xinhua Mao

    2014-01-01

    Full Text Available Micro piezoelectric vibration generator has a wide application in the field of microelectronics. Its natural frequency is unchanged after being manufactured. However, resonance cannot occur when the natural frequencies of a piezoelectric generator and the source of vibration frequency are not consistent. Output voltage of the piezoelectric generator will sharply decline. It cannot normally supply power for electronic devices. In order to make the natural frequency of the generator approach the frequency of vibration source, the capacitance FM technology is adopted in this paper. Different capacitance FM schemes are designed by different locations of the adjustment layer. The corresponding capacitance FM models have been established. Characteristic and effect of the capacitance FM have been simulated by the FM model. Experimental results show that the natural frequency of the generator could vary from 46.5 Hz to 42.4 Hz when the bypass capacitance value increases from 0 nF to 30 nF. The natural frequency of a piezoelectric vibration generator could be continuously adjusted by this method.

  12. Capacitance-based frequency adjustment of micro piezoelectric vibration generator.

    Science.gov (United States)

    Mao, Xinhua; He, Qing; Li, Hong; Chu, Dongliang

    2014-01-01

    Micro piezoelectric vibration generator has a wide application in the field of microelectronics. Its natural frequency is unchanged after being manufactured. However, resonance cannot occur when the natural frequencies of a piezoelectric generator and the source of vibration frequency are not consistent. Output voltage of the piezoelectric generator will sharply decline. It cannot normally supply power for electronic devices. In order to make the natural frequency of the generator approach the frequency of vibration source, the capacitance FM technology is adopted in this paper. Different capacitance FM schemes are designed by different locations of the adjustment layer. The corresponding capacitance FM models have been established. Characteristic and effect of the capacitance FM have been simulated by the FM model. Experimental results show that the natural frequency of the generator could vary from 46.5 Hz to 42.4 Hz when the bypass capacitance value increases from 0 nF to 30 nF. The natural frequency of a piezoelectric vibration generator could be continuously adjusted by this method.

  13. The Effects of Semantic Transparency and Base Frequency on the Recognition of English Complex Words

    Science.gov (United States)

    Xu, Joe; Taft, Marcus

    2015-01-01

    A visual lexical decision task was used to examine the interaction between base frequency (i.e., the cumulative frequencies of morphologically related forms) and semantic transparency for a list of derived words. Linear mixed effects models revealed that high base frequency facilitates the recognition of the complex word (i.e., a "base…

  14. A fit-based frequency programme for the PS

    CERN Document Server

    Hancock, S

    2007-01-01

    Since the probes in the PS reference magnet that generate the so-called B-train are fairly short, they cannot register any change in magnetic length due to saturation. Hence the idea to derive the effective dipole magnetic field seen by the beam from measurements of revolution frequency and mean radial position over an entire cycle, to fit a saturation law, and to use the result to make a new frequency programme. Although far from new, the idea has never been implemented due to the tacit assumption that any imperfections in the existing frequency programme are taken care of by the action of the servo loops of the various beam controls. More recently, the delivery of ions at low energy from LEIR has called into question the accuracy the raw frequency programme and the idea has been revisited in a brief parasitic MD.

  15. Time-Frequency Based Instantaneous Frequency Estimation of Sparse Signals from an Incomplete Set of Samples

    Science.gov (United States)

    2014-06-17

    100 0 2 4 Wigner distribution 0 50 100 0 0.5 1 Auto-correlation function 0 50 100 0 2 4 L- Wigner distribution 0 50 100 0 0.5 1 Auto-correlation function ...bilinear or higher order autocorrelation functions will increase the number of missing samples, the analysis shows that accurate instantaneous...frequency estimation can be achieved even if we deal with only few samples, as long as the auto-correlation function is properly chosen to coincide with

  16. Internalization of Rat FSH and LH/CG Receptors by rec-eCG in CHO-K1 Cells.

    Science.gov (United States)

    Park, Jong-Ju; Seong, Hun-Ki; Kim, Jeong-Soo; Munkhzaya, Byambaragchaa; Kang, Myung-Hwa; Min, Kwan-Sik

    2017-06-01

    Equine chorionic gonadotropin (eCG) is a unique molecule that elicits the response characteristics of both follicle-stimulating hormone (FSH) and luteinizing hormone (LH) in other species. Previous studies from this laboratory had demonstrated that recombinant eCG (rec-eCG) from Chinese hamster ovary (CHO-K1) cells exhibited both FSH- and LH-like activity in rat granulosa and Leydig cells. In this study, we analyzed receptor internalization through rec-eCGs, wild type eCG (eCGβ/α) and mutant eCG (eCGβ/αΔ56) with an N-linked oligosaccharide at Asn 56 of the α-subunit. Both the rec-eCGs were obtained from CHO-K1 cells. The agonist activation of receptors was analyzed by measuring stimulation time and concentrations of rec-eCGs. Internalization values in the stably selected rat follicle-stimulating hormone receptor (rFSHR) and rat luteinizing/chorionic gonadotropin receptor (rLH/CGR) were highest at 50 min after stimulation with 10 ng of rec-eCGβ/α. The dose-dependent response was highest when 10 ng of rec-eCGβ/α was used. The deglycosylated eCGβ/αΔ56 mutant did not enhance the agonist-stimulated internalization. We concluded that the state of activation of rFSHR and rLH/CGR could be modulated through agonist-stimulated internalization. Our results suggested that the eLH/CGRs are mostly internalized within 60 min by agonist-stimulation by rec-eCG. We also suggested that the lack of responsiveness of the deglycosylated eCGβ/ αΔ56 was likely because the site of glycosylation played a pivotal role in agonist-stimulated internalization in cells expressing rFSHR and rLH/CGR.

  17. Frequency Response Function Based Damage Identification for Aerospace Structures

    Science.gov (United States)

    Oliver, Joseph Acton

    Structural health monitoring technologies continue to be pursued for aerospace structures in the interests of increased safety and, when combined with health prognosis, efficiency in life-cycle management. The current dissertation develops and validates damage identification technology as a critical component for structural health monitoring of aerospace structures and, in particular, composite unmanned aerial vehicles. The primary innovation is a statistical least-squares damage identification algorithm based in concepts of parameter estimation and model update. The algorithm uses frequency response function based residual force vectors derived from distributed vibration measurements to update a structural finite element model through statistically weighted least-squares minimization producing location and quantification of the damage, estimation uncertainty, and an updated model. Advantages compared to other approaches include robust applicability to systems which are heavily damped, large, and noisy, with a relatively low number of distributed measurement points compared to the number of analytical degrees-of-freedom of an associated analytical structural model (e.g., modal finite element model). Motivation, research objectives, and a dissertation summary are discussed in Chapter 1 followed by a literature review in Chapter 2. Chapter 3 gives background theory and the damage identification algorithm derivation followed by a study of fundamental algorithm behavior on a two degree-of-freedom mass-spring system with generalized damping. Chapter 4 investigates the impact of noise then successfully proves the algorithm against competing methods using an analytical eight degree-of-freedom mass-spring system with non-proportional structural damping. Chapter 5 extends use of the algorithm to finite element models, including solutions for numerical issues, approaches for modeling damping approximately in reduced coordinates, and analytical validation using a composite

  18. Simulation Analysis of SPWM Variable Frequency Speed Based on Simulink

    Directory of Open Access Journals (Sweden)

    Min-Yan DI

    2014-01-01

    Full Text Available This article is studied on currently a very active field of researching sinusoidal pulse width modulation (SPWM frequency speed control system, and strengthen researched on the simulation model of speed control system with MATLAB / Simulink / Power System simulation tools, thus we can find the best way to simulation. We apply it to the actual conveyor belt, frequency conversion motor, when the obtained simulation results are compared with the measured data, we prove that the method is practical and effective. The results of our research have a guiding role for the future engineering and technical personnel in asynchronous motor SPWM VVVF CAD design.

  19. The effect of administering equine chorionic gonadotropin (eCG) and human chorionic gonadotropin (hCG) post artificial insemination on fertility of lactating dairy cows.

    Science.gov (United States)

    Bartolome, J A; Wallace, S Perez; de la Sota, R L; Thatcher, W W

    2012-09-15

    The objective was to evaluate the effect of equine chorionic gonadotropin (eCG) and hCG post artificial insemination (AI) on fertility of lactating dairy cows. In Experiment 1, cows were either treated with eCG on Day 22 post AI (400 IU; n = 80) or left untreated (n = 84). On Day 29, pregnant cows were either treated with hCG (2500 IU; n = 32) or left untreated (n = 36). Pregnancy and progesterone were evaluated on Days 29 and 45. In Experiment 2, cows (n = 28) were either treated with eCG on Day 22 (n = 13) or left untreated (n = 15) and either treated with hCG on Day 29 (n = 14) or left untreated (n = 14). Blood sampling and ultrasonography were conducted between Days 22 and 45. In Experiment 3, cows were either treated with eCG on Day 22 post AI (n = 229) or left untreated (n = 241). Pregnancy was evaluated on Days 36 and 85. In Experiment 1, eCG on Day 22 increased (P cows on Day 29 (50.0 vs. 33.3%) and on Day 45, the increase was higher (P cows with timed AI (41.2 vs. 6.5%) than in cows AI at detected estrus (50.0 vs. 37.8%). Pregnancy losses were reduced by eCG and hCG, but increased in cows that did not receive eCG but were given hCG (P cows, but not in cows treated with eCG. In Experiment 2, hCG increased (P cows (P cows with low body condition (eCG = 45.6 and 43.5%; Control = 22.9 and 22.9%). In conclusion, eCG at 22 days post insemination increased fertility, primarily in cows with low body condition and reduced pregnancy losses when given 7 days before hCG; hCG induced accessory CLs and slightly increased progesterone, but hCG given in the absence of a prior eCG treatment reduced fertility. Copyright © 2012 Elsevier Inc. All rights reserved.

  20. A paralogue of the phosphomutase-like gene family in Candida glabrata, CgPmu2, gained broad-range phosphatase activity due to a small number of clustered substitutions.

    Science.gov (United States)

    Orlando, Kelly A; Iosue, Christine L; Leone, Sarah G; Davies, Danielle L; Wykoff, Dennis D

    2015-10-15

    Inorganic phosphate is required for a range of cellular processes, such as DNA/RNA synthesis and intracellular signalling. The phosphate starvation-inducible phosphatase activity of Candida glabrata is encoded by the gene CgPMU2 (C. glabrata phosphomutase-like protein). CgPMU2 is part of a three-gene family (∼75% identical) created through gene duplication in the C. glabrata clade; only CgPmu2 is a PHO-regulated broad range acid phosphatase. We identified amino acids that confer broad range phosphatase activity on CgPmu2 by creating fusions of sections of CgPMU2 with CgPMU1, a paralogue with little broad range phosphatase activity. We used site-directed mutagenesis on various fusions to sequentially convert CgPmu1 to CgPmu2. Based on molecular modelling of the Pmu proteins on to a histidine phosphatase crystal structure, clusters of amino acids were found in two distinct regions that were able to confer phosphatase activity. Substitutions in these two regions together conferred broad phosphatase activity on CgPmu1. Interestingly, one change is a histidine adjacent to the active site histidine of CgPmu2 and it exhibits a novel ability to partially replace the conserved active site histidine in CgPmu2. Additionally, a second amino acid change was able to confer nt phosphatase activity to CgPmu1, suggesting single amino acid changes neofunctionalize CgPmu2. © 2015 Authors; published by Portland Press Limited.

  1. Ionospheric correction for spaceborne single-frequency GPS based ...

    Indian Academy of Sciences (India)

    A modified ionospheric correction method and the corresponding approximate algorithm for spaceborne single-frequency Global Positioning System (GPS) users are proposed in this study. Single Layer Model (SLM) mapping function for spaceborne GPS was analyzed. SLM mapping functions at different altitudes were ...

  2. Ionospheric correction for spaceborne single-frequency GPS based ...

    Indian Academy of Sciences (India)

    The Klobuchar model was used to compute ionospheric delays for the dlft station, and .... dual-frequency GPS receivers; therefore, the iono- ... The mapping function is defined as the ratio of .... eter in the processing of an extended set of single.

  3. Dynamic phasor based frequency scanning for grid-connected ...

    Indian Academy of Sciences (India)

    M K Das

    2017-10-11

    Oct 11, 2017 ... situations, it is not so for systems with low-order harmonics, individual-phase schemes, unbalanced or single- ..... rents at x А 2xo and x, respectively, due to the fundamental ... c = xot, where xo is the operating frequency.

  4. Fast Grid Frequency Support from Distributed Inverter-Based Resources

    Energy Technology Data Exchange (ETDEWEB)

    Hoke, Anderson F [National Renewable Energy Laboratory (NREL), Golden, CO (United States)

    2018-05-04

    This presentation summarizes power hardware-in-the-loop testing performed to evaluate the ability of distributed inverter-coupled generation to support grid frequency on the fastest time scales. The research found that distributed PV inverters and other DERs can effectively support the grid on sub-second time scales.

  5. Femtosecond frequency comb based distance measurement in air

    NARCIS (Netherlands)

    Balling, P.; Kren, P.; Masika, P.; van den Berg, S.A.

    2009-01-01

    Interferometric measurement of distance using a femtosecond frequency comb is demonstrated and compared with a counting interferometer displacement measurement. A numerical model of pulse propagation in air is developed and the results are compared with experimental data for short distances. The

  6. High resolution mid-infrared spectroscopy based on frequency upconversion

    DEFF Research Database (Denmark)

    Dam, Jeppe Seidelin; Hu, Qi; Tidemand-Lichtenberg, Peter

    2013-01-01

    signals can be analyzed. The obtainable frequency resolution is usually in the nm range where sub nm resolution is preferred in many applications, like gas spectroscopy. In this work we demonstrate how to obtain sub nm resolution when using upconversion. In the presented realization one object point...... high resolution spectral performance by observing emission from hot water vapor in a butane gas burner....

  7. Wavelet Based Characterization of Low Radio Frequency Solar Emissions

    Science.gov (United States)

    Suresh, A.; Sharma, R.; Das, S. B.; Oberoi, D.; Pankratius, V.; Lonsdale, C.

    2016-12-01

    Low-frequency solar radio observations with the Murchison Widefield Array (MWA) have revealed the presence of numerous short-lived, narrow-band weak radio features, even during quiet solar conditions. In their appearance in in the frequency-time plane, they come closest to the solar type III bursts, but with much shorter spectral spans and flux densities, so much so that they are not detectable with the usual swept frequency radio spectrographs. These features occur at rates of many thousand features per hour in the 30.72 MHz MWA bandwidth, and hence necessarily require an automated approach to determine robust statistical estimates of their properties, e.g., distributions of spectral widths, temporal spans, flux densities, slopes in the time-frequency plane and distribution over frequency. To achieve this, a wavelet decomposition approach has been developed for feature recognition and subsequent parameter extraction from the MWA dynamic spectrum. This work builds on earlier work by the members of this team to achieve a reliable flux calibration in a computationally efficient manner. Preliminary results show that the distribution of spectral span of these features peaks around 3 MHz, most of them last for less than two seconds and are characterized by flux densities of about 60% of the background solar emission. In analogy with the solar type III bursts, this non-thermal emission is envisaged to arise via coherent emission processes. There is also an exciting possibility that these features might correspond to radio signatures of nanoflares, hypothesized (Gold, 1964; Parker, 1972) to explain coronal heating.

  8. Detailed Analysis of Torque Ripple in High Frequency Signal Injection based Sensor less PMSM Drives

    Directory of Open Access Journals (Sweden)

    Ravikumar Setty A.

    2017-01-01

    Full Text Available High Frequency Signal Injection based techniques are robust and well proven to estimate the rotor position from stand still to low speed. However, Injected high frequency signal introduces, high frequency harmonics in the motor phase currents and results in significant Output Torque ripple. There is no detailed analysis exist in the literature, to study the effect of injected signal frequency on Torque ripple. Objective of this work is to study the Torque Ripple resulting from High Frequency signal injection in PMSM motor drives. Detailed MATLAB/Simulink simulations are carried to quantify the Torque ripple at different Signal frequencies.

  9. Kathon CG y Dermatología Laboral: Actualización Kathon CG and Occupational Dermatology: An update

    Directory of Open Access Journals (Sweden)

    Ana Rita Rodrigues Barata

    2012-09-01

    Full Text Available El Kathon CG constituye el nombre comercial de una mezcla de isotiazolinas: Metilcloroisotiazolinona y Metilisotiazolinona. Es un conservante muy utilizado, sobre todo en la industria cosmética, aunque en los últimos años también se ha impuesto su presencia en productos de limpieza de uso doméstico y actualmente a concentraciones más altas en preparados de uso industrial como aceites de corte, emulsiones de látex, pinturas al temple, aceites para motores Diesel, etc. Por su alto poder sensibilizante y amplia utilización, constituye actualmente una de las causas más frecuentes de alergia de contacto por preservativos, tanto en nuestra vida privada, como en el ámbito profesional. Objetivos: Estudiar la capacidad sensibilizante del Kathon CG y su relación con el desarrollo de eczema de contacto alérgico de origen profesional. Métodos: Estudio observacional descriptivo, a través de la revisión de las historias clínicas de los pacientes vistos en el Servicio de Dermatología Laboral del Instituto Nacional de Medicina y Seguridad en el Trabajo durante los años 2008-2012; 1520 pacientes fueron evaluados y estudiados mediante pruebas epicutáneas para descartar una posible dermatosis profesional. Se registraron los casos de sensibilización al Kathon CG y se analizaron las siguientes variables: genero, edad, grupo profesional, localización de las lesiones cutáneas, relevancia y relación profesional. El análisis estadístico se realizó con el programa SPSS 15.0. Resultados: Se observó sensibilización al Kathon CG en 88 pacientes (5,8%, correspondiendo un 42% a sensibilizaciones de origen profesional. Conclusiones: La alergia de contacto profesional por Kathon CG constituye actualmente es un problema de alta prevalencia. Ante un paciente con positividad a este alérgeno hay que interrogar siempre por su profesión.Kathon CG is the tradename for a mixture of isothiazolines: methylchloroisothiazolinone and methylisothiazolinone. It

  10. Phylogenetic relationships of Chaetomium isolates based on the ...

    African Journals Online (AJOL)

    Molecular characterization of 18 Chaetomium isolates collected from India based on the internal transcribed spacer (ITS) region of the rRNA gene sequences was done. Phylogenetic analysis of full length ITS region showed that Chaetomium globosum isolates, Cg1, Cg2, Cg6, Cg11 and Cg15, Chaetomium spp. isolates, ...

  11. Nano-Scale Devices for Frequency-Based Magnetic Biosensing

    Science.gov (United States)

    2017-01-31

    show the basic measurement setup (the field is applied perpendicular to the disk plane). A radiofrequency signal is injected across the disk (disks...shown in Fig. 7(a). A spectrum analyser (S.A.) (or a high frequency oscilloscope) is used to measure the radiofrequency STO output signal with Fig...crystals and, via electrical measurements , in magnetic-vortex-containing, isolated micro- and nano-devices. Via micromagnetic simulations, we have largely

  12. Base-Level Guide for Electromagnetic Frequency Radiation

    Science.gov (United States)

    2012-12-01

    only through exposure to very powerful magnetic fields (> 4 Tesla). For the limits, the force influences on metallic objects are relevant...impractical. Nonferrous shielding materials have little or no effect upon a magnetic field. Magnetic shielding that is effective at low frequencies... detectors or area monitors in Air Force operational environments. This is noted in AFOSH 48-9. In cases where the environment may exceed ten (10

  13. Sparse time-frequency decomposition based on dictionary adaptation.

    Science.gov (United States)

    Hou, Thomas Y; Shi, Zuoqiang

    2016-04-13

    In this paper, we propose a time-frequency analysis method to obtain instantaneous frequencies and the corresponding decomposition by solving an optimization problem. In this optimization problem, the basis that is used to decompose the signal is not known a priori. Instead, it is adapted to the signal and is determined as part of the optimization problem. In this sense, this optimization problem can be seen as a dictionary adaptation problem, in which the dictionary is adaptive to one signal rather than a training set in dictionary learning. This dictionary adaptation problem is solved by using the augmented Lagrangian multiplier (ALM) method iteratively. We further accelerate the ALM method in each iteration by using the fast wavelet transform. We apply our method to decompose several signals, including signals with poor scale separation, signals with outliers and polluted by noise and a real signal. The results show that this method can give accurate recovery of both the instantaneous frequencies and the intrinsic mode functions. © 2016 The Author(s).

  14. A novel histone deacetylase inhibitor, CG200745, potentiates anticancer effect of docetaxel in prostate cancer via decreasing Mcl-1 and Bcl-XL.

    Science.gov (United States)

    Hwang, Jung Jin; Kim, Yong Sook; Kim, Taelim; Kim, Mi Joung; Jeong, In Gab; Lee, Je-Hwan; Choi, Jene; Jang, Sejin; Ro, Seonggu; Kim, Choung-Soo

    2012-08-01

    We synthesized a novel hydroxamate-based pan-histone deacetylase inhibitor (HDACI), CG200745 {(E)-2-(Naphthalen-1-yloxymethyl)-oct-2-enedioic acid 1-[(3-dimethylamino-propyl)-amide] 8-hydroxyamide]}. Like other inhibitors, for example vorinostat and belinostat, CG200745 has the hydroxamic acid moiety to bind zinc at the bottom of catalytic pocket. Firstly, we analyzed its inhibitory activity against histone deacetylase (HDAC) in hormone-dependent LNCaP cells and hormone-independent DU145 and PC3 cells. CG200745 inhibited deacetylation of histone H3 and tubulin as much as vorinostat and belinostat did. CG200745 also inhibited growth of prostate cancer cells, increased sub-G1 population, and activated caspase-9, -3 and -8 in LNCaP, DU145 and PC3 cells. These results indicate that CG200745 induces apoptosis. Next, we examined the effect of CG200745 on cell death induced by docetaxel in DU145 cells in vitro and in vivo. Compared to mono-treatment with each drug, pre-treatment of DU145 cells with docetaxel followed by CG200745 showed synergistic cytotoxicity, and increased the apoptotic sub-G1 population, caspase activation, and tubulin acetylation. Moreover, the combination treatment decreased Mcl-1 and Bcl-(XL). Docetaxel and CG200745 combination reduced tumor size in the DU145 xenograft model. These preclinical results show that combination treatment with docetaxel and new HDACI, CG200745, potentiated anti-tumor effect in hormone-refractory prostate cancer (HRPC) cells via activation of apoptosis.

  15. AHRR (cg05575921) hypomethylation marks smoking behaviour, morbidity and mortality

    DEFF Research Database (Denmark)

    Bojesen, Stig E; Timpson, Nicholas; Relton, Caroline

    2017-01-01

    was associated with former and current smoking status, high daily and cumulative smoking, short time since smoking cessation (all p values 7×10-31), and the smoking-related CHRN3A genotype (-0.48% per T-allele, p=0.002). The multifactorially adjusted HRs for the lowest versus highest methylation quintiles were...... in the lowest and highest methylation quintiles were 3.7% and 0.0% (p=2×10-7), whereas predicted PLCOM2012 6-year risks were similar (4.3% and 4.4%, p=0.77). CONCLUSION: AHRR (cg05575921) hypomethylation, a marker of smoking behaviour, provides potentially clinical relevant predictions of future smoking-related...... morbidity and mortality. METHODS: From the Copenhagen City Heart Study representing the Danish general population, we studied 9234 individuals. Using bisulphite treated leucocyte DNA, AHRR (cg05575921) methylation was measured. Rs1051730 (CHRN3A) genotype was used to evaluate smoking heaviness. Participants...

  16. Cross-linking of hCG to luteal receptors

    Energy Technology Data Exchange (ETDEWEB)

    Ji, T.H.; Ji, I.

    1985-01-01

    Photoaffinity labeling of the lutropin/choriogonadotropin (LH/hCG) receptor system on porcine granulosa cells has demonstrated that both the ..cap alpha.. and ..beta.. subunits of hCG directly photoaffinity label the hormone receptor. Three new bands appear on SDS-PAGE as a consequence of photoaffinity labeling by each subunit: the molecular weights of the three bands (106K, 88K, and 83K) produced by the subunit are larger by approximately 10K than those of the three bands (96K, 76K, and 73K) labeled by the ..cap alpha.. subunit. Although it could be a coincidence that the molecular weight of the ..beta.. subunit is approximately 10K larger than that of the ..cap alpha.. subunit, the similarity in these differences suggests the possibility that both the ..cap alpha.. and ..beta.. subunits have labeled the same polypeptides.

  17. Core damage frequency perspectives based on IPE results

    International Nuclear Information System (INIS)

    Dingman, S.E.; Camp, A.L.; LaChance, J.L.; Drouin, M.T.

    1996-01-01

    In November 1988, the US Nuclear Regulatory Commission (NRC) issued Generic Letter 88-20 requesting that all licensees perform an individual Plant Examination (IPE) to identify any plant-specific vulnerability to severe accidents and report the results to the Commission. This paper provides perspectives gained from reviewing 75 Individual Plant Examination (IPE) submittals covering 108 nuclear power plant units. Variability both within and among reactor types is examined to provide perspectives regarding plant-specific design and operational features, and modeling assumptions that play a significant role in the estimates of core damage frequencies in the IPEs

  18. Wireless Chalcogenide Nanoionic-Based Radio-Frequency Switch

    Science.gov (United States)

    Nessel, James; Miranda, Felix

    2013-01-01

    A new nonvolatile nanoionic switch is powered and controlled through wireless radio-frequency (RF) transmission. A thin layer of chalcogenide glass doped with a metal ion, such as silver, comprises the operational portion of the switch. For the switch to function, an oxidizable electrode is made positive (anode) with respect to an opposing electrode (cathode) when sufficient bias, typically on the order of a few tenths of a volt or more, is applied. This action causes the metal ions to flow toward the cathode through a coordinated hopping mechanism. At the cathode, a reduction reaction occurs to form a metal deposit. This metal deposit creates a conductive path that bridges the gap between electrodes to turn the switch on. Once this conductive path is formed, no further power is required to maintain it. To reverse this process, the metal deposit is made positive with respect to the original oxidizable electrode, causing the dissolution of the metal bridge thereby turning the switch off. Once the metal deposit has been completely dissolved, the process self-terminates. This switching process features the following attributes. It requires very little to change states (i.e., on and off). Furthermore, no power is required to maintain the states; hence, the state of the switch is nonvolatile. Because of these attributes the integration of a rectenna to provide the necessary power and control is unique to this embodiment. A rectenna, or rectifying antenna, generates DC power from an incident RF signal. The low voltages and power required for the nanoionic switch control are easily generated from this system and provide the switch with a novel capability to be operated and powered from an external wireless device. In one realization, an RF signal of a specific frequency can be used to set the switch into an off state, while another frequency can be used to set the switch to an on state. The wireless, miniaturized, and nomoving- part features of this switch make it

  19. Core damage frequency (reactor design) perspectives based on IPE results

    International Nuclear Information System (INIS)

    Camp, A.L.; Dingman, S.E.; Forester, J.A.

    1996-01-01

    This paper provides perspectives gained from reviewing 75 Individual Plant Examination (IPE) submittals covering 108 nuclear power plant units. Variability both within and among reactor types is examined to provide perspectives regarding plant-specific design and operational features, and C, modeling assumptions that play a significant role in the estimates of core damage frequencies in the IPEs. Human actions found to be important in boiling water reactors (BWRs) and in pressurized water reactors (PWRs) are presented and the events most frequently found important are discussed

  20. Presence of a consensus DNA motif at nearby DNA sequence of the mutation susceptible CG nucleotides.

    Science.gov (United States)

    Chowdhury, Kaushik; Kumar, Suresh; Sharma, Tanu; Sharma, Ankit; Bhagat, Meenakshi; Kamai, Asangla; Ford, Bridget M; Asthana, Shailendra; Mandal, Chandi C

    2018-01-10

    Complexity in tissues affected by cancer arises from somatic mutations and epigenetic modifications in the genome. The mutation susceptible hotspots present within the genome indicate a non-random nature and/or a position specific selection of mutation. An association exists between the occurrence of mutations and epigenetic DNA methylation. This study is primarily aimed at determining mutation status, and identifying a signature for predicting mutation prone zones of tumor suppressor (TS) genes. Nearby sequences from the top five positions having a higher mutation frequency in each gene of 42 TS genes were selected from a cosmic database and were considered as mutation prone zones. The conserved motifs present in the mutation prone DNA fragments were identified. Molecular docking studies were done to determine putative interactions between the identified conserved motifs and enzyme methyltransferase DNMT1. Collective analysis of 42 TS genes found GC as the most commonly replaced and AT as the most commonly formed residues after mutation. Analysis of the top 5 mutated positions of each gene (210 DNA segments for 42 TS genes) identified that CG nucleotides of the amino acid codons (e.g., Arginine) are most susceptible to mutation, and found a consensus DNA "T/AGC/GAGGA/TG" sequence present in these mutation prone DNA segments. Similar to TS genes, analysis of 54 oncogenes not only found CG nucleotides of the amino acid Arg as the most susceptible to mutation, but also identified the presence of similar consensus DNA motifs in the mutation prone DNA fragments (270 DNA segments for 54 oncogenes) of oncogenes. Docking studies depicted that, upon binding of DNMT1 methylates to this consensus DNA motif (C residues of CpG islands), mutation was likely to occur. Thus, this study proposes that DNMT1 mediated methylation in chromosomal DNA may decrease if a foreign DNA segment containing this consensus sequence along with CG nucleotides is exogenously introduced to dividing

  1. Effects of equine chorionic gonadotropin (eCG) administration and ...

    African Journals Online (AJOL)

    Pregnancy rate in group F was more than the control group (p < 0.05). Twinning rates and kid crops in groups E+F and F were significantly higher than control group (p < 0.05). Time of onset of estrus decreased in groups with eCG administration (E and E+F). Therefore, it is concluded that the flushing especially coupled with ...

  2. Rhipicephalus (Boophilus microplus: expression and characterization of Bm86-CG in Pichia pastoris Rhipicephalus (Boophilus microplus: expressão e caracterização da Bm86-CG em Pichia pastoris

    Directory of Open Access Journals (Sweden)

    Rodrigo Casquero Cunha

    2011-06-01

    Full Text Available The cattle tick Rhipicephalus (Boophilus microplus is responsible for great economic losses. It is mainly controlled chemically, with limitations regarding development of resistance to the chemicals. Vaccines may help control this parasite, thereby reducing tick pesticide use. In this light, we performed subcloning of the gene of the protein Bm86-GC, the homologue protein that currently forms the basis of vaccines (GavacTM and TickGardPLUS that have been developed against cattle ticks. The subcloning was done in the pPIC9 expression vector, for transformation in the yeast Pichia pastoris. This protein was characterized by expression of the recombinant Mut+ strain, which expressed greater quantities of protein. The expressed protein (rBm86-CG was recognized in the Western-blot assay using anti-Gavac, anti-TickGard, anti-larval extract and anti-rBm86-CG polyclonal sera. The serum produced in cattle vaccinated with the antigen CG rBm86 presented high antibody titers and recognized the native protein. The rBm86-GC has potential relevance as an immunogen for vaccine formulation against cattle ticks.O carrapato-do-boi Rhipicephalus (Boophilus microplus é responsável por grandes perdas econômicas. Seu controle é principalmente químico e apresenta limitações quanto ao desenvolvimento de resistência aos princípios ativos. As vacinas podem auxiliar no controle deste parasita diminuindo as aplicações de carrapaticidas. Considerando isso, foi realizada a subclonagem do gene da proteína Bm86-CG, proteína homologa a que atualmente é a base das vacinas desenvolvidas (GavacTM e TickGardPLUS contra o carrapato-do-boi, no vetor de expressão pPIC9, para ser transformado em levedura, Pichia pastoris. Esta proteína foi caracterizada pela expressão da cepa recombinante Mut+ que expressou maior quantidade de proteína. A proteína expressa, rBm86-CG, foi reconhecida no ensaio de Western-blot pelos soros policlonais anti-Gavac, anti-TickGard, anti

  3. AHRR (cg05575921) hypomethylation marks smoking behaviour, morbidity and mortality

    DEFF Research Database (Denmark)

    Bojesen, Stig E; Timpson, Nicholas; Relton, Caroline

    2017-01-01

    were followed for up to 22 years for exacerbations of COPD, event of lung cancer and all-cause mortality. Six-year lung cancer risk was calculated according to the Prostate, Lung, Colorectal and Ovarian Cancer Screening Trial (PLCOM2012). MEASUREMENTS AND MAIN RESULTS: AHRR (cg05575921) hypomethylation......RATIONALE AND OBJECTIVES: Self-reported smoking underestimates disease risk. Smoking affects DNA methylation, in particular the cg05575921 site in the aryl hydrocarbon receptor repressor (AHRR) gene. We tested the hypothesis that AHRR cg05575921 hypomethylation is associated with risk of smoking...... 4.58 (95% CI 2.83 to 7.42) for COPD exacerbations, 4.87 (2.31 to 10.3) for lung cancer and 1.67 (1.48 to 1.88) for all-cause mortality. Finally, among 2576 high-risk smokers eligible for lung cancer screening by CT, observed cumulative incidences of lung cancer after 6 years for individuals...

  4. Data of evolutionary structure change: 1CG5B-2ZLWD [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1CG5B-2ZLWD 1CG5 2ZLW B D VKLSEDQEHYIKGVWKDVDHKQITAKALERVFVVYPWTT.../seq1> VQLSGEEKAAVLALWDKVNEEEVGGEALGRLLVVYPWTQRFFDSFGDLSNPGAVMGNPKVKAHGKKVLHSFGEGVHHLDNLKGTFAALSELHCDK...224 GLY CA 259 2ZLW D 2ZLWD...W D 2ZLWD ELHCDKLHVDP

  5. Data of evolutionary structure change: 1CG8B-2ZLWD [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1CG8B-2ZLWD 1CG8 2ZLW B D VKLSEDQEHYIKGVWKDVDHKQITAKALERVFVVYPWTT.../seq1> VQLSGEEKAAVLALWDKVNEEEVGGEALGRLLVVYPWTQRFFDSFGDLSNPGAVMGNPKVKAHGKKVLHSFGEGVHHLDNLKGTFAALSELHCDK... GLY CA 249 2ZLW D 2ZLWD...2ZLW D 2ZLWD ELHCDKLHVDP

  6. The power grid AGC frequency bias coefficient online identification method based on wide area information

    Science.gov (United States)

    Wang, Zian; Li, Shiguang; Yu, Ting

    2015-12-01

    This paper propose online identification method of regional frequency deviation coefficient based on the analysis of interconnected grid AGC adjustment response mechanism of regional frequency deviation coefficient and the generator online real-time operation state by measured data through PMU, analyze the optimization method of regional frequency deviation coefficient in case of the actual operation state of the power system and achieve a more accurate and efficient automatic generation control in power system. Verify the validity of the online identification method of regional frequency deviation coefficient by establishing the long-term frequency control simulation model of two-regional interconnected power system.

  7. Islanding Detection of Synchronous Machine-Based DGs using Average Frequency Based Index

    Directory of Open Access Journals (Sweden)

    M. Bakhshi

    2013-06-01

    Full Text Available Identification of intentional and unintentional islanding situations of dispersed generators (DGs is one of the most important protection concerns in power systems. Considering safety and reliability problems of distribution networks, an exact diagnosis index is required to discriminate the loss of the main network from the existing parallel operation. Hence, this paper introduces a new islanding detection method for synchronous machine–based DGs. This method uses the average value of the generator frequency to calculate a new detection index. The proposed method is an effective supplement of the over/under frequency protection (OFP/UFP system. The analytical equations and simulation results are used to assess the performance of the proposed method under various scenarios such as different types of faults, load changes and capacitor bank switching. To show the effectiveness of the proposed method, it is compared with the performance of both ROCOF and ROCOFOP methods.

  8. Mercury Atomic Frequency Standards for Space Based Navigation and Timekeeping

    Science.gov (United States)

    Tjoelker, R. L.; Burt, E. A.; Chung, S.; Hamell, R. L.; Prestage, J. D.; Tucker, B.; Cash, P.; Lutwak, R.

    2012-01-01

    A low power Mercury Atomic Frequency Standard (MAFS) has been developed and demonstrated on the path towards future space clock applications. A self contained mercury ion breadboard clock: emulating flight clock interfaces, steering a USO local oscillator, and consuming approx 40 Watts has been operating at JPL for more than a year. This complete, modular ion clock instrument demonstrates that key GNSS size, weight, and power (SWaP) requirements can be achieved while still maintaining short and long term performance demonstrated in previous ground ion clocks. The MAFS breadboard serves as a flexible platform for optimizing further space clock development and guides engineering model design trades towards fabrication of an ion clock for space flight.

  9. Nanoparticle array based optical frequency selective surfaces: theory and design.

    Science.gov (United States)

    Saeidi, Chiya; van der Weide, Daniel

    2013-07-01

    We demonstrate a synthesis procedure for designing a bandstop optical frequency selective surface (FSS) composed of nanoparticle (NP) elements. The proposed FSS uses two-dimensional (2-D) periodic arrays of NPs with subwavelength unit-cell dimensions. We derive equivalent circuit for a nanoparticle array (NPA) using the closed-form solution for a 2-D NPA excited by a plane wave in the limit of the dipole approximation, which includes contribution from both individual and collective plasmon modes. Using the extracted equivalent circuit, we demonstrate synthesis of an optical FSS using cascaded NPA layers as coupled resonators, which we validate with both circuit model and full-wave simulation for a third-order Butterworth bandstop prototype.

  10. High frequency modulation circuits based on photoconductive wide bandgap switches

    Science.gov (United States)

    Sampayan, Stephen

    2018-02-13

    Methods, systems, and devices for high voltage and/or high frequency modulation. In one aspect, an optoelectronic modulation system includes an array of two or more photoconductive switch units each including a wide bandgap photoconductive material coupled between a first electrode and a second electrode, a light source optically coupled to the WBGP material of each photoconductive switch unit via a light path, in which the light path splits into multiple light paths to optically interface with each WBGP material, such that a time delay of emitted light exists along each subsequent split light path, and in which the WBGP material conducts an electrical signal when a light signal is transmitted to the WBGP material, and an output to transmit the electrical signal conducted by each photoconductive switch unit. The time delay of the photons emitted through the light path is substantially equivalent to the time delay of the electrical signal.

  11. Femtosecond frequency comb based distance measurement in air.

    Science.gov (United States)

    Balling, Petr; Kren, Petr; Masika, Pavel; van den Berg, S A

    2009-05-25

    Interferometric measurement of distance using a femtosecond frequency comb is demonstrated and compared with a counting interferometer displacement measurement. A numerical model of pulse propagation in air is developed and the results are compared with experimental data for short distances. The relative agreement for distance measurement in known laboratory conditions is better than 10(-7). According to the model, similar precision seems feasible even for long-distance measurement in air if conditions are sufficiently known. It is demonstrated that the relative width of the interferogram envelope even decreases with the measured length, and a fringe contrast higher than 90% could be obtained for kilometer distances in air, if optimal spectral width for that length and wavelength is used. The possibility of comb radiation delivery to the interferometer by an optical fiber is shown by model and experiment, which is important from a practical point of view.

  12. Measurement of a discontinuous object based on a dual-frequency grating

    Institute of Scientific and Technical Information of China (English)

    Qiao Nao-Sheng; Cai Xin-Hua; Yao Chun-Mei

    2009-01-01

    The dual-frequency grating measurement theory is proposed in order to carry out the measurement of a discontinuous object. Firstly, the reason why frequency spectra are produced by low frequency gratings and high frequency gratings in the field of frequency is analysed, and the relationship between the wrapped-phase and the unwrappingphase is discussed. Secondly, a method to combine the advantages of the two kinds of gratings is proposed: one stripe is produced in the mutation part of the object measured by a suitable low frequency grating designed by MATLAB, then the phase produced by the low frequency grating need not be unfolded. The integer series of stripes is produced by a high frequency grating designed by MATLAB based on the frequency ratio of the two kinds of gratings and the high frequency wrapped-phase, and the high frequency unwrapping-phase is then obtained. In order to verify the correctness of the theoretical analysis, a steep discontinuous object of 600×600 pixels and 10.00 mm in height is simulated and a discontinuous object of ladder shape which is 32.00 mm in height is used in experiment. Both the simulation and the experiment can restore the discontinuous object height accurately by using the dual-frequency grating measurement theory.

  13. Radioimmunoassay and evaluation for serum SIgA and CG of the hepatopathy patients

    International Nuclear Information System (INIS)

    Liu Junchi; Du Shujun; Lu Jun; Tang Xiaolin; Mao Shaorong

    1995-01-01

    Serum SIgA and CG of 247 hepatopathy (male 140, female 99) are radioimmunoassayed. The Clinical Significance of SIgA, CG for hepatisms is evaluated. The results show that the assay of SIgA, CG has an important significance for the doctor to choose the treatment plans and determine the prognosis

  14. Research on frequency control strategy of interconnected region based on fuzzy PID

    Science.gov (United States)

    Zhang, Yan; Li, Chunlan

    2018-05-01

    In order to improve the frequency control performance of the interconnected power grid, overcome the problems of poor robustness and slow adjustment of traditional regulation, the paper puts forward a frequency control method based on fuzzy PID. The method takes the frequency deviation and tie-line deviation of each area as the control objective, takes the regional frequency deviation and its deviation as input, and uses fuzzy mathematics theory, adjusts PID control parameters online. By establishing the regional frequency control model of water-fire complementary power generation in MATLAB, the regional frequency control strategy is given, and three control modes (TBC-FTC, FTC-FTC, FFC-FTC) are simulated and analyzed. The simulation and experimental results show that, this method has better control performance compared with the traditional regional frequency regulation.

  15. visualization of reaction mechanism by cg based on quantum

    African Journals Online (AJOL)

    IICBA01

    optimization of geometry, for search of potential energies of various geometries of .... university student by means of iBooks Author (ver. 2.1.1, Apple ... Modeling in Science Education 3 Visualization: Theory and Practice in Science Education”,.

  16. High-performance radio frequency transistors based on diameter-separated semiconducting carbon nanotubes

    Energy Technology Data Exchange (ETDEWEB)

    Cao, Yu; Che, Yuchi; Zhou, Chongwu, E-mail: chongwuz@usc.edu [Department of Electrical Engineering, University of Southern California, Los Angeles, California 90089 (United States); Seo, Jung-Woo T.; Hersam, Mark C. [Department of Materials Science and Engineering and Department of Chemistry, Northwestern University, Evanston, Illinois 60208 (United States); Gui, Hui [Department of Chemical Engineering and Materials Science, University of Southern California, Los Angeles, California 90089 (United States)

    2016-06-06

    In this paper, we report the high-performance radio-frequency transistors based on the single-walled semiconducting carbon nanotubes with a refined average diameter of ∼1.6 nm. These diameter-separated carbon nanotube transistors show excellent transconductance of 55 μS/μm and desirable drain current saturation with an output resistance of ∼100 KΩ μm. An exceptional radio-frequency performance is also achieved with current gain and power gain cut-off frequencies of 23 GHz and 20 GHz (extrinsic) and 65 GHz and 35 GHz (intrinsic), respectively. These radio-frequency metrics are among the highest reported for the carbon nanotube thin-film transistors. This study provides demonstration of radio frequency transistors based on carbon nanotubes with tailored diameter distributions, which will guide the future application of carbon nanotubes in radio-frequency electronics.

  17. Diagnostics of trophoblast disease and the control of therapeutic efficiency based on definition of chorionic gonadotrapin and trophoblastic beta1-glycoprotein

    International Nuclear Information System (INIS)

    Yugrinova, L.G.; Olefirenko, G.A.; Dotsenko, Yu.S.

    1982-01-01

    A comparative estimation of markers of trophoblast disease, chorionic gonadotropin (CG) and trophoblastic beta 1 -glycoprotein defined by different methods is given. It is found that diagnostics and control of therapeutic efficiency for patients having trophoblast disease based on CG definition are possible. In 86% of cases the clinical diagnosis was confirmed by the immunoradioautography, and in 33% - by the immunodiffusion method. The dependence of marker detection frequency on the therapeutic efficiency is found

  18. Reinnervation following catheter-based radio-frequency renal denervation.

    Science.gov (United States)

    Booth, Lindsea C; Nishi, Erika E; Yao, Song T; Ramchandra, Rohit; Lambert, Gavin W; Schlaich, Markus P; May, Clive N

    2015-04-20

    What is the topic of this review? Does catheter-based renal denervation effectively denervate the afferent and efferent renal nerves and does reinnervation occur? What advances does it highlight? Following catheter-based renal denervation, the afferent and efferent responses to electrical stimulation were abolished, renal sympathetic nerve activity was absent, and levels of renal noradrenaline and immunohistochemistry for tyrosine hydroxylase and calcitonin gene-related peptide were significantly reduced. By 11 months after renal denervation, both the functional responses and anatomical markers of afferent and efferent renal nerves had returned to normal, indicating reinnervation. Renal denervation reduces blood pressure in animals with experimental hypertension and, recently, catheter-based renal denervation was shown to cause a prolonged decrease in blood pressure in patients with resistant hypertension. The randomized, sham-controlled Symplicity HTN-3 trial failed to meet its primary efficacy end-point, but there is evidence that renal denervation was incomplete in many patients. Currently, there is little information regarding the effectiveness of catheter-based renal denervation and the extent of reinnervation. We assessed the effectiveness of renal nerve denervation with the Symplicity Flex catheter and the functional and anatomical reinnervation at 5.5 and 11 months postdenervation. In anaesthetized, non-denervated sheep, there was a high level of renal sympathetic nerve activity, and electrical stimulation of the renal nerve increased blood pressure and reduced heart rate (afferent response) and caused renal vasoconstriction and reduced renal blood flow (efferent response). Immediately after renal denervation, renal sympathetic nerve activity and the responses to electrical stimulation were absent, indicating effective denervation. By 11 months after denervation, renal sympathetic nerve activity was present and the responses to electrical stimulation

  19. Study on frequency characteristics of wireless power transmission system based on magnetic coupling resonance

    Science.gov (United States)

    Liang, L. H.; Liu, Z. Z.; Hou, Y. J.; Zeng, H.; Yue, Z. K.; Cui, S.

    2017-11-01

    In order to study the frequency characteristics of the wireless energy transmission system based on the magnetic coupling resonance, a circuit model based on the magnetic coupling resonant wireless energy transmission system is established. The influence of the load on the frequency characteristics of the wireless power transmission system is analysed. The circuit coupling theory is used to derive the minimum load required to suppress frequency splitting. Simulation and experimental results verify that when the load size is lower than a certain value, the system will appear frequency splitting, increasing the load size can effectively suppress the frequency splitting phenomenon. The power regulation scheme of the wireless charging system based on magnetic coupling resonance is given. This study provides a theoretical basis for load selection and power regulation of wireless power transmission systems.

  20. Three-frequency BDS precise point positioning ambiguity resolution based on raw observables

    Science.gov (United States)

    Li, Pan; Zhang, Xiaohong; Ge, Maorong; Schuh, Harald

    2018-02-01

    All BeiDou navigation satellite system (BDS) satellites are transmitting signals on three frequencies, which brings new opportunity and challenges for high-accuracy precise point positioning (PPP) with ambiguity resolution (AR). This paper proposes an effective uncalibrated phase delay (UPD) estimation and AR strategy which is based on a raw PPP model. First, triple-frequency raw PPP models are developed. The observation model and stochastic model are designed and extended to accommodate the third frequency. Then, the UPD is parameterized in raw frequency form while estimating with the high-precision and low-noise integer linear combination of float ambiguity which are derived by ambiguity decorrelation. Third, with UPD corrected, the LAMBDA method is used for resolving full or partial ambiguities which can be fixed. This method can be easily and flexibly extended for dual-, triple- or even more frequency. To verify the effectiveness and performance of triple-frequency PPP AR, tests with real BDS data from 90 stations lasting for 21 days were performed in static mode. Data were processed with three strategies: BDS triple-frequency ambiguity-float PPP, BDS triple-frequency PPP with dual-frequency (B1/B2) and three-frequency AR, respectively. Numerous experiment results showed that compared with the ambiguity-float solution, the performance in terms of convergence time and positioning biases can be significantly improved by AR. Among three groups of solutions, the triple-frequency PPP AR achieved the best performance. Compared with dual-frequency AR, additional the third frequency could apparently improve the position estimations during the initialization phase and under constraint environments when the dual-frequency PPP AR is limited by few satellite numbers.

  1. Development of 'SKYSHINE-CG' code. A line-beam method code equipped with combinatorial geometry routine

    Energy Technology Data Exchange (ETDEWEB)

    Nakagawa, Takahiro; Ochiai, Katsuharu [Plant and System Planning Department, Toshiba Corporation, Yokohama, Kanagawa (Japan); Uematsu, Mikio; Hayashida, Yoshihisa [Department of Nuclear Engineering, Toshiba Engineering Corporation, Yokohama, Kanagawa (Japan)

    2000-03-01

    A boiling water reactor (BWR) plant has a single loop coolant system, in which main steam generated in the reactor core proceeds directly into turbines. Consequently, radioactive {sup 16}N (6.2 MeV photon emitter) contained in the steam contributes to gamma-ray skyshine dose in the vicinity of the BWR plant. The skyshine dose analysis is generally performed with the line-beam method code SKYSHINE, in which calculational geometry consists of a rectangular turbine building and a set of isotropic point sources corresponding to an actual distribution of {sup 16}N sources. For the purpose of upgrading calculational accuracy, the SKYSHINE-CG code has been developed by incorporating the combinatorial geometry (CG) routine into the SKYSHINE code, so that shielding effect of in-building equipment can be properly considered using a three-dimensional model composed of boxes, cylinders, spheres, etc. Skyshine dose rate around a 500 MWe BWR plant was calculated with both SKYSHINE and SKYSHINE-CG codes, and the calculated results were compared with measured data obtained with a NaI(Tl) scintillation detector. The C/E values for SKYSHINE-CG calculation were scattered around 4.0, whereas the ones for SKYSHINE calculation were as large as 6.0. Calculational error was found to be reduced by adopting three-dimensional model based on the combinatorial geometry method. (author)

  2. Prediction Equations of Energy Expenditure in Chinese Youth Based on Step Frequency during Walking and Running

    Science.gov (United States)

    Sun, Bo; Liu, Yu; Li, Jing Xian; Li, Haipeng; Chen, Peijie

    2013-01-01

    Purpose: This study set out to examine the relationship between step frequency and velocity to develop a step frequency-based equation to predict Chinese youth's energy expenditure (EE) during walking and running. Method: A total of 173 boys and girls aged 11 to 18 years old participated in this study. The participants walked and ran on a…

  3. Joint Angle and Frequency Estimation Using Multiple-Delay Output Based on ESPRIT

    Science.gov (United States)

    Xudong, Wang

    2010-12-01

    This paper presents a novel ESPRIT algorithm-based joint angle and frequency estimation using multiple-delay output (MDJAFE). The algorithm can estimate the joint angles and frequencies, since the use of multiple output makes the estimation accuracy greatly improved when compared with a conventional algorithm. The useful behavior of the proposed algorithm is verified by simulations.

  4. The RFI situation for a space-based low-frequency radio astronomy instrument

    NARCIS (Netherlands)

    Bentum, Marinus Jan; Boonstra, A.J.

    2016-01-01

    Space based ultra-long wavelength radio astronomy has recently gained a lot of interest. Techniques to open the virtually unexplored frequency band below 30 MHz are becoming within reach at this moment. Due to the ionosphere and the radio interference (RFI) on Earth exploring this frequency band

  5. Model-based Estimation of High Frequency Jump Diffusions with Microstructure Noise and Stochastic Volatility

    NARCIS (Netherlands)

    Bos, Charles S.

    2008-01-01

    When analysing the volatility related to high frequency financial data, mostly non-parametric approaches based on realised or bipower variation are applied. This article instead starts from a continuous time diffusion model and derives a parametric analog at high frequency for it, allowing

  6. Optical fiber strain sensor using fiber resonator based on frequency comb Vernier spectroscopy

    DEFF Research Database (Denmark)

    Zhang, Liang; Lu, Ping; Chen, Li

    2012-01-01

    A novel (to our best knowledge) optical fiber strain sensor using a fiber ring resonator based on frequency comb Vernier spectroscopy is proposed and demonstrated. A passively mode-locked optical fiber laser is employed to generate a phased-locked frequency comb. Strain applied to the optical fib...

  7. Flextensional fiber Bragg grating-based accelerometer for low frequency vibration measurement

    Institute of Scientific and Technical Information of China (English)

    Jinghua Zhang; Xueguang Qiao; Manli Hu; Zhongyao Feng; Hong Gao; Yang Yang; Rui Zhou

    2011-01-01

    @@ The intelligent structural health monitoring method,which uses a fiber Bragg grating(FBG)sensor,is a new approach in the field of civil engineering.However,it lacks a reliable FBG-based accelerometer for taking structural low frequency vibration measurements.In this letter,a flextensional FBG-based accelerometer is proposed and demonstrated.The experimental results indicate that the natural frequency of the developed accelerometer is 16.7 Hz,with a high sensitivity of 410.7 pm/g.In addition,it has a broad and flat response over low frequencies ranging from 1 to 10 Hz.The natural frequency and sensitivity of the accelerometer can be tuned by adding mass to tailor the sensor performance to specific applications.Experimental results are presented to demonstrate the good performance of the proposed FBG-based accelerometer.These results show that the proposed accelerometer is satisfactory for low frequency vibration measurements.%The intelligent structural health monitoring method, which uses a fiber Bragg grating {FBG} sensor, ie a new approach in the field of civil engineering. However, it lacks a reliable FBG-based accelerometer for taking structural low frequency vibration measurements. In this letter, a flextensional FBG-based accelerometer is proposed and demonstrated. The experimental results indicate that the natural frequency of the developed accelerometer is 16.7 Hz, with a high sensitivity of 410.7 pm/g. In addition, it has a broad and flat response over low frequencies ranging from 1 to 10 Hz. The natural frequency and sensitivity of the accelerometer can be tuned by adding mass to tailor the sensor performance to specific applications. Experimental results are presented to demonstrate the good performance of the proposed FBG-based accelerometer. These results show that the proposed accelerometer is satisfactory for low frequency vibration measurements.

  8. Clinical effects of CG (Hythiol) tablets on leukopenia resulting from radiotherapy

    International Nuclear Information System (INIS)

    Fukui, Hideki; Sakaguchi, Kokichi; Sekiba, Kaoru

    1984-01-01

    A double-blind comparative study of CG(L-cysteine) tablets and approved drugs (CG capsules) was made to assess clinical effects of CG tablets on leukopenia. The subjects were 75 patients with cancer of the uterine cervix in whom the number of WBC was 4,500-7,500/mm before irradiation. The ratios of patients who kept WBC as 3,500/mm or more were 64.7% in the group with CG tablets and 50% in the group with CG capsules with no statistical significance. The ratios of patients who kept WBC as 3,000/mm or more were 82.4% in the group with CG tablets and 79.4% in the group with CG capsules with no statistical significance. The ratios to prevent leukopenia were 70.6% in the group with CG tablets and 58.8% in the group with CG capsules with no significant difference. Other hematological findings, subjective symptoms and the performance of radiotherapeutic protocol were not different between the groups. No marked side effects were observed. These results suggest that CG tablets, as well as CG capsules, are effective for preventing leukopenia resulting from radiotherapy. (Namekawa, K.)

  9. Estimating High-Frequency Based (Co-) Variances: A Unified Approach

    DEFF Research Database (Denmark)

    Voev, Valeri; Nolte, Ingmar

    We propose a unified framework for estimating integrated variances and covariances based on simple OLS regressions, allowing for a general market microstructure noise specification. We show that our estimators can outperform, in terms of the root mean squared error criterion, the most recent...... and commonly applied estimators, such as the realized kernels of Barndorff-Nielsen, Hansen, Lunde & Shephard (2006), the two-scales realized variance of Zhang, Mykland & Aït-Sahalia (2005), the Hayashi & Yoshida (2005) covariance estimator, and the realized variance and covariance with the optimal sampling...

  10. Frequency support capability of variable speed wind turbine based on electromagnetic coupler

    DEFF Research Database (Denmark)

    You, Rui; Barahona Garzón, Braulio; Chai, Jianyun

    2015-01-01

    In the variable speed wind turbine based on electromagnetic coupler (WT-EMC), a synchronous generator is directly coupled with grid. So like conventional power plants WT-EMC is able to support grid frequency inherently. But due to the reduced inertia of synchronous generator, its frequency support...... capability has to be enhanced. In this paper, the frequency support capability of WT-EMC is studied at three typical wind conditions and with two control strategies-droop control and inertial control to enhance its frequency support capability. The synchronous generator speed, more stable than the grid...

  11. A general theory on frequency and time-frequency analysis of irregularly sampled time series based on projection methods - Part 1: Frequency analysis

    Science.gov (United States)

    Lenoir, Guillaume; Crucifix, Michel

    2018-03-01

    We develop a general framework for the frequency analysis of irregularly sampled time series. It is based on the Lomb-Scargle periodogram, but extended to algebraic operators accounting for the presence of a polynomial trend in the model for the data, in addition to a periodic component and a background noise. Special care is devoted to the correlation between the trend and the periodic component. This new periodogram is then cast into the Welch overlapping segment averaging (WOSA) method in order to reduce its variance. We also design a test of significance for the WOSA periodogram, against the background noise. The model for the background noise is a stationary Gaussian continuous autoregressive-moving-average (CARMA) process, more general than the classical Gaussian white or red noise processes. CARMA parameters are estimated following a Bayesian framework. We provide algorithms that compute the confidence levels for the WOSA periodogram and fully take into account the uncertainty in the CARMA noise parameters. Alternatively, a theory using point estimates of CARMA parameters provides analytical confidence levels for the WOSA periodogram, which are more accurate than Markov chain Monte Carlo (MCMC) confidence levels and, below some threshold for the number of data points, less costly in computing time. We then estimate the amplitude of the periodic component with least-squares methods, and derive an approximate proportionality between the squared amplitude and the periodogram. This proportionality leads to a new extension for the periodogram: the weighted WOSA periodogram, which we recommend for most frequency analyses with irregularly sampled data. The estimated signal amplitude also permits filtering in a frequency band. Our results generalise and unify methods developed in the fields of geosciences, engineering, astronomy and astrophysics. They also constitute the starting point for an extension to the continuous wavelet transform developed in a companion

  12. Frequency band adjustment match filtering based on variable frequency GPR antennas pairing scheme for shallow subsurface investigations

    Science.gov (United States)

    Shaikh, Shahid Ali; Tian, Gang; Shi, Zhanjie; Zhao, Wenke; Junejo, S. A.

    2018-02-01

    Ground penetrating Radar (GPR) is an efficient tool for subsurface geophysical investigations, particularly at shallow depths. The non-destructiveness, cost efficiency, and data reliability are the important factors that make it an ideal tool for the shallow subsurface investigations. Present study encompasses; variations in central frequency of transmitting and receiving GPR antennas (Tx-Rx) have been analyzed and frequency band adjustment match filters are fabricated and tested accordingly. Normally, the frequency of both the antennas remains similar to each other whereas in this study we have experimentally changed the frequencies of Tx-Rx and deduce the response. Instead of normally adopted three pairs, a total of nine Tx-Rx pairs were made from 50 MHz, 100 MHz, and 200 MHz antennas. The experimental data was acquired at the designated near surface geophysics test site of the Zhejiang University, Hangzhou, China. After the impulse response analysis of acquired data through conventional as well as varied Tx-Rx pairs, different swap effects were observed. The frequency band and exploration depth are influenced by transmitting frequencies rather than the receiving frequencies. The impact of receiving frequencies was noticed on the resolution; the more noises were observed using the combination of high frequency transmitting with respect to low frequency receiving. On the basis of above said variable results we have fabricated two frequency band adjustment match filters, the constant frequency transmitting (CFT) and the variable frequency transmitting (VFT) frequency band adjustment match filters. By the principle, the lower and higher frequency components were matched and then incorporated with intermediate one. Therefore, this study reveals that a Tx-Rx combination of low frequency transmitting with high frequency receiving is a better choice. Moreover, both the filters provide better radargram than raw one, the result of VFT frequency band adjustment filter is

  13. Structural Health Monitoring Based on Combined Structural Global and Local Frequencies

    Directory of Open Access Journals (Sweden)

    Jilin Hou

    2014-01-01

    Full Text Available This paper presents a parameter estimation method for Structural Health Monitoring based on the combined measured structural global frequencies and structural local frequencies. First, the global test is experimented to obtain the low order modes which can reflect the global information of the structure. Secondly, the mass is added on the member of structure to increase the local dynamic characteristic and to make the member have local primary frequency, which belongs to structural local frequency and is sensitive to local parameters. Then the parameters of the structure can be optimized accurately using the combined structural global frequencies and structural local frequencies. The effectiveness and accuracy of the proposed method are verified by the experiment of a space truss.

  14. A New Quantum Key Distribution Scheme Based on Frequency and Time Coding

    International Nuclear Information System (INIS)

    Chang-Hua, Zhu; Chang-Xing, Pei; Dong-Xiao, Quan; Jing-Liang, Gao; Nan, Chen; Yun-Hui, Yi

    2010-01-01

    A new scheme of quantum key distribution (QKD) using frequency and time coding is proposed, in which the security is based on the frequency-time uncertainty relation. In this scheme, the binary information sequence is encoded randomly on either the central frequency or the time delay of the optical pulse at the sender. The central frequency of the single photon pulse is set as ω 1 for bit 0 and set as ω 2 for bit 1 when frequency coding is selected. However, the single photon pulse is not delayed for bit 0 and is delayed in τ for 1 when time coding is selected. At the receiver, either the frequency or the time delay of the pulse is measured randomly, and the final key is obtained after basis comparison, data reconciliation and privacy amplification. With the proposed method, the effect of the noise in the fiber channel and environment on the QKD system can be reduced effectively

  15. Micro-Doppler Signal Time-Frequency Algorithm Based on STFRFT

    Directory of Open Access Journals (Sweden)

    Cunsuo Pang

    2016-09-01

    Full Text Available This paper proposes a time-frequency algorithm based on short-time fractional order Fourier transformation (STFRFT for identification of a complicated movement targets. This algorithm, consisting of a STFRFT order-changing and quick selection method, is effective in reducing the computation load. A multi-order STFRFT time-frequency algorithm is also developed that makes use of the time-frequency feature of each micro-Doppler component signal. This algorithm improves the estimation accuracy of time-frequency curve fitting through multi-order matching. Finally, experiment data were used to demonstrate STFRFT’s performance in micro-Doppler time-frequency analysis. The results validated the higher estimate accuracy of the proposed algorithm. It may be applied to an LFM (Linear frequency modulated pulse radar, SAR (Synthetic aperture radar, or ISAR (Inverse synthetic aperture radar, for improving the probability of target recognition.

  16. Micro-Doppler Signal Time-Frequency Algorithm Based on STFRFT.

    Science.gov (United States)

    Pang, Cunsuo; Han, Yan; Hou, Huiling; Liu, Shengheng; Zhang, Nan

    2016-09-24

    This paper proposes a time-frequency algorithm based on short-time fractional order Fourier transformation (STFRFT) for identification of a complicated movement targets. This algorithm, consisting of a STFRFT order-changing and quick selection method, is effective in reducing the computation load. A multi-order STFRFT time-frequency algorithm is also developed that makes use of the time-frequency feature of each micro-Doppler component signal. This algorithm improves the estimation accuracy of time-frequency curve fitting through multi-order matching. Finally, experiment data were used to demonstrate STFRFT's performance in micro-Doppler time-frequency analysis. The results validated the higher estimate accuracy of the proposed algorithm. It may be applied to an LFM (Linear frequency modulated) pulse radar, SAR (Synthetic aperture radar), or ISAR (Inverse synthetic aperture radar), for improving the probability of target recognition.

  17. Frequency-shaped and observer-based discrete-time sliding mode control

    CERN Document Server

    Mehta, Axaykumar

    2015-01-01

    It is well established that the sliding mode control strategy provides an effective and robust method of controlling the deterministic system due to its well-known invariance property to a class of bounded disturbance and parameter variations. Advances in microcomputer technologies have made digital control increasingly popular among the researchers worldwide. And that led to the study of discrete-time sliding mode control design and its implementation. This brief presents, a method for multi-rate frequency shaped sliding mode controller design based on switching and non-switching type of reaching law. In this approach, the frequency dependent compensator dynamics are introduced through a frequency-shaped sliding surface by assigning frequency dependent weighing matrices in a linear quadratic regulator (LQR) design procedure. In this way, the undesired high frequency dynamics or certain frequency disturbance can be eliminated. The states are implicitly obtained by measuring the output at a faster rate than th...

  18. The Tracking Resonance Frequency Method for Photoacoustic Measurements Based on the Phase Response

    Science.gov (United States)

    Suchenek, Mariusz

    2017-04-01

    One of the major issues in the use of the resonant photoacoustic cell is the resonance frequency of the cell. The frequency is not stable, and its changes depend mostly on temperature and gas mixture. This paper presents a new method for tracking resonance frequency, where both the amplitude and phase are calculated from the input samples. The stimulating frequency can be adjusted to the resonance frequency of the cell based on the phase. This method was implemented using a digital measurement system with an analog to digital converter, field programmable gate array (FPGA) and a microcontroller. The resonance frequency was changed by the injection of carbon dioxide into the cell. A theoretical description and experimental results are also presented.

  19. Passive high-frequency devices based on superlattice ferromagnetic nanowires

    International Nuclear Information System (INIS)

    Ye, B.; Li, F.; Cimpoesu, D.; Wiley, J.B.; Jung, J.-S.; Stancu, A.; Spinu, L.

    2007-01-01

    In this paper we propose to tailor the bandwidth of a microwave filter by exploitation of shape anisotropy of nanowires. In order to achieve this control of shape anisotropy, we considered superlattice wires containing varying-sized ferromagnetic regions separated by nonferromagnetic regions. Superlattice wires of Ni and Au with a nominal diameter of 200 nm were grown using standard electrodeposition techniques. The microwave properties were probed using X-band (9.8 GHz) ferromagnetic resonance (FMR) experiments performed at room temperature. In order to investigate the effectiveness of the shape anisotropy on the superlattice nanowire based filter the FMR spectrum of superlattice structure is compared to the FMR spectra of nanowires samples with constant length

  20. Metasurface-based anti-reflection coatings at optical frequencies

    Science.gov (United States)

    Monti, Alessio; Alù, Andrea; Toscano, Alessandro; Bilotti, Filiberto

    2018-05-01

    In this manuscript, we propose a metasurface approach for the reduction of electromagnetic reflection from an arbitrary air‑dielectric interface. The proposed technique exploits the exotic optical response of plasmonic nanoparticles to achieve complete cancellation of the field reflected by a dielectric substrate by means of destructive interference. Differently from other, earlier anti-reflection approaches based on nanoparticles, our design scheme is supported by a simple transmission-line formulation that allows a closed-form characterization of the anti-reflection performance of a nanoparticle array. Furthermore, since the working principle of the proposed devices relies on an average effect that does not critically depend on the array geometry, our approach enables low-cost production and easy scalability to large sizes. Our theoretical considerations are supported by full-wave simulations confirming the effectiveness of this design principle.

  1. Ten tandem repeats of β-hCG 109-118 enhance immunogenicity and anti-tumor effects of β-hCG C-terminal peptide carried by mycobacterial heat-shock protein HSP65

    International Nuclear Information System (INIS)

    Zhang Yankai; Yan Rong; He Yi; Liu Wentao; Cao Rongyue; Yan Ming; Li Taiming; Liu Jingjing; Wu Jie

    2006-01-01

    The β-subunit of human chorionic gonadotropin (β-hCG) is secreted by many kinds of tumors and it has been used as an ideal target antigen to develop vaccines against tumors. In view of the low immunogenicity of this self-peptide,we designed a method based on isocaudamer technique to repeat tandemly the 10-residue sequence X of β-hCG (109-118), then 10 tandemly repeated copies of the 10-residue sequence combined with β-hCG C-terminal 37 peptides were fused to mycobacterial heat-shock protein 65 to construct a fusion protein HSP65-X10-βhCGCTP37 as an immunogen. In this study, we examined the effect of the tandem repeats of this 10-residue sequence in eliciting an immune by comparing the immunogenicity and anti-tumor effects of the two immunogens, HSP65-X10-βhCGCTP37 and HSP65-βhCGCTP37 (without the 10 tandem repeats). Immunization of mice with the fusion protein HSP65-X10-βhCGCTP37 elicited much higher levels of specific anti-β-hCG antibodies and more effectively inhibited the growth of Lewis lung carcinoma (LLC) in vivo than with HSP65-βhCGCTP37, which should suggest that HSP65-X10-βhCGCTP37 may be an effective protein vaccine for the treatment of β-hCG-dependent tumors and multiple tandem repeats of a certain epitope are an efficient method to overcome the low immunogenicity of self-peptide antigens

  2. Dynamic GnRH and hCG testing

    DEFF Research Database (Denmark)

    Bang, A. Kirstine; Nordkap, Loa; Almstrup, Kristian

    2017-01-01

    OBJECTIVE: Gonadotropin-releasing hormone (GnRH) and human chorionic gonadotropin (hCG) stimulation tests may be used to evaluate the pituitary and testicular capacity. Our aim was to evaluate changes in follicular-stimulating hormone (FSH), luteinizing hormone (LH) and testosterone after Gn...... influence of the tests was illustrated by results from 45 patients suspected of disordered hypothalamic-pituitary-gonadal axis. METHODS: Baseline, stimulated, relative and absolute changes in serum FSH and LH were determined by ultrasensitive TRIFMA, and testosterone was determined by LC-MS/MS. RESULTS......: For the reference group, LH and FSH increased almost 400% and 40% during GnRH testing, stimulated levels varied from 4.4 to 58.8 U/L and 0.2 to 11.8 U/L and FSH decreased in nine men. Testosterone increased approximately 110% (range: 18.7-67.6 nmol/L) during hCG testing. None of the polymorphisms had any major...

  3. Population based allele frequencies of disease associated polymorphisms in the Personalized Medicine Research Project.

    Science.gov (United States)

    Cross, Deanna S; Ivacic, Lynn C; Stefanski, Elisha L; McCarty, Catherine A

    2010-06-17

    There is a lack of knowledge regarding the frequency of disease associated polymorphisms in populations and population attributable risk for many populations remains unknown. Factors that could affect the association of the allele with disease, either positively or negatively, such as race, ethnicity, and gender, may not be possible to determine without population based allele frequencies.Here we used a panel of 51 polymorphisms previously associated with at least one disease and determined the allele frequencies within the entire Personalized Medicine Research Project population based cohort. We compared these allele frequencies to those in dbSNP and other data sources stratified by race. Differences in allele frequencies between self reported race, region of origin, and sex were determined. There were 19544 individuals who self reported a single racial category, 19027 or (97.4%) self reported white Caucasian, and 11205 (57.3%) individuals were female. Of the 11,208 (57%) individuals with an identifiable region of origin 8337 or (74.4%) were German.41 polymorphisms were significantly different between self reported race at the 0.05 level. Stratification of our Caucasian population by self reported region of origin revealed 19 polymorphisms that were significantly different (p = 0.05) between individuals of different origins. Further stratification of the population by gender revealed few significant differences in allele frequencies between the genders. This represents one of the largest population based allele frequency studies to date. Stratification by self reported race and region of origin revealed wide differences in allele frequencies not only by race but also by region of origin within a single racial group. We report allele frequencies for our Asian/Hmong and American Indian populations; these two minority groups are not typically selected for population allele frequency detection. Population wide allele frequencies are important for the design and

  4. Frequency Control in Autanamous Microgrid in the Presence of DFIG based Wind Turbine

    Directory of Open Access Journals (Sweden)

    Ghazanfar Shahgholian

    2015-10-01

    Full Text Available Despite their ever-increasing power injection into power grid, wind turbines play no role in frequency control. On the other hand, power network frequency is mainly adjusted by conventional power plants. DFIG-based wind turbines not only are able to produce power in various mechanical speeds, but they can also reduce speed instantaneously which, in turn, leads to mechanical energy release. Thus, they can aid conventional units in system frequency control. In this paper, the effect of wind energy conversion systems, especially variable speed DFIG-based wind turbines, in controlling and tuning of frequency is investigated when different penetration coefficients are considered in a isolated microgrid comprising of conventional thermal and non-thermal generating unit. To do this, optimal tuning of DFIG's speed controller is performed in different penetration levels using particle swarm optimization (PSO technique. In addition, optimum penetration of wind energy conversion system is studied considering frequency change parameters in a microgrid.

  5. Exposure estimates based on broadband elf magnetic field measurements versus the ICNIRP multiple frequency rule

    International Nuclear Information System (INIS)

    Paniagua, Jesus M.; Rufo, Montana; Jimenez, Antonio; Pachon, Fernando T.; Carrero, Julian

    2015-01-01

    The evaluation of exposure to extremely low-frequency (ELF) magnetic fields using broadband measurement techniques gives satisfactory results when the field has essentially a single frequency. Nevertheless, magnetic fields are in most cases distorted by harmonic components. This work analyses the harmonic components of the ELF magnetic field in an outdoor urban context and compares the evaluation of the exposure based on broadband measurements with that based on spectral analysis. The multiple frequency rule of the International Commission on Non-ionizing Radiation Protection (ICNIRP) regulatory guidelines was applied. With the 1998 ICNIRP guideline, harmonics dominated the exposure with a 55 % contribution. With the 2010 ICNIRP guideline, however, the primary frequency dominated the exposure with a 78 % contribution. Values of the exposure based on spectral analysis were significantly higher than those based on broadband measurements. Hence, it is clearly necessary to determine the harmonic components of the ELF magnetic field to assess exposure in urban contexts. (authors)

  6. GaN-based High Power High Frequency Wide Range LLC Resonant Converter, Phase I

    Data.gov (United States)

    National Aeronautics and Space Administration — SET Group will design, build and demonstrate a Gallium Nitride (GaN) based High Power High Frequency Wide Range LLC Resonant Converter capable of handling high power...

  7. cgDNA: a software package for the prediction of sequence-dependent coarse-grain free energies of B-form DNA.

    Science.gov (United States)

    Petkevičiūtė, D; Pasi, M; Gonzalez, O; Maddocks, J H

    2014-11-10

    cgDNA is a package for the prediction of sequence-dependent configuration-space free energies for B-form DNA at the coarse-grain level of rigid bases. For a fragment of any given length and sequence, cgDNA calculates the configuration of the associated free energy minimizer, i.e. the relative positions and orientations of each base, along with a stiffness matrix, which together govern differences in free energies. The model predicts non-local (i.e. beyond base-pair step) sequence dependence of the free energy minimizer. Configurations can be input or output in either the Curves+ definition of the usual helical DNA structural variables, or as a PDB file of coordinates of base atoms. We illustrate the cgDNA package by comparing predictions of free energy minimizers from (a) the cgDNA model, (b) time-averaged atomistic molecular dynamics (or MD) simulations, and (c) NMR or X-ray experimental observation, for (i) the Dickerson-Drew dodecamer and (ii) three oligomers containing A-tracts. The cgDNA predictions are rather close to those of the MD simulations, but many orders of magnitude faster to compute. Both the cgDNA and MD predictions are in reasonable agreement with the available experimental data. Our conclusion is that cgDNA can serve as a highly efficient tool for studying structural variations in B-form DNA over a wide range of sequences. © The Author(s) 2014. Published by Oxford University Press on behalf of Nucleic Acids Research.

  8. Time-Frequency Distribution of Music based on Sparse Wavelet Packet Representations

    DEFF Research Database (Denmark)

    Endelt, Line Ørtoft

    We introduce a new method for generating time-frequency distributions, which is particularly useful for the analysis of music signals. The method presented here is based on $\\ell1$ sparse representations of music signals in a redundant wavelet packet dictionary. The representations are found using...... the minimization methods basis pursuit and best orthogonal basis. Visualizations of the time-frequency distribution are constructed based on a simplified energy distribution in the wavelet packet decomposition. The time-frequency distributions emphasizes structured musical content, including non-stationary content...

  9. High-resolution mid-IR spectrometer based on frequency upconversion

    DEFF Research Database (Denmark)

    Hu, Qi; Dam, Jeppe Seidelin; Pedersen, Christian

    2012-01-01

    We demonstrate a novel approach for high-resolution spectroscopy based on frequency upconversion and postfiltering by means of a scanning Fabryx2013;Perot interferometer. The system is based on sum-frequency mixing, shifting the spectral content from the mid-infrared to the near-visible region al......-frequency 1064xA0;nm laser. We investigate water vapor emission lines from a butane burner and compare the measured results to model data. The presented method we suggest to be used for real-time monitoring of specific gas lines and reference signals....

  10. A new frequency matching technique for FRF-based model updating

    Science.gov (United States)

    Yang, Xiuming; Guo, Xinglin; Ouyang, Huajiang; Li, Dongsheng

    2017-05-01

    Frequency Response Function (FRF) residues have been widely used to update Finite Element models. They are a kind of original measurement information and have the advantages of rich data and no extraction errors, etc. However, like other sensitivity-based methods, an FRF-based identification method also needs to face the ill-conditioning problem which is even more serious since the sensitivity of the FRF in the vicinity of a resonance is much greater than elsewhere. Furthermore, for a given frequency measurement, directly using a theoretical FRF at a frequency may lead to a huge difference between the theoretical FRF and the corresponding experimental FRF which finally results in larger effects of measurement errors and damping. Hence in the solution process, correct selection of the appropriate frequency to get the theoretical FRF in every iteration in the sensitivity-based approach is an effective way to improve the robustness of an FRF-based algorithm. A primary tool for right frequency selection based on the correlation of FRFs is the Frequency Domain Assurance Criterion. This paper presents a new frequency selection method which directly finds the frequency that minimizes the difference of the order of magnitude between the theoretical and experimental FRFs. A simulated truss structure is used to compare the performance of different frequency selection methods. For the sake of reality, it is assumed that not all the degrees of freedom (DoFs) are available for measurement. The minimum number of DoFs required in each approach to correctly update the analytical model is regarded as the right identification standard.

  11. A general theory on frequency and time-frequency analysis of irregularly sampled time series based on projection methods - Part 2: Extension to time-frequency analysis

    Science.gov (United States)

    Lenoir, Guillaume; Crucifix, Michel

    2018-03-01

    Geophysical time series are sometimes sampled irregularly along the time axis. The situation is particularly frequent in palaeoclimatology. Yet, there is so far no general framework for handling the continuous wavelet transform when the time sampling is irregular. Here we provide such a framework. To this end, we define the scalogram as the continuous-wavelet-transform equivalent of the extended Lomb-Scargle periodogram defined in Part 1 of this study (Lenoir and Crucifix, 2018). The signal being analysed is modelled as the sum of a locally periodic component in the time-frequency plane, a polynomial trend, and a background noise. The mother wavelet adopted here is the Morlet wavelet classically used in geophysical applications. The background noise model is a stationary Gaussian continuous autoregressive-moving-average (CARMA) process, which is more general than the traditional Gaussian white and red noise processes. The scalogram is smoothed by averaging over neighbouring times in order to reduce its variance. The Shannon-Nyquist exclusion zone is however defined as the area corrupted by local aliasing issues. The local amplitude in the time-frequency plane is then estimated with least-squares methods. We also derive an approximate formula linking the squared amplitude and the scalogram. Based on this property, we define a new analysis tool: the weighted smoothed scalogram, which we recommend for most analyses. The estimated signal amplitude also gives access to band and ridge filtering. Finally, we design a test of significance for the weighted smoothed scalogram against the stationary Gaussian CARMA background noise, and provide algorithms for computing confidence levels, either analytically or with Monte Carlo Markov chain methods. All the analysis tools presented in this article are available to the reader in the Python package WAVEPAL.

  12. Ancillary Frequency Control of Direct Drive Full-Scale Converter Based Wind Power Plants

    DEFF Research Database (Denmark)

    Hu, Weihao; Su, Chi; Fang, Jiakun

    2013-01-01

    This paper presents a simulation model of a wind power plant based on a MW-level variable speed wind turbine with a full-scale back-to-back power converter developed in the simulation tool of DIgSILENT Power Factory. Three different kinds of ancillary frequency control strategies, namely inertia...... control strategies are effective means for providing ancillary frequency control of variable speed wind turbines with full-scale back-to-back power converters....... emulation, primary frequency control and secondary frequency control, are proposed in order to improve the frequency stability of power systems. The modified IEEE 39-bus test system with a large-scale wind power penetration is chosen as the studied power system. Simulation results show that the proposed...

  13. EEMD-MUSIC-Based Analysis for Natural Frequencies Identification of Structures Using Artificial and Natural Excitations

    Directory of Open Access Journals (Sweden)

    David Camarena-Martinez

    2014-01-01

    Full Text Available This paper presents a new EEMD-MUSIC- (ensemble empirical mode decomposition-multiple signal classification- based methodology to identify modal frequencies in structures ranging from free and ambient vibration signals produced by artificial and natural excitations and also considering several factors as nonstationary effects, close modal frequencies, and noisy environments, which are common situations where several techniques reported in literature fail. The EEMD and MUSIC methods are used to decompose the vibration signal into a set of IMFs (intrinsic mode functions and to identify the natural frequencies of a structure, respectively. The effectiveness of the proposed methodology has been validated and tested with synthetic signals and under real operating conditions. The experiments are focused on extracting the natural frequencies of a truss-type scaled structure and of a bridge used for both highway traffic and pedestrians. Results show the proposed methodology as a suitable solution for natural frequencies identification of structures from free and ambient vibration signals.

  14. Frequency domain indirect identification of AMB rotor systems based on fictitious proportional feedback gain

    Energy Technology Data Exchange (ETDEWEB)

    Ahn, Hyeong Joon [Dept. of Mechanical Engineering, Soongsil University, Seoul (Korea, Republic of); Kim, Chan Jung [Dept. of Mechanical Design Engineering, Pukyong National University, Busan(Korea, Republic of)

    2016-12-15

    It is very difficult to directly identify an unstable system with uncertain dynamics from frequency domain input-output data. Hence, in these cases, closed-loop frequency responses calculated using a fictitious feedback could be more identifiable than open-loop data. This paper presents a frequency domain indirect identification of AMB rotor systems based on a Fictitious proportional feedback gain (FPFG). The closed-loop effect due to the FPFG can enhance the detectability of the system by moving the system poles, and significantly weigh the target mode in the frequency domain. The effectiveness of the proposed identification method was verified through the frequency domain identification of active magnetic bearing rotor systems.

  15. Dissemination of optical-comb-based ultra-broadband frequency reference through a fiber network.

    Science.gov (United States)

    Nagano, Shigeo; Kumagai, Motohiro; Li, Ying; Ido, Tetsuya; Ishii, Shoken; Mizutani, Kohei; Aoki, Makoto; Otsuka, Ryohei; Hanado, Yuko

    2016-08-22

    We disseminated an ultra-broadband optical frequency reference based on a femtosecond (fs)-laser optical comb through a kilometer-scale fiber link. Its spectrum ranged from 1160 nm to 2180 nm without additional fs-laser combs at the end of the link. By employing a fiber-induced phase noise cancellation technique, the linewidth and fractional frequency instability attained for all disseminated comb modes were of order 1 Hz and 10-18 in a 5000 s averaging time. The ultra-broad optical frequency reference, for which absolute frequency is traceable to Japan Standard Time, was applied in the frequency stabilization of an injection-seeded Q-switched 2051 nm pulse laser for a coherent light detection and ranging LIDAR system.

  16. An automatic method to determine cutoff frequency based on image power spectrum

    International Nuclear Information System (INIS)

    Beis, J.S.; Vancouver Hospital and Health Sciences Center, British Columbia; Celler, A.; Barney, J.S.

    1995-01-01

    The authors present an algorithm for automatically choosing filter cutoff frequency (F c ) using the power spectrum of the projections. The method is based on the assumption that the expectation of the image power spectrum is the sum of the expectation of the blurred object power spectrum (dominant at low frequencies) plus a constant value due to Poisson noise. By considering the discrete components of the noise-dominated high-frequency spectrum as a Gaussian distribution N(μ,σ), the Student t-test determines F c as the highest frequency for which the image frequency components are unlikely to be drawn from N (μ,σ). The method is general and can be applied to any filter. In this work, the authors tested the approach using the Metz restoration filter on simulated, phantom, and patient data with good results. Quantitative performance of the technique was evaluated by plotting recovery coefficient (RC) versus NMSE of reconstructed images

  17. EEMD-MUSIC-Based Analysis for Natural Frequencies Identification of Structures Using Artificial and Natural Excitations

    Science.gov (United States)

    Amezquita-Sanchez, Juan P.; Romero-Troncoso, Rene J.; Osornio-Rios, Roque A.; Garcia-Perez, Arturo

    2014-01-01

    This paper presents a new EEMD-MUSIC- (ensemble empirical mode decomposition-multiple signal classification-) based methodology to identify modal frequencies in structures ranging from free and ambient vibration signals produced by artificial and natural excitations and also considering several factors as nonstationary effects, close modal frequencies, and noisy environments, which are common situations where several techniques reported in literature fail. The EEMD and MUSIC methods are used to decompose the vibration signal into a set of IMFs (intrinsic mode functions) and to identify the natural frequencies of a structure, respectively. The effectiveness of the proposed methodology has been validated and tested with synthetic signals and under real operating conditions. The experiments are focused on extracting the natural frequencies of a truss-type scaled structure and of a bridge used for both highway traffic and pedestrians. Results show the proposed methodology as a suitable solution for natural frequencies identification of structures from free and ambient vibration signals. PMID:24683346

  18. A stabilized optical frequency comb based on an Er-doped fiber femtosecond laser

    Science.gov (United States)

    Xia, Chuanqing; Wu, Tengfei; Zhao, Chunbo; Xing, Shuai

    2018-03-01

    An optical frequency comb based on a 250 MHz home-made Er-doped fiber femtosecond laser is presented in this paper. The Er-doped fiber laser has a ring cavity and operates mode-locked in femtosecond regime with the technique of nonlinear polarization rotation. The pulse duration is 118 fs and the spectral width is 30 nm. A part of the femtosecond laser is amplified in Er-doped fiber amplifier before propagating through a piece of highly nonlinear fiber for expanding the spectrum. The carrier-envelope offset frequency of the comb which has a signal-to-noise ratio more than 35 dB is extracted by means of f-2f beating. It demonstrates that both carrier-envelope offset frequency and repetition frequency keep phase locked to a Rubidium atomic clock simultaneously for 2 hours. The frequency stabilized fiber combs will be increasingly applied in optical metrology, attosecond pulse generation, and absolute distance measurement.

  19. Dual-wavelength green laser with a 4.5 THz frequency difference based on self-frequency- doubling in Nd3+ -doped aperiodically poled lithium niobate.

    Science.gov (United States)

    Maestre, H; Torregrosa, A J; Fernández-Pousa, C R; Rico, M L; Capmany, J

    2008-05-01

    We report a dual-wavelength continuous-wave laser at 542.4 and 546.8 nm based on an Nd(3+)-doped aperiodically poled lithium niobate crystal. Two fundamental infrared (IR) wavelengths at 1084.8 and 1093.6 nm are simultaneously oscillated and self-frequency-doubled to green. The aperiodic domain distribution patterned in the crystal allows for quasi-phase matched self-frequency-doubling of both IR fundamentals while avoiding their sum-frequency mixing.

  20. Analyzing mobile WiMAX base station deployment under different frequency planning strategies

    Science.gov (United States)

    Salman, M. K.; Ahmad, R. B.; Ali, Ziad G.; Aldhaibani, Jaafar A.; Fayadh, Rashid A.

    2015-05-01

    The frequency spectrum is a precious resource and scarce in the communication markets. Therefore, different techniques are adopted to utilize the available spectrum in deploying WiMAX base stations (BS) in cellular networks. In this paper several types of frequency planning techniques are illustrated, and a comprehensive comparative study between conventional frequency reuse of 1 (FR of 1) and fractional frequency reuse (FFR) is presented. These techniques are widely used in network deployment, because they employ universal frequency (using all the available bandwidth) in their base station installation/configuration within network system. This paper presents a network model of 19 base stations in order to be employed in the comparison of the aforesaid frequency planning techniques. Users are randomly distributed within base stations, users' resource mapping and their burst profile selection are based on the measured signal to interference plus-noise ratio (SINR). Simulation results reveal that the FFR has advantages over the conventional FR of 1 in various metrics. 98 % of downlink resources (slots) are exploited when FFR is applied, whilst it is 81 % at FR of 1. Data rate of FFR has been increased to 10.6 Mbps, while it is 7.98 Mbps at FR of 1. The spectral efficiency is better enhanced (1.072 bps/Hz) at FR of 1 than FFR (0.808 bps/Hz), since FR of 1 exploits all the Bandwidth. The subcarrier efficiency shows how many data bits that can be carried by subcarriers under different frequency planning techniques, the system can carry more data bits under FFR (2.40 bit/subcarrier) than FR of 1 (1.998 bit/subcarrier). This study confirms that FFR can perform better than conventional frequency planning (FR of 1) which made it a strong candidate for WiMAX BS deployment in cellular networks.

  1. Simulation of stress-modulated magnetization precession frequency in Heusler-based spin torque oscillator

    International Nuclear Information System (INIS)

    Huang, Houbing; Zhao, Congpeng; Ma, Xingqiao

    2017-01-01

    We investigated stress-modulated magnetization precession frequency in Heusler-based spin transfer torque oscillator by combining micromagnetic simulations with phase field microelasticity theory, by encapsulating the magnetic tunnel junction into multilayers structures. We proposed a novel method of using an external stress to control the magnetization precession in spin torque oscillator instead of an external magnetic field. The stress-modulated magnetization precession frequency can be linearly modulated by externally applied uniaxial in-plane stress, with a tunable range 4.4–7.0 GHz under the stress of 10 MPa. By comparison, the out-of-plane stress imposes negligible influence on the precession frequency due to the large out-of-plane demagnetization field. The results offer new inspiration to the design of spin torque oscillator devices that simultaneously process high frequency, narrow output band, and tunable over a wide range of frequencies via external stress. - Highlights: • We proposed stress-modulated magnetization precession in spin torque oscillator. • The magnetization precession frequency can be linearly modulated by in-plane stress. • The stress also can widen the magnetization frequency range 4.4–7.0 GHz. • The stress-modulated oscillation frequency can simplify STO devices.

  2. A digital frequency stabilization system of external cavity diode laser based on LabVIEW FPGA

    Science.gov (United States)

    Liu, Zhuohuan; Hu, Zhaohui; Qi, Lu; Wang, Tao

    2015-10-01

    Frequency stabilization for external cavity diode laser has played an important role in physics research. Many laser frequency locking solutions have been proposed by researchers. Traditionally, the locking process was accomplished by analog system, which has fast feedback control response speed. However, analog system is susceptible to the effects of environment. In order to improve the automation level and reliability of the frequency stabilization system, we take a grating-feedback external cavity diode laser as the laser source and set up a digital frequency stabilization system based on National Instrument's FPGA (NI FPGA). The system consists of a saturated absorption frequency stabilization of beam path, a differential photoelectric detector, a NI FPGA board and a host computer. Many functions, such as piezoelectric transducer (PZT) sweeping, atomic saturation absorption signal acquisition, signal peak identification, error signal obtaining and laser PZT voltage feedback controlling, are totally completed by LabVIEW FPGA program. Compared with the analog system, the system built by the logic gate circuits, performs stable and reliable. User interface programmed by LabVIEW is friendly. Besides, benefited from the characteristics of reconfiguration, the LabVIEW program is good at transplanting in other NI FPGA boards. Most of all, the system periodically checks the error signal. Once the abnormal error signal is detected, FPGA will restart frequency stabilization process without manual control. Through detecting the fluctuation of error signal of the atomic saturation absorption spectrum line in the frequency locking state, we can infer that the laser frequency stability can reach 1MHz.

  3. Simulation of stress-modulated magnetization precession frequency in Heusler-based spin torque oscillator

    Energy Technology Data Exchange (ETDEWEB)

    Huang, Houbing, E-mail: hbhuang@ustb.edu.cn; Zhao, Congpeng; Ma, Xingqiao, E-mail: xqma@sas.ustb.edu.cn

    2017-03-15

    We investigated stress-modulated magnetization precession frequency in Heusler-based spin transfer torque oscillator by combining micromagnetic simulations with phase field microelasticity theory, by encapsulating the magnetic tunnel junction into multilayers structures. We proposed a novel method of using an external stress to control the magnetization precession in spin torque oscillator instead of an external magnetic field. The stress-modulated magnetization precession frequency can be linearly modulated by externally applied uniaxial in-plane stress, with a tunable range 4.4–7.0 GHz under the stress of 10 MPa. By comparison, the out-of-plane stress imposes negligible influence on the precession frequency due to the large out-of-plane demagnetization field. The results offer new inspiration to the design of spin torque oscillator devices that simultaneously process high frequency, narrow output band, and tunable over a wide range of frequencies via external stress. - Highlights: • We proposed stress-modulated magnetization precession in spin torque oscillator. • The magnetization precession frequency can be linearly modulated by in-plane stress. • The stress also can widen the magnetization frequency range 4.4–7.0 GHz. • The stress-modulated oscillation frequency can simplify STO devices.

  4. Changes in Alpha Frequency and Power of the Electroencephalogram during Volatile-Based General Anesthesia

    Directory of Open Access Journals (Sweden)

    Darren Hight

    2017-05-01

    Full Text Available Oscillations in the electroencephalogram (EEG at the alpha frequency (8–12 Hz are thought to be ubiquitous during surgical anesthesia, but the details of how this oscillation responds to ongoing changes in volatile anesthetic concentration have not been well characterized. It is not known how often alpha oscillations are absent in the clinical context, how sensitively alpha frequency and power respond to changes in anesthetic concentration, and what effect increased age has on alpha frequency. Bipolar EEG was recorded frontally from 305 patients undergoing surgery with sevoflurane or desflurane providing general anesthesia. A new method of detecting the presence of alpha oscillations based on the stability of the rate of change of the peak frequency in the alpha range was developed. Linear concentration-response curves were fitted to assess the sensitivity of alpha power and frequency measures to changing levels of anesthesia. Alpha oscillations were seen to be inexplicably absent in around 4% of patients. Maximal alpha power increased with increasing volatile anesthetic concentrations in half of the patients, and decreased in the remaining patients. Alpha frequency decreased with increasing anesthetic concentrations in near to 90% of patients. Increasing age was associated with decreased sensitivity to volatile anesthesia concentrations, and with decreased alpha frequency, which sometimes transitioned into the theta range (5–7 Hz. While peak alpha frequency shows a consistent slowing to increasing volatile concentrations, the peak power of the oscillation does not, suggesting that frequency might be more informative of depth of anesthesia than traditional power based measures during volatile-based anesthesia. The alpha oscillation becomes slower with increasing age, even when the decreased anesthetic needs of older patients were taken into account.

  5. Visualization of frequency-modulated electric field based on photonic frequency tracking in asynchronous electro-optic measurement system

    Science.gov (United States)

    Hisatake, Shintaro; Yamaguchi, Koki; Uchida, Hirohisa; Tojyo, Makoto; Oikawa, Yoichi; Miyaji, Kunio; Nagatsuma, Tadao

    2018-04-01

    We propose a new asynchronous measurement system to visualize the amplitude and phase distribution of a frequency-modulated electromagnetic wave. The system consists of three parts: a nonpolarimetric electro-optic frequency down-conversion part, a phase-noise-canceling part, and a frequency-tracking part. The photonic local oscillator signal generated by electro-optic phase modulation is controlled to track the frequency of the radio frequency (RF) signal to significantly enhance the measurable RF bandwidth. We demonstrate amplitude and phase measurement of a quasi-millimeter-wave frequency-modulated continuous-wave signal (24 GHz ± 80 MHz with a 2.5 ms period) as a proof-of-concept experiment.

  6. Reference Beam Pattern Design for Frequency Invariant Beamforming Based on Fast Fourier Transform

    Directory of Open Access Journals (Sweden)

    Wang Zhang

    2016-09-01

    Full Text Available In the field of fast Fourier transform (FFT-based frequency invariant beamforming (FIB, there is still an unsolved problem. That is the selection of the reference beam to make the designed wideband pattern frequency invariant (FI over a given frequency range. This problem is studied in this paper. The research shows that for a given array, the selection of the reference beam pattern is determined by the number of sensors and the ratio of the highest frequency to the lowest frequency of the signal (RHL. The length of the weight vector corresponding to a given reference beam pattern depends on the reference frequency. In addition, the upper bound of the weight length to ensure the FI property over the whole frequency band of interest is also given. When the constraints are added to the reference beam, it does not affect the FI property of the designed wideband beam as long as the symmetry of the reference beam is ensured. Based on this conclusion, a scheme for reference beam design is proposed.

  7. The low frequency 2D vibration sensor based on flat coil element

    Energy Technology Data Exchange (ETDEWEB)

    Djamal, Mitra; Sanjaya, Edi; Islahudin; Ramli [Department of Physics, Institut Teknologi Bandung, Jl. Ganesa 10 Bandung 40116 (Indonesia); Department of Physics, Institut Teknologi Bandung, Jl. Ganesa 10 Bandung 40116 (Indonesia) and Department of Physics, UIN Syarif Hidayatullah, Jl. Ir.H. Djuanda 95 Ciputat 15412 (Indonesia); MTs NW Nurul Iman Kembang Kerang, Jl. Raya Mataram - Lb.Lombok, NTB (Indonesia); Department of Physics, Institut Teknologi Bandung, Jl. Ganesa 10 Bandung 40116 (Indonesia) and Department of Physics,Universitas Negeri Padang, Jl. Prof. Hamka, Padang 25132 (Indonesia)

    2012-06-20

    Vibration like an earthquake is a phenomenon of physics. The characteristics of these vibrations can be used as an early warning system so as to reduce the loss or damage caused by earthquakes. In this paper, we introduced a new type of low frequency 2D vibration sensor based on flat coil element that we have developed. Its working principle is based on position change of a seismic mass that put in front of a flat coil element. The flat coil is a part of a LC oscillator; therefore, the change of seismic mass position will change its resonance frequency. The results of measurements of low frequency vibration sensor in the direction of the x axis and y axis gives the frequency range between 0.2 to 1.0 Hz.

  8. Under-Frequency Load Shedding Technique Considering Event-Based for an Islanded Distribution Network

    Directory of Open Access Journals (Sweden)

    Hasmaini Mohamad

    2016-06-01

    Full Text Available One of the biggest challenge for an islanding operation is to sustain the frequency stability. A large power imbalance following islanding would cause under-frequency, hence an appropriate control is required to shed certain amount of load. The main objective of this research is to develop an adaptive under-frequency load shedding (UFLS technique for an islanding system. The technique is designed considering an event-based which includes the moment system is islanded and a tripping of any DG unit during islanding operation. A disturbance magnitude is calculated to determine the amount of load to be shed. The technique is modeled by using PSCAD simulation tool. A simulation studies on a distribution network with mini hydro generation is carried out to evaluate the UFLS model. It is performed under different load condition: peak and base load. Results show that the load shedding technique have successfully shed certain amount of load and stabilized the system frequency.

  9. A time and frequency synchronization method for CO-OFDM based on CMA equalizers

    Science.gov (United States)

    Ren, Kaixuan; Li, Xiang; Huang, Tianye; Cheng, Zhuo; Chen, Bingwei; Wu, Xu; Fu, Songnian; Ping, Perry Shum

    2018-06-01

    In this paper, an efficient time and frequency synchronization method based on a new training symbol structure is proposed for polarization division multiplexing (PDM) coherent optical orthogonal frequency division multiplexing (CO-OFDM) systems. The coarse timing synchronization is achieved by exploiting the correlation property of the first training symbol, and the fine timing synchronization is accomplished by using the time-domain symmetric conjugate of the second training symbol. Furthermore, based on these training symbols, a constant modulus algorithm (CMA) is proposed for carrier frequency offset (CFO) estimation. Theoretical analysis and simulation results indicate that the algorithm has the advantages of robustness to poor optical signal-to-noise ratio (OSNR) and chromatic dispersion (CD). The frequency offset estimation range can achieve [ -Nsc/2 ΔfN , + Nsc/2 ΔfN ] GHz with the mean normalized estimation error below 12 × 10-3 even under the condition of OSNR as low as 10 dB.

  10. Frequency hopping signal detection based on wavelet decomposition and Hilbert-Huang transform

    Science.gov (United States)

    Zheng, Yang; Chen, Xihao; Zhu, Rui

    2017-07-01

    Frequency hopping (FH) signal is widely adopted by military communications as a kind of low probability interception signal. Therefore, it is very important to research the FH signal detection algorithm. The existing detection algorithm of FH signals based on the time-frequency analysis cannot satisfy the time and frequency resolution requirement at the same time due to the influence of window function. In order to solve this problem, an algorithm based on wavelet decomposition and Hilbert-Huang transform (HHT) was proposed. The proposed algorithm removes the noise of the received signals by wavelet decomposition and detects the FH signals by Hilbert-Huang transform. Simulation results show the proposed algorithm takes into account both the time resolution and the frequency resolution. Correspondingly, the accuracy of FH signals detection can be improved.

  11. Application of energies of optimal frequency bands for fault diagnosis based on modified distance function

    Energy Technology Data Exchange (ETDEWEB)

    Zamanian, Amir Hosein [Southern Methodist University, Dallas (United States); Ohadi, Abdolreza [Amirkabir University of Technology (Tehran Polytechnic), Tehran (Iran, Islamic Republic of)

    2017-06-15

    Low-dimensional relevant feature sets are ideal to avoid extra data mining for classification. The current work investigates the feasibility of utilizing energies of vibration signals in optimal frequency bands as features for machine fault diagnosis application. Energies in different frequency bands were derived based on Parseval's theorem. The optimal feature sets were extracted by optimization of the related frequency bands using genetic algorithm and a Modified distance function (MDF). The frequency bands and the number of bands were optimized based on the MDF. The MDF is designed to a) maximize the distance between centers of classes, b) minimize the dispersion of features in each class separately, and c) minimize dimension of extracted feature sets. The experimental signals in two different gearboxes were used to demonstrate the efficiency of the presented technique. The results show the effectiveness of the presented technique in gear fault diagnosis application.

  12. Research of hydroelectric generating set low-frequency vibration monitoring system based on optical fiber sensing

    Science.gov (United States)

    Min, Li; Zhang, Xiaolei; Zhang, Faxiang; Sun, Zhihui; Li, ShuJuan; Wang, Meng; Wang, Chang

    2017-10-01

    In order to satisfy hydroelectric generating set low-frequency vibration monitoring, the design of Passive low-frequency vibration monitoring system based on Optical fiber sensing in this paper. The hardware of the system adopts the passive optical fiber grating sensor and unbalanced-Michelson interferometer. The software system is used to programming by Labview software and finishing the control of system. The experiment show that this system has good performance on the standard vibration testing-platform and it meets system requirements. The frequency of the monitoring system can be as low as 0.2Hz and the resolution is 0.01Hz.

  13. Econometric analysis of realized covariation: high frequency based covariance, regression, and correlation in financial economics

    DEFF Research Database (Denmark)

    Barndorff-Nielsen, Ole Eiler; Shephard, N.

    2004-01-01

    This paper analyses multivariate high frequency financial data using realized covariation. We provide a new asymptotic distribution theory for standard methods such as regression, correlation analysis, and covariance. It will be based on a fixed interval of time (e.g., a day or week), allowing...... the number of high frequency returns during this period to go to infinity. Our analysis allows us to study how high frequency correlations, regressions, and covariances change through time. In particular we provide confidence intervals for each of these quantities....

  14. Simulation of power fluctuation of wind farms based on frequency domain

    DEFF Research Database (Denmark)

    Lin, Jin; Sun, Yuanzhang; Li, Guojie

    2011-01-01

    , however, is incapable of completely explaining the physical mechanism of randomness of power fluctuation. To remedy such a situation, fluctuation modeling based on the frequency domain is proposed. The frequency domain characteristics of stochastic fluctuation on large wind farms are studied using...... the power spectral density of wind speed, the frequency domain model of a wind power generator and the information on weather and geography of the wind farms. The correctness and effectiveness of the model are verified by comparing the measurement data with simulation results of a certain wind farm. © 2011...

  15. Clock-Frequency Switching Technique for Energy Saving of Microcontroller Unit (MCU-Based Sensor Node

    Directory of Open Access Journals (Sweden)

    Pumin Duangmanee

    2018-05-01

    Full Text Available In this paper; a technique is proposed for reducing the energy consumption of microcontroller-based sensor nodes by switching the operating clock between low and high frequencies. The proposed concept is motivated by the fact that if the application codes of the microcontroller unit (MCU consist of no-wait state instruction sets, it consumes less energy when it operates with a higher frequency. When the application code of the MCU consists of wait instruction sets; e.g., a wait acknowledge signal, it switches to low clock frequency. The experimental results confirm that the proposed technique can reduce the MCU energy consumption up to 66.9%.

  16. Influence of laser frequency noise on scanning Fabry-Perot interferometer based laser Doppler velocimetry

    DEFF Research Database (Denmark)

    Rodrigo, Peter John; Pedersen, Christian

    2014-01-01

    n this work, we study the performance of a scanning Fabry-Perot interferometer based laser Doppler velocimeter (sFPILDV) and compare two candidate 1.5 um single-frequency laser sources for the system – a fiber laser (FL) and a semiconductor laser (SL). We describe a straightforward calibration...... procedure for the sFPI-LDV and investigate the effect of different degrees of laser frequency noise between the FL and the SL on the velocimeter’s performance...

  17. Gear-box fault detection using time-frequency based methods

    DEFF Research Database (Denmark)

    Odgaard, Peter Fogh; Stoustrup, Jakob

    2015-01-01

    Gear-box fault monitoring and detection is important for optimization of power generation and availability of wind turbines. The current industrial approach is to use condition monitoring systems, which runs in parallel with the wind turbine control system, using expensive additional sensors...... in the gear-box resonance frequency can be detected. Two different time–frequency based approaches are presented in this paper. One is a filter based approach and the other is based on a Karhunen–Loeve basis. Both of them detect the gear-box fault with an acceptable detection delay of maximum 100s, which...... is neglectable compared with the fault developing time....

  18. Pulse width modulation based pneumatic frequency tuner of the superconducting resonators at IUAC

    International Nuclear Information System (INIS)

    Pandey, A.; Suman, S.K.; Mathuria, D.S.

    2015-01-01

    The existing phase locking scheme of the quarter wave resonators (QWR) used in superconducting linear accelerator (LINAC) of IUAC consists of a fast time (electronic) and a slow time (pneumatic) control. Presently, piezo based mechanical tuners are being used to phase lock the resonators installed in the second and third accelerating modules of LINAC. However, due to space constraint, the piezo tuner can't be implemented on the resonators of the first accelerating module. Therefore, helium gas operated mechanical tuners are being used to phase lock the resonators against the master oscillator (MO) frequency. The present pneumatic frequency tuner has limitations of non-linearity, hysteresis and slow response time. To overcome these problems and to improve the dynamics of the existing tuner, a new pulse width modulation (PWM) based pneumatic frequency tuning system was adopted and successfully tested. After successful test, the PWM based pneumatic frequency tuner was installed in four QWR of the first accelerating module of LINAC. During beam run the PWM based frequency tuner performed well and the cavities could be phase locked at comparatively higher accelerating fields. A comparison of the existing tuning mechanism and the PWM based tuning system along with the test results will be presented in the paper. (author)

  19. Gender classification in children based on speech characteristics: using fundamental and formant frequencies of Malay vowels.

    Science.gov (United States)

    Zourmand, Alireza; Ting, Hua-Nong; Mirhassani, Seyed Mostafa

    2013-03-01

    Speech is one of the prevalent communication mediums for humans. Identifying the gender of a child speaker based on his/her speech is crucial in telecommunication and speech therapy. This article investigates the use of fundamental and formant frequencies from sustained vowel phonation to distinguish the gender of Malay children aged between 7 and 12 years. The Euclidean minimum distance and multilayer perceptron were used to classify the gender of 360 Malay children based on different combinations of fundamental and formant frequencies (F0, F1, F2, and F3). The Euclidean minimum distance with normalized frequency data achieved a classification accuracy of 79.44%, which was higher than that of the nonnormalized frequency data. Age-dependent modeling was used to improve the accuracy of gender classification. The Euclidean distance method obtained 84.17% based on the optimal classification accuracy for all age groups. The accuracy was further increased to 99.81% using multilayer perceptron based on mel-frequency cepstral coefficients. Copyright © 2013 The Voice Foundation. Published by Mosby, Inc. All rights reserved.

  20. Damage detection in multi-span beams based on the analysis of frequency changes

    International Nuclear Information System (INIS)

    Gillich, G R; Ntakpe, J L; Praisach, Z I; Mimis, M C; Abdel Wahab, M

    2017-01-01

    Crack identification in multi-span beams is performed to determine whether the structure is healthy or not. Among all crack identification methods, these based on measured natural frequency changes present the advantage of simplicity and easy to use in practical engineering. To accurately identify the cracks characteristics for multi-span beam structure, a mathematical model is established, which can predict frequency changes for any boundary conditions, the intermediate supports being hinges. This relation is based on the modal strain energy concept. Since frequency changes are relative small, to obtain natural frequencies with high resolution, a signal processing algorithm based on superposing of numerous spectra is also proposed, which overcomes the disadvantage of Fast Fourier Transform in the aspect of frequency resolution. Based on above-mentioned mathematical model and signal processing algorithm, the method of identifying cracks on multi-span beams is presented. To verify the accuracy of this identification method, experimental examples are conducted on a two-span structure. The results demonstrate that the method proposed in this paper can accurately identify the crack position and depth. (paper)

  1. Frequency scanning-based stability analysis method for grid-connected inverter system

    DEFF Research Database (Denmark)

    Wang, Yanbo; Wang, Xiongfei; Blaabjerg, Frede

    2017-01-01

    This paper proposes a frequency scanning-based impedance analysis for stability assessment of grid-connected inverter system, which is able to perform stability assessment without using system mathematical models and inherit the superior feature of impedance-based stability criterion with conside......This paper proposes a frequency scanning-based impedance analysis for stability assessment of grid-connected inverter system, which is able to perform stability assessment without using system mathematical models and inherit the superior feature of impedance-based stability criterion...... with consideration of the inverter nonlinearities. Small current disturbance is injected into grid-connected inverter system in a particular frequency range, and the impedance is computed according to the harmonic-frequency response using Fourier analysis, and then the stability is predicted on the basis...... of the impedance stability criterion. The stability issues of grid-connected inverters with grid-current feedback and the converter-current feedback are addressed using the proposed method. The results obtained from simulation and experiments validate the effectiveness of the method. The frequency scanning...

  2. Modeling of Temperature Effect on Modal Frequency of Concrete Beam Based on Field Monitoring Data

    Directory of Open Access Journals (Sweden)

    Wenchen Shan

    2018-01-01

    Full Text Available Temperature variation has been widely demonstrated to produce significant effect on modal frequencies that even exceed the effect of actual damage. In order to eliminate the temperature effect on modal frequency, an effective method is to construct quantitative models which accurately predict the modal frequency corresponding to temperature variation. In this paper, principal component analysis (PCA is conducted on the temperatures taken from all embedded thermocouples for extracting input parameters of regression models. Three regression-based numerical models using multiple linear regression (MLR, back-propagation neural network (BPNN, and support vector regression (SVR techniques are constructed to capture the relationships between modal frequencies and temperature distributions from measurements of a concrete beam during a period of forty days of monitoring. A comparison with respect to the performance of various optimally configured regression models has been performed on measurement data. Results indicate that the SVR exhibits a better reproduction and prediction capability than BPNN and MLR models for predicting the modal frequencies with respect to nonuniformly distributed temperatures. It is succeeded that temperature effects on modal frequencies can be effectively eliminated based on the optimally formulated SVR model.

  3. Increased frequency of single base substitutions in a population of transcripts expressed in cancer cells

    Directory of Open Access Journals (Sweden)

    Bianchetti Laurent

    2012-11-01

    Full Text Available Abstract Background Single Base Substitutions (SBS that alter transcripts expressed in cancer originate from somatic mutations. However, recent studies report SBS in transcripts that are not supported by the genomic DNA of tumor cells. Methods We used sequence based whole genome expression profiling, namely Long-SAGE (L-SAGE and Tag-seq (a combination of L-SAGE and deep sequencing, and computational methods to identify transcripts with greater SBS frequencies in cancer. Millions of tags produced by 40 healthy and 47 cancer L-SAGE experiments were compared to 1,959 Reference Tags (RT, i.e. tags matching the human genome exactly once. Similarly, tens of millions of tags produced by 7 healthy and 8 cancer Tag-seq experiments were compared to 8,572 RT. For each transcript, SBS frequencies in healthy and cancer cells were statistically tested for equality. Results In the L-SAGE and Tag-seq experiments, 372 and 4,289 transcripts respectively, showed greater SBS frequencies in cancer. Increased SBS frequencies could not be attributed to known Single Nucleotide Polymorphisms (SNP, catalogued somatic mutations or RNA-editing enzymes. Hypothesizing that Single Tags (ST, i.e. tags sequenced only once, were indicators of SBS, we observed that ST proportions were heterogeneously distributed across Embryonic Stem Cells (ESC, healthy differentiated and cancer cells. ESC had the lowest ST proportions, whereas cancer cells had the greatest. Finally, in a series of experiments carried out on a single patient at 1 healthy and 3 consecutive tumor stages, we could show that SBS frequencies increased during cancer progression. Conclusion If the mechanisms generating the base substitutions could be known, increased SBS frequency in transcripts would be a new useful biomarker of cancer. With the reduction of sequencing cost, sequence based whole genome expression profiling could be used to characterize increased SBS frequency in patient’s tumor and aid diagnostic.

  4. Increased frequency of single base substitutions in a population of transcripts expressed in cancer cells

    International Nuclear Information System (INIS)

    Bianchetti, Laurent; Kieffer, David; Féderkeil, Rémi; Poch, Olivier

    2012-01-01

    Single Base Substitutions (SBS) that alter transcripts expressed in cancer originate from somatic mutations. However, recent studies report SBS in transcripts that are not supported by the genomic DNA of tumor cells. We used sequence based whole genome expression profiling, namely Long-SAGE (L-SAGE) and Tag-seq (a combination of L-SAGE and deep sequencing), and computational methods to identify transcripts with greater SBS frequencies in cancer. Millions of tags produced by 40 healthy and 47 cancer L-SAGE experiments were compared to 1,959 Reference Tags (RT), i.e. tags matching the human genome exactly once. Similarly, tens of millions of tags produced by 7 healthy and 8 cancer Tag-seq experiments were compared to 8,572 RT. For each transcript, SBS frequencies in healthy and cancer cells were statistically tested for equality. In the L-SAGE and Tag-seq experiments, 372 and 4,289 transcripts respectively, showed greater SBS frequencies in cancer. Increased SBS frequencies could not be attributed to known Single Nucleotide Polymorphisms (SNP), catalogued somatic mutations or RNA-editing enzymes. Hypothesizing that Single Tags (ST), i.e. tags sequenced only once, were indicators of SBS, we observed that ST proportions were heterogeneously distributed across Embryonic Stem Cells (ESC), healthy differentiated and cancer cells. ESC had the lowest ST proportions, whereas cancer cells had the greatest. Finally, in a series of experiments carried out on a single patient at 1 healthy and 3 consecutive tumor stages, we could show that SBS frequencies increased during cancer progression. If the mechanisms generating the base substitutions could be known, increased SBS frequency in transcripts would be a new useful biomarker of cancer. With the reduction of sequencing cost, sequence based whole genome expression profiling could be used to characterize increased SBS frequency in patient’s tumor and aid diagnostic

  5. An assessment of envelope-based demodulation in case of proximity of carrier and modulation frequencies

    Science.gov (United States)

    Shahriar, Md Rifat; Borghesani, Pietro; Randall, R. B.; Tan, Andy C. C.

    2017-11-01

    Demodulation is a necessary step in the field of diagnostics to reveal faults whose signatures appear as an amplitude and/or frequency modulation. The Hilbert transform has conventionally been used for the calculation of the analytic signal required in the demodulation process. However, the carrier and modulation frequencies must meet the conditions set by the Bedrosian identity for the Hilbert transform to be applicable for demodulation. This condition, basically requiring the carrier frequency to be sufficiently higher than the frequency of the modulation harmonics, is usually satisfied in many traditional diagnostic applications (e.g. vibration analysis of gear and bearing faults) due to the order-of-magnitude ratio between the carrier and modulation frequency. However, the diversification of the diagnostic approaches and applications shows cases (e.g. electrical signature analysis-based diagnostics) where the carrier frequency is in close proximity to the modulation frequency, thus challenging the applicability of the Bedrosian theorem. This work presents an analytic study to quantify the error introduced by the Hilbert transform-based demodulation when the Bedrosian identity is not satisfied and proposes a mitigation strategy to combat the error. An experimental study is also carried out to verify the analytical results. The outcome of the error analysis sets a confidence limit on the estimated modulation (both shape and magnitude) achieved through the Hilbert transform-based demodulation in case of violated Bedrosian theorem. However, the proposed mitigation strategy is found effective in combating the demodulation error aroused in this scenario, thus extending applicability of the Hilbert transform-based demodulation.

  6. Population-based analysis of the frequency of HFE gene polymorphisms: Correlation with the susceptibility to develop hereditary hemochromatosis.

    Science.gov (United States)

    Katsarou, Martha-Spyridoula; Latsi, Rosana; Papasavva, Maria; Demertzis, Nikolaos; Kalogridis, Thodoris; Tsatsakis, Aristides M; Spandidos, Demetrios A; Drakoulis, Nikolaos

    2016-07-01

    Hereditary hemochromatosis (HH) is an autosomal recessive genetic disease, characterized by increased dietary iron absorption. Due to the absence of an effective excretory mechanism, the excess iron in the body may accumulate resulting in toxic effects. The HFE gene also affects the activity of hepcidin, a hormone which acts as a negative regulator of iron metabolism. In this study, we performed a population-based analysis of the distribution of three hemochromatosis-related polymorphisms in the HFE gene (rs1800562, rs1799945 and rs1800730). DNA from 1,446 non‑related individuals of Greek ethnicity was collected and analyzed, either from whole blood or buccal swabs. The frequency distribution of these HFE gene polymorphisms was then determined. The results revealed that in our Greek population cohort (gr) the frequencies of each polymorphism were as follows: rs1800562: GG (wild‑type)=97.0%, GA=1.5%, AA=1.5%; rs1799945: CC (wild‑type)=74.4%, CG=23.4%, GG=2.2%; rs1800730: AA (wild‑type)=98.1%, AT=1.5% and TT=0.4%. No association between the HFE polymorphisms rs1800562, rs1799945 and rs1800730 and gender could be established. As regards the rs1800562 polymorphism, the A allele (mutant) was ~1.8‑fold more frequent in the European population (eur) than in the Greek population [(gr)=2,3%<(eur)=4%]. As for the rs1799945 polymorphism, the G allele (mutant) was 1.2‑fold more frequent in the European population than in the Greek population [(gr)=13,9%<(eur)=17%]. As regards the rs1800730 polymorphism, the T allele (mutant) was ~1.7‑fold more frequent in the European population than in the Greek population [(gr)=1.2%<(eur)=2%]. However, these pathogenic mutations were found more frequently in the Greek population compared to the global population (gl) [rs1800562: (gl)=1%<(gr)=2,3%; rs1799945: (gl)=7%<(gr)=13,9%; rs1800730: (gl)=<1%<(gr)=1.2%]. This suggests that the Greek population may differ genetically from the northern European population

  7. Calibration-free absolute frequency response measurement of directly modulated lasers based on additional modulation.

    Science.gov (United States)

    Zhang, Shangjian; Zou, Xinhai; Wang, Heng; Zhang, Yali; Lu, Rongguo; Liu, Yong

    2015-10-15

    A calibration-free electrical method is proposed for measuring the absolute frequency response of directly modulated semiconductor lasers based on additional modulation. The method achieves the electrical domain measurement of the modulation index of directly modulated lasers without the need for correcting the responsivity fluctuation in the photodetection. Moreover, it doubles measuring frequency range by setting a specific frequency relationship between the direct and additional modulation. Both the absolute and relative frequency response of semiconductor lasers are experimentally measured from the electrical spectrum of the twice-modulated optical signal, and the measured results are compared to those obtained with conventional methods to check the consistency. The proposed method provides calibration-free and accurate measurement for high-speed semiconductor lasers with high-resolution electrical spectrum analysis.

  8. Observer-Based Load Frequency Control for Island Microgrid with Photovoltaic Power

    Directory of Open Access Journals (Sweden)

    Chaoxu Mu

    2017-01-01

    Full Text Available As renewable energy is widely integrated into the power system, the stochastic and intermittent power generation from renewable energy may cause system frequency deviating from the prescribed level, especially for a microgrid. In this paper, the load frequency control (LFC of an island microgrid with photovoltaic (PV power and electric vehicles (EVs is investigated, where the EVs can be treated as distributed energy storages. Considering the disturbances from load change and PV power, an observer-based integral sliding mode (OISM controller is designed to regulate the frequency back to the prescribed value, where the neural network observer is used to online estimate the PV power. Simulation studies on a benchmark microgrid system are presented to illustrate the effectiveness of OISM controller, and comparative results also demonstrate that the proposed method has a superior performance for stabilizing the frequency over the PID control.

  9. Analysis of Power System Low Frequency Oscillation Based on Energy Shift Theory

    Science.gov (United States)

    Zhang, Junfeng; Zhang, Chunwang; Ma, Daqing

    2018-01-01

    In this paper, a new method for analyzing low-frequency oscillation between analytic areas based on energy coefficient is proposed. The concept of energy coefficient is proposed by constructing the energy function, and the low-frequency oscillation is analyzed according to the energy coefficient under the current operating conditions; meanwhile, the concept of model energy is proposed to analyze the energy exchange behavior between two generators. Not only does this method provide an explanation of low-frequency oscillation from the energy point of view, but also it helps further reveal the dynamic behavior of complex power systems. The case analysis of four-machine two-area and the power system of Jilin Power Grid proves the correctness and effectiveness of the proposed method in low-frequency oscillation analysis of power system.

  10. The correction of vibration in frequency scanning interferometry based absolute distance measurement system for dynamic measurements

    Science.gov (United States)

    Lu, Cheng; Liu, Guodong; Liu, Bingguo; Chen, Fengdong; Zhuang, Zhitao; Xu, Xinke; Gan, Yu

    2015-10-01

    Absolute distance measurement systems are of significant interest in the field of metrology, which could improve the manufacturing efficiency and accuracy of large assemblies in fields such as aircraft construction, automotive engineering, and the production of modern windmill blades. Frequency scanning interferometry demonstrates noticeable advantages as an absolute distance measurement system which has a high precision and doesn't depend on a cooperative target. In this paper , the influence of inevitable vibration in the frequency scanning interferometry based absolute distance measurement system is analyzed. The distance spectrum is broadened as the existence of Doppler effect caused by vibration, which will bring in a measurement error more than 103 times bigger than the changes of optical path difference. In order to decrease the influence of vibration, the changes of the optical path difference are monitored by a frequency stabilized laser, which runs parallel to the frequency scanning interferometry. The experiment has verified the effectiveness of this method.

  11. A frequency domain radar interferometric imaging (FII) technique based on high-resolution methods

    Science.gov (United States)

    Luce, H.; Yamamoto, M.; Fukao, S.; Helal, D.; Crochet, M.

    2001-01-01

    In the present work, we propose a frequency-domain interferometric imaging (FII) technique for a better knowledge of the vertical distribution of the atmospheric scatterers detected by MST radars. This is an extension of the dual frequency-domain interferometry (FDI) technique to multiple frequencies. Its objective is to reduce the ambiguity (resulting from the use of only two adjacent frequencies), inherent with the FDI technique. Different methods, commonly used in antenna array processing, are first described within the context of application to the FII technique. These methods are the Fourier-based imaging, the Capon's and the singular value decomposition method used with the MUSIC algorithm. Some preliminary simulations and tests performed on data collected with the middle and upper atmosphere (MU) radar (Shigaraki, Japan) are also presented. This work is a first step in the developments of the FII technique which seems to be very promising.

  12. A noise level prediction method based on electro-mechanical frequency response function for capacitors.

    Science.gov (United States)

    Zhu, Lingyu; Ji, Shengchang; Shen, Qi; Liu, Yuan; Li, Jinyu; Liu, Hao

    2013-01-01

    The capacitors in high-voltage direct-current (HVDC) converter stations radiate a lot of audible noise which can reach higher than 100 dB. The existing noise level prediction methods are not satisfying enough. In this paper, a new noise level prediction method is proposed based on a frequency response function considering both electrical and mechanical characteristics of capacitors. The electro-mechanical frequency response function (EMFRF) is defined as the frequency domain quotient of the vibration response and the squared capacitor voltage, and it is obtained from impulse current experiment. Under given excitations, the vibration response of the capacitor tank is the product of EMFRF and the square of the given capacitor voltage in frequency domain, and the radiated audible noise is calculated by structure acoustic coupling formulas. The noise level under the same excitations is also measured in laboratory, and the results are compared with the prediction. The comparison proves that the noise prediction method is effective.

  13. Significance of Bias Correction in Drought Frequency and Scenario Analysis Based on Climate Models

    Science.gov (United States)

    Aryal, Y.; Zhu, J.

    2015-12-01

    Assessment of future drought characteristics is difficult as climate models usually have bias in simulating precipitation frequency and intensity. To overcome this limitation, output from climate models need to be bias corrected based on the specific purpose of applications. In this study, we examine the significance of bias correction in the context of drought frequency and scenario analysis using output from climate models. In particular, we investigate the performance of three widely used bias correction techniques: (1) monthly bias correction (MBC), (2) nested bias correction (NBC), and (3) equidistance quantile mapping (EQM) The effect of bias correction in future scenario of drought frequency is also analyzed. The characteristics of drought are investigated in terms of frequency and severity in nine representative locations in different climatic regions across the United States using regional climate model (RCM) output from the North American Regional Climate Change Assessment Program (NARCCAP). The Standardized Precipitation Index (SPI) is used as the means to compare and forecast drought characteristics at different timescales. Systematic biases in the RCM precipitation output are corrected against the National Centers for Environmental Prediction (NCEP) North American Regional Reanalysis (NARR) data. The results demonstrate that bias correction significantly decreases the RCM errors in reproducing drought frequency derived from the NARR data. Preserving mean and standard deviation is essential for climate models in drought frequency analysis. RCM biases both have regional and timescale dependence. Different timescale of input precipitation in the bias corrections show similar results. Drought frequency obtained from the RCM future (2040-2070) scenarios is compared with that from the historical simulations. The changes in drought characteristics occur in all climatic regions. The relative changes in drought frequency in future scenario in relation to

  14. Production of specific antisera for radioimmunoassay of human luteinizing hormone (LH) in the presence of human chorionic gonadotropin (hCG)

    International Nuclear Information System (INIS)

    Thorell, J.I.; Jeppsson, S.; Holmstrom, B.

    1976-01-01

    A specific radioimmunoassay for LH, which measures plasma LH in the presence of human chorionic gonadotropin (hCG) is described. Rabbits were immunized with highly purified native LH. One of the antisera with a difference in its reactivity against LH and hCG was further purified by affinity chromatography on a column with hCG coupled to Sepharose 4B. The adsorbed antiserum and 125 I-LH was used in a double antibody assay. The LH standard (MRC/68/40) efficiently inhibited the binding of 125 I-LH, and the standard curve showed a sensitivity of 0.5 ng/ml in the sample. hCG up to 10,000 ng/ml did not inhibit the binding of 125 I-LH. The plasma level of LH in pregnant women in the first trimester was low (1.3 +- 0.1 ng/ml). When LH was measured in fertile or menopausal women with or without stimulation with LH/FSH releasing hormone (LH-RH)/sup x/ the results agreed to those found with our conventional LH-assay based on antiserum against hCG

  15. A frequency output ferroelectric phase PNZT capacitor-based temperature sensor

    KAUST Repository

    Khan, Naveed

    2016-09-05

    In this paper, a frequency output temperature sensor based on a 4% Niobium doped 20/80 Zr/Ti Lead Zirconate Titanate (PNZT) capacitor is proposed. The sensor capacitance vs temperature and capacitance vs voltage characteristics are experimentally measured below the Curie temperature of the ferroelectric capacitor. The capacitance of the 20/80 (Zr/Ti) composition PNZT capacitor changes by 29% for a temperature change from 10°C to 100°C, which translates to 0.32%/°C temperature sensitivity. The measured sensor characteristics show less than ∼0.7°C deviation from the ideal linear response. A Wien bridge oscillator based temperature sensor is demonstrated based on the PNZT capacitors. Mathematical analysis for the effect of the op-amp finite unity-gain frequency on the sensor circuit oscillation frequency is provided. The experimentally realized frequency output temperature sensor shows -17.6% relative frequency change for a temperature change from 10°C to 100°C. The proposed capacitive temperature sensor can be used in low-power smart sensor nodes without the need for extensive calibration. © 2015 IEEE.

  16. Reliability of mechanisms with periodic random modal frequencies using an extreme value-based approach

    International Nuclear Information System (INIS)

    Savage, Gordon J.; Zhang, Xufang; Son, Young Kap; Pandey, Mahesh D.

    2016-01-01

    Resonance in a dynamic system is to be avoided since it often leads to impaired performance, overstressing, fatigue fracture and adverse human reactions. Thus, it is necessary to know the modal frequencies and ensure they do not coincide with any applied periodic loadings. For a rotating planar mechanism, the coefficients in the mass and stiffness matrices are periodically varying, and if the underlying geometry and material properties are treated as random variables then the modal frequencies are both position-dependent and probabilistic. The avoidance of resonance is now a complex problem. Herein, free vibration analysis helps determine ranges of modal frequencies that in turn, identify the running speeds of the mechanism to be avoided. This paper presents an efficient and accurate sample-based approach to determine probabilistic minimum and maximum extremes of the fundamental frequencies and the angular positions of their occurrence. Then, given critical lower and upper frequency constraints it is straightforward to determine reliability in terms of probability of exceedance. The novelty of the proposed approach is that the original expensive and implicit mechanistic model is replaced by an explicit meta-model that captures the tolerances of the design variables over the entire range of angular positions: position-dependent eigenvalues can be found easily and quickly. Extreme-value statistics of the modal frequencies and extreme-value statistics of the angular positions are readily computed through MCS. Limit-state surfaces that connect the frequencies to the design variables may be easily constructed. Error analysis identifies three errors and the paper presents ways to control them so the methodology can be sufficiently accurate. A numerical example of a flexible four-bar linkage shows the proposed methodology has engineering applications. The impact of the proposed methodology is two-fold: it presents a safe-side analysis based on free vibration methods to

  17. Large-scale genomic 2D visualization reveals extensive CG-AT skew correlation in bird genomes

    Directory of Open Access Journals (Sweden)

    Deng Xuemei

    2007-11-01

    Full Text Available Abstract Background Bird genomes have very different compositional structure compared with other warm-blooded animals. The variation in the base skew rules in the vertebrate genomes remains puzzling, but it must relate somehow to large-scale genome evolution. Current research is inclined to relate base skew with mutations and their fixation. Here we wish to explore base skew correlations in bird genomes, to develop methods for displaying and quantifying such correlations at different scales, and to discuss possible explanations for the peculiarities of the bird genomes in skew correlation. Results We have developed a method called Base Skew Double Triangle (BSDT for exhibiting the genome-scale change of AT/CG skew as a two-dimensional square picture, showing base skews at many scales simultaneously in a single image. By this method we found that most chicken chromosomes have high AT/CG skew correlation (symmetry in 2D picture, except for some microchromosomes. No other organisms studied (18 species show such high skew correlations. This visualized high correlation was validated by three kinds of quantitative calculations with overlapping and non-overlapping windows, all indicating that chicken and birds in general have a special genome structure. Similar features were also found in some of the mammal genomes, but clearly much weaker than in chickens. We presume that the skew correlation feature evolved near the time that birds separated from other vertebrate lineages. When we eliminated the repeat sequences from the genomes, the AT and CG skews correlation increased for some mammal genomes, but were still clearly lower than in chickens. Conclusion Our results suggest that BSDT is an expressive visualization method for AT and CG skew and enabled the discovery of the very high skew correlation in bird genomes; this peculiarity is worth further study. Computational analysis indicated that this correlation might be a compositional characteristic

  18. Frequency Control Strategy for Black Starts via PMSG-Based Wind Power Generation

    Directory of Open Access Journals (Sweden)

    Yi Tang

    2017-03-01

    Full Text Available The use of wind power generation (WPG as a source for black starts will significantly enhance the resiliency of power systems and shorten their recovery time from blackouts. Given that frequency stability is the most serious issue during the initial recovery period, virtual inertia control can enable wind turbines to provide frequency support to an external system. In this study, a general procedure of WPG participating in black starts is presented, and the key issues are discussed. The adaptability of existing virtual inertia control strategies is analyzed, and improvement work is performed. A new coordinated frequency control strategy is proposed based on the presented improvement work. A local power network with a permanent-magnet synchronous generator (PMSG-based wind farm is modeled and used to verify the effectiveness of the strategy.

  19. Frequency response function (FRF) based updating of a laser spot welded structure

    Science.gov (United States)

    Zin, M. S. Mohd; Rani, M. N. Abdul; Yunus, M. A.; Sani, M. S. M.; Wan Iskandar Mirza, W. I. I.; Mat Isa, A. A.

    2018-04-01

    The objective of this paper is to present frequency response function (FRF) based updating as a method for matching the finite element (FE) model of a laser spot welded structure with a physical test structure. The FE model of the welded structure was developed using CQUAD4 and CWELD element connectors, and NASTRAN was used to calculate the natural frequencies, mode shapes and FRF. Minimization of the discrepancies between the finite element and experimental FRFs was carried out using the exceptional numerical capability of NASTRAN Sol 200. The experimental work was performed under free-free boundary conditions using LMS SCADAS. Avast improvement in the finite element FRF was achieved using the frequency response function (FRF) based updating with two different objective functions proposed.

  20. A note on eigenfrequency sensitivities and structural eigenfrequency optimization based on local sub-domain frequencies

    DEFF Research Database (Denmark)

    Pedersen, Pauli; Pedersen, Niels Leergaard

    2014-01-01

    foundation. A numerical heuristic redesign procedure is proposed and illustrated with examples. For the ideal case, an optimality criterion is fulfilled if the design have the same sub-domain frequency (local Rayleigh quotient). Sensitivity analysis shows an important relation between squared system...... eigenfrequency and squared local sub-domain frequency for a given eigenmode. Higher order eigenfrequenciesmay also be controlled in this manner. The presented examples are based on 2D finite element models with the use of subspace iteration for analysis and a heuristic recursive design procedure based...... on the derived optimality condition. The design that maximize a frequency depend on the total amount of available material and on a necessary interpolation as illustrated by different design cases.In this note we have assumed a linear and conservative eigenvalue problem without multiple eigenvalues. The presence...

  1. A frequency conversion mode for dispenser in the service station based on flow rate signal

    International Nuclear Information System (INIS)

    Liu, Y J; Tang, D; Huang, J B; Liu, J; Jia, P F

    2012-01-01

    Dispenser is an integrated fuel transport and measurement system at the service station. In this paper, we developed a frequency conversion mode for the dispenser, based on the flow rate signal which is obtained from the converter measuring flow capacity. After introducing the frequency conversion mode to dispenser, we obtained that pump rotates at a high speed when fuelled with high flow rate, and it rotates at a low speed when fuelled with low flow rate. This makes the fuel dispenser more energy-efficient and controllable. We also did some valve optimizations on the dispenser and developed a new control mode for preset refuelling based on the frequency conversion mode, Experimental and theoretical studies have shown that the new dispenser not only can meet the national standards, but also performs better than the ordinary one especially in preset refuelling.

  2. Accurate Frequency Estimation Based On Three-Parameter Sine-Fitting With Three FFT Samples

    Directory of Open Access Journals (Sweden)

    Liu Xin

    2015-09-01

    Full Text Available This paper presents a simple DFT-based golden section searching algorithm (DGSSA for the single tone frequency estimation. Because of truncation and discreteness in signal samples, Fast Fourier Transform (FFT and Discrete Fourier Transform (DFT are inevitable to cause the spectrum leakage and fence effect which lead to a low estimation accuracy. This method can improve the estimation accuracy under conditions of a low signal-to-noise ratio (SNR and a low resolution. This method firstly uses three FFT samples to determine the frequency searching scope, then – besides the frequency – the estimated values of amplitude, phase and dc component are obtained by minimizing the least square (LS fitting error of three-parameter sine fitting. By setting reasonable stop conditions or the number of iterations, the accurate frequency estimation can be realized. The accuracy of this method, when applied to observed single-tone sinusoid samples corrupted by white Gaussian noise, is investigated by different methods with respect to the unbiased Cramer-Rao Low Bound (CRLB. The simulation results show that the root mean square error (RMSE of the frequency estimation curve is consistent with the tendency of CRLB as SNR increases, even in the case of a small number of samples. The average RMSE of the frequency estimation is less than 1.5 times the CRLB with SNR = 20 dB and N = 512.

  3. Gear fault diagnosis based on the structured sparsity time-frequency analysis

    Science.gov (United States)

    Sun, Ruobin; Yang, Zhibo; Chen, Xuefeng; Tian, Shaohua; Xie, Yong

    2018-03-01

    Over the last decade, sparse representation has become a powerful paradigm in mechanical fault diagnosis due to its excellent capability and the high flexibility for complex signal description. The structured sparsity time-frequency analysis (SSTFA) is a novel signal processing method, which utilizes mixed-norm priors on time-frequency coefficients to obtain a fine match for the structure of signals. In order to extract the transient feature from gear vibration signals, a gear fault diagnosis method based on SSTFA is proposed in this work. The steady modulation components and impulsive components of the defective gear vibration signals can be extracted simultaneously by choosing different time-frequency neighborhood and generalized thresholding operators. Besides, the time-frequency distribution with high resolution is obtained by piling different components in the same diagram. The diagnostic conclusion can be made according to the envelope spectrum of the impulsive components or by the periodicity of impulses. The effectiveness of the method is verified by numerical simulations, and the vibration signals registered from a gearbox fault simulator and a wind turbine. To validate the efficiency of the presented methodology, comparisons are made among some state-of-the-art vibration separation methods and the traditional time-frequency analysis methods. The comparisons show that the proposed method possesses advantages in separating feature signals under strong noise and accounting for the inner time-frequency structure of the gear vibration signals.

  4. An adjustable multi-scale single beam acoustic tweezers based on ultrahigh frequency ultrasonic transducer.

    Science.gov (United States)

    Chen, Xiaoyang; Lam, Kwok Ho; Chen, Ruimin; Chen, Zeyu; Yu, Ping; Chen, Zhongping; Shung, K Kirk; Zhou, Qifa

    2017-11-01

    This paper reports the fabrication, characterization, and microparticle manipulation capability of an adjustable multi-scale single beam acoustic tweezers (SBAT) that is capable of flexibly changing the size of "tweezers" like ordinary metal tweezers with a single-element ultrahigh frequency (UHF) ultrasonic transducer. The measured resonant frequency of the developed transducer at 526 MHz is the highest frequency of piezoelectric single crystal based ultrasonic transducers ever reported. This focused UHF ultrasonic transducer exhibits a wide bandwidth (95.5% at -10 dB) due to high attenuation of high-frequency ultrasound wave, which allows the SBAT effectively excite with a wide range of excitation frequency from 150 to 400 MHz by using the "piezoelectric actuator" model. Through controlling the excitation frequency, the wavelength of ultrasound emitted from the SBAT can be changed to selectively manipulate a single microparticle of different sizes (3-100 μm) by using only one transducer. This concept of flexibly changing "tweezers" size is firstly introduced into the study of SBAT. At the same time, it was found that this incident ultrasound wavelength play an important role in lateral trapping and manipulation for microparticle of different sizes. Biotechnol. Bioeng. 2017;114: 2637-2647. © 2017 Wiley Periodicals, Inc. © 2017 Wiley Periodicals, Inc.

  5. Data of evolutionary structure change: 1CG8A-2ZLWD [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1CG8A-2ZLWD 1CG8 2ZLW A D -VLSSQNKKAIEELGNLIKANAEAWGADALARLFELHPQ...R VQLSGEEKAAVLALWDKV--NEEEVGGEALGRLLVVYPWTQRFFDSFGDLSNPGAVMGNPKVKAHGKKVLHSFGEGVHHLDNLKGTFAALSEL...> 2ZLW D 2ZLWD ARHFG...fEVID> 2 2ZLW D 2ZLWD LWD... CA 218 GLN CA 251 2ZLW D

  6. Data of evolutionary structure change: 1CG5A-2ZLWD [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1CG5A-2ZLWD 1CG5 2ZLW A D -VLSSQNKKAIEELGNLIKANAEAWGADALARLFELHPQ...R VQLSGEEKAAVLALWDKV--NEEEVGGEALGRLLVVYPWTQRFFDSFGDLSNPGAVMGNPKVKAHGKKVLHSFGEGVHHLDNLKGTFAALSEL...ne> GLN CA 254 2ZLW D 2ZLWD...ain> 2ZLW D 2ZLWD AR...fEVID> 2 2ZLW D 2ZLWD

  7. Data of evolutionary structure change: 1CG5A-2QU0C [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available D> C 2QU0C ence>YFPHF-DLSHGence> 0 A C VLSSQNKKAIEELGNLIKANAEAWGADALARLFELHPQT...n> 1CG5 A 1CG5A ence>VNLQA-FTPVT...line> THR CA 269 2QU0 C 2QU...0C ence>CHLPNDFTPAVence> HHHH HHH

  8. Data of evolutionary structure change: 1CG8A-2QU0A [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available /pdbChain> 2QU0A ence>YFPHF-DLSHGence> G - 0 A A VLSSQNKKAIEELGNLIKANAEAWGADALARLFELHPQT...hain> 1CG8 A 1CG8A ence>VNLQA-FTPVT...ine>THR CA 278 2QU0 A 2QU...0A ence>CHLPNDFTPAV HH HHHH HHH

  9. Kinderen met hyperthyreoïdie door verhoogd hCG

    NARCIS (Netherlands)

    Jöbsis, Jasper J.; van Trotsenburg, A. S. Paul; Merks, Johannes H. M.; Kamp, Gerdine A.

    2014-01-01

    We describe two children with hyperthyroidism secondary to elevated hCG levels: one patient with gestational trophoblastic disease and one patient with choriocarcinoma. hCG resembles other glycoproteins that can lead to hyperthyroidism through TSH receptor activation. Also, through its LH-mimicking

  10. A novel HDAC inhibitor, CG200745, inhibits pancreatic cancer cell growth and overcomes gemcitabine resistance.

    Science.gov (United States)

    Lee, Hee Seung; Park, Soo Been; Kim, Sun A; Kwon, Sool Ki; Cha, Hyunju; Lee, Do Young; Ro, Seonggu; Cho, Joong Myung; Song, Si Young

    2017-01-30

    Pancreatic cancer is predominantly lethal, and is primarily treated using gemcitabine, with increasing resistance. Therefore, novel agents that increase tumor sensitivity to gemcitabine are needed. Histone deacetylase (HDAC) inhibitors are emerging therapeutic agents, since HDAC plays an important role in cancer initiation and progression. We evaluated the antitumor effect of a novel HDAC inhibitor, CG200745, combined with gemcitabine/erlotinib on pancreatic cancer cells and gemcitabine-resistant pancreatic cancer cells. Three pancreatic cancer-cell lines were used to evaluate the antitumor effect of CG200745 combined with gemcitabine/erlotinib. CG200745 induced the expression of apoptotic proteins (PARP and caspase-3) and increased the levels of acetylated histone H3. CG200745 with gemcitabine/erlotinib showed significant growth inhibition and synergistic antitumor effects in vitro. In vivo, gemcitabine/erlotinib and CG200745 reduced tumor size up to 50%. CG200745 enhanced the sensitivity of gemcitabine-resistant pancreatic cancer cells to gemcitabine, and decreased the level of ATP-binding cassette-transporter genes, especially multidrug resistance protein 3 (MRP3) and MRP4. The novel HDAC inhibitor, CG200745, with gemcitabine/erlotinib had a synergistic anti-tumor effect on pancreatic cancer cells. CG200745 significantly improved pancreatic cancer sensitivity to gemcitabine, with a prominent antitumor effect on gemcitabine-resistant pancreatic cancer cells. Therefore, improved clinical outcome is expected in the future.

  11. Low Noise Frequency Comb Sources Based on Synchronously Pumped Doubly Resonant Optical Parametric Oscillators

    Science.gov (United States)

    Wan, Chenchen

    Optical frequency combs are coherent light sources consist of thousands of equally spaced frequency lines. Frequency combs have achieved success in applications of metrology, spectroscopy and precise pulse manipulation and control. The most common way to generate frequency combs is based on mode-locked lasers which has the output spectrum of comb structures. To generate stable frequency combs, the output from mode-locked lasers need to be phase stabilized. The whole comb lines will be stabilized if the pulse train repetition rate corresponding to comb spacing and the pulse carrier envelope offset (CEO) frequency are both stabilized. The output from a laser always has fluctuations in parameters known as noise. In laser applications, noise is an important factor to limit the performance and often need to be well controlled. For example in precision measurement such as frequency metrology and precise spectroscopy, low laser intensity and phase noise is required. In mode-locked lasers there are different types of noise like intensity noise, pulse temporal position noise also known as timing jitter, optical phase noise. In term for frequency combs, these noise dynamics is more complex and often related. Understanding the noise behavior is not only of great interest in practical applications but also help understand fundamental laser physics. In this dissertation, the noise of frequency combs and mode-locked lasers will be studied in two projects. First, the CEO frequency phase noise of a synchronously pumped doubly resonant optical parametric oscillators (OPO) will be explored. This is very important for applications of the OPO as a coherent frequency comb source. Another project will focus on the intensity noise coupling in a soliton fiber oscillator, the finding of different noise coupling in soliton pulses and the dispersive waves generated from soliton perturbation can provide very practical guidance for low noise soliton laser design. OPOs are used to generate

  12. Linear active disturbance rejection-based load frequency control concerning high penetration of wind energy

    International Nuclear Information System (INIS)

    Tang, Yanmei; Bai, Yan; Huang, Congzhi; Du, Bin

    2015-01-01

    Highlights: • A disturbance rejection solution to the load frequency control issue is proposed. • Several power systems with wind energy conversation system have been tested. • A tuning algorithm of the controller parameters was proposed. • The performance of the proposed approach is better than traditional controllers. - Abstract: A new grid load frequency control approach is proposed for the doubly fed induction generator based wind power plants. The load frequency control issue in a power system is undergoing fundamental changes due to the rapidly growing amount of wind energy conversation system, and concentrating on maintaining generation-load balance and disturbance rejection. The prominent feature of the linear active disturbance rejection control approach is that the total disturbance can be estimated and then eliminated in real time. And thus, it is a feasible solution to deal with the load frequency control issue. In this paper, the application of the linear active disturbance rejection control approach in the load frequency control issue for a complex power system with wind energy conversation system based on doubly fed induction generator is investigated. The load frequency control issue is formulated as a decentralized multi-objective optimization control problem, the solution to which is solved by the hybrid particle swarm optimization technique. To show the effectiveness of the proposed control scheme, the robust performance testing based on Monte-Carlo approach is carried out. The performance superiority of the system with the proposed linear active disturbance rejection control approach over that with the traditional proportional integral and fuzzy-proportional integral-based controllers is validated by the simulation results

  13. Frequency Support of PMSG-WTG Based on Improved Inertial Control: Preprint

    Energy Technology Data Exchange (ETDEWEB)

    Wu, Z.; Wang, X.; Gao, W.; Kang, M.; Hwang, M.; Kang, Y.; Gevorgian, Vahan; Muljadi, Eduard

    2016-03-15

    With increasing integrations of large-scale systems based on permanent magnet synchronous generator wind turbine generators (PMSG-WTGs), the overall inertial response of a power system will tend to deteriorate as a result of the decoupling of rotor speed and grid frequency through the power converter as well as the scheduled retirement of conventional synchronous generators. Thus, PMSG-WTGs can provide value to an electric grid by contributing to the system's inertial response by utilizing the inherent kinetic energy stored in their rotating masses and fast power control. In this work, an improved inertial control method based on the maximum power point tracking operation curve is introduced to enhance the overall frequency support capability of PMSG-WTGs in the case of large supply-demand imbalances. Moreover, this method is implemented in the CART2-PMSG integrated model in MATLAB/Simulink to investigate its impact on the wind turbine's structural loads during the inertial response process. Simulation results indicate that the proposed method can effectively reduce the frequency nadir, arrest the rate of change of frequency, and mitigate the secondary frequency drop while imposing no negative impact on the major mechanical components of the wind turbine.

  14. Study on Fault Diagnosis of Rolling Bearing Based on Time-Frequency Generalized Dimension

    Directory of Open Access Journals (Sweden)

    Yu Yuan

    2015-01-01

    Full Text Available The condition monitoring technology and fault diagnosis technology of mechanical equipment played an important role in the modern engineering. Rolling bearing is the most common component of mechanical equipment which sustains and transfers the load. Therefore, fault diagnosis of rolling bearings has great significance. Fractal theory provides an effective method to describe the complexity and irregularity of the vibration signals of rolling bearings. In this paper a novel multifractal fault diagnosis approach based on time-frequency domain signals was proposed. The method and numerical algorithm of Multi-fractal analysis in time-frequency domain were provided. According to grid type J and order parameter q in algorithm, the value range of J and the cut-off condition of q were optimized based on the effect on the dimension calculation. Simulation experiments demonstrated that the effective signal identification could be complete by multifractal method in time-frequency domain, which is related to the factors such as signal energy and distribution. And the further fault diagnosis experiments of bearings showed that the multifractal method in time-frequency domain can complete the fault diagnosis, such as the fault judgment and fault types. And the fault detection can be done in the early stage of fault. Therefore, the multifractal method in time-frequency domain used in fault diagnosis of bearing is a practicable method.

  15. Joint DOA and Fundamental Frequency Estimation Methods based on 2-D Filtering

    DEFF Research Database (Denmark)

    Jensen, Jesper Rindom; Christensen, Mads Græsbøll; Jensen, Søren Holdt

    2010-01-01

    of the fundamental frequency and the DOA of spatio-temporarily sampled periodic signals. The first and simplest method is based on the 2-D periodogram, whereas the second method is a generalization of the 2-D Capon method. In the experimental part, both qualitative and quantitative measurements show that the proposed...

  16. Improving Frequency Stability Based on Distributed Control of Multiple Load Aggregators

    DEFF Research Database (Denmark)

    Hu, Jianqiang; Cao, Jinde; Guerrero, Josep M.

    2017-01-01

    into the traditional centralized proportional-integral-based automatic generation control (AGC) framework, which has formed the coupled secondary frequency control structure. It has been shown that the total power mismatch in each control area is shared with both AGC units and load aggregators, and the system...

  17. Analyzing Idioms and Their Frequency in Three Advanced ILI Textbooks: A Corpus-Based Study

    Science.gov (United States)

    Alavi, Sepideh; Rajabpoor, Aboozar

    2015-01-01

    The present study aimed at identifying and quantifying the idioms used in three ILI "Advanced" level textbooks based on three different English corpora; MICASE, BNC and the Brown Corpus, and comparing the frequencies of the idioms across the three corpora. The first step of the study involved searching the books to find multi-word…

  18. High Frequency Resonance Damping of DFIG based Wind Power System under Weak Network

    DEFF Research Database (Denmark)

    Song, Yipeng; Wang, Xiongfei; Blaabjerg, Frede

    2017-01-01

    When operating in a micro or weak grid which has a relatively large network impedance, the Doubly Fed Induction Generator (DFIG) based wind power generation system is prone to suffer high frequency resonance due to the impedance interaction between DFIG system and the parallel compensated network...

  19. Analysis of in-band interference in noise-based frequency offset modulation

    NARCIS (Netherlands)

    Bilal, Ibrahim; Meijerink, Arjan; Bentum, Marinus Jan

    2014-01-01

    A noise-based frequency offset modulation (N-FOM) system is considered, employing a wideband noise carrier, transmit reference modulation and a self-correlation receiver. The performance of such a system in the presence of in-band interference is studied by modeling the interference as a Gaussian

  20. CG2Real: Improving the Realism of Computer Generated Images Using a Large Collection of Photographs.

    Science.gov (United States)

    Johnson, Micah K; Dale, Kevin; Avidan, Shai; Pfister, Hanspeter; Freeman, William T; Matusik, Wojciech

    2011-09-01

    Computer-generated (CG) images have achieved high levels of realism. This realism, however, comes at the cost of long and expensive manual modeling, and often humans can still distinguish between CG and real images. We introduce a new data-driven approach for rendering realistic imagery that uses a large collection of photographs gathered from online repositories. Given a CG image, we retrieve a small number of real images with similar global structure. We identify corresponding regions between the CG and real images using a mean-shift cosegmentation algorithm. The user can then automatically transfer color, tone, and texture from matching regions to the CG image. Our system only uses image processing operations and does not require a 3D model of the scene, making it fast and easy to integrate into digital content creation workflows. Results of a user study show that our hybrid images appear more realistic than the originals.

  1. Postmenopausal pregnancy? Evaluation of elevated hCG in a 59-year-old woman.

    Science.gov (United States)

    Basham, Mary Margaret; Bryan, Teresa

    2017-06-05

    Slightly elevated serum human chorionic gonadotropin (hCG) can be a normal finding in postmenopausal women. We report a case of a 59-year-old woman with a history of abnormal uterine bleeding who presented with a concern for pregnancy after developing nausea and vomiting a few weeks after unprotected intercourse. Although pregnancy was extremely unlikely, hCG was obtained in order to reassure the patient since she reported that her mother conceived at the age of 60. Serum hCG was positive, prompting concern for malignancy versus pregnancy. Stable serum hCG levels, elevated follicle-stimulating hormone and negative transvaginal ultrasound ruled out both malignancy and pregnancy. Positive serum pregnancy test and hCG elevation was attributed to normal postmenopausal state. © BMJ Publishing Group Ltd (unless otherwise stated in the text of the article) 2017. All rights reserved. No commercial use is permitted unless otherwise expressly granted.

  2. Channel and delay estimation for base-station–based cooperative communications in frequency-selective fading channels

    Directory of Open Access Journals (Sweden)

    Hongjun Xu

    2011-07-01

    Full Text Available A channel and delay estimation algorithm for both positive and negative delay, based on the distributed Alamouti scheme, has been recently discussed for base-station–based asynchronous cooperative systems in frequency-flat fading channels. This paper extends the algorithm, the maximum likelihood estimator, to work in frequency-selective fading channels. The minimum mean square error (MMSE performance of channel estimation for both packet schemes and normal schemes is discussed in this paper. The symbol error rate (SER performance of equalisation and detection for both time-reversal space-time block code (STBC and single-carrier STBC is also discussed in this paper. The MMSE simulation results demonstrated the superior performance of the packet scheme over the normal scheme with an improvement in performance of up to 6 dB when feedback was used in the frequency-selective channel at a MSE of 3 x 10–2. The SER simulation results showed that, although both the normal and packet schemes achieved similar diversity orders, the packet scheme demonstrated a 1 dB coding gain over the normal scheme at a SER of 10–5. Finally, the SER simulations showed that the frequency-selective fading system outperformed the frequency-flat fading system.

  3. Modelling and assessment of urban flood hazards based on rainfall intensity-duration-frequency curves reformation

    OpenAIRE

    Ghazavi, Reza; Moafi Rabori, Ali; Ahadnejad Reveshty, Mohsen

    2016-01-01

    Estimate design storm based on rainfall intensity–duration–frequency (IDF) curves is an important parameter for hydrologic planning of urban areas. The main aim of this study was to estimate rainfall intensities of Zanjan city watershed based on overall relationship of rainfall IDF curves and appropriate model of hourly rainfall estimation (Sherman method, Ghahreman and Abkhezr method). Hydrologic and hydraulic impacts of rainfall IDF curves change in flood properties was evaluated via Stormw...

  4. Recent progress in synchrotron-based frequency-domain Fourier-transform THz-EPR.

    Science.gov (United States)

    Nehrkorn, Joscha; Holldack, Karsten; Bittl, Robert; Schnegg, Alexander

    2017-07-01

    We describe frequency-domain Fourier-transform THz-EPR as a method to assign spin-coupling parameters of high-spin (S>1/2) systems with very large zero-field splittings. The instrumental foundations of synchrotron-based FD-FT THz-EPR are presented, alongside with a discussion of frequency-domain EPR simulation routines. The capabilities of this approach is demonstrated for selected mono- and multinuclear HS systems. Finally, we discuss remaining challenges and give an outlook on the future prospects of the technique. Copyright © 2017 Elsevier Inc. All rights reserved.

  5. Multiuser Carrier Frequency Offset Estimation for OFDMA Uplink Based on Multi-Antenna

    Science.gov (United States)

    Zhang, Weile; Wang, Junsong; Yin, Qinye; Feng, Ang

    In this letter, a novel method is proposed for carrier-frequency offset (CFO) estimation for multiple users in orthogonal frequency division multiple access (OFDMA) uplink with the generalized carrier assignment scheme (GCAS). The base station (BS) is equipped with multiple antennas, and each user's CFO can be estimated by the ESPRIT-like method that utilizes the rotation invariance of the space-domain snapshot matrix. The method is still effective even in fully loaded system with all subcarriers allocated to users. Simulation results illustrate the high performance of the proposed algorithm.

  6. Combined failure acoustical diagnosis based on improved frequency domain blind deconvolution

    International Nuclear Information System (INIS)

    Pan, Nan; Wu, Xing; Chi, YiLin; Liu, Xiaoqin; Liu, Chang

    2012-01-01

    According to gear box combined failure extraction in complex sound field, an acoustic fault detection method based on improved frequency domain blind deconvolution was proposed. Follow the frequency-domain blind deconvolution flow, the morphological filtering was firstly used to extract modulation features embedded in the observed signals, then the CFPA algorithm was employed to do complex-domain blind separation, finally the J-Divergence of spectrum was employed as distance measure to resolve the permutation. Experiments using real machine sound signals was carried out. The result demonstrate this algorithm can be efficiently applied to gear box combined failure detection in practice.

  7. Voltage and frequency control of wind-powered islanded microgrids based on induction generator and STATCOM

    DEFF Research Database (Denmark)

    Bouzid, Allal; Sicard, Pierre; Guerrero, Josep M.

    2015-01-01

    This paper presents a comprehensive modeling of a three-phase cage induction machine used as a self-excited squirrel-cage induction generator (SEIG), and discusses the regulation of the voltage and frequency of a self-excited SEIG based on the action of the static synchronous Compensator (STATCOM......). The STATCOM with the proposed controller consists of a three-phase voltage-sourced inverter and a DC voltage. The compensator can provide the active and reactive powers and regulate AC system bus voltage and the frequency, but also may enhance the load stability. Moreover, a feed forward control method...

  8. Cough Recognition Based on Mel Frequency Cepstral Coefficients and Dynamic Time Warping

    Science.gov (United States)

    Zhu, Chunmei; Liu, Baojun; Li, Ping

    Cough recognition provides important clinical information for the treatment of many respiratory diseases, but the assessment of cough frequency over a long period of time remains unsatisfied for either clinical or research purpose. In this paper, according to the advantage of dynamic time warping (DTW) and the characteristic of cough recognition, an attempt is made to adapt DTW as the recognition algorithm for cough recognition. The process of cough recognition based on mel frequency cepstral coefficients (MFCC) and DTW is introduced. Experiment results of testing samples from 3 subjects show that acceptable performances of cough recognition are obtained by DTW with a small training set.

  9. Blood velocity estimation using spatio-temporal encoding based on frequency division approach

    DEFF Research Database (Denmark)

    Gran, Fredrik; Nikolov, Svetoslav; Jensen, Jørgen Arendt

    2005-01-01

    In this paper a feasibility study of using a spatial encoding technique based on frequency division for blood flow estimation is presented. The spatial encoding is carried out by dividing the available bandwidth of the transducer into a number of narrow frequency bands with approximately disjoint...... spectral support. By assigning one band to one virtual source, all virtual sources can be excited simultaneously. The received echoes are beamformed using Synthetic Transmit Aperture beamforming. The velocity of the moving blood is estimated using a cross- correlation estimator. The simulation tool Field...

  10. Design of Meander-Line Antennas for Radio Frequency Identification Based on Multiobjective Optimization

    Directory of Open Access Journals (Sweden)

    X. L. Travassos

    2012-01-01

    Full Text Available This paper presents optimization problem formulations to design meander-line antennas for passive UHF radio frequency identification tags based on given specifications of input impedance, frequency range, and geometric constraints. In this application, there is a need for directive transponders to select properly the target tag, which in turn must be ideally isotropic. The design of an effective meander-line antenna for RFID purposes requires balancing geometrical characteristics with the microchip impedance. Therefore, there is an issue of optimization in determining the antenna parameters for best performance. The antenna is analyzed by a method of moments. Some results using a deterministic optimization algorithm are shown.

  11. Cross-media color reproduction using the frequency-based spatial gamut mapping algorithm based on human color vision

    Science.gov (United States)

    Wu, Guangyuan; Niu, Shijun; Li, Xiaozhou; Hu, Guichun

    2018-04-01

    Due to the increasing globalization of printing industry, remoting proofing will become the inevitable development trend. Cross-media color reproduction will occur in different color gamuts using remote proofing technologies, which usually leads to the problem of incompatible color gamut. In this paper, to achieve equivalent color reproduction between a monitor and a printer, a frequency-based spatial gamut mapping algorithm is proposed for decreasing the loss of visual color information. The design of algorithm is based on the contrast sensitivity functions (CSF), which exploited CSF spatial filter to preserve luminance of the high spatial frequencies and chrominance of the low frequencies. First we show a general framework for how to apply CSF spatial filter in retention of relevant visual information. Then we compare the proposed framework with HPMINDE, CUSP, Bala's algorithm. The psychophysical experimental results indicated the good performance of the proposed algorithm.

  12. Development of a fast piezo-based frequency tuner for superconducting CH cavities

    International Nuclear Information System (INIS)

    Amberg, Michael

    2015-01-01

    In this thesis, a fast piezo-based frequency tuner for current and prospective superconducting (sc) CH-cavities has been developed. The novel tuning concept differs fundamentally from conventional tuning systems for superconducting cavities. So called dynamic bellow tuners are welded into the resonator to act against slow and fast frequency variations during operation. Because of their adjustable length it is possible to specifically influence the capacitance and therefore the resonance frequency of the cavity. To change the length of the dynamic bellow tuners the frequency tuner drive, which consists of a slow tuning device controlled by a stepper motor and a fast piezo-based tuning system, is mounted to the helium vessel of the cavity. To validate the whole tuning concept a frequency tuner drive prototype was built in the workshop of the Institute for Applied Physics (IAP) of Frankfurt University. First successful room temperature measurements show that the developed frequency tuning system is an excellent and promising candidate to fulfill the requirements of slow and fast frequency tuning of sc CH-cavities during operation. Furthermore, several coupled structural and electromagnetic simulations of the sc 325 MHz CH-cavity as well as the sc 217 MHz CH-cavity have been performed with the simulation softwares ANSYS Workbench and CST MicroWave Studio, respectively. With these simulations it was possible to reduce the required frequency range and thus the mechanical stroke of the dynamic bellow tuners on the one hand, and on the other hand the mechanical stability of the particular CH-cavity was investigated to avoid plastic deformations due to limiting external effects. To verify the accuracy of the coupled simulations the structural mechanical behaviour and the resulting frequency variations of the sc CH-cavities dependent on the external influences were measured at room temperature as well as at cryogenic temperatures around 4.2 K. The measurement results of both

  13. Agent based Particle Swarm Optimization for Load Frequency Control of Distribution Grid

    DEFF Research Database (Denmark)

    Cha, Seung-Tae; Saleem, Arshad; Wu, Qiuwei

    2012-01-01

    This paper presents a Particle Swarm Optimization (PSO) based on multi-agent controller. Real-time digital simulator (RTDS) is used for modelling the power system, while a PSO based multi-agent LFC algorithm is developed in JAVA for communicating with resource agents and determines the scenario...... to stabilize the frequency and voltage after the system enters into the islanding operation mode. The proposed algorithm is based on the formulation of an optimization problem using agent based PSO. The modified IEEE 9-bus system is employed to illustrate the performance of the proposed controller via RTDS...

  14. Recognition of phonetic Arabic figures via wavelet based Mel Frequency Cepstrum using HMMs

    Directory of Open Access Journals (Sweden)

    Ibrahim M. El-Henawy

    2014-04-01

    A comparison between different features of speech is given. The features based on the Cepstrum give accuracy of 94% for speech recognition while the features based on the short time energy in time domain give accuracy of 92%. The features based on formant frequencies give accuracy of 95.5%. It is clear that the features based on MFCCs with accuracy of 98% give the best accuracy rate. So the features depend on MFCCs with HMMs may be recommended for recognition of the spoken Arabic digits.

  15. Crossed SMPS MOSFET-based protection circuit for high frequency ultrasound transceivers and transducers.

    Science.gov (United States)

    Choi, Hojong; Shung, K Kirk

    2014-06-12

    The ultrasonic transducer is one of the core components of ultrasound systems, and the transducer's sensitivity is significantly related the loss of electronic components such as the transmitter, receiver, and protection circuit. In an ultrasonic device, protection circuits are commonly used to isolate the electrical noise between an ultrasound transmitter and transducer and to minimize unwanted discharged pulses in order to protect the ultrasound receiver. However, the performance of the protection circuit and transceiver obviously degrade as the operating frequency or voltage increases. We therefore developed a crossed SMPS (Switching Mode Power Supply) MOSFET-based protection circuit in order to maximize the sensitivity of high frequency transducers in ultrasound systems.The high frequency pulse signals need to trigger the transducer, and high frequency pulse signals must be received by the transducer. We therefore selected the SMPS MOSFET, which is the main component of the protection circuit, to minimize the loss in high frequency operation. The crossed configuration of the protection circuit can drive balanced bipolar high voltage signals from the pulser and transfer the balanced low voltage echo signals from the transducer. The equivalent circuit models of the SMPS MOSFET-based protection circuit are shown in order to select the proper device components. The schematic diagram and operation mechanism of the protection circuit is provided to show how the protection circuit is constructed. The P-Spice circuit simulation was also performed in order to estimate the performance of the crossed MOSFET-based protection circuit. We compared the performance of our crossed SMPS MOSFET-based protection circuit with a commercial diode-based protection circuit. At 60 MHz, our expander and limiter circuits have lower insertion loss than the commercial diode-based circuits. The pulse-echo test is typical method to evaluate the sensitivity of ultrasonic transducers

  16. Low-frequency magnetization processes in chemically etched Co-based amorphous ribbons

    International Nuclear Information System (INIS)

    Betancourt, I.; Martinez, L.A.; Valenzuela, R.

    2005-01-01

    In this report we present a study of the magnetization processes for Co-based amorphous ribbons at low frequencies (10 Hz-13 MHz) as a function of decreasing thicknesses attained by chemical etching. Reversible domain-wall bulging, characterized by initial permeability and relaxation frequency, was monitored by means of inductance measurements. The real part of inductance (proportional to initial permeability) exhibited a decreasing trend with diminishing ribbon thickness, together with an increasing tendency for the relaxation frequency. For high amplitude of the ac field (leading to domain-wall unpinning), reduced ribbon thickness showed a deleterious-enhancement effect on irreversible domain-wall displacement, which was observed for both real and imaginary inductance spectroscopic plots. Results are interpreted in terms of reduced domain-wall pinning distances resulting from thinner alloy samples

  17. Reliability and applications of statistical methods based on oligonucleotide frequencies in bacterial and archaeal genomes

    DEFF Research Database (Denmark)

    Bohlin, J; Skjerve, E; Ussery, David

    2008-01-01

    with here are mainly used to examine similarities between archaeal and bacterial DNA from different genomes. These methods compare observed genomic frequencies of fixed-sized oligonucleotides with expected values, which can be determined by genomic nucleotide content, smaller oligonucleotide frequencies......, or be based on specific statistical distributions. Advantages with these statistical methods include measurements of phylogenetic relationship with relatively small pieces of DNA sampled from almost anywhere within genomes, detection of foreign/conserved DNA, and homology searches. Our aim was to explore...... the reliability and best suited applications for some popular methods, which include relative oligonucleotide frequencies (ROF), di- to hexanucleotide zero'th order Markov methods (ZOM) and 2.order Markov chain Method (MCM). Tests were performed on distant homology searches with large DNA sequences, detection...

  18. Gearbox fault diagnosis based on time-frequency domain synchronous averaging and feature extraction technique

    Science.gov (United States)

    Zhang, Shengli; Tang, Jiong

    2016-04-01

    Gearbox is one of the most vulnerable subsystems in wind turbines. Its healthy status significantly affects the efficiency and function of the entire system. Vibration based fault diagnosis methods are prevalently applied nowadays. However, vibration signals are always contaminated by noise that comes from data acquisition errors, structure geometric errors, operation errors, etc. As a result, it is difficult to identify potential gear failures directly from vibration signals, especially for the early stage faults. This paper utilizes synchronous averaging technique in time-frequency domain to remove the non-synchronous noise and enhance the fault related time-frequency features. The enhanced time-frequency information is further employed in gear fault classification and identification through feature extraction algorithms including Kernel Principal Component Analysis (KPCA), Multilinear Principal Component Analysis (MPCA), and Locally Linear Embedding (LLE). Results show that the LLE approach is the most effective to classify and identify different gear faults.

  19. Generation of ultra-wide and flat optical frequency comb based on electro absorption modulator

    Science.gov (United States)

    Ujjwal; Thangaraj, Jaisingh

    2018-05-01

    A novel technique is proposed for the generation of ultra-wide and flat optical frequency comb (OFC) based on serially cascading three stages of electro absorption modulators (EAMs) through sinusoidal radio frequency (RF) signals by setting frequencies at f GHz, f/2 GHz and f/4 GHz. Here, the first stage acts as subcarrier generator, the second stage acts as subcarrier doubler, and the third stage acts as subcarrier quadrupler. In addition, a higher number of subcarriers can easily be generated by adjusting the driving sinusoidal RF signal. In this paper, cascading three stages of EAMs driven by 50 GHz, 25 GHz and 12.5 GHz clock sources, we obtain 272 subcarriers with spacing of 2.5 GHz and power deviation within 1 dB. Theoretical analysis of serially cascaded EAMs for subcarrier generation is also investigated. Principal analysis and simulation of this technique are demonstrated.

  20. Dual-Phase Lock-In Amplifier Based on FPGA for Low-Frequencies Experiments

    Directory of Open Access Journals (Sweden)

    Gonzalo Macias-Bobadilla

    2016-03-01

    Full Text Available Photothermal techniques allow the detection of characteristics of material without invading it. Researchers have developed hardware for some specific Phase and Amplitude detection (Lock-In Function applications, eliminating space and unnecessary electronic functions, among others. This work shows the development of a Digital Lock-In Amplifier based on a Field Programmable Gate Array (FPGA for low-frequency applications. This system allows selecting and generating the appropriated frequency depending on the kind of experiment or material studied. The results show good frequency stability in the order of 1.0 × 10−9 Hz, which is considered good linearity and repeatability response for the most common Laboratory Amplitude and Phase Shift detection devices, with a low error and standard deviation.

  1. Preliminary In-vivo Results For Spatially Coded Synthetic Transmit Aperture Ultrasound Based On Frequency Division

    DEFF Research Database (Denmark)

    Gran, Fredrik; Hansen, Kristoffer Lindskov; Jensen, Jørgen Arendt

    2006-01-01

    This paper investigates the possibility of using spatial coding based on frequency division for in-vivo synthetic transmit aperture (STA) ultrasound imaging. When using spatial encoding for STA, it is possible to use several transmitters simultaneously and separate the signals at the receiver....... This increases the maximum transmit power compared to conventional STA, where only one transmitter can be active. The signal-to-noise-ratio can therefore he increased and better penetration can be obtained. For frequency division, the coding is achieved by designing a number of transmit waveforms with disjoint...... spectral support, spanning the passband of the ultrasound transducer. The signals can therefore he separated at the receiver using matched filtering. The method is tested using a commercial linear array transducer with a center frequency of 9 MHz and 68% fractional bandwidth. In this paper, the transmit...

  2. A low-frequency vibration energy harvester based on diamagnetic levitation

    Science.gov (United States)

    Kono, Yuta; Masuda, Arata; Yuan, Fuh-Gwo

    2017-04-01

    This article presents 3-degree-of-freedom theoretical modeling and analysis of a low-frequency vibration energy harvester based on diamagnetic levitation. In recent years, although much attention has been placed on vibration energy harvesting technologies, few harvesters still can operate efficiently at extremely low frequencies in spite of large potential demand in the field of structural health monitoring and wearable applications. As one of the earliest works, Liu, Yuan and Palagummi proposed vertical and horizontal diamagnetic levitation systems as vibration energy harvesters with low resonant frequencies. This study aims to pursue further improvement along this direction, in terms of expanding maximum amplitude and enhancing the flexibility of the operation direction for broader application fields by introducing a new topology of the levitation system.

  3. Role of growth temperature on the frequency response characteristics of pentacene-based organic devices

    International Nuclear Information System (INIS)

    Shao, Yayun; Zhang, Yang; He, Wenqiang; Wu, Sujuan; Zeng, Min; Zhang, Zhang; Gao, Xingsen; Lu, Xubing; Liu, J-M; Liu, Chuan; Minari, Takeo

    2015-01-01

    The ac frequency response characteristics (FRC) of organic thin film transistors and metal-insulator semiconductor diodes were highly improved by controlling the morphology and electrical characteristics of semiconducting pentacene films. The devices with films grown at 50 °C show much higher cutoff frequency and better frequency stability of flat-band voltage, as compared to those with films grown at other temperatures below or above. The improvement mainly originates from the maximum field effect carrier mobility of 0.78 cm 2 V −1 s −1 and a small metal/organic contact resistance (R c ) obtained in the optimum thin film transistors. Our results indicate growth temperature precisely tunes the film microstructure and metal/semiconductor interface, which together determine the FRC of pentacene-based organic devices. (paper)

  4. Cryocooled wideband digital channelizing radio-frequency receiver based on low-pass ADC

    International Nuclear Information System (INIS)

    Vernik, Igor V; Kirichenko, Dmitri E; Dotsenko, Vladimir V; Miller, Robert; Webber, Robert J; Shevchenko, Pavel; Talalaevskii, Andrei; Gupta, Deepnarayan; Mukhanov, Oleg A

    2007-01-01

    We have demonstrated a digital receiver performing direct digitization of radio-frequency signals over a wide frequency range from kilohertz to gigahertz. The complete system, consisting of a cryopackaged superconductor all-digital receiver (ADR) chip followed by room-temperature interface electronics and a field programmable gate array (FPGA) based post-processing module, has been developed. The ADR chip comprises a low-pass analog-to-digital converter (ADC) delta modulator with phase modulation-demodulation architecture together with digital in-phase and quadrature mixer and a pair of digital decimation filters. The chip is fabricated using a 4.5 kA cm -2 process and is cryopackaged using a commercial-off-the-shelf cryocooler. Experimental results in HF, VHF, UHF and L bands and their analysis, proving consistent operation of the cryopackaged ADR chip up to 24.32 GHz clock frequency, are presented and discussed

  5. Reduction of low frequency error for SED36 and APS based HYDRA star trackers

    Science.gov (United States)

    Ouaknine, Julien; Blarre, Ludovic; Oddos-Marcel, Lionel; Montel, Johan; Julio, Jean-Marc

    2017-11-01

    In the frame of the CNES Pleiades satellite, a reduction of the star tracker low frequency error, which is the most penalizing error for the satellite attitude control, was performed. For that purpose, the SED36 star tracker was developed, with a design based on the flight qualified SED16/26. In this paper, the SED36 main features will be first presented. Then, the reduction process of the low frequency error will be developed, particularly the optimization of the optical distortion calibration. The result is an attitude low frequency error of 1.1" at 3 sigma along transverse axes. The implementation of these improvements to HYDRA, the new multi-head APS star tracker developed by SODERN, will finally be presented.

  6. Modeling of low frequency dynamics of a smart system and its state feedback based active control

    Science.gov (United States)

    Kant, Mohit; Parameswaran, Arun P.

    2018-01-01

    Major physical systems/structures suffer from unwanted vibrations. For efficient working of such systems, these vibrations have to be controlled. In this paper, mathematical modeling of an aluminum cantilever beam with bonded multiple piezoelectric patches which act as the disturbance generator, sensor as well as control actuator has been presented. This piezoelectric laminate cantilever beam is assumed to be vibrating in a single degree of freedom i.e. in the flexural mode only and the corresponding state space models have been derived analytically using the finite element technique. Dominant modes of flexural vibration are identified from the frequency response of the developed model of the system and finally a state feedback controller based on pole placement technique is designed to actively suppress the vibrations. Through numerous simulations as well as experimental validation, the effectiveness of the active controller in damping the vibrations at various excitation frequencies as well as frequency ranges along the flexural mode is established.

  7. Simulation of power fluctuation of wind farms based on frequency domain

    DEFF Research Database (Denmark)

    Lin, Jin; Sun, Yuanzhang; Li, Guojie

    2011-01-01

    The wind power fluctuation model built up in the frequency domain is mathematically equivalent with that in the time domain, and has a clearer physical meaning therefore describes the fluctuation more accurately. However, the simulation of this model is required to deal with the time......-frequency transformation related to the power spectrum density (PSD), which is more special and complicated than normal transformations. Meanwhile, the computational complexity also increases significantly, more computation resources are needed. These problems negatively affect the engineering application of the model....... To overcome these disadvantages, the physical meaning of PSD based on fundamental concepts is presented, so that the specialties of this model compared with conventional ones can be understood. Then the time-frequency transformation algorithm is derived, which is fast to be implemented in digital computers...

  8. Frequency locking of a field-widened Michelson interferometer based on optimal multi-harmonics heterodyning.

    Science.gov (United States)

    Cheng, Zhongtao; Liu, Dong; Zhou, Yudi; Yang, Yongying; Luo, Jing; Zhang, Yupeng; Shen, Yibing; Liu, Chong; Bai, Jian; Wang, Kaiwei; Su, Lin; Yang, Liming

    2016-09-01

    A general resonant frequency locking scheme for a field-widened Michelson interferometer (FWMI), which is intended as a spectral discriminator in a high-spectral-resolution lidar, is proposed based on optimal multi-harmonics heterodyning. By transferring the energy of a reference laser to multi-harmonics of different orders generated by optimal electro-optic phase modulation, the heterodyne signal of these multi-harmonics through the FWMI can reveal the resonant frequency drift of the interferometer very sensitively within a large frequency range. This approach can overcome the locking difficulty induced by the low finesse of the FWMI, thus contributing to excellent locking accuracy and lock acquisition range without any constraint on the interferometer itself. The theoretical and experimental results are presented to verify the performance of this scheme.

  9. Radio frequency electromagnetic field compliance assessment of multi-band and MIMO equipped radio base stations.

    Science.gov (United States)

    Thors, Björn; Thielens, Arno; Fridén, Jonas; Colombi, Davide; Törnevik, Christer; Vermeeren, Günter; Martens, Luc; Joseph, Wout

    2014-05-01

    In this paper, different methods for practical numerical radio frequency exposure compliance assessments of radio base station products were investigated. Both multi-band base station antennas and antennas designed for multiple input multiple output (MIMO) transmission schemes were considered. For the multi-band case, various standardized assessment methods were evaluated in terms of resulting compliance distance with respect to the reference levels and basic restrictions of the International Commission on Non-Ionizing Radiation Protection. Both single frequency and multiple frequency (cumulative) compliance distances were determined using numerical simulations for a mobile communication base station antenna transmitting in four frequency bands between 800 and 2600 MHz. The assessments were conducted in terms of root-mean-squared electromagnetic fields, whole-body averaged specific absorption rate (SAR) and peak 10 g averaged SAR. In general, assessments based on peak field strengths were found to be less computationally intensive, but lead to larger compliance distances than spatial averaging of electromagnetic fields used in combination with localized SAR assessments. For adult exposure, the results indicated that even shorter compliance distances were obtained by using assessments based on localized and whole-body SAR. Numerical simulations, using base station products employing MIMO transmission schemes, were performed as well and were in agreement with reference measurements. The applicability of various field combination methods for correlated exposure was investigated, and best estimate methods were proposed. Our results showed that field combining methods generally considered as conservative could be used to efficiently assess compliance boundary dimensions of single- and dual-polarized multicolumn base station antennas with only minor increases in compliance distances. © 2014 Wiley Periodicals, Inc.

  10. Frequency specificity and left-ear advantage of medial olivocochlear efferent modulation: a study based on stimulus frequency otoacoustic emission.

    Science.gov (United States)

    Xing, Dongjia; Gong, Qin

    2017-09-06

    The medial olivocochlear (MOC) bundle is an auditory nucleus that projects efferent nerve fibers to the outer hair cells (OHCs) for synaptic innervation. The aim of the present study was to investigate the possible existence of frequency and ear specificity in MOC efferent modulation, as well as how MOC activation influences cochlear tuning. Stimulus frequency otoacoustic emissions (SFOAEs) were used to study MOC efferent modulation. Therefore, the current experiment was designed to compare the degree of SFOAE suppression in the both ears of 20 individuals at 1, 2, 4, and 8 kHz. We also compared changes in Q10 values of SFOAE suppression tuning curves at 1, 2, and 4 kHz under contralateral acoustic stimulation (CAS) and no-CAS conditions. We observed a significant reduction in SFOAE magnitude in the CAS condition compared with the no-CAS condition at 1 and 2 kHz in the left ear. A significant difference in CAS suppression was also found between the left and right ears at 1 and 2 kHz, with larger CAS suppression in the left ear. CAS further produced a statistically significant increase in the Q10 value at 1 kHz and a significant reduction in Q10 values at 2 and 4 kHz. These findings suggest a left-ear advantage in terms of CAS-induced MOC efferent SFOAE suppression, with larger MOC efferent modulation for lower frequencies, and cochlear tuning was sharpened by means of MOC activation at lower frequencies and broadened at higher frequencies.

  11. Entropy-based derivation of generalized distributions for hydrometeorological frequency analysis

    Science.gov (United States)

    Chen, Lu; Singh, Vijay P.

    2018-02-01

    Frequency analysis of hydrometeorological and hydrological extremes is needed for the design of hydraulic and civil infrastructure facilities as well as water resources management. A multitude of distributions have been employed for frequency analysis of these extremes. However, no single distribution has been accepted as a global standard. Employing the entropy theory, this study derived five generalized distributions for frequency analysis that used different kinds of information encoded as constraints. These distributions were the generalized gamma (GG), the generalized beta distribution of the second kind (GB2), and the Halphen type A distribution (Hal-A), Halphen type B distribution (Hal-B) and Halphen type inverse B distribution (Hal-IB), among which the GG and GB2 distribution were previously derived by Papalexiou and Koutsoyiannis (2012) and the Halphen family was first derived using entropy theory in this paper. The entropy theory allowed to estimate parameters of the distributions in terms of the constraints used for their derivation. The distributions were tested using extreme daily and hourly rainfall data. Results show that the root mean square error (RMSE) values were very small, which indicated that the five generalized distributions fitted the extreme rainfall data well. Among them, according to the Akaike information criterion (AIC) values, generally the GB2 and Halphen family gave a better fit. Therefore, those general distributions are one of the best choices for frequency analysis. The entropy-based derivation led to a new way for frequency analysis of hydrometeorological extremes.

  12. System frequency support of permanent magnet synchronous generator-based wind power plant

    Science.gov (United States)

    Wu, Ziping

    With ever-increasing penetration of wind power into modern electric grids all over the world, a trending replacement of conventional synchronous generators by large wind power plants will likely result in the poor overall frequency regulation performance. On the other hand, permanent magnet synchronous generator wind Turbine System (PMSG-WTG) with full power back to back converters tends to become one of the most promising wind turbine technologies thanks to various advantages. It possesses a significant amount of kinetic energy stored in the rotating mass of turbine blades, which can be utilized to enhance the total inertia of power system. Additionally, the deloaded operation and decoupled control of active and reactive power make it possible for PMSG-WTG to provide a fast frequency regulation through full-power converter. First of all, a comprehensive and in-depth survey is conducted to analyze the motivations for incorporating the inertial response and frequency regulation of VSWT into the system frequency regulation. Besides, control classifications, fundamental control concepts and advanced control schemes implemented for auxiliary frequency support of individual WT or wind power plant are elaborated along with a comparison of the potential frequency regulation capabilities of four major types of WTs. Secondly, a Controls Advanced Research Turbine2-Permanent Magnet Synchronous Generator wind turbine (CART2-PMSG) integrated model representing the typical configuration and operation characteristics of PMSG-WT is established in Matlab/Simulink,. Meanwhile, two different rotor-side converter control schemes, including rotor speed-based control and active power-based control, are integrated into this CART2-PMSG integrated model to perform Maximum Power Point Tracking (MPPT) operation over a wide range of wind speeds, respectively. Thirdly, a novel comprehensive frequency regulation (CFR) control scheme is developed and implemented into the CART2-PMSG model based

  13. Time-frequency feature analysis and recognition of fission neutrons signal based on support vector machine

    International Nuclear Information System (INIS)

    Jin Jing; Wei Biao; Feng Peng; Tang Yuelin; Zhou Mi

    2010-01-01

    Based on the interdependent relationship between fission neutrons ( 252 Cf) and fission chain ( 235 U system), the paper presents the time-frequency feature analysis and recognition in fission neutron signal based on support vector machine (SVM) through the analysis on signal characteristics and the measuring principle of the 252 Cf fission neutron signal. The time-frequency characteristics and energy features of the fission neutron signal are extracted by using wavelet decomposition and de-noising wavelet packet decomposition, and then applied to training and classification by means of support vector machine based on statistical learning theory. The results show that, it is effective to obtain features of nuclear signal via wavelet decomposition and de-noising wavelet packet decomposition, and the latter can reflect the internal characteristics of the fission neutron system better. With the training accomplished, the SVM classifier achieves an accuracy rate above 70%, overcoming the lack of training samples, and verifying the effectiveness of the algorithm. (authors)

  14. An Islanding Detection Method by Using Frequency Positive Feedback Based on FLL for Single-Phase Microgrid

    DEFF Research Database (Denmark)

    Sun, Qinfei; Guerrero, Josep M.; Jing, Tianjun

    2017-01-01

    An active islanding detection method based on Frequency-Locked Loop (FLL) for constant power controlled inverter in single-phase microgrid is proposed. This method generates a phase shift comparing the instantaneous frequency obtained from FLL unit with the nominal frequency to modify the reference...

  15. Intense high-frequency gyrotron-based microwave beams for material processing

    Energy Technology Data Exchange (ETDEWEB)

    Hardek, T.W.; Cooke, W.D.; Katz, J.D.; Perry, W.L.; Rees, D.E.

    1997-03-01

    Microwave processing of materials has traditionally utilized frequencies in the 0.915 and 2.45 GHz regions. Microwave power sources are readily available at these frequencies but the relatively long wavelengths can present challenges in uniformly heating materials. An additional difficulty is the poor coupling of ceramic based materials to the microwave energy. Los Alamos National Laboratory scientists, working in conjunction with the National Center for Manufacturing Sciences (NCMS), have assembled a high-frequency demonstration processing facility utilizing gyrotron based RF sources. The facility is primarily intended to demonstrate the unique features available at frequencies as high as 84 GHz. The authors can readily provide quasi-optical, 37 GHz beams at continuous wave (CW) power levels in the 10 kW range. They have also provided beams at 84 GHz at 10 kW CW power levels. They are presently preparing a facility to demonstrate the sintering of ceramics at 30 GHz. This paper presents an overview of the present demonstration processing facility and describes some of the features they have available now and will have available in the near future.

  16. A feedback-retransmission based asynchronous frequency hopping MAC protocol for military aeronautical ad hoc networks

    Directory of Open Access Journals (Sweden)

    Jinhui TANG

    2018-05-01

    Full Text Available Attacking time-sensitive targets has rigid demands for the timeliness and reliability of information transmission, while typical Media Access Control (MAC designed for this application works well only in very light-load scenarios; as a consequence, the performances of system throughput and channel utilization are degraded. For this problem, a feedback-retransmission based asynchronous FRequency hopping Media Access (FRMA control protocol is proposed. Burst communication, asynchronous Frequency Hopping (FH, channel coding, and feedback retransmission are utilized in FRMA. With the mechanism of asynchronous FH, immediate packet transmission and multi-packet reception can be realized, and thus the timeliness is improved. Furthermore, reliability can be achieved via channel coding and feedback retransmission. With theories of queuing theory, Markov model, packets collision model, and discrete Laplace transformation, the formulas of packet success probability, system throughput, average packet end-to-end delay, and delay distribution are obtained. The approximation accuracy of theoretical derivation is verified by experimental results. Within a light-load network, the proposed FRMA has the ability of millisecond delay and 99% reliability as well as outperforms the non-feedback-retransmission based asynchronous frequency hopping media access control protocol. Keywords: Ad hoc networks, Aeronautical communications, Frequency hopping, Media Access Control (MAC, Time-sensitive

  17. Displacement sensing based on resonant frequency monitoring of electrostatically actuated curved micro beams

    International Nuclear Information System (INIS)

    Krakover, Naftaly; Krylov, Slava; Ilic, B Robert

    2016-01-01

    The ability to control nonlinear interactions of suspended mechanical structures offers a unique opportunity to engineer rich dynamical behavior that extends the dynamic range and ultimate device sensitivity. We demonstrate a displacement sensing technique based on resonant frequency monitoring of curved, doubly clamped, bistable micromechanical beams interacting with a movable electrode. In this configuration, the electrode displacement influences the nonlinear electrostatic interactions, effective stiffness and frequency of the curved beam. Increased sensitivity is made possible by dynamically operating the beam near the snap-through bistability onset. Various in-plane device architectures were fabricated from single crystal silicon and measured under ambient conditions using laser Doppler vibrometry. In agreement with the reduced order Galerkin-based model predictions, our experimental results show a significant resonant frequency reduction near critical snap-through, followed by a frequency increase within the post-buckling configuration. Interactions with a stationary electrode yield a voltage sensitivity up to  ≈560 Hz V −1 and results with a movable electrode allow motion sensitivity up to  ≈1.5 Hz nm −1 . Our theoretical and experimental results collectively reveal the potential of displacement sensing using nonlinear interactions of geometrically curved beams near instabilities, with possible applications ranging from highly sensitive resonant inertial detectors to complex optomechanical platforms providing an interface between the classical and quantum domains. (paper)

  18. Frequency-tuned microwave photon counter based on a superconductive quantum interferometer

    Science.gov (United States)

    Shnyrkov, V. I.; Yangcao, Wu; Soroka, A. A.; Turutanov, O. G.; Lyakhno, V. Yu.

    2018-03-01

    Various types of single-photon counters operating in infrared, ultraviolet, and optical wavelength ranges are successfully used to study electromagnetic fields, analyze radiation sources, and solve problems in quantum informatics. However, their operating principles become ineffective at millimeter band, S-band, and ultra-high frequency bands of wavelengths due to the decrease in quantum energy by 4-5 orders of magnitude. Josephson circuits with discrete Hamiltonians and qubits are a good foundation for the construction of single-photon counters at these frequencies. This paper presents a frequency-tuned microwave photon counter based on a single-junction superconducting quantum interferometer and flux qutrit. The control pulse converts the interferometer into a two-level system for resonance absorption of photons. Decay of the photon-induced excited state changes the magnetic flux in the interferometer, which is measured by a SQUID magnetometer. Schemes for recording the magnetic flux using a DC SQUID or ideal parametric detector, based on a qutrit with high-frequency excitation, are discussed. It is shown that the counter consisting of an interferometer with a Josephson junction and a parametric detector demonstrates high performance and is capable of detecting single photons in a microwave band.

  19. Wideband optical vector network analyzer based on optical single-sideband modulation and optical frequency comb.

    Science.gov (United States)

    Xue, Min; Pan, Shilong; He, Chao; Guo, Ronghui; Zhao, Yongjiu

    2013-11-15

    A novel approach to increase the measurement range of the optical vector network analyzer (OVNA) based on optical single-sideband (OSSB) modulation is proposed and experimentally demonstrated. In the proposed system, each comb line in an optical frequency comb (OFC) is selected by an optical filter and used as the optical carrier for the OSSB-based OVNA. The frequency responses of an optical device-under-test (ODUT) are thus measured channel by channel. Because the comb lines in the OFC have fixed frequency spacing, by fitting the responses measured in all channels together, the magnitude and phase responses of the ODUT can be accurately achieved in a large range. A proof-of-concept experiment is performed. A measurement range of 105 GHz and a resolution of 1 MHz is achieved when a five-comb-line OFC with a frequency spacing of 20 GHz is applied to measure the magnitude and phase responses of a fiber Bragg grating.

  20. Low-cost, smartphone based frequency doubling technology visual field testing using virtual reality (Conference Presentation)

    Science.gov (United States)

    Alawa, Karam A.; Sayed, Mohamed; Arboleda, Alejandro; Durkee, Heather A.; Aguilar, Mariela C.; Lee, Richard K.

    2017-02-01

    Glaucoma is the leading cause of irreversible blindness worldwide. Due to its wide prevalence, effective screening tools are necessary. The purpose of this project is to design and evaluate a system that enables portable, cost effective, smartphone based visual field screening based on frequency doubling technology. The system is comprised of an Android smartphone to display frequency doubling stimuli and handle processing, a Bluetooth remote for user input, and a virtual reality headset to simulate the exam. The LG Nexus 5 smartphone and BoboVR Z3 virtual reality headset were used for their screen size and lens configuration, respectively. The system is capable of running the C-20, N-30, 24-2, and 30-2 testing patterns. Unlike the existing system, the smartphone FDT tests both eyes concurrently by showing the same background to both eyes but only displaying the stimulus to one eye at a time. Both the Humphrey Zeiss FDT and the smartphone FDT were tested on five subjects without a history of ocular disease with the C-20 testing pattern. The smartphone FDT successfully produced frequency doubling stimuli at the correct spatial and temporal frequency. Subjects could not tell which eye was being tested. All five subjects preferred the smartphone FDT to the Humphrey Zeiss FDT due to comfort and ease of use. The smartphone FDT is a low-cost, portable visual field screening device that can be used as a screening tool for glaucoma.

  1. Frequency Dependence of Electrical Parameters of an Organic-Inorganic Hybrid Composite Based Humidity Sensor

    Directory of Open Access Journals (Sweden)

    Rizwan Akram

    2016-05-01

    Full Text Available The present study highlights the interdependence of ambient humidity levels on the electrical parameters of organic-inorganic hybrid composite based humidity sensor at varied AC frequencies of input signal. Starting from the bottom, the layer stack of the fabricated humidity sensor was 200-nm silver (Ag thin film and 4 μm spun-coated PEPC+NiPC+Cu2O active layer. Silver thin films were deposited by thermal evaporator on well cleaned microscopic glass slides, which served as a substrate. Conventional optical lithography procedure was adapted to define pairs of silver-silver surface electrodes with two sorts of configurations, i.e., interdigitated and rectangular. Humidity-sensitive layers of organic-inorganic composite were then spun-cast upon the channel between the silver electrodes. The changes in relative humidity levels induced variation in capacitance and impedance of the sensors. These variations in electrical parameters of sensors were also found to be highly dependent upon frequency of input AC signal. Our findings reveal that the organic-inorganic composite shows higher humidity sensitivity at smaller orders of frequency. This finding is in accordance with the established fact that organic semiconductors-based devices are not applicable for high frequency applications due to their lower charge carrier mobility values. Two distinct geometries of semiconducting medium between the silver electrodes were investigated to optimize the sensing parameters of the humidity sensor. Furthermore, the effect of temperature change on the resistance of organic composite has also been studied.

  2. An ultra-stable iodine-based frequency reference for space applications

    Science.gov (United States)

    Schuldt, Thilo; Braxmaier, Claus; Doeringshoff, Klaus; Keetman, Anja; Reggentin, Matthias; Kovalchuk, Evgeny; Peters, Achim

    2012-07-01

    Future space missions require for ultra-stable optical frequency references. Examples are the gravitational wave detector LISA/eLISA (Laser Interferometer Space Antenna), the SpaceTime Asymmetry Research (STAR) program, the aperture-synthesis telescope Darwin and the GRACE (Gravity Recovery and Climate Experiment) follow on mission exploring Earth's gravity. As high long-term frequency stability is required, lasers stabilized to atomic or molecular transitions are preferred, also offering an absolute frequency reference. Frequency stabilities in the 10 ^{-15} domains at longer integration times (up to several hours) are demonstrated in laboratory experiments using setups based on Doppler-free spectroscopy. Such setups with a frequency stability comparable to the hydrogen maser in the microwave domain, have the potential to be developed space compatible on a relatively short time scale. Here, we present the development of ultra-stable optical frequency references based on modulation-transfer spectroscopy of molecular iodine. Noise levels of 2\\cdot10 ^{-14} at an integration time of 1 s and below 3\\cdot10 ^{-15} at integration times between 100 s and 1000 s are demonstrated with a laboratory setup using an 80 cm long iodine cell in single-pass configuration in combination with a frequency-doubled Nd:YAG laser and standard optical components and optomechanic mounts. The frequency stability at longer integration times is (amongst other things) limited by the dimensional stability of the optical setup, i.e. by th pointing stability of the two counter-propagating beams overlapped in the iodine cell. With the goal of a future space compatible setup, a compact frequency standard on EBB (elegant breadboard) level was realized. The spectroscopy unit utilizes a baseplate made of Clearceram-HS, a glass ceramics with an ultra-low coefficient of thermal expansion of 2\\cdot10 ^{-8} K ^{-1}. The optical components are joint to the baseplate using adhesive bonding technology

  3. Ultrasensitive immunoradiometric assay for chorionic gonadotropin which does not cross-react with luteinizing hormone nor free β chain of hCG and which detects hCG in blood of non-pregnant humans

    International Nuclear Information System (INIS)

    Griffin, J.; Odell, W.D.

    1987-01-01

    A sensitive, non-competitive, two-monoclonal antibody, sandwich-type or immunoradiometric assay has been developed for human chorionic gonadotropin (hCG) which shows no cross-reaction with the free β chain of hCG nor with human luteinizing hormone (LH). In the assay procedure, two, highly selected monoclonal antibodies reacted in solution with hCG to be quantified. One antibody was covalently conjugated to biotin. This antibody was specific for the β subunit of hCG, and showed no reaction with LH nor the α subunit. The second antibody was labelled with 125 I and was specific for intact hCG and LH, showing no cross-reaction with βhCG nor the α subunit. The separation system was a polystyrene ball conjugated with biotin. This ball bound via an avidin bridge the monoclonal 'sandwich' containing hCG. Counts per minute bound to the ball were directly proportional to the amount of hCG present. The assay was specific for whole hCG and showed no reaction with βhCG, βLH, intact LH nor the free α subunit. Sensitivity was adequate to detect 'hCG-like' material in all post menopausal women and, when single samples were obtained, in over 2/3 of normal men. When multiple samples were obtained, 'hCG-like' material was detectable in all eugonadal adults studied. 27 refs.; 4 figs.; 1 table

  4. a Thz Photomixing Synthesizer Based on a Fiber Frequency Comb for High Resolution Rotational Spectroscopy

    Science.gov (United States)

    Hindle, Francis; Mouret, Gael; Cuisset, Arnaud; Yang, Chun; Eliet, Sophie; Bocquet, Robin

    2010-06-01

    To date the principal application for photomixing sources has been for high resolution spectroscopy of gases due to the large tuning range and spectral purity. New Developments of the Opto-Electronic THz Spectrometer have been performed in order to obtain a powerful tool for High-Resolution Spectroscopy. The combination of two extended cavity laser diodes and fast charge carrier lifetime semiconductor materials has allowed a continuous-wave THz spectrometer to be constructed based on optical heterodyning. Unlike many THz sources, this instrument gives access to all frequencies in the range 0.3 to 3.5 THz with a resolution of 1 MHz. The main spectroscopic applications of this spectrometer were dedicated to line profile analysis of rotational transitions referenced in the spectroscopic databases. One limitation of the THz spectrometer was accuracy with which the generated frequency is known. Recently, this obstacle has been circled with the construction of a photomixing spectrometer where the two pump lasers are phase locked to two modes of a repetition rate stabilized frequency doubled fiber laser frequency comb. In order to achieve a tuning range in excess to 100 MHz a third cw laser was required in the new configuration of the THz spectrometer. To assess the performances of this instrument, the frequencies of the pure rotational transitions of OCS molecules have been measured between 0,8 to 1,2 THz. A rms inferior to 100 kHz, deduced from the frequencies measured, demonstrates that the THz photomixing synthesizer is now able to be competitive with microwave and submillimeter techniques. S. Matton, F. Rohart, R. Bocquet, D. Bigourd, A. Cuisset, F. Hindle, G. Mouret, J. Mol. Spectrosc., 2006, 239: 182. C. Yang, J. Buldyreva, I. E. Gordon, F. Rohart, A. Cuisset, G. Mouret, R. Bocquet, F. Hindle, J. Quant. Spectrosc. Radiat. Transfer, 2008, 109: 2857. G. Mouret, F. Hindle, A. Cuisset, C. Yang, R. Bocquet, M. Lours, D. Rovera, Opt. Express, 2009, 17: 22031.

  5. Power MOSFET-diode-based limiter for high-frequency ultrasound systems.

    Science.gov (United States)

    Choi, Hojong; Kim, Min Gon; Cummins, Thomas M; Hwang, Jae Youn; Shung, K Kirk

    2014-10-01

    The purpose of the limiter circuits used in the ultrasound imaging systems is to pass low-voltage echo signals generated by ultrasonic transducers while preventing high-voltage short pulses transmitted by pulsers from damaging front-end circuits. Resistor-diode-based limiters (a 50 Ω resistor with a single cross-coupled diode pair) have been widely used in pulse-echo measurement and imaging system applications due to their low cost and simple architecture. However, resistor-diode-based limiters may not be suited for high-frequency ultrasound transducer applications since they produce large signal conduction losses at higher frequencies. Therefore, we propose a new limiter architecture utilizing power MOSFETs, which we call a power MOSFET-diode-based limiter. The performance of a power MOSFET-diode-based limiter was evaluated with respect to insertion loss (IL), total harmonic distortion (THD), and response time (RT). We compared these results with those of three other conventional limiter designs and showed that the power MOSFET-diode-based limiter offers the lowest IL (-1.33 dB) and fastest RT (0.10 µs) with the lowest suppressed output voltage (3.47 Vp-p) among all the limiters at 70 MHz. A pulse-echo test was performed to determine how the new limiter affected the sensitivity and bandwidth of the transducer. We found that the sensitivity and bandwidth of the transducer were 130% and 129% greater, respectively, when combined with the new power MOSFET-diode-based limiter versus the resistor-diode-based limiter. Therefore, these results demonstrate that the power MOSFET-diode-based limiter is capable of producing lower signal attenuation than the three conventional limiter designs at higher frequency operation. © The Author(s) 2014.

  6. Frequency spectrum analysis of 252Cf neutron source based on LabVIEW

    International Nuclear Information System (INIS)

    Mi Deling; Li Pengcheng

    2011-01-01

    The frequency spectrum analysis of 252 Cf Neutron source is an extremely important method in nuclear stochastic signal processing. Focused on the special '0' and '1' structure of neutron pulse series, this paper proposes a fast-correlation algorithm to improve the computational rate of the spectrum analysis system. And the multi-core processor technology is employed as well as multi-threaded programming techniques of LabVIEW to construct frequency spectrum analysis system of 252 Cf neutron source based on LabVIEW. It not only obtains the auto-correlation and cross correlation results, but also auto-power spectrum,cross-power spectrum and ratio of spectral density. The results show that: analysis tools based on LabVIEW improve the fast auto-correlation and cross correlation code operating efficiency about by 25% to 35%, also verify the feasibility of using LabVIEW for spectrum analysis. (authors)

  7. Testing General Relativity with Low-Frequency, Space-Based Gravitational-Wave Detectors

    Directory of Open Access Journals (Sweden)

    John G. Baker

    2013-09-01

    Full Text Available We review the tests of general relativity that will become possible with space-based gravitational-wave detectors operating in the ∼ 10^{-5} – 1 Hz low-frequency band. The fundamental aspects of gravitation that can be tested include the presence of additional gravitational fields other than the metric; the number and tensorial nature of gravitational-wave polarization states; the velocity of propagation of gravitational waves; the binding energy and gravitational-wave radiation of binaries, and therefore the time evolution of binary inspirals; the strength and shape of the waves emitted from binary mergers and ringdowns; the true nature of astrophysical black holes; and much more. The strength of this science alone calls for the swift implementation of a space-based detector; the remarkable richness of astrophysics, astronomy, and cosmology in the low-frequency gravitational-wave band make the case even stronger.

  8. Degradation Behaviour of Lithium-Ion Batteries based on Field Measured Frequency Regulation Mission Profile

    DEFF Research Database (Denmark)

    Stroe, Daniel Ioan; Swierczynski, Maciej Jozef; Stroe, Ana-Irina

    2015-01-01

    Energy storage systems based on Lithium-ion batteries have been proposed as an environmental friendly alternative to traditional conventional generating units for providing grid frequency regulation. One major challenge regarding the use of Lithium-ion batteries in such applications is their cost...... competitiveness in comparison to other storage technologies or with the traditional frequency regulation methods. In order to surpass this challenge and to allow for optimal sizing and proper use of the battery, accurate knowledge about the lifetime of the Lithium-ion battery and its degradation behaviour...... is required. This paper aims to investigate, based on a laboratory developed lifetime model, the degradation behaviour of the performance parameters (i.e., capacity and power capability) of a Lithium-ion battery cell when it is subjected to a field measured mission profile, which is characteristic...

  9. Testing General Relativity with Low-Frequency, Space-Based Gravitational-Wave Detectors.

    Science.gov (United States)

    Gair, Jonathan R; Vallisneri, Michele; Larson, Shane L; Baker, John G

    2013-01-01

    We review the tests of general relativity that will become possible with space-based gravitational-wave detectors operating in the ∼ 10 -5 - 1 Hz low-frequency band. The fundamental aspects of gravitation that can be tested include the presence of additional gravitational fields other than the metric; the number and tensorial nature of gravitational-wave polarization states; the velocity of propagation of gravitational waves; the binding energy and gravitational-wave radiation of binaries, and therefore the time evolution of binary inspirals; the strength and shape of the waves emitted from binary mergers and ringdowns; the true nature of astrophysical black holes; and much more. The strength of this science alone calls for the swift implementation of a space-based detector; the remarkable richness of astrophysics, astronomy, and cosmology in the low-frequency gravitational-wave band make the case even stronger.

  10. Historical and future drought in Bangladesh using copula-based bivariate regional frequency analysis

    Science.gov (United States)

    Mortuza, Md Rubayet; Moges, Edom; Demissie, Yonas; Li, Hong-Yi

    2018-02-01

    The study aims at regional and probabilistic evaluation of bivariate drought characteristics to assess both the past and future drought duration and severity in Bangladesh. The procedures involve applying (1) standardized precipitation index to identify drought duration and severity, (2) regional frequency analysis to determine the appropriate marginal distributions for both duration and severity, (3) copula model to estimate the joint probability distribution of drought duration and severity, and (4) precipitation projections from multiple climate models to assess future drought trends. Since drought duration and severity in Bangladesh are often strongly correlated and do not follow same marginal distributions, the joint and conditional return periods of droughts are characterized using the copula-based joint distribution. The country is divided into three homogeneous regions using Fuzzy clustering and multivariate discordancy and homogeneity measures. For given severity and duration values, the joint return periods for a drought to exceed both values are on average 45% larger, while to exceed either value are 40% less than the return periods from the univariate frequency analysis, which treats drought duration and severity independently. These suggest that compared to the bivariate drought frequency analysis, the standard univariate frequency analysis under/overestimate the frequency and severity of droughts depending on how their duration and severity are related. Overall, more frequent and severe droughts are observed in the west side of the country. Future drought trend based on four climate models and two scenarios showed the possibility of less frequent drought in the future (2020-2100) than in the past (1961-2010).

  11. Consumer Product Perceptions and Salmon Consumption Frequency: The Role of Heterogeneity Based on Food Lifestyle Segments

    OpenAIRE

    Yuko Onozaka; Håvard Hansen; Arne Sørvig

    2014-01-01

    Seafood consumers are vastly heterogeneous in terms of their knowledge, confidence, and perceptions about seafood. This article examines the relationship between consumer perceptions (healthiness, value for money, and convenience) and salmon consumption frequencies while modeling unobserved consumer heterogeneity by segmenting consumers based on their food-related lifestyle. We employ latent class analysis (LCA) that embeds the structural equation modeling (SEM) to ensure the latent nature of...

  12. Pulse Retrieval Algorithm for Interferometric Frequency-Resolved Optical Gating Based on Differential Evolution

    OpenAIRE

    Hyyti, Janne; Escoto, Esmerando; Steinmeyer, Günter

    2017-01-01

    A novel algorithm for the ultrashort laser pulse characterization method of interferometric frequency-resolved optical gating (iFROG) is presented. Based on a genetic method, namely differential evolution, the algorithm can exploit all available information of an iFROG measurement to retrieve the complex electric field of a pulse. The retrieval is subjected to a series of numerical tests to prove robustness of the algorithm against experimental artifacts and noise. These tests show that the i...

  13. Radio frequency identification and time-driven activity based costing:RFID-TDABC application in warehousing

    OpenAIRE

    Bahr, Witold; Price, Brian J

    2016-01-01

    Purpose: This paper extends the use of Radio Frequency Identification (RFID) data for accounting of warehouse costs and services. Time Driven Activity Based Costing (TDABC) methodology is enhanced with the real-time collected RFID data about duration of warehouse activities. This allows warehouse managers to have accurate and instant calculations of costs. The RFID enhanced TDABC (RFID-TDABC) is proposed as a novel application of the RFID technology. Research Approach: Application of RFID-TDA...

  14. Bipolar-power-transistor-based limiter for high frequency ultrasound imaging systems.

    Science.gov (United States)

    Choi, Hojong; Yang, Hao-Chung; Shung, K Kirk

    2014-03-01

    High performance limiters are described in this paper for applications in high frequency ultrasound imaging systems. Limiters protect the ultrasound receiver from the high voltage (HV) spikes produced by the transmitter. We present a new bipolar power transistor (BPT) configuration and compare its design and performance to a diode limiter used in traditional ultrasound research and one commercially available limiter. Limiter performance depends greatly on the insertion loss (IL), total harmonic distortion (THD) and response time (RT), each of which will be evaluated in all the limiters. The results indicated that, compared with commercial limiter, BPT-based limiter had less IL (-7.7 dB), THD (-74.6 dB) and lower RT (43 ns) at 100 MHz. To evaluate the capability of these limiters, they were connected to a 100 MHz single element transducer and a two-way pulse-echo test was performed. It was found that the -6 dB bandwidth and sensitivity of the transducer using BPT-based limiter were better than those of the commercial limiter by 22% and 140%, respectively. Compared to the commercial limiter, BPT-based limiter is shown to be capable of minimizing signal attenuation, RT and THD at high frequencies and is thus suited for high frequency ultrasound applications. Copyright © 2013 Elsevier B.V. All rights reserved.

  15. Frequency Monitoring and Control during Power System Restoration Based on Wide Area Measurement System

    Directory of Open Access Journals (Sweden)

    Saber Nourizadeh

    2011-01-01

    Full Text Available Frequency control during power system restoration has not been strongly addressed. Operators are often concerned with the offline sizing of load and generation steps, but, nowadays, the introduction of Wide Area Measurement System (WAMS makes it possible to monitor the stability of power system online. The constraints of WAMS operation result in some changes in power system frequency control. This paper proposes a novel methodology for frequency control and monitoring during the early steps of power system restoration based on WAMS. Detailed load modeling is achieved based on the static load modeling approach. Power generators' modeling is also accomplished utilizing the single machine equivalent of the power system based on PMU measurements. Simulation results of the presented methodology on the 39 bus New England power system clearly show the effectiveness and applicability of the proposed method. The simulation results show that the presented approach has a completely acceptable precision and an outstanding speed with less than 0.05% error. The outstanding speed of the presented approach along with the result precision will result in a great promotion in power system restoration methodologies.

  16. A Kind of Single-frequency Precise Point Positioning Algorithm Based on the Raw Observations

    Directory of Open Access Journals (Sweden)

    WANG Li

    2015-01-01

    Full Text Available A kind of single-frequency precise point positioning (PPP algorithm based on the raw observations is presented in this paper. By this algorithm, the ionospheric delays were corrected efficiently by means of adding the ionospheric delay prior information and the virtual observation equations with the spatial and temporal constraints, and they were estimated as the unknown parameters simultaneously with other positioning parameters. Then, a dataset of 178 International GNSS Service (IGS stations at day 72 in 2012 was used to evaluate the convergence speed, the positioning accuracy and the accuracy of the retrieved ionospheric VTEC. The series of results have shown that the convergence speed and stability of the new algorithm are much better than the traditional PPP algorithm, and the positioning accuracy of about 2-3 cm and 2-3 dm can be achieved respectively for static and kinematic positioning with the single-frequency observations' daily solution. The average bias of ionospheric total electron content retrieved by the single-frequency PPP and dual-frequency PPP is less than 5 TECU. So the ionospheric total electron content can be used as a kind of auxiliary products in GPS positioning.

  17. Powering autonomous sensors with miniaturized piezoelectric based energy harvesting devices operating at very low frequency

    Science.gov (United States)

    Ferin, G.; Bantignies, C.; Le Khanh, H.; Flesch, E.; Nguyen-Dinh, A.

    2015-12-01

    Harvesting energy from ambient mechanical vibrations is a smart and efficient way to power autonomous sensors and support innovative developments in IoT (Internet of Things), WSN (Wireless Sensor Network) and even implantable medical devices. Beyond the environmental operating conditions, efficiency of such devices is mainly related to energy source properties like the amplitude of vibrations and its spectral contain and some of these applications exhibit a quite low frequency spectrum where harvesting surrounding mechanical energy make sense, typically 5-50Hz for implantable medical devices or 50Hz-150Hz for industrial machines. Harvesting such low frequency vibrations is a challenge since it leads to adapt the resonator geometries to the targeted frequency or to use out-off band indirect harvesting strategies. In this paper we present a piezoelectric based vibrational energy harvesting device (PEH) which could be integrated into a biocompatible package to power implantable sensor or therapeutic medical devices. The presented architecture is a serial bimorph laminated with ultra-thinned (ranging from 15μm to 100μm) outer PZT “skins” that could operate at a “very low frequency”, below 25Hz typically. The core process flow is disclosed and performances highlighted with regards to other low frequency demonstrations.

  18. Powering autonomous sensors with miniaturized piezoelectric based energy harvesting devices operating at very low frequency

    International Nuclear Information System (INIS)

    Ferin, G; Bantignies, C; Khanh, H Le; Flesch, E; Nguyen-Dinh, A

    2015-01-01

    Harvesting energy from ambient mechanical vibrations is a smart and efficient way to power autonomous sensors and support innovative developments in IoT (Internet of Things), WSN (Wireless Sensor Network) and even implantable medical devices. Beyond the environmental operating conditions, efficiency of such devices is mainly related to energy source properties like the amplitude of vibrations and its spectral contain and some of these applications exhibit a quite low frequency spectrum where harvesting surrounding mechanical energy make sense, typically 5-50Hz for implantable medical devices or 50Hz-150Hz for industrial machines. Harvesting such low frequency vibrations is a challenge since it leads to adapt the resonator geometries to the targeted frequency or to use out-off band indirect harvesting strategies. In this paper we present a piezoelectric based vibrational energy harvesting device (PEH) which could be integrated into a biocompatible package to power implantable sensor or therapeutic medical devices. The presented architecture is a serial bimorph laminated with ultra-thinned (ranging from 15μm to 100μm) outer PZT “skins” that could operate at a “very low frequency”, below 25Hz typically. The core process flow is disclosed and performances highlighted with regards to other low frequency demonstrations. (paper)

  19. Wavelet-Based Frequency Response Function: Comparative Study of Input Excitation

    Directory of Open Access Journals (Sweden)

    K. Dziedziech

    2014-01-01

    Full Text Available Time-variant systems can be found in many areas of engineering. It is widely accepted that the classical Fourier-based methods are not suitable for the analysis and identification of such systems. The time-variant frequency response function—based on the continuous wavelet transform—is used in this paper for the analysis of time-variant systems. The focus is on the comparative study of various broadband input excitations. The performance of the method is tested using simulated data from a simple MDOF system and experimental data from a frame-like structure.

  20. Scenario-based stochastic optimal operation of wind, photovoltaic, pump-storage hybrid system in frequency- based pricing

    International Nuclear Information System (INIS)

    Zare Oskouei, Morteza; Sadeghi Yazdankhah, Ahmad

    2015-01-01

    Highlights: • Two-stage objective function is proposed for optimization problem. • Hourly-based optimal contractual agreement is calculated. • Scenario-based stochastic optimization problem is solved. • Improvement of system frequency by utilizing PSH unit. - Abstract: This paper proposes the operating strategy of a micro grid connected wind farm, photovoltaic and pump-storage hybrid system. The strategy consists of two stages. In the first stage, the optimal hourly contractual agreement is determined. The second stage corresponds to maximizing its profit by adapting energy management strategy of wind and photovoltaic in coordination with optimum operating schedule of storage device under frequency based pricing for a day ahead electricity market. The pump-storage hydro plant is utilized to minimize unscheduled interchange flow and maximize the system benefit by participating in frequency control based on energy price. Because of uncertainties in power generation of renewable sources and market prices, generation scheduling is modeled by a stochastic optimization problem. Uncertainties of parameters are modeled by scenario generation and scenario reduction method. A powerful optimization algorithm is proposed using by General Algebraic Modeling System (GAMS)/CPLEX. In order to verify the efficiency of the method, the algorithm is applied to various scenarios with different wind and photovoltaic power productions in a day ahead electricity market. The numerical results demonstrate the effectiveness of the proposed approach.

  1. Effect of human chorionic gonadotropin (hCG) on in vitro oocyte ...

    African Journals Online (AJOL)

    use

    2011-11-23

    Nov 23, 2011 ... In vitro exposure of Barilius vagra ovarian follicles to human chorionic gonadotropin (hCG) .... breakdown (GVBD) by treating them with egg clearing solution ..... trihydroxy-5Я-pregnen-20-one, in female plaice (Pleuronectes.

  2. Navy DD(X) and CG(X) Program: Background and Issues for Congress

    National Research Council Canada - National Science Library

    O'Rourke, Ronald

    2005-01-01

    The FY2006-FY2011 Future Years Defense Plan (FYDP) reduces planned DD(X) destroyer procurement to one ship per year in FY2007-FY2011 and accelerates procurement of the first CG(X) cruiser to FY2011...

  3. ICT Based Performance Evaluation of Primary Frequency Control Support from Renewable Power Plants in Smart Grids

    Directory of Open Access Journals (Sweden)

    Kamal Shahid

    2018-05-01

    Full Text Available The increased penetration of Renewable Energy Generation (ReGen plants in future power systems poses several challenges to the stability of the entire system. In future green energy rich power systems, the responsibility for providing ancillary services will be shifted from conventional power plants towards ReGen plants, such as wind and photovoltaic power plants. Frequency control support from the Wind Power Plants (WPPs is one of the crucial ancillary services in order to preserve operational stability in case of grid disturbances. Among other requirements, the ability to provide fast frequency control support from ReGen plants will highly depend on the underlying communication infrastructure that allows an exchange of information between different ReGen plants and the control centers. This paper, therefore, focuses on the evaluation of the impact of communication and the related aspects to provide online frequency control support from ReGen (with special focus on WPP. The performance evaluation is based on an aggregated WPP model that is integrated into a generic power system model. This generic power system model is specifically designed to assess the ancillary services in a relatively simple yet relevant environment. Several case studies with different wind speeds at a particular wind-power penetration level and communication scenarios are considered to evaluate the performance of power system frequency response. The article provides the Transmission System Operator (TSO and other communication engineers insights into the importance and various aspects of communication infrastructure for general service coordination between WPPs and specifically primary frequency control coordination from WPPs in future power systems.

  4. Terahertz-Frequency Spin Hall Auto-oscillator Based on a Canted Antiferromagnet

    Science.gov (United States)

    Sulymenko, O. R.; Prokopenko, O. V.; Tiberkevich, V. S.; Slavin, A. N.; Ivanov, B. A.; Khymyn, R. S.

    2017-12-01

    We propose a design of a terahertz-frequency signal generator based on a layered structure consisting of a current-driven platinum (Pt) layer and a layer of an antiferromagnet (AFM) with easy-plane anisotropy, where the magnetization vectors of the AFM sublattices are canted inside the easy plane by the Dzyaloshinskii-Moriya interaction (DMI). The dc electric current flowing in the Pt layer creates due to the spin Hall effect, a perpendicular spin current that, being injected in the AFM layer, tilts the DMI-canted AFM sublattices out of the easy plane, thus exposing them to the action of a strong internal exchange magnetic field of the AFM. The sublattice magnetizations, along with the small net magnetization vector mDMI of the canted AFM, start to rotate about the hard anisotropy axis of the AFM with the terahertz frequency proportional to the injected spin current and the AFM exchange field. The rotation of the small net magnetization mDMI results in the terahertz-frequency dipolar radiation that can be directly received by an adjacent (e.g., dielectric) resonator. We demonstrate theoretically that the radiation frequencies in the range f =0.05 - 2 THz are possible at the experimentally reachable magnitudes of the driving current density, and we evaluate the power of the signal radiated into different types of resonators. This power increases with the increase of frequency f , and it can exceed 1 μ W at f ˜0.5 THz for a typical dielectric resonator of the electric permittivity ɛ ˜10 and a quality factor Q ˜750 .

  5. Single-frequency, fully integrated, miniature DPSS laser based on monolithic resonator

    Science.gov (United States)

    Dudzik, G.; Sotor, J.; Krzempek, K.; Soboń, G.; Abramski, K. M.

    2014-02-01

    We present a single frequency, stable, narrow linewidth, miniature laser sources operating at 532 nm (or 1064 nm) based on a monolithic resonators. Such resonators utilize birefringent filters formed by YVO4 beam displacer and KTP or YVO4 crystals to force single frequency operation at 532 nm or 1064 nm, respectively. In both configurations Nd:YVO4 gain crystal is used. The resonators dimensions are 1x1x10.5 mm3 and 1x1x8.5 mm3 for green and infrared configurations, respectively. Presented laser devices, with total dimensions of 40x52x120 mm3, are fully equipped with driving electronics, pump diode, optical and mechanical components. The highly integrated (36x15x65 mm3) low noise driving electronics with implemented digital PID controller was designed. It provides pump current and resonator temperature stability of ±30 μA@650 mA and ±0,003ºC, respectively. The laser parameters can be set and monitored via the USB interface by external application. The developed laser construction is universal. Hence, the other wavelengths can be obtained only by replacing the monolithic resonator. The optical output powers in single frequency regime was at the level of 42 mW@532 nm and 0.5 W@1064 nm with the long-term fluctuations of ±0.85 %. The linewidth and the passive frequency stability under the free running conditions were Δν < 100 kHz and 3ṡ10-9@1 s integration time, respectively. The total electrical power supply consumption of laser module was only 4 W. Presented compact, single frequency laser operating at 532 nm and 1064 nm may be used as an excellent source for laser vibrometry, interferometry or seed laser for fiber amplifiers.

  6. Blind Separation of Nonstationary Sources Based on Spatial Time-Frequency Distributions

    Directory of Open Access Journals (Sweden)

    Zhang Yimin

    2006-01-01

    Full Text Available Blind source separation (BSS based on spatial time-frequency distributions (STFDs provides improved performance over blind source separation methods based on second-order statistics, when dealing with signals that are localized in the time-frequency (t-f domain. In this paper, we propose the use of STFD matrices for both whitening and recovery of the mixing matrix, which are two stages commonly required in many BSS methods, to provide robust BSS performance to noise. In addition, a simple method is proposed to select the auto- and cross-term regions of time-frequency distribution (TFD. To further improve the BSS performance, t-f grouping techniques are introduced to reduce the number of signals under consideration, and to allow the receiver array to separate more sources than the number of array sensors, provided that the sources have disjoint t-f signatures. With the use of one or more techniques proposed in this paper, improved performance of blind separation of nonstationary signals can be achieved.

  7. Dimension reduction of frequency-based direct Granger causality measures on short time series.

    Science.gov (United States)

    Siggiridou, Elsa; Kimiskidis, Vasilios K; Kugiumtzis, Dimitris

    2017-09-01

    The mainstream in the estimation of effective brain connectivity relies on Granger causality measures in the frequency domain. If the measure is meant to capture direct causal effects accounting for the presence of other observed variables, as in multi-channel electroencephalograms (EEG), typically the fit of a vector autoregressive (VAR) model on the multivariate time series is required. For short time series of many variables, the estimation of VAR may not be stable requiring dimension reduction resulting in restricted or sparse VAR models. The restricted VAR obtained by the modified backward-in-time selection method (mBTS) is adapted to the generalized partial directed coherence (GPDC), termed restricted GPDC (RGPDC). Dimension reduction on other frequency based measures, such the direct directed transfer function (dDTF), is straightforward. First, a simulation study using linear stochastic multivariate systems is conducted and RGPDC is favorably compared to GPDC on short time series in terms of sensitivity and specificity. Then the two measures are tested for their ability to detect changes in brain connectivity during an epileptiform discharge (ED) from multi-channel scalp EEG. It is shown that RGPDC identifies better than GPDC the connectivity structure of the simulated systems, as well as changes in the brain connectivity, and is less dependent on the free parameter of VAR order. The proposed dimension reduction in frequency measures based on VAR constitutes an appropriate strategy to estimate reliably brain networks within short-time windows. Copyright © 2017 Elsevier B.V. All rights reserved.

  8. Key Concept Identification: A Comprehensive Analysis of Frequency and Topical Graph-Based Approaches

    Directory of Open Access Journals (Sweden)

    Muhammad Aman

    2018-05-01

    Full Text Available Automatic key concept extraction from text is the main challenging task in information extraction, information retrieval and digital libraries, ontology learning, and text analysis. The statistical frequency and topical graph-based ranking are the two kinds of potentially powerful and leading unsupervised approaches in this area, devised to address the problem. To utilize the potential of these approaches and improve key concept identification, a comprehensive performance analysis of these approaches on datasets from different domains is needed. The objective of the study presented in this paper is to perform a comprehensive empirical analysis of selected frequency and topical graph-based algorithms for key concept extraction on three different datasets, to identify the major sources of error in these approaches. For experimental analysis, we have selected TF-IDF, KP-Miner and TopicRank. Three major sources of error, i.e., frequency errors, syntactical errors and semantical errors, and the factors that contribute to these errors are identified. Analysis of the results reveals that performance of the selected approaches is significantly degraded by these errors. These findings can help us develop an intelligent solution for key concept extraction in the future.

  9. Relationship between soft stratum thickness and predominant frequency of ground based on microtremor observation data

    Science.gov (United States)

    Chia, Kenny; Lau, Tze Liang

    2017-07-01

    Despite categorized as low seismicity group, until being affected by distant earthquake ground motion from Sumatra and the recent 2015 Sabah Earthquake, Malaysia has come to realize that seismic hazard in the country is real and has the potential to threaten the public safety and welfare. The major concern in this paper is to study the effect of local site condition, where it could amplify the magnitude of ground vibration at sites. The aim for this study is to correlate the thickness of soft stratum with the predominant frequency of soil. Single point microtremor measurements were carried out at 24 selected points where the site investigation reports are available. Predominant period and frequency at each site are determined by Nakamura's method. The predominant period varies from 0.22 s to 0.98 s. Generally, the predominant period increases when getting closer to the shoreline which has thicker sediments. As far as the thickness of the soft stratum could influence the amplification of seismic wave, the advancement of micotremor observation to predict the thickness of soft stratum (h) from predominant frequency (fr) is of the concern. Thus an empirical relationship h =54.917 fr-1.314 is developed based on the microtremor observation data. The empirical relationship will be benefited in the prediction of thickness of soft stratum based on microtremor observation for seismic design with minimal cost compared to conventional boring method.

  10. Proposed Sandia frequency shift for anti-islanding detection method based on artificial immune system

    Directory of Open Access Journals (Sweden)

    A.Y. Hatata

    2018-03-01

    Full Text Available Sandia frequency shift (SFS is one of the active anti-islanding detection methods that depend on frequency drift to detect an islanding condition for inverter-based distributed generation. The non-detection zone (NDZ of the SFS method depends to a great extent on its parameters. Improper adjusting of these parameters may result in failure of the method. This paper presents a proposed artificial immune system (AIS-based technique to obtain optimal parameters of SFS anti-islanding detection method. The immune system is highly distributed, highly adaptive, and self-organizing in nature, maintains a memory of past encounters, and has the ability to continually learn about new encounters. The proposed method generates less total harmonic distortion (THD than the conventional SFS, which results in faster island detection and better non-detection zone. The performance of the proposed method is derived analytically and simulated using Matlab/Simulink. Two case studies are used to verify the proposed method. The first case includes a photovoltaic (PV connected to grid and the second includes a wind turbine connected to grid. The deduced optimized parameter setting helps to achieve the “non-islanding inverter” as well as least potential adverse impact on power quality. Keywords: Anti-islanding detection, Sandia frequency shift (SFS, Non-detection zone (NDZ, Total harmonic distortion (THD, Artificial immune system (AIS, Clonal selection algorithm

  11. Frequency-based time-series gene expression recomposition using PRIISM

    Directory of Open Access Journals (Sweden)

    Rosa Bruce A

    2012-06-01

    Full Text Available Abstract Background Circadian rhythm pathways influence the expression patterns of as much as 31% of the Arabidopsis genome through complicated interaction pathways, and have been found to be significantly disrupted by biotic and abiotic stress treatments, complicating treatment-response gene discovery methods due to clock pattern mismatches in the fold change-based statistics. The PRIISM (Pattern Recomposition for the Isolation of Independent Signals in Microarray data algorithm outlined in this paper is designed to separate pattern changes induced by different forces, including treatment-response pathways and circadian clock rhythm disruptions. Results Using the Fourier transform, high-resolution time-series microarray data is projected to the frequency domain. By identifying the clock frequency range from the core circadian clock genes, we separate the frequency spectrum to different sections containing treatment-frequency (representing up- or down-regulation by an adaptive treatment response, clock-frequency (representing the circadian clock-disruption response and noise-frequency components. Then, we project the components’ spectra back to the expression domain to reconstruct isolated, independent gene expression patterns representing the effects of the different influences. By applying PRIISM on a high-resolution time-series Arabidopsis microarray dataset under a cold treatment, we systematically evaluated our method using maximum fold change and principal component analyses. The results of this study showed that the ranked treatment-frequency fold change results produce fewer false positives than the original methodology, and the 26-hour timepoint in our dataset was the best statistic for distinguishing the most known cold-response genes. In addition, six novel cold-response genes were discovered. PRIISM also provides gene expression data which represents only circadian clock influences, and may be useful for circadian clock studies

  12. A variable-frequency structural health monitoring system based on omnidirectional shear horizontal wave piezoelectric transducers

    Science.gov (United States)

    Huan, Qiang; Miao, Hongchen; Li, Faxin

    2018-02-01

    Structural health monitoring (SHM) is of great importance for engineering structures as it may detect the early degradation and thus avoid life and financial loss. Guided wave based inspection is very useful in SHM due to its capability for long distance and wide range monitoring. The fundamental shear horizontal (SH0) wave based method should be most promising since SH0 is the unique non-dispersive wave mode in plate-like structures. In this work, a sparse array SHM system based on omnidirectional SH wave piezoelectric transducers (OSH-PT) was proposed and the multi data fusion method was used for defect inspection in a 2 mm thick aluminum plate. Firstly, the performances of three types OSH-PTs was comprehensively compared and the thickness-poled d15 mode OSH-PT used in this work was demonstrated obviously superior to the other two. Then, the signal processing method and imaging algorithm for this SHM system was presented. Finally, experiments were carried out to examine the performance of the proposed SHM system in defect localization and imaging. Results indicated that this SHM system can locate a through hole as small as 0.12λ (4 mm) in diameter (where λ is the wavelength corresponding to the central operation frequency) under frequencies from 90 to 150 kHz. It can also locate multiple defects accurately based on the baseline subtraction method. Obviously, this SHM system can detect larger areas with sparse sensors because of the adopted single mode, non-dispersive and low frequency SH0 wave which can propagate long distance with small attenuation. Considering its good performances, simple data processing and sparse array, this SH0 wave-based SHM system is expected to greatly promote the applications of guided wave inspection.

  13. Histone deacetylase inhibitor, CG200745, attenuates cardiac hypertrophy and fibrosis in DOCA-induced hypertensive rats

    OpenAIRE

    Lee, Eunjo; Song, Min-ji; Lee, Hae-Ahm; Kang, Seol-Hee; Kim, Mina; Yang, Eun Kyoung; Lee, Do Young; Ro, Seonggu; Cho, Joong Myung; Kim, Inkyeom

    2016-01-01

    CG200745 is a novel inhibitor of histone deacetylases (HDACs), initially developed for treatment of various hematological and solid cancers. Because it is water-soluble, it can be administered orally. We hypothesized that the HDAC inhibitor, CG200745, attenuates cardiac hypertrophy and fibrosis in deoxycorticosterone acetate (DOCA)-induced hypertensive rats. For establishment of hypertension, 40 mg/kg of DOCA was subcutaneously injected four times weekly into Sprague-Dawley rats. All the rats...

  14. Development of monitoring and control system for a mine main fan based on frequency converter

    Science.gov (United States)

    Zhang, Y. C.; Zhang, R. W.; Kong, X. Z.; Y Gong, J.; Chen, Q. G.

    2013-12-01

    In the process of mine exploitation, the requirement of air flow rate often changes. The procedure of traditional control mode of the fan is complex and it is hard to meet the worksite requirement for air. This system is based on Principal Computer (PC) monitoring system and high performance PLC control system. In this system, the frequency converter is adapted to adjust the fan speed and the air of worksite can be regulated steplessly. The function of the monitoring and control system contains on-line monitoring and centralized control. The system can monitor the parameters of fan in real-time, control the operation of frequency converter, as well as, control the fan and its accessory equipments. At the same time, the automation level of the system is highly, the field equipments can be monitored and controlled automatically. So, the system is an important safeguard for mine production.

  15. Frequency of gastric varices in patients with portal hypertension based on endoscopic findings

    International Nuclear Information System (INIS)

    Mir, A.W.; Chaudry, A.A.; Mir, S.; Ahmed, N.; Khan, A.A.; Shahzadi, M.

    2017-01-01

    To find out the frequency of gastric varices in patients with portal hypertension based on endoscopic findings. Study Design: Descriptive Study. Place and Duration of Study: Department of Gastroenterology, Military Hospital, Rawalpindi from Jan to Jun 2011. Material and Methods: All patients fulfilling the inclusion criteria were selected through consecutive sampling. The patients presenting with hematemesis, melena or ascites with portal hypertension on ultrasound abdomen were admitted in the hospital. The patients were first stabilized hemodynamically and then kept empty stomach for at least four hours before endoscopy. The patients were sedated with intravenous midazolam and endoscopic findings obtained were entered on the patient proforma. Results: The overall frequency of gastric varices was 11 percent, whereas 89 percent had no gastric varices. Conclusion: A large number of patients with portal hypertension have gastric varices. It is recommended that endoscopy be carried out in all patients with identified portal hypertension. (author)

  16. Development of monitoring and control system for a mine main fan based on frequency converter

    International Nuclear Information System (INIS)

    Zhang, Y C; Kong, X Z; Chen, Q G; Zhang, R W; Gong, J Y

    2013-01-01

    In the process of mine exploitation, the requirement of air flow rate often changes. The procedure of traditional control mode of the fan is complex and it is hard to meet the worksite requirement for air. This system is based on Principal Computer (PC) monitoring system and high performance PLC control system. In this system, the frequency converter is adapted to adjust the fan speed and the air of worksite can be regulated steplessly. The function of the monitoring and control system contains on-line monitoring and centralized control. The system can monitor the parameters of fan in real-time, control the operation of frequency converter, as well as, control the fan and its accessory equipments. At the same time, the automation level of the system is highly, the field equipments can be monitored and controlled automatically. So, the system is an important safeguard for mine production

  17. Diode-pumped two-frequency lasers based on c-cut vanadate crystals

    International Nuclear Information System (INIS)

    Sirotkin, A A; Garnov, Sergei V; Zagumennyi, A I; Zavartsev, Yu D; Kutovoi, S A; Vlasov, V I; Shcherbakov, Ivan A

    2009-01-01

    The luminescent and lasing properties of the neo-dymium ion at the 4 F 3/2 - 4 I 11/2 transition in c-cut vanadate crystals (Nd:YVO 4 , Nd:GdVO 4 , and Nd:Gd 1-x Y x VO 4 ) are studied. Tuning of the laser radiation wavelength (Δλ = 5.4 nm) is demonstrated. Two-frequency laser schemes with the use of a Lyot filter, a Fabry-Perot etalon, and a Brewster prism as spectral selection elements are proposed and experimentally realised. Stable two-frequency lasing of a laser based on the c-cut Nd:GdVO 4 crystal was obtained in the cw, Q-switched (nanosecond pulses), and active acousto-optic mode-locked (picosecond pulses) regimes. (lasers)

  18. Vibration energy harvester with low resonant frequency based on flexible coil and liquid spring

    Science.gov (United States)

    Wang, Y.; Zhang, Q.; Zhao, L.; Tang, Y.; Shkel, A.; Kim, E. S.

    2016-11-01

    This paper reports an electromagnetic vibration-energy harvester with low resonant frequency based on liquid spring composed of ferrofluid. Cylinder magnet array formed by four disc NdFeB magnets is suspended by ferrofluid in a laser-machined acrylic tube which is wrapped by flexible planar coil fabricated with microfabrication process. The magnet array and coil are aligned automatically by the ferrofluid. Restoring force when the magnet array is deviated from the balance position is proportional to the deviated distance, which makes the ferrofluid work as a liquid spring obeying Hook's law. Experimental results show that the electromagnetic energy harvester occupying 1.8 cc and weighing 5 g has a resonant frequency of 16 Hz and generates an induced electromotive force of Vrms = 2.58 mV (delivering 79 nW power into matched load of 21 Ω) from 3 g acceleration at 16 Hz.

  19. Fast simulation approaches for power fluctuation model of wind farm based on frequency domain

    DEFF Research Database (Denmark)

    Lin, Jin; Gao, Wen-zhong; Sun, Yuan-zhang

    2012-01-01

    This paper discusses one model developed by Riso, DTU, which is capable of simulating the power fluctuation of large wind farms in frequency domain. In the original design, the “frequency-time” transformations are time-consuming and might limit the computation speed for a wind farm of large size....... Under this background, this paper proposes four efficient approaches to accelerate the simulation speed. Two of them are based on physical model simplifications, and the other two improve the numerical computation. The case study demonstrates the efficiency of these approaches. The acceleration ratio...... is more than 300 times if all these approaches are adopted, in any low, medium and high wind speed test scenarios....

  20. Remote Impedance-based Loose Bolt Inspection Using a Radio-Frequency Active Sensing Node

    Energy Technology Data Exchange (ETDEWEB)

    Park, Seung Hee; Yun, Chung Bang [Korea Advanced Institute of Science and Technology, Daejeon (Korea, Republic of); Inman, Daniel J. [Virginia Polytechnic Institute and State University, Virginia (United States)

    2007-06-15

    This paper introduces an active sensing node using radio-frequency (RF) telemetry. This device has brought the traditional impedance-based structural health monitoring (SHM) technique to a new paradigm. The RF active sensing node consists of a miniaturized impedance measuring device (AD5933), a microcontroller (ATmega128L), and a radio frequency (RF) transmitter (XBee). A macro-fiber composite (MFC) patch interrogates a host structure by using a self-sensing technique of the miniaturized impedance measuring device. All the process including structural interrogation, data acquisition, signal processing, and damage diagnostic is being performed at the sensor location by the microcontroller. The RF transmitter is used to communicate the current status of the host structure. The feasibility of the proposed SHM strategy is verified through an experimental study inspecting loose bolts in a bolt-jointed aluminum structure

  1. Remote Impedance-based Loose Bolt Inspection Using a Radio-Frequency Active Sensing Node

    International Nuclear Information System (INIS)

    Park, Seung Hee; Yun, Chung Bang; Inman, Daniel J.

    2007-01-01

    This paper introduces an active sensing node using radio-frequency (RF) telemetry. This device has brought the traditional impedance-based structural health monitoring (SHM) technique to a new paradigm. The RF active sensing node consists of a miniaturized impedance measuring device (AD5933), a microcontroller (ATmega128L), and a radio frequency (RF) transmitter (XBee). A macro-fiber composite (MFC) patch interrogates a host structure by using a self-sensing technique of the miniaturized impedance measuring device. All the process including structural interrogation, data acquisition, signal processing, and damage diagnostic is being performed at the sensor location by the microcontroller. The RF transmitter is used to communicate the current status of the host structure. The feasibility of the proposed SHM strategy is verified through an experimental study inspecting loose bolts in a bolt-jointed aluminum structure

  2. Analysis of measured data of human body based on error correcting frequency

    Science.gov (United States)

    Jin, Aiyan; Peipei, Gao; Shang, Xiaomei

    2014-04-01

    Anthropometry is to measure all parts of human body surface, and the measured data is the basis of analysis and study of the human body, establishment and modification of garment size and formulation and implementation of online clothing store. In this paper, several groups of the measured data are gained, and analysis of data error is gotten by analyzing the error frequency and using analysis of variance method in mathematical statistics method. Determination of the measured data accuracy and the difficulty of measured parts of human body, further studies of the causes of data errors, and summarization of the key points to minimize errors possibly are also mentioned in the paper. This paper analyses the measured data based on error frequency, and in a way , it provides certain reference elements to promote the garment industry development.

  3. Heart rate variability analysis based on time–frequency representation and entropies in hypertrophic cardiomyopathy patients

    International Nuclear Information System (INIS)

    Clariá, F; Vallverdú, M; Caminal, P; Baranowski, R; Chojnowska, L

    2008-01-01

    In hypertrophic cardiomyopathy (HCM) patients there is an increased risk of premature death, which can occur with little or no warning. Furthermore, classification for sudden cardiac death on patients with HCM is very difficult. The aim of our study was to improve the prognostic value of heart rate variability (HRV) in HCM patients, giving insight into changes of the autonomic nervous system. In this way, the suitability of linear and nonlinear measures was studied to assess the HRV. These measures were based on time–frequency representation (TFR) and on Shannon and Rényi entropies, and compared with traditional HRV measures. Holter recordings of 64 patients with HCM and 55 healthy subjects were analyzed. The HCM patients consisted of two groups: 13 high risk patients, after aborted sudden cardiac death (SCD); 51 low risk patients, without SCD. Five-hour RR signals, corresponding to the sleep period of the subjects, were considered for the analysis as a comparable standard situation. These RR signals were filtered in the three frequency bands: very low frequency band (VLF, 0–0.04 Hz), low frequency band (LF, 0.04–0.15 Hz) and high frequency band (HF, 0.15–0.45 Hz). TFR variables based on instantaneous frequency and energy functions were able to classify HCM patients and healthy subjects (control group). Results revealed that measures obtained from TFR analysis of the HRV better classified the groups of subjects than traditional HRV parameters. However, results showed that nonlinear measures improved group classification. It was observed that entropies calculated in the HF band showed the highest statistically significant levels comparing the HCM group and the control group, p-value < 0.0005. The values of entropy measures calculated in the HCM group presented lower values, indicating a decreasing of complexity, than those calculated from the control group. Moreover, similar behavior was observed comparing high and low risk of premature death, the values of

  4. A 2D analytical cylindrical gate tunnel FET (CG-TFET) model: impact of shortest tunneling distance

    Science.gov (United States)

    Dash, S.; Mishra, G. P.

    2015-09-01

    A 2D analytical tunnel field-effect transistor (FET) potential model with cylindrical gate (CG-TFET) based on the solution of Laplace’s equation is proposed. The band-to-band tunneling (BTBT) current is derived by the help of lateral electric field and the shortest tunneling distance. However, the analysis is extended to obtain the subthreshold swing (SS) and transfer characteristics of the device. The dependency of drain current, SS and transconductance on gate voltage and shortest tunneling distance is discussed. Also, the effect of scaling the gate oxide thickness and the cylindrical body diameter on the electrical parameters of the device is analyzed.

  5. A 2D analytical cylindrical gate tunnel FET (CG-TFET) model: impact of shortest tunneling distance

    International Nuclear Information System (INIS)

    Dash, S; Mishra, G P

    2015-01-01

    A 2D analytical tunnel field-effect transistor (FET) potential model with cylindrical gate (CG-TFET) based on the solution of Laplace’s equation is proposed. The band-to-band tunneling (BTBT) current is derived by the help of lateral electric field and the shortest tunneling distance. However, the analysis is extended to obtain the subthreshold swing (SS) and transfer characteristics of the device. The dependency of drain current, SS and transconductance on gate voltage and shortest tunneling distance is discussed. Also, the effect of scaling the gate oxide thickness and the cylindrical body diameter on the electrical parameters of the device is analyzed. (paper)

  6. Histone deacetylase inhibitor, CG200745, attenuates cardiac hypertrophy and fibrosis in DOCA-induced hypertensive rats.

    Science.gov (United States)

    Lee, Eunjo; Song, Min-Ji; Lee, Hae-Ahm; Kang, Seol-Hee; Kim, Mina; Yang, Eun Kyoung; Lee, Do Young; Ro, Seonggu; Cho, Joong Myung; Kim, Inkyeom

    2016-09-01

    CG200745 is a novel inhibitor of histone deacetylases (HDACs), initially developed for treatment of various hematological and solid cancers. Because it is water-soluble, it can be administered orally. We hypothesized that the HDAC inhibitor, CG200745, attenuates cardiac hypertrophy and fibrosis in deoxycorticosterone acetate (DOCA)-induced hypertensive rats. For establishment of hypertension, 40 mg/kg of DOCA was subcutaneously injected four times weekly into Sprague-Dawley rats. All the rats used in this study including those in the sham group had been unilaterally nephrectomized and allowed free access to drinking water containing 1% NaCl. Systolic blood pressure was measured by the tail-cuff method. Blood chemistry including sodium, potassium, glucose, triglyceride, and cholesterol levels was analyzed. Sections of the heart were visualized after trichrome and hematoxylin and eosin stain. The expression of hypertrophic genes such as atrial natriuretic peptide A (Nppa) and atrial natriuretic peptide B (Nppb) in addition to fibrotic genes such as Collagen-1, Collagen-3, connective tissue growth factor (Ctgf), and Fibronectin were measured by quantitative real-time PCR (qRT-PCR). Injection of DOCA increased systolic blood pressure, heart weight, and cardiac fibrosis, which was attenuated by CG200745. Neither DOCA nor CG200745 affected body weight, vascular contraction and relaxation responses, and blood chemistry. Injection of DOCA increased expression of both hypertrophic and fibrotic genes, which was abrogated by CG200745. These results indicate that CG200745 attenuates cardiac hypertrophy and fibrosis in DOCA-induced hypertensive rats.

  7. Resonance-Based Time-Frequency Manifold for Feature Extraction of Ship-Radiated Noise

    Science.gov (United States)

    Yan, Jiaquan; Sun, Haixin; Chen, Hailan; Junejo, Naveed Ur Rehman; Cheng, En

    2018-01-01

    In this paper, a novel time-frequency signature using resonance-based sparse signal decomposition (RSSD), phase space reconstruction (PSR), time-frequency distribution (TFD) and manifold learning is proposed for feature extraction of ship-radiated noise, which is called resonance-based time-frequency manifold (RTFM). This is suitable for analyzing signals with oscillatory, non-stationary and non-linear characteristics in a situation of serious noise pollution. Unlike the traditional methods which are sensitive to noise and just consider one side of oscillatory, non-stationary and non-linear characteristics, the proposed RTFM can provide the intact feature signature of all these characteristics in the form of a time-frequency signature by the following steps: first, RSSD is employed on the raw signal to extract the high-oscillatory component and abandon the low-oscillatory component. Second, PSR is performed on the high-oscillatory component to map the one-dimensional signal to the high-dimensional phase space. Third, TFD is employed to reveal non-stationary information in the phase space. Finally, manifold learning is applied to the TFDs to fetch the intrinsic non-linear manifold. A proportional addition of the top two RTFMs is adopted to produce the improved RTFM signature. All of the case studies are validated on real audio recordings of ship-radiated noise. Case studies of ship-radiated noise on different datasets and various degrees of noise pollution manifest the effectiveness and robustness of the proposed method. PMID:29565288

  8. Bearing performance degradation assessment based on time-frequency code features and SOM network

    International Nuclear Information System (INIS)

    Zhang, Yan; Tang, Baoping; Han, Yan; Deng, Lei

    2017-01-01

    Bearing performance degradation assessment and prognostics are extremely important in supporting maintenance decision and guaranteeing the system’s reliability. To achieve this goal, this paper proposes a novel feature extraction method for the degradation assessment and prognostics of bearings. Features of time-frequency codes (TFCs) are extracted from the time-frequency distribution using a hybrid procedure based on short-time Fourier transform (STFT) and non-negative matrix factorization (NMF) theory. An alternative way to design the health indicator is investigated by quantifying the similarity between feature vectors using a self-organizing map (SOM) network. On the basis of this idea, a new health indicator called time-frequency code quantification error (TFCQE) is proposed to assess the performance degradation of the bearing. This indicator is constructed based on the bearing real-time behavior and the SOM model that is previously trained with only the TFC vectors under the normal condition. Vibration signals collected from the bearing run-to-failure tests are used to validate the developed method. The comparison results demonstrate the superiority of the proposed TFCQE indicator over many other traditional features in terms of feature quality metrics, incipient degradation identification and achieving accurate prediction. Highlights • Time-frequency codes are extracted to reflect the signals’ characteristics. • SOM network served as a tool to quantify the similarity between feature vectors. • A new health indicator is proposed to demonstrate the whole stage of degradation development. • The method is useful for extracting the degradation features and detecting the incipient degradation. • The superiority of the proposed method is verified using experimental data. (paper)

  9. Compliance boundaries for multiple-frequency base station antennas in three directions.

    Science.gov (United States)

    Thielens, Arno; Vermeeren, Günter; Kurup, Divya; Joseph, Wout; Martens, Luc

    2013-09-01

    In this article, compliance boundaries and allowed output powers are determined for the front, back, and side of multiple-frequency base station antennas, based on the root-mean-squared electric field, the whole-body averaged specific absorption rate (SAR), and the 10 g averaged SAR in both the limbs and the head and trunk. For this purpose, the basic restrictions and reference levels defined by the International Commission on Non-Ionizing Radiation Protection (ICNIRP) for both the general public and occupational exposure are used. The antennas are designed for Global System for Mobile Communications around 900 MHz (GSM900), GSM1800, High Speed Packet Access (HSPA), and Long Term Evolution (LTE), and are operated with output powers at the individual frequencies up to 300 W. The compliance boundaries are estimated using finite-difference time-domain simulations with the Virtual Family Male and have been determined for three directions with respect to the antennas for 800, 900, 1800, and 2600 MHz. The reference levels are not always conservative when the radiating part of the antenna is small compared to the length of the body. Combined compliance distances, which ensure compliance with all reference levels and basic restrictions, have also been determined for each frequency. A method to determine a conservative estimation of compliance boundaries for multiple-frequency (cumulative) exposure is introduced. Using the errors on the estimated allowed powers, an uncertainty analysis is carried out for the compliance distances. Uncertainties on the compliance distances are found to be smaller than 122%. Copyright © 2013 Wiley Periodicals, Inc.

  10. Frequency and voltage dependent electrical responses of poly(triarylamine thin film-based organic Schottky diode

    Directory of Open Access Journals (Sweden)

    Mohamad Khairul Anuar

    2017-01-01

    Full Text Available A metal-organic-metal (MOM type Schottky diode based on poly (triarylamine (PTAA thin films has been fabricated by using the spin coating method. Investigation of the frequency dependent conductance-voltage (G-V-f and capacitance-voltage (C-V-f characteristics of the ITO/PTAA/Al MOM type diode were carried out in the frequency range from 12 Hz to 100 kHz using an LCR meter at room temperature. The frequency and bias voltage dependent electrical response were determined by admittance-based measured method in terms of an equivalent circuit model of the parallel combination of resistance and capacitance (RC circuit. Investigation revealed that the conductance is frequency and a bias voltage dependent in which conductance continuous increase as the increasing frequency, respectively. Meanwhile, the capacitance is dependent on frequency up to a certain value of frequency (100 Hz but decreases at high frequency (1 – 10 kHz. The interface state density in the Schottky diode was determined from G-V and C-V characteristics. The interface state density has values almost constant of 2.8 x 1012 eV−1cm−2 with slightly decrease by increasing frequencies. Consequently, both series resistance and interface trap density were found to decrease with increasing frequency. The frequency dependence of the electrical responses is attributed the distribution density of interface states that could follow the alternating current (AC signal.

  11. Frequency and voltage dependent electrical responses of poly(triarylamine) thin film-based organic Schottky diode

    Science.gov (United States)

    Anuar Mohamad, Khairul; Tak Hoh, Hang; Alias, Afishah; Ghosh, Bablu Kumar; Fukuda, Hisashi

    2017-11-01

    A metal-organic-metal (MOM) type Schottky diode based on poly (triarylamine) (PTAA) thin films has been fabricated by using the spin coating method. Investigation of the frequency dependent conductance-voltage (G-V-f) and capacitance-voltage (C-V-f) characteristics of the ITO/PTAA/Al MOM type diode were carried out in the frequency range from 12 Hz to 100 kHz using an LCR meter at room temperature. The frequency and bias voltage dependent electrical response were determined by admittance-based measured method in terms of an equivalent circuit model of the parallel combination of resistance and capacitance (RC circuit). Investigation revealed that the conductance is frequency and a bias voltage dependent in which conductance continuous increase as the increasing frequency, respectively. Meanwhile, the capacitance is dependent on frequency up to a certain value of frequency (100 Hz) but decreases at high frequency (1 - 10 kHz). The interface state density in the Schottky diode was determined from G-V and C-V characteristics. The interface state density has values almost constant of 2.8 x 1012 eV-1cm-2 with slightly decrease by increasing frequencies. Consequently, both series resistance and interface trap density were found to decrease with increasing frequency. The frequency dependence of the electrical responses is attributed the distribution density of interface states that could follow the alternating current (AC) signal.

  12. SDS-PAGE Electrophoretic Property of Human Chorionic Gonadotropin (hCG) and its β-subunit

    OpenAIRE

    Gam, Lay-Harn; Latiff, Aishah

    2005-01-01

    The microheterogeneity property of hCG with regards to its sialic acid contents resulted in variable mobility of the glycoprotein in SDS-PAGE. The intact hCG molecule is composed of two dissimilar subunits, namely α- and β-subunits. The identification of hCG bands in SDS-PAGE was accomplished by the immunoblotting experiment, whereby the antibody directed toward the specific region of β-subunit of hCG was used. The data shows that the different mobility of intact hCG was attributed to the dif...

  13. Decreased levels of genuine large free hCG alpha in men presenting with abnormal semen analysis

    Directory of Open Access Journals (Sweden)

    Plas Eugen

    2011-08-01

    Full Text Available Abstract Background The pregnancy hormone human chorionic gonadotropin (hCG and its free subunits (hCG alpha, hCG beta are produced in the male reproductive tract and found in high concentrations in seminal fluid, in particular hCG alpha. This study aimed to elucidate changes in peptide hormone profiles in patients showing abnormal semen analyses and to determine the genuineness of the highly abundant hCG alpha. Methods Seminal plasma was obtained from 45 male patients undergoing semen analysis during infertility workups. Comprehensive peptide hormone profiles were established by a panel of immunofluorometric assays for hCG, hCG alpha, hCG beta and its metabolite hCG beta core fragment, placental lactogen, growth hormone and prolactin in seminal plasma of patients with abnormal semen analysis results (n = 29 versus normozoospermic men (n = 16. The molecular identity of large hyperglycosylated hCG alpha was analyzed by mass-spectrometry and selective deglycosylation. Results hCG alpha levels were found to be significantly lower in men with impaired semen quality (1346 +/- 191 vs. 2753 +/- 533 ng/ml, P = 0.022. Moreover, patients with reduced sperm count had reduced intact hCG levels compared with normozoospermic men (0.097 +/- 0.022 vs. 0.203 +/- 0.040 ng/ml, P = 0.028. Using mass-spectrometry, the biochemical identity of hCG alpha purified from seminal plasma was verified. Under non-reducing conditions in SDS-PAGE, hCG alpha isolated from seminal plasma migrated in a manner comparable with large free hCG alpha with an apparent molecular mass (Mr, app of 24 kDa, while hCG alpha dissociated from pregnancy-derived holo-hCG migrated at approximately 22 kDa. After deglycosylation with PNGase F under denaturing conditions, all hCG alpha variants showed an Mr, app of 15 kDa, indicating identical amino acid backbones. Conclusions The findings indicate a pathophysiological relevance of hCG, particularly its free alpha subunit, in spermatogenesis. The

  14. Differences in Signal Activation by LH and hCG are Mediated by the LH/CG Receptor's Extracellular Hinge Region.

    Science.gov (United States)

    Grzesik, Paul; Kreuchwig, Annika; Rutz, Claudia; Furkert, Jens; Wiesner, Burkhard; Schuelein, Ralf; Kleinau, Gunnar; Gromoll, Joerg; Krause, Gerd

    2015-01-01

    The human lutropin (hLH)/choriogonadotropin (hCG) receptor (LHCGR) can be activated by binding two slightly different gonadotropic glycoprotein hormones, choriogonadotropin (CG) - secreted by the placenta, and lutropin (LH) - produced by the pituitary. They induce different signaling profiles at the LHCGR. This cannot be explained by binding to the receptor's leucine-rich-repeat domain (LRRD), as this binding is similar for the two hormones. We therefore speculate that there are previously unknown differences in the hormone/receptor interaction at the extracellular hinge region, which might help to understand functional differences between the two hormones. We have therefore performed a detailed study of the binding and action of LH and CG at the LHCGR hinge region. We focused on a primate-specific additional exon in the hinge region, which is located between LRRD and the serpentine domain. The segment of the hinge region encoded by exon10 was previously reported to be only relevant to hLH signaling, as the exon10-deletion receptor exhibits decreased hLH signaling, but unchanged hCG signaling. We designed an advanced homology model of the hormone/LHCGR complex, followed by experimental characterization of relevant fragments in the hinge region. In addition, we examined predictions of a helical exon10-encoded conformation by block-wise polyalanine (helix supporting) mutations. These helix preserving modifications showed no effect on hormone-induced signaling. However, introduction of a structure-disturbing double-proline mutant LHCGR-Q303P/E305P within the exon10-helix has, in contrast to exon10-deletion, no impact on hLH, but only on hCG signaling. This opposite effect on signaling by hLH and hCG can be explained by distinct sites of hormone interaction in the hinge region. In conclusion, our analysis provides details of the differences between hLH- and hCG-induced signaling that are mainly determined in the L2-beta loop of the hormones and in the hinge

  15. Differences in Signal Activation by LH and hCG are Mediated by the LH/CG Receptor’s Extracellular Hinge Region

    Science.gov (United States)

    Grzesik, Paul; Kreuchwig, Annika; Rutz, Claudia; Furkert, Jens; Wiesner, Burkhard; Schuelein, Ralf; Kleinau, Gunnar; Gromoll, Joerg; Krause, Gerd

    2015-01-01

    The human lutropin (hLH)/choriogonadotropin (hCG) receptor (LHCGR) can be activated by binding two slightly different gonadotropic glycoprotein hormones, choriogonadotropin (CG) – secreted by the placenta, and lutropin (LH) – produced by the pituitary. They induce different signaling profiles at the LHCGR. This cannot be explained by binding to the receptor’s leucine-rich-repeat domain (LRRD), as this binding is similar for the two hormones. We therefore speculate that there are previously unknown differences in the hormone/receptor interaction at the extracellular hinge region, which might help to understand functional differences between the two hormones. We have therefore performed a detailed study of the binding and action of LH and CG at the LHCGR hinge region. We focused on a primate-specific additional exon in the hinge region, which is located between LRRD and the serpentine domain. The segment of the hinge region encoded by exon10 was previously reported to be only relevant to hLH signaling, as the exon10-deletion receptor exhibits decreased hLH signaling, but unchanged hCG signaling. We designed an advanced homology model of the hormone/LHCGR complex, followed by experimental characterization of relevant fragments in the hinge region. In addition, we examined predictions of a helical exon10-encoded conformation by block-wise polyalanine (helix supporting) mutations. These helix preserving modifications showed no effect on hormone-induced signaling. However, introduction of a structure-disturbing double-proline mutant LHCGR-Q303P/E305P within the exon10-helix has, in contrast to exon10-deletion, no impact on hLH, but only on hCG signaling. This opposite effect on signaling by hLH and hCG can be explained by distinct sites of hormone interaction in the hinge region. In conclusion, our analysis provides details of the differences between hLH- and hCG-induced signaling that are mainly determined in the L2-beta loop of the hormones and in the

  16. Iron Oxide Nanoparticle-Based Magnetic Ink Development for Fully Printed Tunable Radio-Frequency Devices

    KAUST Repository

    Vaseem, Mohammad

    2018-01-30

    The field of printed electronics is still in its infancy and most of the reported work is based on commercially available nanoparticle-based metallic inks. Although fully printed devices that employ dielectric/semiconductor inks have recently been reported, there is a dearth of functional inks that can demonstrate controllable devices. The lack of availability of functional inks is a barrier to the widespread use of fully printed devices. For radio-frequency electronics, magnetic materials have many uses in reconfigurable components but rely on expensive and rigid ferrite materials. A suitable magnetic ink can facilitate the realization of fully printed, magnetically controlled, tunable devices. This report presents the development of an iron oxide nanoparticle-based magnetic ink. First, a tunable inductor is fully printed using iron oxide nanoparticle-based magnetic ink. Furthermore, iron oxide nanoparticles are functionalized with oleic acid to make them compatible with a UV-curable SU8 solution. Functionalized iron oxide nanoparticles are successfully embedded in the SU8 matrix to make a magnetic substrate. The as-fabricated substrate is characterized for its magnetostatic and microwave properties. A frequency tunable printed patch antenna is demonstrated using the magnetic and in-house silver-organo-complex inks. This is a step toward low-cost, fully printed, controllable electronic components.

  17. Quantification of LOCA core damage frequency based on thermal-hydraulics analysis

    International Nuclear Information System (INIS)

    Cho, Jaehyun; Park, Jin Hee; Kim, Dong-San; Lim, Ho-Gon

    2017-01-01

    Highlights: • We quantified the LOCA core damage frequency based on the best-estimated success criteria analysis. • The thermal-hydraulic analysis using MARS code has been applied to Korea Standard Nuclear Power Plants. • Five new event trees with new break size boundaries and new success criteria were developed. • The core damage frequency is 5.80E−07 (/y), which is 12% less than the conventional PSA event trees. - Abstract: A loss-of-coolant accident (LOCA) has always been significantly considered one of the most important initiating events. However, most probabilistic safety assessment models, up to now, have undoubtedly adopted the three groups of LOCA, and even an exact break size boundary that used in WASH-1400 reports was published in 1975. With an awareness of the importance of a realistic PSA for a risk-informed application, several studies have tried to find the realistic thermal-hydraulic behavior of a LOCA, and improve the PSA model. The purpose of this research is to obtain realistic results of the LOCA core damage frequency based on a success criteria analysis using the best-estimate thermal-hydraulics code. To do so, the Korea Standard Nuclear Power Plant (KSNP) was selected for this study. The MARS code was used for a thermal hydraulics analysis and the AIMS code was used for the core damage quantification. One of the major findings in the thermal hydraulics analysis was that the decay power is well removed by only a normal secondary cooling in LOCAs of below 1.4 in and by only a high pressure safety injection in LOCAs of 0.8–9.4 in. Based on the thermal hydraulics results regarding new break size boundaries and new success criteria, five new event trees (ETs) were developed. The core damage frequency of new LOCA ETs is 5.80E−07 (/y), which is 12% less than the conventional PSA ETs. In this research, we obtained not only thermal-hydraulics characteristics for the entire break size of a LOCA in view of the deterministic safety

  18. Quantification of LOCA core damage frequency based on thermal-hydraulics analysis

    Energy Technology Data Exchange (ETDEWEB)

    Cho, Jaehyun, E-mail: chojh@kaeri.re.kr; Park, Jin Hee; Kim, Dong-San; Lim, Ho-Gon

    2017-04-15

    Highlights: • We quantified the LOCA core damage frequency based on the best-estimated success criteria analysis. • The thermal-hydraulic analysis using MARS code has been applied to Korea Standard Nuclear Power Plants. • Five new event trees with new break size boundaries and new success criteria were developed. • The core damage frequency is 5.80E−07 (/y), which is 12% less than the conventional PSA event trees. - Abstract: A loss-of-coolant accident (LOCA) has always been significantly considered one of the most important initiating events. However, most probabilistic safety assessment models, up to now, have undoubtedly adopted the three groups of LOCA, and even an exact break size boundary that used in WASH-1400 reports was published in 1975. With an awareness of the importance of a realistic PSA for a risk-informed application, several studies have tried to find the realistic thermal-hydraulic behavior of a LOCA, and improve the PSA model. The purpose of this research is to obtain realistic results of the LOCA core damage frequency based on a success criteria analysis using the best-estimate thermal-hydraulics code. To do so, the Korea Standard Nuclear Power Plant (KSNP) was selected for this study. The MARS code was used for a thermal hydraulics analysis and the AIMS code was used for the core damage quantification. One of the major findings in the thermal hydraulics analysis was that the decay power is well removed by only a normal secondary cooling in LOCAs of below 1.4 in and by only a high pressure safety injection in LOCAs of 0.8–9.4 in. Based on the thermal hydraulics results regarding new break size boundaries and new success criteria, five new event trees (ETs) were developed. The core damage frequency of new LOCA ETs is 5.80E−07 (/y), which is 12% less than the conventional PSA ETs. In this research, we obtained not only thermal-hydraulics characteristics for the entire break size of a LOCA in view of the deterministic safety

  19. IPE Data Base: Plant design, core damage frequency and containment performance information

    International Nuclear Information System (INIS)

    Lehner, J.; Lin, C.C.; Pratt, W.T.; Su, T.; Danziger, L.

    1995-01-01

    This data base stores data obtained from the Individual Plant Examinations (IPEs) which licensees of nuclear power plants have conducted in response to NRC's Generic Letter GL88-20. The IPE Data Base is a collection of linked files which store information about plant design, core damage frequency, and containment performance in a uniform, structured way. The information contined in the various files is based on data contained in the IPE submittals. The information extracted from the submittals and entered into the IPE Data Base can be maniulated so that queries regarding individual or groups of plants can be answered using the IPE Data Base. The IPE Data Base supports detailed inquiries into the characteristics of individual plants or classes of plants. Progress has been made on the IPE Data Base and it is largely complete. Recent focus has been the development of a user friendly version which is menu driven and allows the user to ask queries of varying complexity easily, without the need to become familiar with particular data base formats or conventions such as those of DBase IV or Microsoft Access. The user can obtain the information he desired by quickly moving through a series of on-screen menus and ''clicking'' on appropriate choices. In this way even a first time user can benefit from the large amount of information stored in the IPE Data Base without the need of a learning period

  20. Dietary diversity and meal frequency among infant and young children: a community based study.

    Science.gov (United States)

    Belew, Aysheshim Kassahun; Ali, Bekrie Mohammed; Abebe, Zegeye; Dachew, Berihun Assefa

    2017-08-15

    Insufficient quantities, frequencies, and inadequate quality of complementary feedings have a negative effect on child health and growth, especially in the first two years of life. Therefore, the aim of this study was to assess the minimum dietary diversity, meal frequency and its associated factors among infants and young children aged 6-23 months at Dabat District, northwest, Ethiopia. A community- based cross-sectional study was conducted from February 15 to March 10, 2016. The simple random sampling method was used to select study participants. An interviewer- administered structured questionnaire was used to collect data. Both Crude and Adjusted Odds Ratio with the corresponding 95% confidence interval were calculated to show the strength of association. In the multivariable analysis, variables with less than 0.05 P-value were considered statistically significant. The proportion of children who met the minimum dietary diversity and meal frequency were 17% (95% CI: 14.9, 19.4%) and 72.2% (95% CL: 69.3, 75%), respectively. Satisfactory media exposure (AOR = 2.79; 95% CI: 1.74, 4.47), postnatal care visits (AOR = 1.96; 95% CI: 1.32, 2.88), participation in child growth and monitoring follow ups (AOR = 1.65; 95% CI: 1.14, 2.39), age of children (AOR = 2.34; 95% CI: 1.33, 4.11) and age of mothers (AOR = 1.89; 95% CI: 1.09, 3.27) were positively associated with dietary diversity. Similarly, age of children (AOR = 2.38; 95% CI: 1.56, 3.65), household wealth status (AOR = 1.84; 95% CI: 1.27, 2.68), residence (AOR = 3.02; 95% CI: 1.41, 6.48), sources of information (AOR = 1.72; 95% CI:1.14, 2.59) and participation in child growth monitoring folow ups (AOR = 1.57; 95% CI: 1.13, 2.19) were significantly associated with meal frequency. In this study, the proportion of children who received the minimum dietary diversity and meal frequency were low. Media exposure, age of children, postnatal care visits, and participation in child growth and monitoring

  1. A direct method for soil-structure interaction analysis based on frequency-dependent soil masses

    International Nuclear Information System (INIS)

    Danisch, R.; Delinic, K.; Marti, J.; Trbojevic, V.M.

    1993-01-01

    In a soil-structure interaction analysis, the soil, as a subsystem of the global vibrating system, exerts a strong influence on the response of the nuclear reactor building to the earthquake excitation. The volume of resources required for dealing with the soil have led to a number of different types of frequency-domain solutions, most of them based on the impedance function approach. These procedures require coupling the soil to the lumped-mass finite-element model of the reactor building. In most practical cases, the global vibrating system is analysed in the time domain (i.e. modal time history, linear or non-linear direct time-integration). Hence, it follows that the frequency domain solution for soil must be converted to an 'equivalent' soil model in the time domain. Over the past three decades, different approaches have been developed and used for earthquake analysis of nuclear power plants. In some cases, difficulties experienced in modelling the soil have affected the methods of global analysis, thus leading to approaches like the substructuring technique, e.g. 3-step method. In the practical applications, the limitations of each specific method must be taken into account in order to avoid unrealistic results. The aim of this paper is to present the recent development on an equivalent SDOF system for soil including frequency-dependent soil masses. The method will be compared with the classical 3-step method. (author)

  2. Technique for long and absolute distance measurement based on laser pulse repetition frequency sweeping

    Science.gov (United States)

    Castro Alves, D.; Abreu, Manuel; Cabral, A.; Jost, Michael; Rebordão, J. M.

    2017-11-01

    In this work we present a technique to perform long and absolute distance measurements based on mode-locked diode lasers. Using a Michelson interferometer, it is possible to produce an optical cross-correlation between laser pulses of the reference arm with the pulses from the measurement arm, adjusting externally their degree of overlap either changing the pulse repetition frequency (PRF) or the position of the reference arm mirror for two (or more) fixed frequencies. The correlation of the travelling pulses for precision distance measurements relies on ultra-short pulse durations, as the uncertainty associated to the method is dependent on the laser pulse width as well as on a highly stable PRF. Mode-locked Diode lasers are a very appealing technology for its inherent characteristics, associated to compactness, size and efficiency, constituting a positive trade-off with regard to other mode-locked laser sources. Nevertheless, main current drawback is the non-availability of frequency-stable laser diodes. The laser used is a monolithic mode-locked semiconductor quantum-dot (QD) laser. The laser PRF is locked to an external stabilized RF reference. In this work we will present some of the preliminary results and discuss the importance of the requirements related to laser PRF stability in the final metrology system accuracy.

  3. Sustaining GHz oscillation of carbon nanotube based oscillators via a MHz frequency excitation

    International Nuclear Information System (INIS)

    Motevalli, Benyamin; Taherifar, Neda; Liu, Jefferson Zhe

    2016-01-01

    There have been intensive studies to investigate the properties of gigahertz nano-oscillators based on multi-walled carbon nanotubes (MWCNTs). Many of these studies, however, revealed that the unique telescopic translational oscillations in such devices would damp quickly due to various energy dissipation mechanisms. This challenge remains the primary obstacle against its practical applications. Herein, we propose a design concept in which a GHz oscillation could be re-excited by a MHz mechanical motion. This design involves a triple-walled CNT, in which sliding of the longer inner tube at a MHz frequency can re-excite and sustain a GHz oscillation of the shorter middle tube. Our molecular dynamics (MD) simulations prove this design concept at ∼10 nm scale. A mathematical model is developed to explore the feasibility at a larger size scale. As an example, in an oscillatory system with the CNT’s length above 100 nm, the high oscillatory frequency range of 1.8–3.3 GHz could be excited by moving the inner tube at a much lower frequency of 53.4 MHz. This design concept together with the mechanical model could energize the development of GHz nano-oscillators in miniaturized electro-mechanical devices. (paper)

  4. Wideband RCS Reduction of Microstrip Array Antenna Based on Absorptive Frequency Selective Surface and Microstrip Resonators

    Directory of Open Access Journals (Sweden)

    Jingjing Xue

    2017-01-01

    Full Text Available An approach for wideband radar cross section (RCS reduction of a microstrip array antenna is presented and discussed. The scheme is based on the microstrip resonators and absorptive frequency selective surface (AFSS with a wideband absorptive property over the low band 1.9–7.5 GHz and a transmission characteristic at high frequency 11.05 GHz. The AFSS is designed to realize the out-of-band RCS reduction and preserve the radiation performance simultaneously, and it is placed above the antenna with the operating frequency of 11.05 GHz. Moreover, the microstrip resonators are loaded to obtain the in-band RCS reduction. As a result, a significant RCS reduction from 1.5 GHz to 13 GHz for both types of polarization has been accomplished. Compared with the reference antenna, the simulated results exhibit that the monostatic RCS of the proposed array antenna in x- and y-polarization can be reduced as much as 17.6 dB and 21.5 dB, respectively. And the measured results agree well with the simulated ones.

  5. Active cancellation of residual amplitude modulation in a frequency-modulation based Fabry-Perot interferometer.

    Science.gov (United States)

    Yu, Yinan; Wang, Yicheng; Pratt, Jon R

    2016-03-01

    Residual amplitude modulation (RAM) is one of the most common noise sources known to degrade the sensitivity of frequency modulation spectroscopy. RAM can arise as a result of the temperature dependent birefringence of the modulator crystal, which causes the orientation of the crystal's optical axis to shift with respect to the polarization of the incident light with temperature. In the fiber-based optical interferometer used on the National Institute of Standards and Technology calculable capacitor, RAM degrades the measured laser frequency stability and correlates with the environmental temperature fluctuations. We have demonstrated a simple approach that cancels out excessive RAM due to polarization mismatch between the light and the optical axis of the crystal. The approach allows us to measure the frequency noise of a heterodyne beat between two lasers individually locked to different resonant modes of a cavity with an accuracy better than 0.5 ppm, which meets the requirement to further determine the longitudinal mode number of the cavity length. Also, this approach has substantially mitigated the temperature dependency of the measurements of the cavity length and consequently the capacitance.

  6. Binary particle swarm optimization for frequency band selection in motor imagery based brain-computer interfaces.

    Science.gov (United States)

    Wei, Qingguo; Wei, Zhonghai

    2015-01-01

    A brain-computer interface (BCI) enables people suffering from affective neurological diseases to communicate with the external world. Common spatial pattern (CSP) is an effective algorithm for feature extraction in motor imagery based BCI systems. However, many studies have proved that the performance of CSP depends heavily on the frequency band of EEG signals used for the construction of covariance matrices. The use of different frequency bands to extract signal features may lead to different classification performances, which are determined by the discriminative and complementary information they contain. In this study, the broad frequency band (8-30 Hz) is divided into 10 sub-bands of band width 4 Hz and overlapping 2 Hz. Binary particle swarm optimization (BPSO) is used to find the best sub-band set to improve the performance of CSP and subsequent classification. Experimental results demonstrate that the proposed method achieved an average improvement of 6.91% in cross-validation accuracy when compared to broad band CSP.

  7. Complex Road Intersection Modelling Based on Low-Frequency GPS Track Data

    Science.gov (United States)

    Huang, J.; Deng, M.; Zhang, Y.; Liu, H.

    2017-09-01

    It is widely accepted that digital map becomes an indispensable guide for human daily traveling. Traditional road network maps are produced in the time-consuming and labour-intensive ways, such as digitizing printed maps and extraction from remote sensing images. At present, a large number of GPS trajectory data collected by floating vehicles makes it a reality to extract high-detailed and up-to-date road network information. Road intersections are often accident-prone areas and very critical to route planning and the connectivity of road networks is mainly determined by the topological geometry of road intersections. A few studies paid attention on detecting complex road intersections and mining the attached traffic information (e.g., connectivity, topology and turning restriction) from massive GPS traces. To the authors' knowledge, recent studies mainly used high frequency (1 s sampling rate) trajectory data to detect the crossroads regions or extract rough intersection models. It is still difficult to make use of low frequency (20-100 s) and easily available trajectory data to modelling complex road intersections geometrically and semantically. The paper thus attempts to construct precise models for complex road intersection by using low frequency GPS traces. We propose to firstly extract the complex road intersections by a LCSS-based (Longest Common Subsequence) trajectory clustering method, then delineate the geometry shapes of complex road intersections by a K-segment principle curve algorithm, and finally infer the traffic constraint rules inside the complex intersections.

  8. Tunable and broadband microwave frequency combs based on a semiconductor laser with incoherent optical feedback

    International Nuclear Information System (INIS)

    Zhao Mao-Rong; Wu Zheng-Mao; Deng Tao; Zhou Zhen-Li; Xia Guang-Qiong

    2015-01-01

    Based on a semiconductor laser (SL) with incoherent optical feedback, a novel all-optical scheme for generating tunable and broadband microwave frequency combs (MFCs) is proposed and investigated numerically. The results show that, under suitable operation parameters, the SL with incoherent optical feedback can be driven to operate at a regular pulsing state, and the generated MFCs have bandwidths broader than 40 GHz within a 10 dB amplitude variation. For a fixed bias current, the line spacing (or repetition frequency) of the MFCs can be easily tuned by varying the feedback delay time and the feedback strength, and the tuning range of the line spacing increases with the increase in the bias current. The linewidth of the MFCs is sensitive to the variation of the feedback delay time and the feedback strength, and a linewidth of tens of KHz can be achieved through finely adjusting the feedback delay time and the feedback strength. In addition, mappings of amplitude variation, repetition frequency, and linewidth of MFCs in the parameter space of the feedback delay time and the feedback strength are presented. (paper)

  9. A Switched Capacitor Based AC/DC Resonant Converter for High Frequency AC Power Generation

    Directory of Open Access Journals (Sweden)

    Cuidong Xu

    2015-09-01

    Full Text Available A switched capacitor based AC-DC resonant power converter is proposed for high frequency power generation output conversion. This converter is suitable for small scale, high frequency wind power generation. It has a high conversion ratio to provide a step down from high voltage to low voltage for easy use. The voltage conversion ratio of conventional switched capacitor power converters is fixed to n, 1/n or −1/n (n is the switched capacitor cell. In this paper, A circuit which can provide n, 1/n and 2n/m of the voltage conversion ratio is presented (n is stepping up the switched capacitor cell, m is stepping down the switching capacitor cell. The conversion ratio can be changed greatly by using only two switches. A resonant tank is used to assist in zero current switching, and hence the current spike, which usually exists in a classical switching switched capacitor converter, can be eliminated. Both easy operation and efficiency are possible. Principles of operation, computer simulations and experimental results of the proposed circuit are presented. General analysis and design methods are given. The experimental result verifies the theoretical analysis of high frequency AC power generation.

  10. a High-Frequency Three-Dimensional Tyre Model Based on Two Coupled Elastic Layers

    Science.gov (United States)

    LARSSON, K.; KROPP, W.

    2002-06-01

    Road traffic noise is today a serious environmental problem in urban areas. The dominating noise source at speeds greater than 50 km/h is car tyres. In order to achieve a reduction of traffic noise tyres have to become quieter. To reduce tyre/road noise a deep understanding of the noise generation mechanisms is of major importance. An existing tyre/road noise simulation model consists of a smooth tyre rolling at a constant speed on a rough road surface. It is composed of three separate modules: a tyre model, a contact model and a radiation model. The major drawback with the contact model is that it only takes the radial component of the contact forces into account. To improve this model, a description of the tangential motion at high frequencies is necessary. Most of the models for the structure-borne sound behaviour of tyres are designed for the low-frequency range (i.e., below 400 Hz). Above this frequency range, the curvature of the tyre is unimportant, while the internal structure (multi-layers of steel and rubber) increases in importance. For the high-frequency range, a double-layer tyre model is proposed, which is based on the general field equations, to take into account the tangential motion and the local deformation of the tread. Both propagating waves and mode shapes have been investigated by the use of this model. Calculations of the response of the tyre to an external excitation show relatively good agreement with measurements on a smooth tyre.

  11. Tunable KTA Stokes laser based on stimulated polariton scattering and its intracavity frequency doubling.

    Science.gov (United States)

    Zang, Jie; Cong, Zhenhua; Chen, Xiaohan; Zhang, Xingyu; Qin, Zengguang; Liu, Zhaojun; Lu, Jianren; Wu, Dong; Fu, Qiang; Jiang, Shiqi; Zhang, Shaojun

    2016-04-04

    This paper presents the tunable Stokes laser characteristics of KTiOAsO4 (KTA) crystal based on stimulated polariton scattering (SPS). When the pumping laser wavelength is 1064.2 nm, the KTA Stokes wave can be discontinuously tuned from 1077.9 to 1088.4 nm with four gaps from 1079.0 to 1080.1 nm, from 1080.8 to 1082.8 nm, from 1083.6 to 1085.5 nm, and from 1085.8 to 1086.8 nm. When a frequency doubling crystal LiB3O5 (LBO) is inserted into the Stokes laser cavity, the frequency-doubled wave can be discontinuously tuned from 539.0 to 539.5 nm, from 540.1 to 540.4 nm, from 541.3 to 541.8 nm, from 542.7 to 542.9 nm and from 543.4 to 544.2 nm. With a pumping pulse energy of 130.0 mJ and an output coupler reflectivity of about 30%, the obtained maximum Stokes laser pulse energy at 1078.6 nm is 33.9 mJ and the obtained maximum frequency-doubled laser pulse energy at 543.8 nm is 15.7 mJ. By using the most probably coupled transverse optical modes obtained from the literature, the polariton refractive indexes, and the simplified polariton Sellmeier equations, the polariton dispersion curve is obtained. The formation of the Stokes frequency gaps is explained.

  12. Analysis of High Frequency Resonance in DFIG-based Offshore Wind Farm via Long Transmission Cable

    DEFF Research Database (Denmark)

    Song, Yipeng; Ebrahimzadeh, Esmaeil; Blaabjerg, Frede

    2018-01-01

    During the past two decades, the Doubly Fed Induction Generator (DFIG) based wind farm has been under rapid growth, and the increasing wind power penetration has been seen. Practically, these wind farms are connected to the three-phase AC grid through long transmission cable which can be modelled...... as several II units. The impedance of this cable cannot be neglected and requires careful investigation due to its long distance. As a result, the impedance interaction between the DFIG based wind farm and the long cable is inevitable, and may produce High Frequency Resonance (HFR) in the wind farm....... This paper discusses the HFR of the large scale DFIG based wind farm connected to the long cable. Several influencing factors, including 1) the length of the cable, 2) the output active power and 3) the rotor speed, are investigated. Simulation validations using MATLAB / Simulink have been conducted...

  13. Distributed Optical Fiber Sensors Based on Optical Frequency Domain Reflectometry: A review.

    Science.gov (United States)

    Ding, Zhenyang; Wang, Chenhuan; Liu, Kun; Jiang, Junfeng; Yang, Di; Pan, Guanyi; Pu, Zelin; Liu, Tiegen

    2018-04-03

    Distributed optical fiber sensors (DOFS) offer unprecedented features, the most unique one of which is the ability of monitoring variations of the physical and chemical parameters with spatial continuity along the fiber. Among all these distributed sensing techniques, optical frequency domain reflectometry (OFDR) has been given tremendous attention because of its high spatial resolution and large dynamic range. In addition, DOFS based on OFDR have been used to sense many parameters. In this review, we will survey the key technologies for improving sensing range, spatial resolution and sensing performance in DOFS based on OFDR. We also introduce the sensing mechanisms and the applications of DOFS based on OFDR including strain, stress, vibration, temperature, 3D shape, flow, refractive index, magnetic field, radiation, gas and so on.

  14. Microwave amplification based on quasiparticle SIS up and down frequency converters

    Directory of Open Access Journals (Sweden)

    T. Kojima

    2018-02-01

    Full Text Available Heterodyne instruments have recently attained quantum-limited low-noise performance, particularly in radio astronomy, but it is difficult to develop large heterodyne arrays such as a modern radio camera using cryogenic sensitive detectors based on microwave kinetic inductance detectors, transition edge sensors, etc. In the realization of the heterodyne array, the reduction of power dissipation for semiconductor-based amplifiers remains a major challenge. Alternatively, superconducting parametric amplifiers still seem to have several barriers to application, especially in terms of operating temperature. Here, we show a novel concept of microwave amplification based on up and down frequency-conversion processes using quasiparticle superconductor-insulator-superconductor (SIS tunnel junctions. We demonstrate positive gain using a proof-of-concept test module, which operates with a power dissipation of several μW at a bath temperature of 4 K. The performance of the module suggests great potential for application in large arrays.

  15. Distributed Optical Fiber Sensors Based on Optical Frequency Domain Reflectometry: A review

    Science.gov (United States)

    Wang, Chenhuan; Liu, Kun; Jiang, Junfeng; Yang, Di; Pan, Guanyi; Pu, Zelin; Liu, Tiegen

    2018-01-01

    Distributed optical fiber sensors (DOFS) offer unprecedented features, the most unique one of which is the ability of monitoring variations of the physical and chemical parameters with spatial continuity along the fiber. Among all these distributed sensing techniques, optical frequency domain reflectometry (OFDR) has been given tremendous attention because of its high spatial resolution and large dynamic range. In addition, DOFS based on OFDR have been used to sense many parameters. In this review, we will survey the key technologies for improving sensing range, spatial resolution and sensing performance in DOFS based on OFDR. We also introduce the sensing mechanisms and the applications of DOFS based on OFDR including strain, stress, vibration, temperature, 3D shape, flow, refractive index, magnetic field, radiation, gas and so on. PMID:29614024

  16. Distributed Optical Fiber Sensors Based on Optical Frequency Domain Reflectometry: A review

    Directory of Open Access Journals (Sweden)

    Zhenyang Ding

    2018-04-01

    Full Text Available Distributed optical fiber sensors (DOFS offer unprecedented features, the most unique one of which is the ability of monitoring variations of the physical and chemical parameters with spatial continuity along the fiber. Among all these distributed sensing techniques, optical frequency domain reflectometry (OFDR has been given tremendous attention because of its high spatial resolution and large dynamic range. In addition, DOFS based on OFDR have been used to sense many parameters. In this review, we will survey the key technologies for improving sensing range, spatial resolution and sensing performance in DOFS based on OFDR. We also introduce the sensing mechanisms and the applications of DOFS based on OFDR including strain, stress, vibration, temperature, 3D shape, flow, refractive index, magnetic field, radiation, gas and so on.

  17. Estimating parameters of speciation models based on refined summaries of the joint site-frequency spectrum.

    Directory of Open Access Journals (Sweden)

    Aurélien Tellier

    Full Text Available Understanding the processes and conditions under which populations diverge to give rise to distinct species is a central question in evolutionary biology. Since recently diverged populations have high levels of shared polymorphisms, it is challenging to distinguish between recent divergence with no (or very low inter-population gene flow and older splitting events with subsequent gene flow. Recently published methods to infer speciation parameters under the isolation-migration framework are based on summarizing polymorphism data at multiple loci in two species using the joint site-frequency spectrum (JSFS. We have developed two improvements of these methods based on a more extensive use of the JSFS classes of polymorphisms for species with high intra-locus recombination rates. First, using a likelihood based method, we demonstrate that taking into account low-frequency polymorphisms shared between species significantly improves the joint estimation of the divergence time and gene flow between species. Second, we introduce a local linear regression algorithm that considerably reduces the computational time and allows for the estimation of unequal rates of gene flow between species. We also investigate which summary statistics from the JSFS allow the greatest estimation accuracy for divergence time and migration rates for low (around 10 and high (around 100 numbers of loci. Focusing on cases with low numbers of loci and high intra-locus recombination rates we show that our methods for the estimation of divergence time and migration rates are more precise than existing approaches.

  18. The Monitoring Case of Ground-Based Synthetic Aperture Radar with Frequency Modulated Continuous Wave System

    Science.gov (United States)

    Zhang, H. Y.; Zhai, Q. P.; Chen, L.; Liu, Y. J.; Zhou, K. Q.; Wang, Y. S.; Dou, Y. D.

    2017-09-01

    The features of the landslide geological disaster are wide distribution, variety, high frequency, high intensity, destructive and so on. It has become a natural disaster with harmful and wide range of influence. The technology of ground-based synthetic aperture radar is a novel deformation monitoring technology developed in recent years. The features of the technology are large monitoring area, high accuracy, long distance without contact and so on. In this paper, fast ground-based synthetic aperture radar (Fast-GBSAR) based on frequency modulated continuous wave (FMCW) system is used to collect the data of Ma Liuzui landslide in Chongqing. The device can reduce the atmospheric errors caused by rapidly changing environment. The landslide deformation can be monitored in severe weather conditions (for example, fog) by Fast-GBSAR with acquisition speed up to 5 seconds per time. The data of Ma Liuzui landslide in Chongqing are analyzed in this paper. The result verifies that the device can monitor landslide deformation under severe weather conditions.

  19. Building Modern Vibration Diagnostics Systems Based on the Frequency-Time Transformations of A Measured Signal

    Directory of Open Access Journals (Sweden)

    Yasoveev Vasikh

    2016-01-01

    Full Text Available Basic methods of analysis of vibration transducers signals were reviewed. Continuous wavelet transform, being a time-frequency transform, was found to be an advanced mathematical tool for analysis of vibration signals. Experimental studies revealed obvious changes in the continuous wavelet transform spectrum depending on the existing defects. A method for detection and identification of technological violations based on the analysis of CWT spectrum components and normalized correlation coefficient was suggested. In accordance with the suggested method software for vibration diagnostics was developed.

  20. Frequency of different lifestyle modification measures among patients with GERD based on monthly income.

    Science.gov (United States)

    Chen, Philumena; Khan, Mahnoor Saeed; Naseem, Sajida

    2017-11-01

    A cross-sectional study was carried out at Shifa International Hospital Islamabad over a period of 6 months, to determine the frequency and compare the different lifestyle modifications among patients with Gastroesophageal Reflux Disease (GERD) of different monthly income groups. Two hundred patients of GERD were enrolled in the study and divided into two groups based on monthly income less than and more than Rs. 30,000 respectively. Data was analyzed using SPSS 21. Descriptive statistics were calculated. Chi-square test was applied keeping p-value modifications to reduce GERD symptoms and stop sole reliance on medications.

  1. An optical modulation format generation scheme based on spectral filtering and frequency-to-time mapping

    Institute of Scientific and Technical Information of China (English)

    ZHANG Ai-ling; ZHANG Yue; SONG Hong-yun; YAO Yuan; PAN Hong-gang

    2018-01-01

    An optical modulation format generation scheme based on spectral filtering and frequency-to-time mapping is experimentally demonstrated.Many modulation formats with continuously adjustable duty radio and bit rate can be formed by changing the dispersion of dispersion element and the bandwidth of shaped spectrum in this scheme.In the experiment,non-return-to-zero (NRZ) signal with bit rate of 29.41 Gbit/s and 1/2 duty ratio return-to-zero (RZ) signal with bit rate of 13.51 Gbit/s are obtained.The maximum bit rate of modulation format signal is also analyzed.

  2. Francisella tularensis detection using magnetic labels and a magnetic biosensor based on frequency mixing

    International Nuclear Information System (INIS)

    Meyer, Martin H.F.; Krause, Hans-Joachim; Hartmann, Markus; Miethe, Peter; Oster, Juergen; Keusgen, Michael

    2007-01-01

    A biosensor that uses resonant coils with a special frequency-mixing technique and magnetic beads as detectable labels has been established for the detection of Francisella tularensis, the causative agent for tularemia. The detection principle is based on a sandwich immunoassay using an anti-Ft antibody for immunofiltration immobilized to ABICAP[reg] polyethylene filters, and biotinylated with streptavidin-coated magnetic beads as labels. The linear detection range of this biosensor was found to be 10 4 -10 6 cfu F. tularensis lipopolysaccharide (LPS) per ml. Tested sample matrices were physiological PBS buffer and rabbit serum

  3. Francisella tularensis detection using magnetic labels and a magnetic biosensor based on frequency mixing

    Energy Technology Data Exchange (ETDEWEB)

    Meyer, Martin H.F. [Institute for Pharmaceutical Chemistry, Philipps-Universitaet Marburg (Germany); Krause, Hans-Joachim [Institute of Bio-and Nanosystems (IBN-2), Research Center Juelich (Germany); Hartmann, Markus [Institute for Pharmaceutical Chemistry, Philipps-Universitaet Marburg (Germany); Miethe, Peter [SENOVA GmbH, Jena (Germany); Oster, Juergen [chemagen GmbH, Baesweiler (Germany); Keusgen, Michael [Institute for Pharmaceutical Chemistry, Philipps-Universitaet Marburg (Germany)]. E-mail: Keusgen@staff.uni-marburg.de

    2007-04-15

    A biosensor that uses resonant coils with a special frequency-mixing technique and magnetic beads as detectable labels has been established for the detection of Francisella tularensis, the causative agent for tularemia. The detection principle is based on a sandwich immunoassay using an anti-Ft antibody for immunofiltration immobilized to ABICAP[reg] polyethylene filters, and biotinylated with streptavidin-coated magnetic beads as labels. The linear detection range of this biosensor was found to be 10{sup 4}-10{sup 6} cfu F. tularensis lipopolysaccharide (LPS) per ml. Tested sample matrices were physiological PBS buffer and rabbit serum.

  4. GaN-based High Efficiency Bidirectional DC-DC Converter with 10 MHz Switching Frequency

    DEFF Research Database (Denmark)

    Kruse, Kristian; Zhang, Zhe; Elbo, Mads

    2017-01-01

    -isolated bidirectional DC-DC converter equipped with Gallium Nitride (GaN) semiconductor transistors is presented. The converter’s operation principles, zero-voltage switching (ZVS) constraints and dead-time effects are studied. Moreover, the optimization and tradeoffs on the adopted high-frequency inductor...... are achieved. Moreover, the measured losses can match the theoretically calculated counterparts well, therefore the design and analysis are verified. However, from the experimental test carried out, it can also be seen, that making a compact converter, even for a GaN-based one, operate at 10 MHz and 100 W...

  5. Research on a Micro-Grid Frequency Modulation Strategy Based on Optimal Utilization of Air Conditioners

    Directory of Open Access Journals (Sweden)

    Qingzhu Wan

    2016-12-01

    Full Text Available With the proportion of air conditioners increasing gradually, they can provide a certain amount of frequency-controlled reserves for a micro-grid. Optimizing utilization of air conditioners and considering load response characteristics and customer comfort, the frequency adjustment model is a quadratic function model between the trigger temperature of the air conditioner compressor, and frequency variation is provided, which can be used to regulate the trigger temperature of the air conditioner when the micro-grid frequency rises and falls. This frequency adjustment model combines a primary frequency modulation method and a secondary frequency modulation method of the energy storage system, in order to optimize the frequency of a micro-grid. The simulation results show that the frequency modulation strategy for air conditioners can effectively improve the frequency modulation ability of air conditioners and frequency modulation effects of a micro-grid in coordination with an energy storage system.

  6. Dynamic model based novel findings in power systems analysis and frequency measurement verification

    Science.gov (United States)

    Kook, Kyung Soo

    This study selects several new advanced topics in power systems, and verifies their usefulness using the simulation. In the study on ratio of the equivalent reactance and resistance of the bulk power systems, the simulation results give us the more correct value of X/R of the bulk power system, which can explain why the active power compensation is also important in voltage flicker mitigation. In the application study of the Energy Storage System(ESS) to the wind power, the new model implementation of the ESS connected to the wind power is proposed, and the control effect of ESS to the intermittency of the wind power is verified. Also this study conducts the intensive simulations for clarifying the behavior of the wide-area power system frequency as well as the possibility of the on-line instability detection. In our POWER IT Laboratory, since 2003, the U.S. national frequency monitoring network (FNET) has been being continuously operated to monitor the wide-area power system frequency in the U.S. Using the measured frequency data, the event of the power system is triggered, and its location and scale are estimated. This study also looks for the possibility of using the simulation technologies to contribute the applications of FNET, finds similarity of the event detection orders between the frequency measurements and the simulations in the U.S. Eastern power grid, and develops the new methodology for estimating the event location based on the simulated N-1 contingencies using the frequency measurement. It has been pointed out that the simulation results can not represent the actual response of the power systems due to the inevitable limit of modeling power systems and different operating conditions of the systems at every second. However, in the circumstances that we need to test such an important infrastructure supplying the electric energy without taking any risk of it, the software based simulation will be the best solution to verify the new technologies in

  7. High accuracy microwave frequency measurement based on single-drive dual-parallel Mach-Zehnder modulator

    DEFF Research Database (Denmark)

    Zhao, Ying; Pang, Xiaodan; Deng, Lei

    2011-01-01

    A novel approach for broadband microwave frequency measurement by employing a single-drive dual-parallel Mach-Zehnder modulator is proposed and experimentally demonstrated. Based on bias manipulations of the modulator, conventional frequency-to-power mapping technique is developed by performing a...... 10−3 relative error. This high accuracy frequency measurement technique is a promising candidate for high-speed electronic warfare and defense applications....

  8. Pairwise comparison of 89Zr- and 124I-labeled cG250 based on positron emission tomography imaging and nonlinear immunokinetic modeling: in vivo carbonic anhydrase IX receptor binding and internalization in mouse xenografts of clear-cell renal cell carcinoma

    International Nuclear Information System (INIS)

    Cheal, Sarah M.; Punzalan, Blesida; Doran, Michael G.; Osborne, Joseph R.; Evans, Michael J.; Lewis, Jason S.; Zanzonico, Pat; Larson, Steven M.

    2014-01-01

    The PET tracer, 124 I-cG250, directed against carbonic anhydrase IX (CAIX) shows promise for presurgical diagnosis of clear-cell renal cell carcinoma (ccRCC) (Divgi et al. in Lancet Oncol 8:304-310, 2007; Divgi et al. in J Clin Oncol 31:187-194, 2013). The radiometal 89 Zr, however, may offer advantages as a surrogate PET nuclide over 124 I in terms of greater tumor uptake and retention (Rice et al. in Semin Nucl Med 41:265-282, 2011). We have developed a nonlinear immunokinetic model to facilitate a quantitative comparison of absolute uptake and antibody turnover between 124 I-cG250 and 89 Zr-cG250 using a human ccRCC xenograft tumor model in mice. We believe that this unique model better relates quantitative imaging data to the salient biological features of tumor antibody-antigen binding and turnover. We conducted experiments with 89 Zr-cG250 and 124 I-cG250 using a human ccRCC cell line (SK-RC-38) to characterize the binding affinity and internalization kinetics of the two tracers in vitro. Serial PET imaging was performed in mice bearing subcutaneous ccRCC tumors to simultaneously detect and quantify time-dependent tumor uptake in vivo. Using the known specific activities of the two tracers, the equilibrium rates of antibody internalization and turnover in the tumors were derived from the PET images using nonlinear compartmental modeling. The two tracers demonstrated virtually identical tumor cell binding and internalization but showed markedly different retentions in vitro. Superior PET images were obtained using 89 Zr-cG250, owing to the more prolonged trapping of the radiolabel in the tumor and simultaneous washout from normal tissues. Estimates of cG250/CAIX complex turnover were 1.35 - 5.51 x 10 12 molecules per hour per gram of tumor (20 % of receptors internalized per hour), and the ratio of 124 I/ 89 Zr atoms released per unit time by tumor was 17.5. Pairwise evaluation of 89 Zr-cG250 and 124 I-cG250 provided the basis for a nonlinear immunokinetic

  9. Pairwise comparison of {sup 89}Zr- and {sup 124}I-labeled cG250 based on positron emission tomography imaging and nonlinear immunokinetic modeling: in vivo carbonic anhydrase IX receptor binding and internalization in mouse xenografts of clear-cell renal cell carcinoma

    Energy Technology Data Exchange (ETDEWEB)

    Cheal, Sarah M.; Punzalan, Blesida; Doran, Michael G.; Osborne, Joseph R. [Memorial Sloan-Kettering Cancer Center, Department of Radiology, New York, NY (United States); Evans, Michael J. [Memorial Sloan-Kettering Cancer Center, Human Oncology and Pathogenesis Program, New York, NY (United States); Lewis, Jason S. [Memorial Sloan-Kettering Cancer Center, Department of Radiology, New York, NY (United States); Memorial Sloan-Kettering Cancer Center, Program in Molecular Pharmacology and Chemistry, New York, NY (United States); Memorial Sloan-Kettering Cancer Center, Radiochemistry and Imaging Sciences Service, New York, NY (United States); Zanzonico, Pat [Memorial Sloan-Kettering Cancer Center, Department of Radiology, New York, NY (United States); Memorial Sloan-Kettering Cancer Center, Molecular Pharmacology and Therapy Service, New York, NY (United States); Memorial-Sloan Kettering Cancer Center, New York, NY (United States); Larson, Steven M. [Memorial Sloan-Kettering Cancer Center, Department of Radiology, New York, NY (United States); Memorial Sloan-Kettering Cancer Center, Program in Molecular Pharmacology and Chemistry, New York, NY (United States); Memorial Sloan-Kettering Cancer Center, Molecular Pharmacology and Therapy Service, New York, NY (United States)

    2014-05-15

    The PET tracer, {sup 124}I-cG250, directed against carbonic anhydrase IX (CAIX) shows promise for presurgical diagnosis of clear-cell renal cell carcinoma (ccRCC) (Divgi et al. in Lancet Oncol 8:304-310, 2007; Divgi et al. in J Clin Oncol 31:187-194, 2013). The radiometal {sup 89}Zr, however, may offer advantages as a surrogate PET nuclide over {sup 124}I in terms of greater tumor uptake and retention (Rice et al. in Semin Nucl Med 41:265-282, 2011). We have developed a nonlinear immunokinetic model to facilitate a quantitative comparison of absolute uptake and antibody turnover between {sup 124}I-cG250 and {sup 89}Zr-cG250 using a human ccRCC xenograft tumor model in mice. We believe that this unique model better relates quantitative imaging data to the salient biological features of tumor antibody-antigen binding and turnover. We conducted experiments with {sup 89}Zr-cG250 and {sup 124}I-cG250 using a human ccRCC cell line (SK-RC-38) to characterize the binding affinity and internalization kinetics of the two tracers in vitro. Serial PET imaging was performed in mice bearing subcutaneous ccRCC tumors to simultaneously detect and quantify time-dependent tumor uptake in vivo. Using the known specific activities of the two tracers, the equilibrium rates of antibody internalization and turnover in the tumors were derived from the PET images using nonlinear compartmental modeling. The two tracers demonstrated virtually identical tumor cell binding and internalization but showed markedly different retentions in vitro. Superior PET images were obtained using {sup 89}Zr-cG250, owing to the more prolonged trapping of the radiolabel in the tumor and simultaneous washout from normal tissues. Estimates of cG250/CAIX complex turnover were 1.35 - 5.51 x 10{sup 12} molecules per hour per gram of tumor (20 % of receptors internalized per hour), and the ratio of {sup 124}I/{sup 89}Zr atoms released per unit time by tumor was 17.5. Pairwise evaluation of {sup 89}Zr-cG250 and {sup

  10. A time-frequency analysis method to obtain stable estimates of magnetotelluric response function based on Hilbert-Huang transform

    Science.gov (United States)

    Cai, Jianhua

    2017-05-01

    The time-frequency analysis method represents signal as a function of time and frequency, and it is considered a powerful tool for handling arbitrary non-stationary time series by using instantaneous frequency and instantaneous amplitude. It also provides a possible alternative to the analysis of the non-stationary magnetotelluric (MT) signal. Based on the Hilbert-Huang transform (HHT), a time-frequency analysis method is proposed to obtain stable estimates of the magnetotelluric response function. In contrast to conventional methods, the response function estimation is performed in the time-frequency domain using instantaneous spectra rather than in the frequency domain, which allows for imaging the response parameter content as a function of time and frequency. The theory of the method is presented and the mathematical model and calculation procedure, which are used to estimate response function based on HHT time-frequency spectrum, are discussed. To evaluate the results, response function estimates are compared with estimates from a standard MT data processing method based on the Fourier transform. All results show that apparent resistivities and phases, which are calculated from the HHT time-frequency method, are generally more stable and reliable than those determined from the simple Fourier analysis. The proposed method overcomes the drawbacks of the traditional Fourier methods, and the resulting parameter minimises the estimation bias caused by the non-stationary characteristics of the MT data.

  11. Novel power MOSFET-based expander for high frequency ultrasound systems.

    Science.gov (United States)

    Choi, Hojong; Shung, K Kirk

    2014-01-01

    The function of an expander is to obstruct the noise signal transmitted by the pulser so that it does not pass into the transducer or receive electronics, where it can produce undesirable ring-down in an ultrasound imaging application. The most common type is a diode-based expander, which is essentially a simple diode-pair, is widely used in pulse-echo measurements and imaging applications because of its simple architecture. However, diode-based expanders may degrade the performance of ultrasonic transducers and electronic components on the receiving and transmitting sides of the ultrasound systems, respectively. Since they are non-linear devices, they cause excessive signal attenuation and noise at higher frequencies and voltages. In this paper, a new type of expander that utilizes power MOSFET components, which we call a power MOSFET-based expander, is introduced and evaluated for use in high frequency ultrasound imaging systems. The performance of a power MOSFET-based expander was evaluated relative to a diode-based expander by comparing the noise figure (NF), insertion loss (IL), total harmonic distortion (THD), response time (RT), electrical impedance (EI) and dynamic power consumption (DPC). The results showed that the power MOSFET-based expander provided better NF (0.76 dB), IL (-0.3 dB) and THD (-62.9 dB), and faster RT (82 ns) than did the diode-based expander (NF (2.6 dB), IL (-1.4 dB), THD (-56.0 dB) and RT (119 ns)) at 70 MHz. The -6 dB bandwidth and the peak-to-peak voltage of the echo signal received by the transducer using the power MOSFET-based expander improved by 17.4% and 240% compared to the diode-based expander, respectively. The new power MOSFET-based expander was shown to yield lower NF, IL and THD, faster RT and lower ring down than the diode-based expander at the expense of higher dynamic power consumption. Copyright © 2013 Elsevier B.V. All rights reserved.

  12. Study on the changes of serum HA and CG levels in several diseases besides liver disorders

    International Nuclear Information System (INIS)

    Lu Zhiping; Ma Yunbao; Zhang Xiaoyi; Lv Weihua

    2005-01-01

    Objective: To study the changes of serum hyaluronic acid (HA) and cholyglycine (CG) in several diseases besides liver disorders. Methods: Serum HA and CG levels were measured with RIA in 78 patients with chronic liver diseases (with 70 controls), (84 patients with primary hepatic carcinoma ), 70 pediatric patients with various infections diseases (with 40 controls), 50 pediatric patients with recurrent respiratory infection (RRI, with 30 controls) and 428 pregnant women ( with 60 controls). In addition, RBC C 3 b receptor ratio (RBCC 3 bRR) and RBC immune-complex ratio (RBCICR) (both with yeast rosette method) as well as serum IgG,IgM,IgA,C 3 levels (with immunoturbidity test) were examined in the 50 RRI pediatric patients, ALT levels were examined in the 70 pediatric patients with infectious diseases and SF examined in the 78 patients with chronic liver diseases. Results: The serum CG, HA and SF levels in the three groups of patients with chronic liver diseases ( CPH, CAH, Cirrhosis) were significantly higher than those in the controls (all P 0.05). In patients with hepatic carcinoma, the CG and HA levels were positively correlated with the mortality at 4 months (P 0.05). For ALT, levels only increased in patients with hepatitis and typhoid fever with none in bacillary dysentery and mumps. In pediatric patients with RRI, RBCC 3 bRR (%), CG, C 3 , IgG levels were significantly higher than those in controls (P 0.05). Conclusion: Various infectious diseases in pediatric patients could induce mild liver damage, which was closely related to the depressed immune status. High CG and HA levels in liver cancer patients suggested high mortality at 4 months. Women in late pregnancy might harbour disturbances in CG metabolism and mild liver injury though without overt symptoms. (authors)

  13. Origami-based mechanical metamaterials with tunable frequency band structures (Conference Presentation)

    Science.gov (United States)

    Yasuda, Hiromi; Pratt, Riley; Yang, Jinkyu

    2017-04-01

    We investigate wave dynamics in origami-based mechanical metamaterials composed of bellows-like origami structures, specifically the Tachi-Miura Polyhedron (TMP). One of the unique features of the TMP is that its structural deformations take place only along the crease lines, therefore the structure can be made of rigid plates and hinges. By utilizing this feature, we introduce linear torsional springs to model the crease lines and derive the force and displacement relationship of the TMP structure along the longitudinal direction. Our analysis shows strain softening/hardening behaviors in compression/tensile regions respectively, and the force-displacement curve can be manipulated by altering the initial configuration of the TMP (e.g., the initial folding angle). We also fabricate physical prototypes and measure the force-displacement behavior to verify our analytical model. Based on this static analysis on the TMP, we simplify the TMP structure into a linkage model, preserving the tunable strain softening/hardening behaviors. Dynamic analysis is also conducted numerically to analyze the frequency response of the simplified TMP unit cell under harmonic excitations. The simplified TMP exhibits a transition between linear and nonlinear behaviors, which depends on the amplitude of the excitation and the initial configuration. In addition, we design a 1D system composed of simplified TMP unit cells and analyze the relationship between frequency and wave number. If two different configurations of the unit cell (e.g., different initial folding angles) are connected in an alternating arrangement, the system develops frequency bandgaps. These unique static/dynamic behaviors can be exploited to design engineering devices which can handle vibrations and impact in an efficient manner.

  14. A Machine Learning-based Rainfall System for GPM Dual-frequency Radar

    Science.gov (United States)

    Tan, H.; Chandrasekar, V.; Chen, H.

    2017-12-01

    Precipitation measurement produced by the Global Precipitation Measurement (GPM) Dual-frequency Precipitation Radar (DPR) plays an important role in researching the water circle and forecasting extreme weather event. Compare with its predecessor - Tropical Rainfall Measuring Mission (TRMM) Precipitation Radar (PR), GRM DPR measures precipitation in two different frequencies (i.e., Ku and Ka band), which can provide detailed information on the microphysical properties of precipitation particles, quantify particle size distribution and quantitatively measure light rain and falling snow. This paper presents a novel Machine Learning system for ground-based and space borne radar rainfall estimation. The system first trains ground radar data for rainfall estimation using rainfall measurements from gauges and subsequently uses the ground radar based rainfall estimates to train GPM DPR data in order to get space based rainfall product. Therein, data alignment between space DPR and ground radar is conducted using the methodology proposed by Bolen and Chandrasekar (2013), which can minimize the effects of potential geometric distortion of GPM DPR observations. For demonstration purposes, rainfall measurements from three rain gauge networks near Melbourne, Florida, are used for training and validation purposes. These three gauge networks, which are located in Kennedy Space Center (KSC), South Florida Water Management District (SFL), and St. Johns Water Management District (STJ), include 33, 46, and 99 rain gauge stations, respectively. Collocated ground radar observations from the National Weather Service (NWS) Weather Surveillance Radar - 1988 Doppler (WSR-88D) in Melbourne (i.e., KMLB radar) are trained with the gauge measurements. The trained model is then used to derive KMLB radar based rainfall product, which is used to train GPM DPR data collected from coincident overpasses events. The machine learning based rainfall product is compared against the GPM standard products

  15. High-frequency combination coding-based steady-state visual evoked potential for brain computer interface

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Feng; Zhang, Xin; Xie, Jun; Li, Yeping; Han, Chengcheng; Lili, Li; Wang, Jing [School of Mechanical Engineering, Xi’an Jiaotong University, Xi’an 710049 (China); Xu, Guang-Hua [School of Mechanical Engineering, Xi’an Jiaotong University, Xi’an 710049 (China); State Key Laboratory for Manufacturing Systems Engineering, Xi’an Jiaotong University, Xi’an 710054 (China)

    2015-03-10

    This study presents a new steady-state visual evoked potential (SSVEP) paradigm for brain computer interface (BCI) systems. The goal of this study is to increase the number of targets using fewer stimulation high frequencies, with diminishing subject’s fatigue and reducing the risk of photosensitive epileptic seizures. The new paradigm is High-Frequency Combination Coding-Based High-Frequency Steady-State Visual Evoked Potential (HFCC-SSVEP).Firstly, we studied SSVEP high frequency(beyond 25 Hz)response of SSVEP, whose paradigm is presented on the LED. The SNR (Signal to Noise Ratio) of high frequency(beyond 40 Hz) response is very low, which is been unable to be distinguished through the traditional analysis method; Secondly we investigated the HFCC-SSVEP response (beyond 25 Hz) for 3 frequencies (25Hz, 33.33Hz, and 40Hz), HFCC-SSVEP produces n{sup n} with n high stimulation frequencies through Frequence Combination Code. Further, Animproved Hilbert-huang transform (IHHT)-based variable frequency EEG feature extraction method and a local spectrum extreme target identification algorithmare adopted to extract time-frequency feature of the proposed HFCC-SSVEP response.Linear predictions and fixed sifting (iterating) 10 time is used to overcome the shortage of end effect and stopping criterion,generalized zero-crossing (GZC) is used to compute the instantaneous frequency of the proposed SSVEP respondent signals, the improved HHT-based feature extraction method for the proposed SSVEP paradigm in this study increases recognition efficiency, so as to improve ITR and to increase the stability of the BCI system. what is more, SSVEPs evoked by high-frequency stimuli (beyond 25Hz) minimally diminish subject’s fatigue and prevent safety hazards linked to photo-induced epileptic seizures, So as to ensure the system efficiency and undamaging.This study tests three subjects in order to verify the feasibility of the proposed method.

  16. High-frequency combination coding-based steady-state visual evoked potential for brain computer interface

    International Nuclear Information System (INIS)

    Zhang, Feng; Zhang, Xin; Xie, Jun; Li, Yeping; Han, Chengcheng; Lili, Li; Wang, Jing; Xu, Guang-Hua

    2015-01-01

    This study presents a new steady-state visual evoked potential (SSVEP) paradigm for brain computer interface (BCI) systems. The goal of this study is to increase the number of targets using fewer stimulation high frequencies, with diminishing subject’s fatigue and reducing the risk of photosensitive epileptic seizures. The new paradigm is High-Frequency Combination Coding-Based High-Frequency Steady-State Visual Evoked Potential (HFCC-SSVEP).Firstly, we studied SSVEP high frequency(beyond 25 Hz)response of SSVEP, whose paradigm is presented on the LED. The SNR (Signal to Noise Ratio) of high frequency(beyond 40 Hz) response is very low, which is been unable to be distinguished through the traditional analysis method; Secondly we investigated the HFCC-SSVEP response (beyond 25 Hz) for 3 frequencies (25Hz, 33.33Hz, and 40Hz), HFCC-SSVEP produces n n with n high stimulation frequencies through Frequence Combination Code. Further, Animproved Hilbert-huang transform (IHHT)-based variable frequency EEG feature extraction method and a local spectrum extreme target identification algorithmare adopted to extract time-frequency feature of the proposed HFCC-SSVEP response.Linear predictions and fixed sifting (iterating) 10 time is used to overcome the shortage of end effect and stopping criterion,generalized zero-crossing (GZC) is used to compute the instantaneous frequency of the proposed SSVEP respondent signals, the improved HHT-based feature extraction method for the proposed SSVEP paradigm in this study increases recognition efficiency, so as to improve ITR and to increase the stability of the BCI system. what is more, SSVEPs evoked by high-frequency stimuli (beyond 25Hz) minimally diminish subject’s fatigue and prevent safety hazards linked to photo-induced epileptic seizures, So as to ensure the system efficiency and undamaging.This study tests three subjects in order to verify the feasibility of the proposed method

  17. Differences in signal activation by LH and hCG are mediated by the LH/CG receptor`s extracellular hinge region

    Directory of Open Access Journals (Sweden)

    Paul eGrzesik

    2015-09-01

    Full Text Available The human lutropin/choriogonadotropin receptor (LHCGR can be activated by binding two slightly different gonadotropic glycoprotein hormones, choriogonadotropin (CG - secreted by the placenta, and lutropin (LH - produced by the pituitary. They induce different signaling profiles at the LHCGR. This cannot be explained by binding to the receptor's leucine-rich repeat domain (LRRD, as this binding is similar for the two hormones. We therefore speculate that there are previously unknown differences in the hormone/receptor interaction at the extracellular hinge region, which might help to understand functional differences between the two hormones. We have therefore performed a detailed study of the binding and action of LH and CG at the LHCGR hinge region. We focused on a primate-specific additional exon in the hinge region, which is located between LRRD and the serpentine domain. The segment of the hinge region encoded by exon10 was previously reported to be only relevant to hLH signaling, as the exon10-deletion receptor exhibits decreased hLH signaling, but unchanged hCG signaling. We designed an advanced homology model of the hormone/LHCGR complex, followed by experimental characterization of relevant fragments in the hinge region. In addition, we examined predictions of a helical exon10-encoded conformation by block-wise polyalanine (helix supporting mutations. These helix preserving modifications showed no effect on hormone induced signaling. However, introduction of a structure-disturbing double-proline mutant LHCGR-Q303P/E305P within the exon10-helix has, in contrast to exon10 deletion, no impact on hLH, but only on hCG signaling. This opposite effect on signaling by hLH and hCG can be explained by distinct sites of hormone interaction in the hinge region s. In conclusion, our analysis provides details of the differences between hLH- and hCG-induced signaling that are mainly determined in the L2-beta loop of the hormones and in the hinge region

  18. Research on Health State Perception Algorithm of Mining Equipment Based on Frequency Closeness

    Directory of Open Access Journals (Sweden)

    Gang Wang

    2014-06-01

    Full Text Available The health state perception of mining equipment is intended to have an online real- time knowledge and analysis of the running conditions of large mining equipments. Due to its unknown failure mode, a challenge was raised to the traditional fault diagnosis of mining equipments. A health state perception algorithm of mining equipment was introduced in this paper, and through continuous sampling of the machine vibration data, the time-series data set was set up; subsequently, the mode set based on the frequency closeness was constructed by the d neighborhood method combined with the TSDM algorithm, thus the forecast method on the basis of the dual mode set was eventually formed. In the calculation of the frequency closeness, the Goertzel algorithm was introduced to effectively decrease the computation amount. It was indicated through the simulation test on the vibration data of the drum shaft base that the health state of the device could be effectively distinguished. The algorithm has been successfully applied to equipment monitoring in the Huoer Xinhe Coal Mine of Shanxi Coal Imp&Exp. Group Co., Ltd.

  19. Simple Wide Frequency Range Impedance Meter Based on AD5933 Integrated Circuit

    Directory of Open Access Journals (Sweden)

    Chabowski Konrad

    2015-03-01

    Full Text Available As it contains elements of complete digital impedance meter, the AD5933 integrated circuit is an interesting solution for impedance measurements. However, its use for measurements in a wide range of impedances and frequencies requires an additional digital and analogue circuitry. This paper presents the design and performance of a simple impedance meter based on the AD5933 IC. Apart from the AD5933 IC it consists of a clock generator with a programmable prescaler, a novel DC offset canceller for the excitation signal based on peak detectors and a current to voltage converter with switchable conversion ratios. The authors proposed a simple method for choosing the measurement frequency to minimalize errors resulting from the spectral leakage and distortion caused by a lack of an anti-aliasing filter in the DDS generator. Additionally, a novel method for the AD5933 IC calibration was proposed. It consists in a mathematical compensation of the systematic error occurring in the argument of the value returned from the AD5933 IC as a result. The performance of the whole system is demonstrated in an exemplary measurement.

  20. Performance Evaluation of Frequency Transform Based Block Classification of Compound Image Segmentation Techniques

    Science.gov (United States)

    Selwyn, Ebenezer Juliet; Florinabel, D. Jemi

    2018-04-01

    Compound image segmentation plays a vital role in the compression of computer screen images. Computer screen images are images which are mixed with textual, graphical, or pictorial contents. In this paper, we present a comparison of two transform based block classification of compound images based on metrics like speed of classification, precision and recall rate. Block based classification approaches normally divide the compound images into fixed size blocks of non-overlapping in nature. Then frequency transform like Discrete Cosine Transform (DCT) and Discrete Wavelet Transform (DWT) are applied over each block. Mean and standard deviation are computed for each 8 × 8 block and are used as features set to classify the compound images into text/graphics and picture/background block. The classification accuracy of block classification based segmentation techniques are measured by evaluation metrics like precision and recall rate. Compound images of smooth background and complex background images containing text of varying size, colour and orientation are considered for testing. Experimental evidence shows that the DWT based segmentation provides significant improvement in recall rate and precision rate approximately 2.3% than DCT based segmentation with an increase in block classification time for both smooth and complex background images.

  1. Determination of delayed neutrons source in the frequency domain based on in-pile oscillation measurements

    International Nuclear Information System (INIS)

    Yedvab, Y.; Reiss, I.; Bettan, M.; Harari, R.; Grober, A.; Ettedgui, H.; Caspi, E. N.

    2006-01-01

    A method for determining delayed neutrons source in the frequency domain based on measuring power oscillations in a non-critical reactor is presented. This method is unique in the sense that the delayed neutrons source is derived from the dynamic behavior of the reactor, which serves as the measurement system. An algorithm for analyzing power oscillation measurements was formulated, which avoids the need for a multi-parameter non-linear fit process used by other methods. Using this algorithm results of two sets of measurements performed in IRR-I and IRR-II (Israeli Research Reactors I and II) are presented. The agreement between measured values from both reactors and calculated values based on Keepin (and JENDL-3.3) group parameters is very good. (authors)

  2. Hardware architecture design of image restoration based on time-frequency domain computation

    Science.gov (United States)

    Wen, Bo; Zhang, Jing; Jiao, Zipeng

    2013-10-01

    The image restoration algorithms based on time-frequency domain computation is high maturity and applied widely in engineering. To solve the high-speed implementation of these algorithms, the TFDC hardware architecture is proposed. Firstly, the main module is designed, by analyzing the common processing and numerical calculation. Then, to improve the commonality, the iteration control module is planed for iterative algorithms. In addition, to reduce the computational cost and memory requirements, the necessary optimizations are suggested for the time-consuming module, which include two-dimensional FFT/IFFT and the plural calculation. Eventually, the TFDC hardware architecture is adopted for hardware design of real-time image restoration system. The result proves that, the TFDC hardware architecture and its optimizations can be applied to image restoration algorithms based on TFDC, with good algorithm commonality, hardware realizability and high efficiency.

  3. Rule Based System for Medicine Inventory Control Using Radio Frequency Identification (RFID

    Directory of Open Access Journals (Sweden)

    Ardhyanti Mita Nugraha Joanna

    2018-01-01

    Full Text Available Rule based system is very efficient to ensure stock of drug to remain available by utilizing Radio Frequency Identification (RFID as input means automatically. This method can ensure the stock of drugs to remain available by analyzing the needs of drug users. The research data was the amount of drug usage in hospital for 1 year. The data was processed by using ABC classification to determine the drug with fast, medium and slow movement. In each classification result, rule based algorithm was given for determination of safety stock and Reorder Point (ROP. This research yielded safety stock and ROP values that vary depending on the class of each drug. Validation is done by comparing the calculation of safety stock and reorder point both manually and by system, then, it was found that the mean deviation value at safety stock was 0,03 and and ROP was 0,08.

  4. Rule Based System for Medicine Inventory Control Using Radio Frequency Identification (RFID)

    Science.gov (United States)

    Nugraha, Joanna Ardhyanti Mita; Suryono; Suseno, dan Jatmiko Endro

    2018-02-01

    Rule based system is very efficient to ensure stock of drug to remain available by utilizing Radio Frequency Identification (RFID) as input means automatically. This method can ensure the stock of drugs to remain available by analyzing the needs of drug users. The research data was the amount of drug usage in hospital for 1 year. The data was processed by using ABC classification to determine the drug with fast, medium and slow movement. In each classification result, rule based algorithm was given for determination of safety stock and Reorder Point (ROP). This research yielded safety stock and ROP values that vary depending on the class of each drug. Validation is done by comparing the calculation of safety stock and reorder point both manually and by system, then, it was found that the mean deviation value at safety stock was 0,03 and and ROP was 0,08.

  5. EGC: a time-frequency augmented template-based method for gravitational wave burst search in ground-based interferometers

    International Nuclear Information System (INIS)

    Clapson, Andre-Claude; Barsuglia, Matteo; Bizouard, Marie-Anne; Brisson, Violette; Cavalier, Fabien; Davier, Michel; Hello, Patrice; Leroy, Nicolas; Varvella, Monica

    2008-01-01

    The detection of burst-type events in the output of ground gravitational wave detectors is particularly challenging. The potential variety of astrophysical waveforms, as proposed by simulations and analytic studies in general relativity and the discrimination of actual signals from instrumental noise both are critical issues. Robust methods that achieve reasonable detection performances over a wide range of signals are required. We present here a hybrid burst-detection pipeline related to time-frequency transforms while based on matched filtering to provide robustness against noise characteristics. Studies on simulated noise show that the algorithm has a detection efficiency similar to other methods over very different waveforms and particularly good timing even for low amplitude signals: no bias for most tested waveforms and an average accuracy of 1.1 ms (down to 0.1 ms in the best case). Time-frequency-type parameters, useful for event classification, are also derived for noise spectral densities unfavourable to standard time-frequency algorithms

  6. EGC: a time-frequency augmented template-based method for gravitational wave burst search in ground-based interferometers

    Energy Technology Data Exchange (ETDEWEB)

    Clapson, Andre-Claude; Barsuglia, Matteo; Bizouard, Marie-Anne; Brisson, Violette; Cavalier, Fabien; Davier, Michel; Hello, Patrice; Leroy, Nicolas; Varvella, Monica [LAL, Universite Paris-Sud 11, BP 34, 91898 Orsay (France)

    2008-02-07

    The detection of burst-type events in the output of ground gravitational wave detectors is particularly challenging. The potential variety of astrophysical waveforms, as proposed by simulations and analytic studies in general relativity and the discrimination of actual signals from instrumental noise both are critical issues. Robust methods that achieve reasonable detection performances over a wide range of signals are required. We present here a hybrid burst-detection pipeline related to time-frequency transforms while based on matched filtering to provide robustness against noise characteristics. Studies on simulated noise show that the algorithm has a detection efficiency similar to other methods over very different waveforms and particularly good timing even for low amplitude signals: no bias for most tested waveforms and an average accuracy of 1.1 ms (down to 0.1 ms in the best case). Time-frequency-type parameters, useful for event classification, are also derived for noise spectral densities unfavourable to standard time-frequency algorithms.

  7. Study on the changes of serum HA and CG levels in several diseases besides liver disorders

    Energy Technology Data Exchange (ETDEWEB)

    Zhiping, Lu; Yunbao, Ma; Xiaoyi, Zhang; Weihua, Lv [Changshu Hospital Attached to Medical College of Yangzhou Univ., Changshu No.2 People' s Hospital, Changshu (China)

    2005-12-15

    Objective: To study the changes of serum hyaluronic acid (HA) and cholyglycine (CG) in several diseases besides liver disorders. Methods: Serum HA and CG levels were measured with RIA in 78 patients with chronic liver diseases (with 70 controls), (84 patients with primary hepatic carcinoma ), 70 pediatric patients with various infections diseases (with 40 controls), 50 pediatric patients with recurrent respiratory infection (RRI, with 30 controls) and 428 pregnant women ( with 60 controls). In addition, RBC C{sub 3}b receptor ratio (RBCC{sub 3} bRR) and RBC immune-complex ratio (RBCICR) (both with yeast rosette method) as well as serum IgG,IgM,IgA,C{sub 3} levels (with immunoturbidity test) were examined in the 50 RRI pediatric patients, ALT levels were examined in the 70 pediatric patients with infectious diseases and SF examined in the 78 patients with chronic liver diseases. Results: The serum CG, HA and SF levels in the three groups of patients with chronic liver diseases ( CPH, CAH, Cirrhosis) were significantly higher than those in the controls (all P<0.01 ) with the exception of HA in CPH patients (P > 0.05). In patients with hepatic carcinoma, the CG and HA levels were positively correlated with the mortality at 4 months (P < 0.05). Among pregnant women, serum levels of HA and CG were significantly higher during the second and third trimesters (P<0.05-0.01) than those in the controls but not so during the first trimester. In the pediatric patients with infectious diseases, CG and HA levels were significantly higher in all these patients (P<0.01) with the only exception of HA in patients with mumps (P>0.05). For ALT, levels only increased in patients with hepatitis and typhoid fever with none in bacillary dysentery and mumps. In pediatric patients with RRI, RBCC{sub 3}bRR (%), CG, C{sub 3}, IgG levels were significantly higher than those in controls (P<0.05 ) with no significant differences in the case of RBCICR (%), HA, IgM and IgA levels (P>0

  8. Functional reconstitution into liposomes of purified human RhCG ammonia channel.

    Directory of Open Access Journals (Sweden)

    Isabelle Mouro-Chanteloup

    Full Text Available BACKGROUND: Rh glycoproteins (RhAG, RhBG, RhCG are members of the Amt/Mep/Rh family which facilitate movement of ammonium across plasma membranes. Changes in ammonium transport activity following expression of Rh glycoproteins have been described in different heterologous systems such as yeasts, oocytes and eukaryotic cell lines. However, in these complex systems, a potential contribution of endogenous proteins to this function cannot be excluded. To demonstrate that Rh glycoproteins by themselves transport NH(3, human RhCG was purified to homogeneity and reconstituted into liposomes, giving new insights into its channel functional properties. METHODOLOGY/PRINCIPAL FINDINGS: An HA-tag introduced in the second extracellular loop of RhCG was used to purify to homogeneity the HA-tagged RhCG glycoprotein from detergent-solubilized recombinant HEK293E cells. Electron microscopy analysis of negatively stained purified RhCG-HA revealed, after image processing, homogeneous particles of 9 nm diameter with a trimeric protein structure. Reconstitution was performed with sphingomyelin, phosphatidylcholine and phosphatidic acid lipids in the presence of the C(12E(8 detergent which was subsequently removed by Biobeads. Control of protein incorporation was carried out by freeze-fracture electron microscopy. Particle density in liposomes was a function of the Lipid/Protein ratio. When compared to empty liposomes, ammonium permeability was increased two and three fold in RhCG-proteoliposomes, depending on the Lipid/Protein ratio (1/300 and 1/150, respectively. This strong NH(3 transport was reversibly inhibited by mercuric and copper salts and exhibited a low Arrhenius activation energy. CONCLUSIONS/SIGNIFICANCE: This study allowed the determination of ammonia permeability per RhCG monomer, showing that the apparent Punit(NH3 (around 1x10(-3 microm(3xs(-1 is close to the permeability measured in HEK293E cells expressing a recombinant human RhCG (1.60x10

  9. Disease causality extraction based on lexical semantics and document-clause frequency from biomedical literature.

    Science.gov (United States)

    Lee, Dong-Gi; Shin, Hyunjung

    2017-05-18

    Recently, research on human disease network has succeeded and has become an aid in figuring out the relationship between various diseases. In most disease networks, however, the relationship between diseases has been simply represented as an association. This representation results in the difficulty of identifying prior diseases and their influence on posterior diseases. In this paper, we propose a causal disease network that implements disease causality through text mining on biomedical literature. To identify the causality between diseases, the proposed method includes two schemes: the first is the lexicon-based causality term strength, which provides the causal strength on a variety of causality terms based on lexicon analysis. The second is the frequency-based causality strength, which determines the direction and strength of causality based on document and clause frequencies in the literature. We applied the proposed method to 6,617,833 PubMed literature, and chose 195 diseases to construct a causal disease network. From all possible pairs of disease nodes in the network, 1011 causal pairs of 149 diseases were extracted. The resulting network was compared with that of a previous study. In terms of both coverage and quality, the proposed method showed outperforming results; it determined 2.7 times more causalities and showed higher correlation with associated diseases than the existing method. This research has novelty in which the proposed method circumvents the limitations of time and cost in applying all possible causalities in biological experiments and it is a more advanced text mining technique by defining the concepts of causality term strength.

  10. Intrauterine administration of human chorionic gonadotropin (hCG) for subfertile women undergoing assisted reproduction.

    Science.gov (United States)

    Craciunas, Laurentiu; Tsampras, Nikolaos; Coomarasamy, Arri; Raine-Fenning, Nick

    2016-05-20

    Subfertility affects 15% of couples and represents the inability to conceive naturally following 12 months of regular unprotected sexual intercourse. Assisted reproduction refers to procedures involving the in vitro handling of both human gametes and represents a key option for many subfertile couples. Most women undergoing assisted reproduction treatment will reach the stage of embryo transfer (ET) but the proportion of embryos that successfully implant following ET has remained small since the mid-1990s. Human chorionic gonadotropin (hCG) is a hormone synthesised and released by the syncytiotrophoblast and has a fundamental role in embryo implantation and the early stages of pregnancy. Intrauterine administration of synthetic or natural hCG via an ET catheter during a mock procedure around the time of ET is a novel approach that has recently been suggested to improve the outcomes of assisted reproduction. To investigate whether the intrauterine administration of hCG around the time of ET improves the clinical outcomes in subfertile women undergoing assisted reproduction. We performed a comprehensive literature search of the Cochrane Gynaecology and Fertility Group Specialised Register, Cochrane Central Register of Controlled Trials (CENTRAL), MEDLINE, EMBASE, CINAHL, PsycINFO, registers of ongoing trials andreference lists of all included studies and relevant reviews (from inception to 10 November 2015), in consultation with the Cochrane Gynaecology and Fertility Group Trials Search Co-ordinator. We included all randomised controlled trials (RCTs) evaluating intrauterine administration of hCG around the time of ET in this review irrespective of language and country of origin. Two authors independently selected studies, assessed risk of bias, extracted data from studies and attempted to contact the authors where data were missing. We performed statistical analysis using Review Manager 5 in accordance with the Cochrane Handbook for Systematic Reviews of

  11. Characterization of CG6178 gene product with high sequence similarity to firefly luciferase in Drosophila melanogaster.

    Science.gov (United States)

    Oba, Yuichi; Ojika, Makoto; Inouye, Satoshi

    2004-03-31

    This is the first identification of a long-chain fatty acyl-CoA synthetase in Drosophila by enzymatic characterization. The gene product of CG6178 (CG6178) in Drosophila melanogaster genome, which has a high sequence similarity to firefly luciferase, has been expressed and characterized. CG6178 showed long-chain fatty acyl-CoA synthetic activity in the presence of ATP, CoA and Mg(2+), suggesting a fatty acyl adenylate is an intermediate. Recently, it was revealed that firefly luciferase has two catalytic functions, monooxygenase (luciferase) and AMP-mediated CoA ligase (fatty acyl-CoA synthetase). However, unlike firefly luciferase, CG6178 did not show luminescence activity in the presence of firefly luciferin, ATP, CoA and Mg(2+). The enzymatic properties of CG6178 including substrate specificity, pH dependency and optimal temperature were close to those of firefly luciferase and rat fatty acyl-CoA synthetase. Further, phylogenic analyses strongly suggest that the firefly luciferase gene may have evolved from a fatty acyl-CoA synthetase gene as a common ancestral gene.

  12. EPICS based low-level radio frequency control system in LIPAc

    Energy Technology Data Exchange (ETDEWEB)

    Calvo, Julio, E-mail: julio.calvo@ciemat.es [Centro de Investigaciones Energeticas Medioambientales y Tecnologicas, Ciemat (Spain); Rivers, Mark L. [Department of Geophysical Sciences and Center for Advanced Radiation Sources, The University of Chicago (United States); Patricio, Miguel A. [Departamento de Informatica, Universidad Carlos III de Madrid (Spain); Ibarra, Angel [Centro de Investigaciones Energeticas Medioambientales y Tecnologicas, Ciemat (Spain)

    2012-11-15

    Highlights: Black-Right-Pointing-Pointer The system proposed can control amplitude and phase of each cavity. Black-Right-Pointing-Pointer Rapid diagnostics are refreshed in milliseconds. Black-Right-Pointing-Pointer Increasing control parameters will not increase consumed time neither complexity. Black-Right-Pointing-Pointer IQ demodulation can be achieved thanks to the transformed values at driver level. - Abstract: The IFMIF-EVEDA (International Fusion Materials Irradiation Facility - Engineering Validation and Engineering Design Activity) linear accelerator, known as Linear IFMIF Prototype Accelerator (LIPAc), will be a 9 MeV, 125 mA continuous wave (CW) deuteron accelerator prototype to validate the technical options of the accelerator design for IFMIF. The primary mission of such facility is to test and verify materials performance when subjected to extensive neutron irradiation of the type encountered in a fusion reactor to prepare for the design, construction, licensing and safe operation of a fusion demonstration reactor (DEMO). The radio frequency (RF) power system of IFMIF-EVEDA consists of 18 RF chains working at 175 MHz with three amplification stages each. The low-level radio frequency (LLRF) controls the amplitude and phase of the signal to be synchronized with the beam and it also controls the resonance frequency of the cavities. The system is based on a commercial compact peripheral component interconnect (cPCI) field programmable gate array (FPGA) board, provided by Lyrtech and controlled by a Windows host PC. For this purpose, it is mandatory to communicate the cPCI FPGA board from EPICS Channel Access [1]. A software architecture on EPICS framework in order to control and monitor the LLRF system is presented.

  13. Dual fiber Bragg gratings configuration-based fiber acoustic sensor for low-frequency signal detection

    Science.gov (United States)

    Yang, Dong; Wang, Shun; Lu, Ping; Liu, Deming

    2014-11-01

    We propose and fabricate a new type fiber acoustic sensor based on dual fiber Bragg gratings (FBGs) configuration. The acoustic sensor head is constructed by putting the sensing cells enclosed in an aluminum cylinder space built by two Cband FBGs and a titanium diaphragm of 50 um thickness. One end of each FBG is longitudinally adhered to the diaphragm by UV glue. Both of the two FBGs are employed for reflecting light. The dual FBGs play roles not only as signal transmission system but also as sensing component, and they demodulate each other's optical signal mutually during the measurement. Both of the two FBGs are pre-strained and the output optical power experiences fluctuation in a linear relationship along with a variation of axial strain and surrounding acoustic interference. So a precise approach to measure the frequency and sound pressure of the acoustic disturbance is achieved. Experiments are performed and results show that a relatively flat frequency response in a range from 200 Hz to 1 kHz with the average signal-to-noise ratio (SNR) above 21 dB is obtained. The maximum sound pressure sensitivity of 11.35mV/Pa is achieved with the Rsquared value of 0.99131 when the sound pressure in the range of 87.7-106.6dB. It has potential applications in low frequency signal detection. Owing to its direct self-demodulation method, the sensing system reveals the advantages of easy to demodulate, good temperature stability and measurement reliability. Besides, performance of the proposed sensor could be improved by optimizing the parameters of the sensor, especially the diaphragm.

  14. Study of a Particle Based Films Cure Process by High-Frequency Eddy Current Spectroscopy

    Directory of Open Access Journals (Sweden)

    Iryna Patsora

    2016-12-01

    Full Text Available Particle-based films are today an important part of various designs and they are implemented in structures as conductive parts, i.e., conductive paste printing in the manufacture of Li-ion batteries, solar cells or resistive paste printing in IC. Recently, particle based films were also implemented in the 3D printing technique, and are particularly important for use in aircraft, wind power, and the automotive industry when incorporated onto the surface of composite structures for protection against damages caused by a lightning strike. A crucial issue for the lightning protection area is to realize films with high homogeneity of electrical resistance where an in-situ noninvasive method has to be elaborated for quality monitoring to avoid undesirable financial and time costs. In this work the drying process of particle based films was investigated by high-frequency eddy current (HFEC spectroscopy in order to work out an automated in-situ quality monitoring method with a focus on the electrical resistance of the films. Different types of particle based films deposited on dielectric and carbon fiber reinforced plastic substrates were investigated in the present study and results show that the HFEC method offers a good opportunity to monitor the overall drying process of particle based films. Based on that, an algorithm was developed, allowing prediction of the final electrical resistance of the particle based films throughout the drying process, and was successfully implemented in a prototype system based on the EddyCus® HFEC device platform presented in this work. This prototype is the first solution for a portable system allowing HFEC measurement on huge and uneven surfaces.

  15. An injection-locked OEO based frequency doubler independent of electrical doubler phase noise deteriorating rule

    Science.gov (United States)

    Xie, Zhengyang; Zheng, Xiaoping; Li, Shangyuan; Yan, Haozhe; Xiao, Xuedi; Xue, Xiaoxiao

    2018-06-01

    We propose an injection-locked optoelectronic oscillator (OEO) based wide-band frequency doubler, which is free from phase noise deterioration in electrical doubler, by using a dual-parallel Mach-Zehnder modulator (DPMZM). Through adjusting the optical phase shifts in different arms of the DPMZM, the doubling signal oscillates in the OEO loop while the fundamental signal takes on phase modulation over the light and vanishes at photo-detector (PD) output. By controlling power of fundamental signal the restriction of phase-noise deterioration rule in electrical doubler is totally canceled. Experimental results show that the doubler output has a better phase noise value of, for example, -117 dBc/Hz @ 10 kHz at 6 GHz with an improvement more than 17 dB and 23 dB compared with that of fundamental input and electrical doubler, respectively. Besides, the stability of this doubler output can reach to 1 . 5 × 10-14 at 1000 s averaging time. The frequency range of doubling signal is limited by the bandwidth of electrical amplifier in OEO loop.

  16. LES-based generation of high-frequency fluctuation in wind turbulence obtained by meteorological model

    Science.gov (United States)

    Tamura, Tetsuro; Kawaguchi, Masaharu; Kawai, Hidenori; Tao, Tao

    2017-11-01

    The connection between a meso-scale model and a micro-scale large eddy simulation (LES) is significant to simulate the micro-scale meteorological problem such as strong convective events due to the typhoon or the tornado using LES. In these problems the mean velocity profiles and the mean wind directions change with time according to the movement of the typhoons or tornadoes. Although, a fine grid micro-scale LES could not be connected to a coarse grid meso-scale WRF directly. In LES when the grid is suddenly refined at the interface of nested grids which is normal to the mean advection the resolved shear stresses decrease due to the interpolation errors and the delay of the generation of smaller scale turbulence that can be resolved on the finer mesh. For the estimation of wind gust disaster the peak wind acting on buildings and structures has to be correctly predicted. In the case of meteorological model the velocity fluctuations have a tendency of diffusive variation without the high frequency component due to the numerically filtering effects. In order to predict the peak value of wind velocity with good accuracy, this paper proposes a LES-based method for generating the higher frequency components of velocity and temperature fields obtained by meteorological model.

  17. Measuring streetscape complexity based on the statistics of local contrast and spatial frequency.

    Directory of Open Access Journals (Sweden)

    André Cavalcante

    Full Text Available Streetscapes are basic urban elements which play a major role in the livability of a city. The visual complexity of streetscapes is known to influence how people behave in such built spaces. However, how and which characteristics of a visual scene influence our perception of complexity have yet to be fully understood. This study proposes a method to evaluate the complexity perceived in streetscapes based on the statistics of local contrast and spatial frequency. Here, 74 streetscape images from four cities, including daytime and nighttime scenes, were ranked for complexity by 40 participants. Image processing was then used to locally segment contrast and spatial frequency in the streetscapes. The statistics of these characteristics were extracted and later combined to form a single objective measure. The direct use of statistics revealed structural or morphological patterns in streetscapes related to the perception of complexity. Furthermore, in comparison to conventional measures of visual complexity, the proposed objective measure exhibits a higher correlation with the opinion of the participants. Also, the performance of this method is more robust regarding different time scenarios.

  18. Sequence comparison alignment-free approach based on suffix tree and L-words frequency.

    Science.gov (United States)

    Soares, Inês; Goios, Ana; Amorim, António

    2012-01-01

    The vast majority of methods available for sequence comparison rely on a first sequence alignment step, which requires a number of assumptions on evolutionary history and is sometimes very difficult or impossible to perform due to the abundance of gaps (insertions/deletions). In such cases, an alternative alignment-free method would prove valuable. Our method starts by a computation of a generalized suffix tree of all sequences, which is completed in linear time. Using this tree, the frequency of all possible words with a preset length L-L-words--in each sequence is rapidly calculated. Based on the L-words frequency profile of each sequence, a pairwise standard Euclidean distance is then computed producing a symmetric genetic distance matrix, which can be used to generate a neighbor joining dendrogram or a multidimensional scaling graph. We present an improvement to word counting alignment-free approaches for sequence comparison, by determining a single optimal word length and combining suffix tree structures to the word counting tasks. Our approach is, thus, a fast and simple application that proved to be efficient and powerful when applied to mitochondrial genomes. The algorithm was implemented in Python language and is freely available on the web.

  19. Sequence Comparison Alignment-Free Approach Based on Suffix Tree and L-Words Frequency

    Directory of Open Access Journals (Sweden)

    Inês Soares

    2012-01-01

    Full Text Available The vast majority of methods available for sequence comparison rely on a first sequence alignment step, which requires a number of assumptions on evolutionary history and is sometimes very difficult or impossible to perform due to the abundance of gaps (insertions/deletions. In such cases, an alternative alignment-free method would prove valuable. Our method starts by a computation of a generalized suffix tree of all sequences, which is completed in linear time. Using this tree, the frequency of all possible words with a preset length L—L-words—in each sequence is rapidly calculated. Based on the L-words frequency profile of each sequence, a pairwise standard Euclidean distance is then computed producing a symmetric genetic distance matrix, which can be used to generate a neighbor joining dendrogram or a multidimensional scaling graph. We present an improvement to word counting alignment-free approaches for sequence comparison, by determining a single optimal word length and combining suffix tree structures to the word counting tasks. Our approach is, thus, a fast and simple application that proved to be efficient and powerful when applied to mitochondrial genomes. The algorithm was implemented in Python language and is freely available on the web.

  20. Reconstruction of human brain spontaneous activity based on frequency-pattern analysis of magnetoencephalography data

    Science.gov (United States)

    Llinás, Rodolfo R.; Ustinin, Mikhail N.; Rykunov, Stanislav D.; Boyko, Anna I.; Sychev, Vyacheslav V.; Walton, Kerry D.; Rabello, Guilherme M.; Garcia, John

    2015-01-01

    A new method for the analysis and localization of brain activity has been developed, based on multichannel magnetic field recordings, over minutes, superimposed on the MRI of the individual. Here, a high resolution Fourier Transform is obtained over the entire recording period, leading to a detailed multi-frequency spectrum. Further analysis implements a total decomposition of the frequency components into functionally invariant entities, each having an invariant field pattern localizable in recording space. The method, addressed as functional tomography, makes it possible to find the distribution of magnetic field sources in space. Here, the method is applied to the analysis of simulated data, to oscillating signals activating a physical current dipoles phantom, and to recordings of spontaneous brain activity in 10 healthy adults. In the analysis of simulated data, 61 dipoles are localized with 0.7 mm precision. Concerning the physical phantom the method is able to localize three simultaneously activated current dipoles with 1 mm precision. Spatial resolution 3 mm was attained when localizing spontaneous alpha rhythm activity in 10 healthy adults, where the alpha peak was specified for each subject individually. Co-registration of the functional tomograms with each subject's head MRI localized alpha range activity to the occipital and/or posterior parietal brain region. This is the first application of this new functional tomography to human brain activity. The method successfully provides an overall view of brain electrical activity, a detailed spectral description and, combined with MRI, the localization of sources in anatomical brain space. PMID:26528119

  1. frequency and risk factors for chronic HCV infection: a community based study

    International Nuclear Information System (INIS)

    Tahir, M.; Mustafa, G.; Khan, M.B.

    2011-01-01

    It was a community based, cross-sectional study undertaken to assess the frequency of HCV infection and to find out the risk factors associated with its spread. Methods: Study was carried out from Oct 2004 to Mar 2005. One hundred and twenty five apparently healthy consecutive subjects not known to be infected with HBV or HCV, between the ages 13 and 60 years with equal sex distribution were selected from the population of the Village Mera Kalan near Rawalpindi. They were screened for Anti HCV antibodies using ELISA and interviewed in detail. Subjects found positive for Anti HCV Ab were tested for ALT (Alanine aminotransferase) levels and HCV RNA by PCR. Results: The frequency of HCV was found to be 53.6%. The most important risk factor associated with the transmission of HCV infection was unsafe injection therapy with contaminated equipment. Other risk factors include ear and nose piercing by unsterilized means in females and sharing of razors in males. Conclusion: The prevalence of HCV infection in our population is significantly higher than in the developed world. Public awareness programs should target the identified risk factors to prevent HCV transmission. (author)

  2. Model based PI power system stabilizer design for damping low frequency oscillations in power systems.

    Science.gov (United States)

    Salgotra, Aprajita; Pan, Somnath

    2018-05-01

    This paper explores a two-level control strategy by blending local controller with centralized controller for the low frequency oscillations in a power system. The proposed control scheme provides stabilization of local modes using a local controller and minimizes the effect of inter-connection of sub-systems performance through a centralized control. For designing the local controllers in the form of proportional-integral power system stabilizer (PI-PSS), a simple and straight forward frequency domain direct synthesis method is considered that works on use of a suitable reference model which is based on the desired requirements. Several examples both on one machine infinite bus and multi-machine systems taken from the literature are illustrated to show the efficacy of the proposed PI-PSS. The effective damping of the systems is found to be increased remarkably which is reflected in the time-responses; even unstable operation has been stabilized with improved damping after applying the proposed controller. The proposed controllers give remarkable improvement in damping the oscillations in all the illustrations considered here and as for example, the value of damping factor has been increased from 0.0217 to 0.666 in Example 1. The simulation results obtained by the proposed control strategy are favourably compared with some controllers prevalent in the literature. Copyright © 2018 ISA. Published by Elsevier Ltd. All rights reserved.

  3. Patch Antenna based on a Photovoltaic Cell with a Dual resonance Frequency

    Directory of Open Access Journals (Sweden)

    C. Baccouch

    2016-11-01

    Full Text Available The present work was to use photovoltaic solar cells in patch antenna structures. The radiating patch element of a patch antenna was replaced by a solar cell. Direct Current (DC generation remained the original feature of the solar cell, but additionally   it was now able to receive and transmit electromagnetic waves. Here, we used a new patch antenna structure based on a photovoltaic solar cell. It was then used to collect photo-generated current as well as Radio Frequency (RF transmission. A mathematical model which would serve the minimization of power losses of the cell and therefore the improvement in the conversion efficiency was studied. A simulation allowed analysing the performance of the antenna, with a silicon material, and testing its parameters such as the reflection coefficient (S11, gain, directivity and radiated power. The performance analysis of the solar cell patch antenna was conducted using Advanced Design System (ADS software. Simulation results for this antenna showed a dual resonance frequency of 5.77 GHz and of 6.18 GHz with an effective return loss of -38.22dB and a gain of 1.59dBi.

  4. A CURRENT MIRROR BASED TWO STAGE CMOS CASCODE OP-AMP FOR HIGH FREQUENCY APPLICATION

    Directory of Open Access Journals (Sweden)

    RAMKRISHNA KUNDU

    2017-03-01

    Full Text Available This paper presents a low power, high slew rate, high gain, ultra wide band two stage CMOS cascode operational amplifier for radio frequency application. Current mirror based cascoding technique and pole zero cancelation technique is used to ameliorate the gain and enhance the unity gain bandwidth respectively, which is the novelty of the circuit. In cascading technique a common source transistor drive a common gate transistor. The cascoding is used to enhance the output resistance and hence improve the overall gain of the operational amplifier with less complexity and less power dissipation. To bias the common gate transistor, a current mirror is used in this paper. The proposed circuit is designed and simulated using Cadence analog and digital system design tools of 45 nanometer CMOS technology. The simulated results of the circuit show DC gain of 63.62 dB, unity gain bandwidth of 2.70 GHz, slew rate of 1816 V/µs, phase margin of 59.53º, power supply of the proposed operational amplifier is 1.4 V (rail-to-rail ±700 mV, and power consumption is 0.71 mW. This circuit specification has encountered the requirements of radio frequency application.

  5. Multi-Frequency Polarimetric SAR Classification Based on Riemannian Manifold and Simultaneous Sparse Representation

    Directory of Open Access Journals (Sweden)

    Fan Yang

    2015-07-01

    Full Text Available Normally, polarimetric SAR classification is a high-dimensional nonlinear mapping problem. In the realm of pattern recognition, sparse representation is a very efficacious and powerful approach. As classical descriptors of polarimetric SAR, covariance and coherency matrices are Hermitian semidefinite and form a Riemannian manifold. Conventional Euclidean metrics are not suitable for a Riemannian manifold, and hence, normal sparse representation classification cannot be applied to polarimetric SAR directly. This paper proposes a new land cover classification approach for polarimetric SAR. There are two principal novelties in this paper. First, a Stein kernel on a Riemannian manifold instead of Euclidean metrics, combined with sparse representation, is employed for polarimetric SAR land cover classification. This approach is named Stein-sparse representation-based classification (SRC. Second, using simultaneous sparse representation and reasonable assumptions of the correlation of representation among different frequency bands, Stein-SRC is generalized to simultaneous Stein-SRC for multi-frequency polarimetric SAR classification. These classifiers are assessed using polarimetric SAR images from the Airborne Synthetic Aperture Radar (AIRSAR sensor of the Jet Propulsion Laboratory (JPL and the Electromagnetics Institute Synthetic Aperture Radar (EMISAR sensor of the Technical University of Denmark (DTU. Experiments on single-band and multi-band data both show that these approaches acquire more accurate classification results in comparison to many conventional and advanced classifiers.

  6. Empirical Determination of Efficient Sensing Frequencies for Magnetometer-Based Continuous Human Contact Monitoring

    Directory of Open Access Journals (Sweden)

    Seungho Kuk

    2018-04-01

    Full Text Available The high linear correlation between the smartphone magnetometer readings in close proximity can be exploited for physical human contact detection, which could be useful for such applications as infectious disease contact tracing or social behavior monitoring. Alternative approaches using other capabilities in smartphones have aspects that do not fit well with the human contact detection. Using Wi-Fi or cellular fingerprints have larger localization errors than close human contact distances. Bluetooth beacons could reveal the identity of the transmitter, threatening the privacy of the user. Also, using sensors such as GPS does not work for indoor contacts. However, the magnetometer correlation check works best in human contact distances that matter in infectious disease transmissions or social interactions. The omni-present geomagnetism makes it work both indoors and outdoors, and the measured magnetometer values do not easily reveal the identity and the location of the smartphone. One issue with the magnetometer-based contact detection, however, is the energy consumption. Since the contacts can take place anytime, the magnetometer sensing and recording should be running continuously. Therefore, how we address the energy requirement for the extended and continuous operation can decide the viability of the whole idea. However, then, we note that almost all existing magnetometer-based applications such as indoor location and navigation have used high sensing frequencies, ranging from 10 Hz to 200 Hz. At these frequencies, we measure that the time to complete battery drain in a typical smartphone is shortened by three to twelve hours. The heavy toll raises the question as to whether the magnetometer-based contact detection can avoid such high sensing rates while not losing the contact detection accuracy. In order to answer the question, we conduct a measurement-based study using independently produced magnetometer traces from three different

  7. Empirical Determination of Efficient Sensing Frequencies for Magnetometer-Based Continuous Human Contact Monitoring.

    Science.gov (United States)

    Kuk, Seungho; Kim, Junha; Park, Yongtae; Kim, Hyogon

    2018-04-27

    The high linear correlation between the smartphone magnetometer readings in close proximity can be exploited for physical human contact detection, which could be useful for such applications as infectious disease contact tracing or social behavior monitoring. Alternative approaches using other capabilities in smartphones have aspects that do not fit well with the human contact detection. Using Wi-Fi or cellular fingerprints have larger localization errors than close human contact distances. Bluetooth beacons could reveal the identity of the transmitter, threatening the privacy of the user. Also, using sensors such as GPS does not work for indoor contacts. However, the magnetometer correlation check works best in human contact distances that matter in infectious disease transmissions or social interactions. The omni-present geomagnetism makes it work both indoors and outdoors, and the measured magnetometer values do not easily reveal the identity and the location of the smartphone. One issue with the magnetometer-based contact detection, however, is the energy consumption. Since the contacts can take place anytime, the magnetometer sensing and recording should be running continuously. Therefore, how we address the energy requirement for the extended and continuous operation can decide the viability of the whole idea. However, then, we note that almost all existing magnetometer-based applications such as indoor location and navigation have used high sensing frequencies, ranging from 10 Hz to 200 Hz. At these frequencies, we measure that the time to complete battery drain in a typical smartphone is shortened by three to twelve hours. The heavy toll raises the question as to whether the magnetometer-based contact detection can avoid such high sensing rates while not losing the contact detection accuracy. In order to answer the question, we conduct a measurement-based study using independently produced magnetometer traces from three different countries. Specifically, we

  8. MULTI-TEMPORAL AND MULTI-SENSOR IMAGE MATCHING BASED ON LOCAL FREQUENCY INFORMATION

    Directory of Open Access Journals (Sweden)

    X. Liu

    2012-08-01

    Full Text Available Image Matching is often one of the first tasks in many Photogrammetry and Remote Sensing applications. This paper presents an efficient approach to automated multi-temporal and multi-sensor image matching based on local frequency information. Two new independent image representations, Local Average Phase (LAP and Local Weighted Amplitude (LWA, are presented to emphasize the common scene information, while suppressing the non-common illumination and sensor-dependent information. In order to get the two representations, local frequency information is firstly obtained from Log-Gabor wavelet transformation, which is similar to that of the human visual system; then the outputs of odd and even symmetric filters are used to construct the LAP and LWA. The LAP and LWA emphasize on the phase and amplitude information respectively. As these two representations are both derivative-free and threshold-free, they are robust to noise and can keep as much of the image details as possible. A new Compositional Similarity Measure (CSM is also presented to combine the LAP and LWA with the same weight for measuring the similarity of multi-temporal and multi-sensor images. The CSM can make the LAP and LWA compensate for each other and can make full use of the amplitude and phase of local frequency information. In many image matching applications, the template is usually selected without consideration of its matching robustness and accuracy. In order to overcome this problem, a local best matching point detection is presented to detect the best matching template. In the detection method, we employ self-similarity analysis to identify the template with the highest matching robustness and accuracy. Experimental results using some real images and simulation images demonstrate that the presented approach is effective for matching image pairs with significant scene and illumination changes and that it has advantages over other state-of-the-art approaches, which include: the

  9. Clinical significance of changes of serum TBA, CG, HA levels in neonate with parenteral nutrition

    International Nuclear Information System (INIS)

    Huang Weiliang; Zhou Jiongying; Zhang Xiaoyi; Lv Weihua; Ma Yunbao; He Qizhi

    2010-01-01

    Objective: To study the clinical significance of changes of serum levels of TBA, CG, HA in neonate with parenteral nutrition. Methods: Serum total bile acid (TBA, with biochemistry) and CG, HA (with RIA) contents were measured in 52 neonates (full-term 32, preterm 20) with parenteral nutrition and 28 neonates (full-term 16, preterm 12) without parenteral nutrition (as controls). Results: Before parenteral nutrition,the serum TBA, CG and HA levels in full-term neonates were not significantly different from those in the controls (P>0.05). After parenteral nutrition,serum levels were significantly higher than those before parenteral nutrition (P<0.01). The levels in pre-term neonates were significantly higher after parenteral nutrition than those in full-term neonates (P<0.05). Conclusion: Long term parenteral nutrition might be harmful to hepatic and gall bladder function in neonates especially in premature ones. (authors)

  10. Micro-dose hCG as luteal phase support without exogenous progesterone administration

    DEFF Research Database (Denmark)

    Andersen, C Yding; Fischer, R; Giorgione, V

    2016-01-01

    RHa trigger to induce ovulation showed that exogenous progesterone administration without hCG supplementation was insufficient to obtain satisfactory pregnancy rates. This has prompted development of alternative strategies for LPS. Augmenting the local endogenous production of progesterone by the multiple......For the last two decades, exogenous progesterone administration has been used as luteal phase support (LPS) in connection with controlled ovarian stimulation combined with use of the human chorionic gonadotropin (hCG) trigger for the final maturation of follicles. The introduction of the Gn...... corpora lutea has been one focus with emphasis on one hand to avoid development of ovarian hyper-stimulation syndrome and, on the other hand, to provide adequate levels of progesterone to sustain implantation. The present study evaluates the use of micro-dose hCG for LPS support and examines the potential...

  11. Pulse retrieval algorithm for interferometric frequency-resolved optical gating based on differential evolution.

    Science.gov (United States)

    Hyyti, Janne; Escoto, Esmerando; Steinmeyer, Günter

    2017-10-01

    A novel algorithm for the ultrashort laser pulse characterization method of interferometric frequency-resolved optical gating (iFROG) is presented. Based on a genetic method, namely, differential evolution, the algorithm can exploit all available information of an iFROG measurement to retrieve the complex electric field of a pulse. The retrieval is subjected to a series of numerical tests to prove the robustness of the algorithm against experimental artifacts and noise. These tests show that the integrated error-correction mechanisms of the iFROG method can be successfully used to remove the effect from timing errors and spectrally varying efficiency in the detection. Moreover, the accuracy and noise resilience of the new algorithm are shown to outperform retrieval based on the generalized projections algorithm, which is widely used as the standard method in FROG retrieval. The differential evolution algorithm is further validated with experimental data, measured with unamplified three-cycle pulses from a mode-locked Ti:sapphire laser. Additionally introducing group delay dispersion in the beam path, the retrieval results show excellent agreement with independent measurements with a commercial pulse measurement device based on spectral phase interferometry for direct electric-field retrieval. Further experimental tests with strongly attenuated pulses indicate resilience of differential-evolution-based retrieval against massive measurement noise.

  12. Implementasi Rule Based Expert Systems untuk Realtime Monitoring Penyelesaian Perkara Pidana Menggunakan Teknologi Radio Frequency Identification

    Directory of Open Access Journals (Sweden)

    Mar Fuah

    2017-05-01

    Full Text Available One of the problems in the criminal case completions is that the difficulty of making decision to estimate when the settlement of the case file will be fulfilled. It is caused by the number of case files handled and detention time changing. Therefore, the fast and accurate information is needed. The research aims to develop a monitoring system tracking and tracking of scheduling rules using Rule Based Expert Systems method with 17 rules, and supported by Radio Frequency Identification technology (RFID in the form of computer applications. Based on the output of the system, an analysis is performed in the criminal case settlement process with a set of IF-THEN rules. The RFID reader read the data of case files through radio wave signals emitted by the antenna toward active-Tag attached in the criminal case file. The system is designed to monitor the tracking and tracing of RFID-based scheduling rules in realtime way that was built in the form of computer application in accordance with the system design. This study results in no failure in reading active tags by the RFID reader to detect criminal case files that had been examined. There were many case files handled in three different location, they were the constabulary, prosecutor, and judges of district court and RFID was able to identify them simultaneously. So, RFID supports the implementation of Rule Based Expert Systems very much for realtime monitoring in criminal case accomplishment.

  13. N1303K (c.3909C>G) Mutation and Splicing: Implication of Its c.[744-33GATT(6); 869+11C>T] Complex Allele in CFTR Exon 7 Aberrant Splicing

    Science.gov (United States)

    Farhat, Raëd; Puissesseau, Géraldine; El-Seedy, Ayman; Pasquet, Marie-Claude; Adolphe, Catherine; Corbani, Sandra; Megarbané, André; Kitzis, Alain; Ladeveze, Véronique

    2015-01-01

    Cystic Fibrosis is the most common recessive autosomal rare disease found in Caucasians. It is caused by mutations on the Cystic Fibrosis Transmembrane Conductance Regulator gene (CFTR) that encodes a protein located on the apical membrane of epithelial cells. c.3909C>G (p.Asn1303Lys, old nomenclature: N1303K) is one of the most common worldwide mutations. This mutation has been found at high frequencies in the Mediterranean countries with the highest frequency in the Lebanese population. Therefore, on the genetic level, we conducted a complete CFTR gene screening on c.3909C>G Lebanese patients. The complex allele c.[744-33GATT(6); 869+11C>T] was always associated with the c.3909C>G mutation in cis in the Lebanese population. In cellulo splicing studies, realized by hybrid minigene constructs, revealed no impact of the c.3909C>G mutation on the splicing process, whereas the associated complex allele induces minor exon skipping. PMID:26075213

  14. Improvement of grid frequency dynamic characteristic with novel wind turbine based on electromagnetic coupler

    DEFF Research Database (Denmark)

    You, Rui; Barahona, Braulio; Chai, Jianyun

    2017-01-01

    . Additional power should be generated in response to a grid frequency drop in order to improve the dynamic characteristic of the grid frequency. In this paper, a novel control strategy for WT-EMC to improve the dynamic characteristic of grid frequency is proposed. The principle is to detect active power...... torque to stabilize the rotor speed, therefore directly improving the grid frequency. The proposed control strategy effectiveness is firstly tested through simulations and then validated on a specially built experimental platform....

  15. Serum Beta-hCG of 11 Days after Embryo Transfer to Predict Pregnancy Outcome

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    Objective To assess the clinic value of a single maternal serum beta-human chorionic gonadotropin (β-hCG) assay 11 d after embryo transfer in ART pregnancies and to predict pregnancy outcome.Methods A total of 384 pregnancies after embryo transfer were included.Inviable pregnancies were defined as biochemical pregnancies,ectopic pregnancies and first trimester abortions.Ongoing pregnancies were defined as singleton pregnancies and multiple pregnancies whose gestation were achieved more than 12 weeks.Serum β-hCG concentrations were compared among different groups.Results On the post embryo transfer d 11,the mean β-hCG concentration of the ongoing pregnancy group (323.7±285.2 mIU/ml) was significantly higher than that of the inviable pregnancy group(81.4±68.1 mmIU/ml)(P<0.001).In multiple gestations,the levels of β-hCG were significantly higher compared with singleton pregnancies.If the β-hCG level was between 10 mIU/ml and 50 mIU/ml,the positive predictive value of biochemical pregnancies and ectopic pregnancies was 81.8%,the negative predictive value was 94.4%.If the level was less than 100 mIU/ml,the positive predictive value of first trimester abortions was 80.8% the negative predictive value was 77.8%.If the level was greater than 250 mIU/ml,the positive predictive value of multiple pregnancies was 83.3%.the negative predictive value was 74.4%.Conclusions A single serum β-hCG level on d 11 after embryo transfer has good predictive valuefor clinical pregnancy outcome in controlled ovarian stimulation cycles and helps to plan the subsequent follow-up.

  16. Advanced RF and microwave functions based on an integrated optical frequency comb source.

    Science.gov (United States)

    Xu, Xingyuan; Wu, Jiayang; Nguyen, Thach G; Shoeiby, Mehrdad; Chu, Sai T; Little, Brent E; Morandotti, Roberto; Mitchell, Arnan; Moss, David J

    2018-02-05

    We demonstrate advanced transversal radio frequency (RF) and microwave functions based on a Kerr optical comb source generated by an integrated micro-ring resonator. We achieve extremely high performance for an optical true time delay aimed at tunable phased array antenna applications, as well as reconfigurable microwave photonic filters. Our results agree well with theory. We show that our true time delay would yield a phased array antenna with features that include high angular resolution and a wide range of beam steering angles, while the microwave photonic filters feature high Q factors, wideband tunability, and highly reconfigurable filtering shapes. These results show that our approach is a competitive solution to implementing reconfigurable, high performance and potentially low cost RF and microwave signal processing functions for applications including radar and communication systems.

  17. Capacitor regenerative braking system of electric wheelchair for senior citizen based on variable frequency chopper control.

    Science.gov (United States)

    Takahashi, Yoshiaki; Seki, Hirokazu

    2009-01-01

    This paper proposes a novel regenerative braking control system of electric wheelchairs for senior citizen. "Electric powered wheelchair", which generates the driving force by electric motors according to the human operation, is expected to be widely used as a mobility support system for elderly people. This study focuses on the braking control to realize the safety and smooth stopping motion using the regenerative braking control technique based on fuzzy algorithm. The ride quality improvement and energy recycling can be expected by the proposed control system with stopping distance estimation and variable frequency control on the step-up/down chopper type of capacitor regenerative circuit. Some driving experiments confirm the effectiveness of the proposed control system.

  18. HIGH-FREQUENCY MICROINDUCTOR ON THE BASE OF FLEXIBLE POLYIMIDE FILM

    Directory of Open Access Journals (Sweden)

    A. V. Petrov

    2011-01-01

    Full Text Available A method of creation of 3D flexible high-frequency microinductor on the base of polyimide film with etched swift heavy ion tracks, filled with a conducting material is proposed. This methos is more simple as compared with existing technologies. The service model of the microinductor having dimensions 0,04 mm3 is fabricated. This model has following main operational characteristics: winding density of 7 winding/mm at the winding thickness 10 μm; inductivity 0.3 mH with the Q-factor of 8 at 200 MHz. A possibility of the decrease of dimensions of the device down to 10-6 mm3 is shown. 

  19. Semifragile Speech Watermarking Based on Least Significant Bit Replacement of Line Spectral Frequencies

    Directory of Open Access Journals (Sweden)

    Mohammad Ali Nematollahi

    2017-01-01

    Full Text Available There are various techniques for speech watermarking based on modifying the linear prediction coefficients (LPCs; however, the estimated and modified LPCs vary from each other even without attacks. Because line spectral frequency (LSF has less sensitivity to watermarking than LPC, watermark bits are embedded into the maximum number of LSFs by applying the least significant bit replacement (LSBR method. To reduce the differences between estimated and modified LPCs, a checking loop is added to minimize the watermark extraction error. Experimental results show that the proposed semifragile speech watermarking method can provide high imperceptibility and that any manipulation of the watermark signal destroys the watermark bits since manipulation changes it to a random stream of bits.

  20. Wavelet-transform-based time–frequency domain reflectometry for reduction of blind spot

    International Nuclear Information System (INIS)

    Lee, Sin Ho; Park, Jin Bae; Choi, Yoon Ho

    2012-01-01

    In this paper, wavelet-transform-based time–frequency domain reflectometry (WTFDR) is proposed to reduce the blind spot in reflectometry. TFDR has a blind spot problem when the time delay between the reference signal and the reflected signal is short enough compared with the time duration of the reference signal. To solve the blind spot problem, the wavelet transform (WT) is used because the WT has linearity. Using the characteristics of the WT, the overlapped reference signal at the measured signal can be separated and the blind spot is reduced by obtaining the difference of the wavelet coefficients for the reference and reflected signals. In the proposed method, the complex wavelet is utilized as a mother wavelet because the reference signal in WTFDR has a complex form. Finally, the computer simulations and the real experiments are carried out to confirm the effectiveness and accuracy of the proposed method. (paper)

  1. Assessment of questionnaire-based PCB exposure focused on food frequency in birth cohorts in Japan.

    Science.gov (United States)

    Eguchi, Akifumi; Otake, Masae; Hanazato, Masamichi; Suzuki, Norimichi; Matsuno, Yoshiharu; Nakaoka, Hiroko; Todaka, Emiko; Mori, Chisato

    2017-02-01

    We investigated the relationship between food frequency questionnaire (FFQ) responses and serum polychlorinated biphenyl (PCB) levels of mothers and fathers recruited from the Chiba Regional Center, which is one of the 15 regional centers of the Japan Environment and Children's Study (mothers: n = 1477, fathers: n = 219). The expected PCB values were estimated from the participants' FFQ answers and medical records (age, body mass index and number of deliveries). Based on the stepwise forward selection results of Bayesian regression models, age and fish and egg consumption were positively associated with PCB concentrations and a number of deliveries were negatively associated with PCB concentrations in mothers, whereas only age was positively associated with PCB concentrations in fathers.These findings indicated that the estimation of daily dietary intake may be useful for the prediction of PCB concentration for mothers.

  2. Impact of MAC Delay on AUV Localization: Underwater Localization Based on Hyperbolic Frequency Modulation Signal.

    Science.gov (United States)

    Kim, Sungryul; Yoo, Younghwan

    2018-01-26

    Medium Access Control (MAC) delay which occurs between the anchor node's transmissions is one of the error sources in underwater localization. In particular, in AUV localization, the MAC delay significantly degrades the ranging accuracy. The Cramer-Rao Low Bound (CRLB) definition theoretically proves that the MAC delay significantly degrades the localization performance. This paper proposes underwater localization combined with multiple access technology to decouple the localization performance from the MAC delay. Towards this goal, we adopt hyperbolic frequency modulation (HFM) signal that provides multiplexing based on its good property, high-temporal correlation. Owing to the multiplexing ability of the HFM signal, the anchor nodes can transmit packets without MAC delay, i.e., simultaneous transmission is possible. In addition, the simulation results show that the simultaneous transmission is not an optional communication scheme, but essential for the localization of mobile object in underwater.

  3. Frequency of damage by external explosion hazards based on geographical information

    International Nuclear Information System (INIS)

    Becker, Guenter; Camarinopoulos, Alexis; Theodora, Karali; Camarinopoulos, Leonidas; Schubert, B.

    2013-01-01

    External explosions can significantly contribute to risk of damage for industrial plants. External explosions may origin from other plants in the neighbourhood, which store and operate with explosive substances, or from transport of such substances on road, rail, or water. If deflagration is involved, ignition will not necessarily occur at the place of the accident, but a cloud of a combustible gas-air mixture may develop, which will ignite at some distance depending on wind velocity. A probabilistic model has been developed to calculate frequencies of damage based on numerical integration or on Monte Carlo simulation. Geographical information systems provide map material for sites, roads, rail and rivers on a computer. Data has been collected and applied for a nuclear power plant in Germany as an example. The method, however, can be used for any type of plant subject to external explosion hazards. (orig.)

  4. Design of an Ultra-wideband Pseudo Random Coded MIMO Radar Based on Radio Frequency Switches

    Directory of Open Access Journals (Sweden)

    Su Hai

    2017-02-01

    Full Text Available A Multiple-Input Multiple-Output (MIMO ultra-wideband radar can detect the range and azimuth information of targets in real time. It is widely used for geological surveys, life rescue, through-wall tracking, and other military or civil fields. This paper presents the design of an ultra-wideband pseudo random coded MIMO radar that is based on Radio Frequency (RF switches and implements a MIMO radar system. RF switches are employed to reduce cost and complexity of the system. As the switch pressure value is limited, the peak power of the transmitting signal is 18 dBm. The ultra-wideband radar echo is obtained by hybrid sampling, and pulse compression is computed by Digital Signal Processors (DSPs embedded in an Field-Programmable Gate Array (FPGA to simplify the signal process. The experiment illustrates that the radar system can detect the range and azimuth information of targets in real time.

  5. Frequency of damage by external explosion hazards based on geographical information

    Energy Technology Data Exchange (ETDEWEB)

    Becker, Guenter [Risa Sicherheitsanalysen GmbH, Berlin-Charlottenburg (Germany); Camarinopoulos, Alexis; Theodora, Karali [Environment Reliability and Risk Analysis (ERRA), Athens (Greece); Camarinopoulos, Leonidas [Piraeus Univ. (Greece); Schubert, B. [VENE, Hamburg (Germany)

    2013-05-15

    External explosions can significantly contribute to risk of damage for industrial plants. External explosions may origin from other plants in the neighbourhood, which store and operate with explosive substances, or from transport of such substances on road, rail, or water. If deflagration is involved, ignition will not necessarily occur at the place of the accident, but a cloud of a combustible gas-air mixture may develop, which will ignite at some distance depending on wind velocity. A probabilistic model has been developed to calculate frequencies of damage based on numerical integration or on Monte Carlo simulation. Geographical information systems provide map material for sites, roads, rail and rivers on a computer. Data has been collected and applied for a nuclear power plant in Germany as an example. The method, however, can be used for any type of plant subject to external explosion hazards. (orig.)

  6. Broadband pulsed difference frequency generation laser source centered 3326 nm based on ring fiber lasers

    Science.gov (United States)

    Chen, Guangwei; Li, Wenlei

    2018-03-01

    A broadband pulsed mid-infrared difference frequency generation (DFG) laser source based on MgO-doped congruent LiNbO3 bulk is experimentally demonstrated, which employs a homemade pulsed ytterbium-doped ring fiber laser and a continuous wave erbium-doped ring fiber laser to act as seed sources. The experimental results indicate that the perfect phase match crystal temperature is about 74.5∘C. The maximum spectrum bandwidth of idler is about 60 nm with suitable polarization states of fundamental lights. The central wavelength of idlers varies from 3293 nm to 3333 nm over the crystal temperature ranges of 70.4-76∘C. A jump of central wavelength exists around crystal temperature of 72∘C with variation of about 30 nm. The conversion efficiency of DFG can be tuned with the crystal temperature and polarization states of fundamental lights.

  7. Analog of electromagnetically induced transparency at terahertz frequency based on a bilayer-double-H-metamaterial

    Science.gov (United States)

    Wang, Yue'e.; Li, Zhi; Hu, Fangrong

    2018-01-01

    We designed a bilayer-double-H-metamaterials (BDHM) composed of two layers of metal and two layers of dielectric to analog a spectral response of electromagnetically induced transparency (EIT) at terahertz frequency. By changing the incident angle, the BDHM exhibits an EIT-like spectral response. The tunable spectral performances and modulation mechanism of the transparent peak are theoretically investigated using full-wave electromagnetic simulation software. The physical mechanism of the EIT-like effect is based on the constructive and destructive interference between the induced electrical dipoles. Our work provides a new way to realize the EIT-like effect only by changing the incident angles of the metamaterials. The potential applications include tunable filters, sensors, attenuators, switches, and so on.

  8. Multi-beam synchronous measurement based on PSD phase detection using frequency-domain multiplexing

    Science.gov (United States)

    Duan, Ying; Qin, Lan; Xue, Lian; Xi, Feng; Mao, Jiubing

    2013-10-01

    According to the principle of centroid measurement, position-sensitive detectors (PSD) are commonly used for micro displacement detection. However, single-beam detection method cannot satisfy such tasks as multi-dimension position measurement, three dimension vision reconstruction, and robot precision positioning, which require synchronous measurement of multiple light beams. Consequently, we designed PSD phase detection method using frequency-domain multiplexing for synchronous detection of multiple modulated light beams. Compared to previous PSD amplitude detection method, the phase detection method using FDM has advantages of simplified measuring system, low cost, high capability of resistance to light interference as well as improved resolution. The feasibility of multi-beam synchronous measurement based on PSD phase detection using FDM was validated by multi-beam measuring experiments. The maximum non-linearity error of the multi-beam synchronous measurement is 6.62%.

  9. A High-Precision Time-Frequency Entropy Based on Synchrosqueezing Generalized S-Transform Applied in Reservoir Detection

    Directory of Open Access Journals (Sweden)

    Hui Chen

    2018-06-01

    Full Text Available According to the fact that high frequency will be abnormally attenuated when seismic signals travel across reservoirs, a new method, which is named high-precision time-frequency entropy based on synchrosqueezing generalized S-transform, is proposed for hydrocarbon reservoir detection in this paper. First, the proposed method obtains the time-frequency spectra by synchrosqueezing generalized S-transform (SSGST, which are concentrated around the real instantaneous frequency of the signals. Then, considering the characteristics and effects of noises, we give a frequency constraint condition to calculate the entropy based on time-frequency spectra. The synthetic example verifies that the entropy will be abnormally high when seismic signals have an abnormal attenuation. Besides, comparing with the GST time-frequency entropy and the original SSGST time-frequency entropy in field data, the results of the proposed method show higher precision. Moreover, the proposed method can not only accurately detect and locate hydrocarbon reservoirs, but also effectively suppress the impact of random noises.

  10. Evaluation of web-based, self-administered, graphical food frequency questionnaire.

    Science.gov (United States)

    Kristal, Alan R; Kolar, Ann S; Fisher, James L; Plascak, Jesse J; Stumbo, Phyllis J; Weiss, Rick; Paskett, Electra D

    2014-04-01

    Computer-administered food frequency questionnaires (FFQs) can address limitations inherent in paper questionnaires by allowing very complex skip patterns, portion size estimation based on food pictures, and real-time error checking. We evaluated a web-based FFQ, the Graphical Food Frequency System (GraFFS). Participants completed the GraFFS, six telephone-administered 24-hour dietary recalls over the next 12 weeks, followed by a second GraFFS. Participants were 40 men and 34 women, aged 18 to 69 years, living in the Columbus, OH, area. Intakes of energy, macronutrients, and 17 micronutrients/food components were estimated from the GraFFS and the mean of all recalls. Bias (second GraFFS minus recalls) was -9%, -5%, +4%, and -4% for energy and percentages of energy from fat, carbohydrate, and protein, respectively. De-attenuated, energy-adjusted correlations (intermethod reliability) between the recalls and the second GraFFS for fat, carbohydrate, protein, and alcohol were 0.82, 0.79, 0.67, and 0.90, respectively; for micronutrients/food components the median was 0.61 and ranged from 0.40 for zinc to 0.92 for beta carotene. The correlations between the two administrations of the GraFFS (test-retest reliability) for fat, carbohydrate, protein, and alcohol were 0.60, 0.63, 0.73, and 0.87, respectively; among micronutrients/food components the median was 0.67 and ranged from 0.49 for vitamin B-12 to 0.82 for fiber. The measurement characteristics of the GraFFS were at least as good as those reported for most paper FFQs, and its high intermethod reliability suggests that further development of computer-administered FFQs is warranted. Copyright © 2014 Academy of Nutrition and Dietetics. Published by Elsevier Inc. All rights reserved.

  11. High-Resolution Time-Frequency Spectrum-Based Lung Function Test from a Smartphone Microphone

    Directory of Open Access Journals (Sweden)

    Tharoeun Thap

    2016-08-01

    Full Text Available In this paper, a smartphone-based lung function test, developed to estimate lung function parameters using a high-resolution time-frequency spectrum from a smartphone built-in microphone is presented. A method of estimation of the forced expiratory volume in 1 s divided by forced vital capacity (FEV1/FVC based on the variable frequency complex demodulation method (VFCDM is first proposed. We evaluated our proposed method on 26 subjects, including 13 healthy subjects and 13 chronic obstructive pulmonary disease (COPD patients, by comparing with the parameters clinically obtained from pulmonary function tests (PFTs. For the healthy subjects, we found that an absolute error (AE and a root mean squared error (RMSE of the FEV1/FVC ratio were 4.49% ± 3.38% and 5.54%, respectively. For the COPD patients, we found that AE and RMSE from COPD patients were 10.30% ± 10.59% and 14.48%, respectively. For both groups, we compared the results using the continuous wavelet transform (CWT and short-time Fourier transform (STFT, and found that VFCDM was superior to CWT and STFT. Further, to estimate other parameters, including forced vital capacity (FVC, forced expiratory volume in 1 s (FEV1, and peak expiratory flow (PEF, regression analysis was conducted to establish a linear transformation. However, the parameters FVC, FEV1, and PEF had correlation factor r values of 0.323, 0.275, and −0.257, respectively, while FEV1/FVC had an r value of 0.814. The results obtained suggest that only the FEV1/FVC ratio can be accurately estimated from a smartphone built-in microphone. The other parameters, including FVC, FEV1, and PEF, were subjective and dependent on the subject’s familiarization with the test and performance of forced exhalation toward the microphone.

  12. Effects of hormonehCG following injection of estnanate of reproductive performances ofswamp buffalo (Bubalus bubalis

    Directory of Open Access Journals (Sweden)

    Polmer Situmorang

    1998-12-01

    Full Text Available Low reproductive performance of buffalo resulted the population growth in Indonesia was only slightly increase during the last 50 year. Reproductive performance can be improved by hormone treatment during synchronization . One study was conducted in Porsea and Siborong-borong to see the effects of hormone hCG on the reproductive performances of swamp buffalo . A total of 34 buffaloes were kept in field grazing and commercial concentrate 4 kg/head/day was given for supplementation in 27 buffaloes and the rest 7 buffaloes treated as control with no supplemeniation . Synchronization performed by two intromuscular (IM injections of2 ml estrumate in 11 days interval . The buffaloes were divided into 2 groups of 16 buffaloes without hCG (Control group and 18 buffaloes with hCG (Treated group. Treated group wereinjected with 500 IU hCG intro-muscularly (IM 24-48 hours following second injection of estrumate . All buffaloes were artificially inseminated (AI 48 and 72 hours after the second injection of estrumate. Results showed that injection of estrurnate twice in 11 days interval was very effective to synchronize oestrus of buffaloes. The persentage of buffalo showing oestrus was 67 .5 and 85 .3% following 48 and 72 Ins of thesecond injection of estrumate resfectively . The effectiveness of estrumate was significantly affected by body condition of buffaloes where the persentage of oestrus 48 and 72 hours following estrumate injection was significantly higher (P<0.01 in buffaloes with good body condition than those in poor body condition (74.5 and 92.5% vs 42 .9 and 57 .1%. Injection ofhCG following estrumate increased the percentage of oestrus and pregnancy of buffalo. Percentages of oestrus of buffaloes 48 and 72 hours following estrumate injections was significantly higher (P<0 .01 in hCG treatment (83 .3 and 100% than those in control groups (68 .8 and 81 .3% . The pregnancy rate of buffalo with good body condition was significantly higher (P<0

  13. Amphiregulin mediates hCG-induced StAR expression and progesterone production in human granulosa cells

    OpenAIRE

    Fang, Lanlan; Yu, Yiping; Zhang, Ruizhe; He, Jingyan; Sun, Ying-Pu

    2016-01-01

    Progesterone plays critical roles in maintaining a successful pregnancy at the early embryonic stage. Human chorionic gonadotropin (hCG) rapidly induces amphiregulin (AREG) expression. However, it remains unknown whether AREG mediates hCG-induced progesterone production. Thus, the objective of this study was to investigate the role of AREG in hCG-induced progesterone production and the underlying molecular mechanism in human granulosa cells; primary cells were used as the experimental model. ...

  14. Education System Using Interactive 3D Computer Graphics (3D-CG) Animation and Scenario Language for Teaching Materials

    Science.gov (United States)

    Matsuda, Hiroshi; Shindo, Yoshiaki

    2006-01-01

    The 3D computer graphics (3D-CG) animation using a virtual actor's speaking is very effective as an educational medium. But it takes a long time to produce a 3D-CG animation. To reduce the cost of producing 3D-CG educational contents and improve the capability of the education system, we have developed a new education system using Virtual Actor.…

  15. 75 FR 42376 - Proposed Information Collection; Comment Request; NTIA/FCC Web-based Frequency Coordination System

    Science.gov (United States)

    2010-07-21

    ... Information Collection; Comment Request; NTIA/FCC Web- based Frequency Coordination System AGENCY: National.... Abstract The National Telecommunications and Information Administration (NTIA) hosts a Web-based system...) bands that are shared on a co-primary basis by federal and non-federal users. The Web-based system...

  16. Low energy proton irradiation effects on InP/InGaAs DHBTs and InP-base frequency dividers

    Science.gov (United States)

    Zhang, Xingyao; Li, Yudong; Guo, Qi; Feng, Jie

    2018-03-01

    InP/InGaAs DHBTs and frequency dividers are irradiated by low energy proton, and displacement damage effect of the devices are analyzed. InP/InGaAs DHBTs has been made DC characteristics measurements, and the function measurement for frequency dividers has been done both before and after proton irradiation. The breakdown voltage of InP DHBTs drop to 3.7V When the fluence up to 5x1013 protons/cm2. Meanwhile, the function of frequency dividers get out of order. Degradation of DC characteristics of DHBTs are due to the radiation-induced defects in the quasi neutral base and the space charge region of base-collector and base-emitter junctions. The performance deterioration of DHBTs induce the fault of frequency dividers, and prescaler may be the most sensitive circuit.

  17. Low frequency of defective mismatch repair in a population-based series of upper urothelial carcinoma

    International Nuclear Information System (INIS)

    Ericson, Kajsa M; Isinger, Anna P; Isfoss, Björn L; Nilbert, Mef C

    2005-01-01

    Upper urothelial cancer (UUC), i.e. transitional cell carcinomas of the renal pelvis and the ureter, occur at an increased frequency in patients with hereditary nonpolyposis colorectal cancer (HNPCC). Defective mismatch repair (MMR) specifically characterizes HNPCC-associated tumors, but also occurs in subsets of some sporadic tumors, e.g. in gastrointestinal cancer and endometrial cancer. We assessed the contribution of defective MMR to the development of UUC in a population-based series from the southern Swedish Cancer Registry, through microsatellite instability (MSI) analysis and immunohistochemical evaluation of expression of the MMR proteins MLH1, PMS2, MSH2, and MSH6. A MSI-high phenotype was identified in 9/216 (4%) successfully analyzed patients and a MSI-low phenotype in 5/216 (2%). Loss of MMR protein immunostaining was found in 11/216 (5%) tumors, and affected most commonly MSH2 and MSH6. This population-based series indicates that somatic MMR inactivation is a minor pathway in the development of UUC, but tumors that display defective MMR are, based on the immunohistochemical expression pattern, likely to be associated with HNPCC

  18. Low frequency of defective mismatch repair in a population-based series of upper urothelial carcinoma

    Directory of Open Access Journals (Sweden)

    Isfoss Björn L

    2005-03-01

    Full Text Available Abstract Background Upper urothelial cancer (UUC, i.e. transitional cell carcinomas of the renal pelvis and the ureter, occur at an increased frequency in patients with hereditary nonpolyposis colorectal cancer (HNPCC. Defective mismatch repair (MMR specifically characterizes HNPCC-associated tumors, but also occurs in subsets of some sporadic tumors, e.g. in gastrointestinal cancer and endometrial cancer. Methods We assessed the contribution of defective MMR to the development of UUC in a population-based series from the southern Swedish Cancer Registry, through microsatellite instability (MSI analysis and immunohistochemical evaluation of expression of the MMR proteins MLH1, PMS2, MSH2, and MSH6. Results A MSI-high phenotype was identified in 9/216 (4% successfully analyzed patients and a MSI-low phenotype in 5/216 (2%. Loss of MMR protein immunostaining was found in 11/216 (5% tumors, and affected most commonly MSH2 and MSH6. Conclusion This population-based series indicates that somatic MMR inactivation is a minor pathway in the development of UUC, but tumors that display defective MMR are, based on the immunohistochemical expression pattern, likely to be associated with HNPCC.

  19. Low frequency of defective mismatch repair in a population-based series of upper urothelial carcinoma

    Energy Technology Data Exchange (ETDEWEB)

    Ericson, Kajsa M; Isinger, Anna P [Departments of Oncology, University Hospital, Lund (Sweden); Isfoss, Björn L [Departments of Pathology, University Hospital, Lund (Sweden); Nilbert, Mef C [Departments of Oncology, University Hospital, Lund (Sweden)

    2005-01-01

    Upper urothelial cancer (UUC), i.e. transitional cell carcinomas of the renal pelvis and the ureter, occur at an increased frequency in patients with hereditary nonpolyposis colorectal cancer (HNPCC). Defective mismatch repair (MMR) specifically characterizes HNPCC-associated tumors, but also occurs in subsets of some sporadic tumors, e.g. in gastrointestinal cancer and endometrial cancer. We assessed the contribution of defective MMR to the development of UUC in a population-based series from the southern Swedish Cancer Registry, through microsatellite instability (MSI) analysis and immunohistochemical evaluation of expression of the MMR proteins MLH1, PMS2, MSH2, and MSH6. A MSI-high phenotype was identified in 9/216 (4%) successfully analyzed patients and a MSI-low phenotype in 5/216 (2%). Loss of MMR protein immunostaining was found in 11/216 (5%) tumors, and affected most commonly MSH2 and MSH6. This population-based series indicates that somatic MMR inactivation is a minor pathway in the development of UUC, but tumors that display defective MMR are, based on the immunohistochemical expression pattern, likely to be associated with HNPCC.

  20. A population-based job exposure matrix for power-frequency magnetic fields.

    Science.gov (United States)

    Bowman, Joseph D; Touchstone, Jennifer A; Yost, Michael G

    2007-09-01

    A population-based job exposure matrix (JEM) was developed to assess personal exposures to power-frequency magnetic fields (MF) for epidemiologic studies. The JEM compiled 2,317 MF measurements taken on or near workers by 10 studies in the United States, Sweden, New Zealand, Finland, and Italy. A database was assembled from the original data for six studies plus summary statistics grouped by occupation from four other published studies. The job descriptions were coded into the 1980 Standard Occupational Classification system (SOC) and then translated to the 1980 job categories of the U.S. Bureau of the Census (BOC). For each job category, the JEM database calculated the arithmetic mean, standard deviation, geometric mean, and geometric standard deviation of the workday-average MF magnitude from the combined data. Analysis of variance demonstrated that the combining of MF data from the different sources was justified, and that the homogeneity of MF exposures in the SOC occupations was comparable to JEMs for solvents and particulates. BOC occupation accounted for 30% of the MF variance (p job variance to the total of within- and between-job variances) was 88%. Jobs lacking data had their exposures inferred from measurements on similar occupations. The JEM provided MF exposures for 97% of the person-months in a population-based case-control study and 95% of the jobs on death certificates in a registry study covering 22 states. Therefore, we expect this JEM to be useful in other population-based epidemiologic studies.

  1. Carbon Nanofiber-Based, High-Frequency, High-Q, Miniaturized Mechanical Resonators

    Science.gov (United States)

    Kaul, Anupama B.; Epp, Larry W.; Bagge, Leif

    2011-01-01

    High Q resonators are a critical component of stable, low-noise communication systems, radar, and precise timing applications such as atomic clocks. In electronic resonators based on Si integrated circuits, resistive losses increase as a result of the continued reduction in device dimensions, which decreases their Q values. On the other hand, due to the mechanical construct of bulk acoustic wave (BAW) and surface acoustic wave (SAW) resonators, such loss mechanisms are absent, enabling higher Q-values for both BAW and SAW resonators compared to their electronic counterparts. The other advantages of mechanical resonators are their inherently higher radiation tolerance, a factor that makes them attractive for NASA s extreme environment planetary missions, for example to the Jovian environments where the radiation doses are at hostile levels. Despite these advantages, both BAW and SAW resonators suffer from low resonant frequencies and they are also physically large, which precludes their integration into miniaturized electronic systems. Because there is a need to move the resonant frequency of oscillators to the order of gigahertz, new technologies and materials are being investigated that will make performance at those frequencies attainable. By moving to nanoscale structures, in this case vertically oriented, cantilevered carbon nanotubes (CNTs), that have larger aspect ratios (length/thickness) and extremely high elastic moduli, it is possible to overcome the two disadvantages of both bulk acoustic wave (BAW) and surface acoustic wave (SAW) resonators. Nano-electro-mechanical systems (NEMS) that utilize high aspect ratio nanomaterials exhibiting high elastic moduli (e.g., carbon-based nanomaterials) benefit from high Qs, operate at high frequency, and have small force constants that translate to high responsivity that results in improved sensitivity, lower power consumption, and im - proved tunablity. NEMS resonators have recently been demonstrated using topdown

  2. A New High Frequency Injection Method Based on Duty Cycle Shifting without Maximum Voltage Magnitude Loss

    DEFF Research Database (Denmark)

    Wang, Dong; Lu, Kaiyuan; Rasmussen, Peter Omand

    2015-01-01

    The conventional high frequency signal injection method is to superimpose a high frequency voltage signal to the commanded stator voltage before space vector modulation. Therefore, the magnitude of the voltage used for machine torque production is limited. In this paper, a new high frequency...... amplitude. This may be utilized to develop new position estimation algorithm without involving the inductance in the medium to high speed range. As an application example, a developed inductance independent position estimation algorithm using the proposed high frequency injection method is applied to drive...... injection method, in which high frequency signal is generated by shifting the duty cycle between two neighboring switching periods, is proposed. This method allows injecting a high frequency signal at half of the switching frequency without the necessity to sacrifice the machine fundamental voltage...

  3. A comparative assessment of different frequency based damage detection in unidirectional composite plates using MFC sensors

    Science.gov (United States)

    de Medeiros, Ricardo; Sartorato, Murilo; Vandepitte, Dirk; Tita, Volnei

    2016-11-01

    The basic concept of the vibration based damage identification methods is that the dynamic behaviour of a structure can change if damage occurs. Damage in a structure can alter the structural integrity, and therefore, the physical properties like stiffness, mass and/or damping may change. The dynamic behaviour of a structure is a function of these physical properties and will, therefore, directly be affected by the damage. The dynamic behaviour can be described in terms of time, frequency and modal domain parameters. The changes in these parameters (or properties derived from these parameters) are used as indicators of damage. Hence, this work has two main objectives. The first one is to provide an overview of the structural vibration based damage identification methods. For this purpose, a fundamental description of the structural vibration based damage identification problem is given, followed by a short literature overview of the damage features, which are commonly addressed. The second objective is to create a damage identification method for detection of the damage in composite structures. To aid in this process, two basic principles are discussed, namely the effect of the potential damage case on the dynamic behaviour, and the consequences involved with the information reduction in the signal processing. Modal properties from the structural dynamic output response are obtained. In addition, experimental and computational results are presented for the application of modal analysis techniques applied to composite specimens with and without damage. The excitation of the structures is performed using an impact hammer and, for measuring the output data, accelerometers as well as piezoelectric sensors. Finite element models are developed by shell elements, and numerical results are compared to experimental data, showing good correlation for the response of the specimens in some specific frequency range. Finally, FRFs are analysed using suitable metrics, including a

  4. Low-frequency noise suppression of a fiber laser based on a round-trip EDFA power stabilizer

    International Nuclear Information System (INIS)

    Pan, Z Q; Zhou, J; Yang, F; Ye, Q; Cai, H W; Qu, R H; Fang, Z J

    2013-01-01

    We have designed a power stabilizer based on a round-trip erbium-doped fiber amplifier (EDFA) structure to suppress the low-frequency relative intensity noise (RIN) for a narrow linewidth fiber laser. The noise suppressor is analyzed theoretically and its feasibility is verified experimentally. For a short-cavity single-frequency fiber laser with this device, about 20 dB low-frequency RIN improvement is achieved (down to −120 dB Hz −1 at 10 Hz). The corresponding frequency noise is also reduced by a factor of 1.6. The proposed method is an effective solution to achieve a low-frequency low RIN laser source for highly coherent detection applications. (paper)

  5. Cut-off frequency of magnetostrictive materials based on permeability spectra

    International Nuclear Information System (INIS)

    Meng Hao; Zhang Tianli; Jiang Chengbao

    2012-01-01

    The loss behavior and cut-off frequency of TbDyFe alloy and TbDyFe/epoxy composite have been investigated by measuring their permeability spectra. The loss factor of TbDyFe alloy increases exponentially as the frequency goes up, while it is almost unchanged for the TbDyFe/epoxy composite. The loss factor value for the TbDyFe composite is only 4.3% of that for the monolithic TbDyFe alloy at high frequency of 10 kHz under the peak magnetic induction of 10 mT. The cut-off frequency of TbDyFe/epoxy composite is 6800 kHz, 3 orders of magnitude larger than that of TbDyFe alloy. The cut-off frequency is found to be the ferromagnetic resonance frequency and can be calculated from Snoek's law. - Highlights: ► The cut-off frequency of TbDyFe alloy and TbDyFe/epoxy composite has been investigated. ► Permeability spectra are used to study loss behavior and cut-off frequency. ► A mathematic formula is deduced to predict the cut-off frequency. ► TbDyFe/epoxy composite presents high cut-off frequency of 6800 kHz.

  6. Frequency and predictors of psychological distress after a diagnosis of epilepsy: A community-based study.

    Science.gov (United States)

    Xu, Ying; Hackett, Maree L; Glozier, Nick; Nikpour, Armin; Bleasel, Andrew; Somerville, Ernest; Lawson, John; Jan, Stephen; Hyde, Lorne; Todd, Lisa; Martiniuk, Alexandra; Ireland, Carol; Anderson, Craig S

    2017-10-01

    The objective of the study was to determine the frequency and predictors of psychological distress after a diagnosis of epilepsy. The Sydney Epilepsy Incidence Study to Measure Illness Consequences (SEISMIC) was a prospective, multicenter, community-based study of people of all ages with newly diagnosed epilepsy in Sydney, Australia. Analyses involved multivariate logistic regression and multinomial logit regression to identify predictors of psychological distress, assessed using the Hospital Anxiety and Depression Scale (HADS) and the Strengths and Difficulties Questionnaire (SDQ), as part of structured interviews. Psychological distress occurred in 33% (95% confidence interval [CI] 26 to 40%) and 24% (95% CI 18 to 31%) of 180 adults at baseline and 12months, respectively, and 23% (95% CI 14 to 33%) of 77 children at both time points. Thirty adults and 7 children had distress at baseline who recovered at 12months, while 15 adults and 7 children had new onset of distress during this period. History of psychiatric or behavioral disorder (for adults, odds ratio [OR] 6.82, 95% CI 3.08 to 15.10; for children, OR 28.85, 95% CI 2.88 to 288.60) and higher psychosocial disability (adults, OR 1.17, 95% CI 1.07 to 1.27) or lower family functioning (children, OR 1.80, 95% CI 1.08 to 3.02) were associated with psychological distress (C statistics 0.80 and 0.78). Psychological distress is common and fluctuates in frequency after a diagnosis of epilepsy. Those with premorbid psychological, psychosocial, and family problems are at high risk of this adverse outcome. Copyright © 2017 Elsevier Inc. All rights reserved.

  7. Polymer Magnetic Composite Core Based Microcoils and Microtransformers for Very High Frequency Power Applications

    Directory of Open Access Journals (Sweden)

    Saravana Guru Mariappan

    2016-04-01

    Full Text Available We present a rapid prototyping and a cost effective fabrication process on batch fabricated wafer-level micro inductive components with polymer magnetic composite (PMC cores. The new PMC cores provide a possibility to bridge the gap between the non-magnetic and magnetic core inductive devices in terms of both the operating frequency and electrical performance. An optimized fabrication process of molding, casting, and demolding which uses teflon for the molding tool is presented. High permeability NiFeZn powder was mixed with Araldite epoxy to form high resistive PMC cores. Cylindrical PMC cores having a footprint of 0.79 mm 2 were fabricated with varying percentage of the magnetic powder on FR4 substrates. The core influence on the electrical performance of the inductive elements is discussed. Inductor chips having a solenoidal coil as well as transformer chips with primary and secondary coils wound around each other have been fabricated and evaluated. A core with 65% powder equipped with a solenoid made out of 25 µm thick insulated Au wire having 30 turns, yielded a constant inductance value of 2 µH up to the frequency of 50 MHz and a peak quality factor of 13. A 1:1 transformer with similar PMC core and solenoidal coils having 10 turns yielded a maximum efficiency of 84% and a coupling factor of 96%. In order to protect the solenoids and to increase the mechanical robustness and handling of the chips, a novel process was developed to encapsulate the components with an epoxy based magnetic composite. The effect on the electrical performance through the magnetic composite encapsulation is reported as well.

  8. Large-scale derived flood frequency analysis based on continuous simulation

    Science.gov (United States)

    Dung Nguyen, Viet; Hundecha, Yeshewatesfa; Guse, Björn; Vorogushyn, Sergiy; Merz, Bruno

    2016-04-01

    There is an increasing need for spatially consistent flood risk assessments at the regional scale (several 100.000 km2), in particular in the insurance industry and for national risk reduction strategies. However, most large-scale flood risk assessments are composed of smaller-scale assessments and show spatial inconsistencies. To overcome this deficit, a large-scale flood model composed of a weather generator and catchments models was developed reflecting the spatially inherent heterogeneity. The weather generator is a multisite and multivariate stochastic model capable of generating synthetic meteorological fields (precipitation, temperature, etc.) at daily resolution for the regional scale. These fields respect the observed autocorrelation, spatial correlation and co-variance between the variables. They are used as input into catchment models. A long-term simulation of this combined system enables to derive very long discharge series at many catchment locations serving as a basic for spatially consistent flood risk estimates at the regional scale. This combined model was set up and validated for major river catchments in Germany. The weather generator was trained by 53-year observation data at 528 stations covering not only the complete Germany but also parts of France, Switzerland, Czech Republic and Australia with the aggregated spatial scale of 443,931 km2. 10.000 years of daily meteorological fields for the study area were generated. Likewise, rainfall-runoff simulations with SWIM were performed for the entire Elbe, Rhine, Weser, Donau and Ems catchments. The validation results illustrate a good performance of the combined system, as the simulated flood magnitudes and frequencies agree well with the observed flood data. Based on continuous simulation this model chain is then used to estimate flood quantiles for the whole Germany including upstream headwater catchments in neighbouring countries. This continuous large scale approach overcomes the several

  9. Reconstruction of human brain spontaneous activity based on frequency-pattern analysis of magnetoencephalography data

    Directory of Open Access Journals (Sweden)

    Rodolfo R Llinas

    2015-10-01

    Full Text Available A new method for the analysis and localization of brain activity has been developed, based on multichannel magnetic field recordings, over minutes, superimposed on the MRI of the individual. Here, a high resolution Fourier Transform is obtained over the entire recording period, leading to a detailed multi-frequency spectrum. Further analysis implements a total decomposition of the frequency components into functionally invariant entities, each having an invariant field pattern localizable in recording space. The method, addressed as functional tomography, makes it possible to find the distribution of magnetic field sources in space. Here, the method is applied to the analysis of simulated data, to oscillating signals activating a physical current dipoles phantom, and to recordings of spontaneous brain activity in ten healthy adults. In the analysis of simulated data, 61 dipoles are localized with 0.7 mm precision. Concerning the physical phantom the method is able to localize three simultaneously activated current dipoles with 1 mm precision. Spatial resolution 3 mm was attained when localizing spontaneous alpha rhythm activity in ten healthy adults, where the alpha peak was specified for each subject individually. Co-registration of the functional tomograms with each subject’s head MRI localized alpha range activity to the occipital and/or posterior parietal brain region. This is the first application of this new functional tomography to human brain activity. The method successfully provides an overall view of brain electrical activity, a detailed spectral description and, combined with MRI, the localization of sources in anatomical brain space.

  10. High-frequency acoustic spectrum analyzer based on polymer integrated optics

    Science.gov (United States)

    Yacoubian, Araz

    This dissertation presents an acoustic spectrum analyzer based on nonlinear polymer-integrated optics. The device is used in a scanning heterodyne geometry by zero biasing a Michelson interferometer. It is capable of detecting vibrations from DC to the GHz range. Initial low frequency experiments show that the device is an effective tool for analyzing an acoustic spectrum even in noisy environments. Three generations of integrated sensors are presented, starting with a very lossy (86 dB total insertion loss) initial device that detects vibrations as low as λ/10, and second and third generation improvements with a final device of 44 dB total insertion loss. The sensor was further tested for detecting a pulsed laser-excited vibration and resonances due to the structure of the sample. The data are compared to the acoustic spectrum measured using a low loss passive fiber interferometer detection scheme which utilizes a high speed detector. The peaks present in the passive detection scheme are clearly visible with our sensor data, which have a lower noise floor. Hybrid integration of GHz electronics is also investigated in this dissertation. A voltage controlled oscillator (VCO) is integrated on a polymer device using a new approach. The VCO is shown to operate as specified by the manufacturer, and the RF signal is efficiently launched onto the micro-strip line used for EO modulation. In the future this technology can be used in conjunction with the presented sensor to produce a fully integrated device containing high frequency drive electronics controlled by low DC voltage. Issues related to device fabrication, loss analysis, RF power delivery to drive circuitry, efficient poling of large area samples, and optimizing poling conditions are also discussed throughout the text.

  11. Classification of thyroid nodules using a resonance-frequency-based electrical impedance spectroscopy: progress assessment

    Science.gov (United States)

    Zheng, Bin; Tublin, Mitchell E.; Lederman, Dror; Klym, Amy H.; Brown, Erica D.; Gur, David

    2012-02-01

    The incidence of thyroid cancer is rising faster than other malignancies and has nearly doubled in the United States (U.S.) in the last 30 years. However, classifying between malignant and benign thyroid nodules is often difficult. Although ultrasound guided Fine Needle Aspiration Biopsy (FNAB) is considered an excellent tool for triaging patients, up to 25% of FNABs are inconclusive. As a result, definitive diagnosis requires an exploratory surgery and a large number of these are performed in the U.S. annually. It would be extremely beneficial to develop a non-invasive tool or procedure that could assist in assessing the likelihood of malignancy of otherwise indeterminate thyroid nodules, thereby reducing the number of exploratory thyroidectomies that are performed under general anesthesia. In this preliminary study we demonstrate a unique hand-held Resonance-frequency based Electrical Impedance Spectroscopy (REIS) device with six pairs of detection probes to detect and classify thyroid nodules using multi-channel EIS output signal sweeps. Under an Institutional Review Board (IRB)-approved case collection protocol, this REIS device is being tested in our clinical facility and we have been collecting an initial patient data set since March of this year. Between March and August of 2011, 65 EIS tests were conducted on 65 patients. Among these cases, six depicted pathology-verified malignant cells. Our initial assessment indicates the feasibility of easily applying this REIS device and measurement approach in a very busy clinical setting. The measured resonance frequency differences between malignant and benign nodules could potentially make it possible to accurately classify indeterminate thyroid nodules.

  12. Detachments of the subducted Indian continental lithosphere based on 3D finite-frequency tomographic images

    Science.gov (United States)

    Liang, X.; Tian, X.; Wang, M.

    2017-12-01

    Indian plate collided with Eurasian plate at 60 Ma and there are about 3000 km crustal shortening since the continental-continental collision. At least one third of the total amount of crustal shortening between Indian and Eurasian plates could not be accounted by thickened Tibetan crust and surface erosion. It will need a combination of possible transfer of lower crust to the mantle by eclogitization and lateral extrusion. Based on the lithosphere-asthenosphere boundary images beneath the Tibetan plateau, there is also at least the same amount deficit for lithospheric mantle subducted into upper/lower mantle or lateral extrusion with the crust. We have to recover a detailed Indian continental lithosphere image beneath the plateau in order to explain this deficit of mass budget. Combining the new teleseismic body waves recorded by SANDWICH passive seismic array with waveforms from several previous temporary seismic arrays, we carried out finite-frequency tomographic inversions to image three-dimensional velocity structures beneath southern and central Tibetan plateau to examine the possible image of subducted Indian lithosphere in the Tibetan upper mantle. We have recovered a continuous high velocity body in upper mantle and piece-wised high velocity anomalies in the mantle transition zone. Based on their geometry and relative locations, we interpreted these high velocity anomalies as the subducted and detached Indian lithosphere at different episodes of the plateau evolution. Detachments of the subducted Indian lithosphere should have a crucial impact on the volcanism activities and uplift history of the plateau.

  13. A network-based frequency analysis of Inclusive Wealth to track sustainable development in world countries.

    Science.gov (United States)

    Ahmad, Nasir; Derrible, Sybil; Managi, Shunsuke

    2018-07-15

    Using human (HC), natural (NC), and produced (PC) capital from Inclusive Wealth as representatives of the triple bottom line of sustainability and utilizing elements of network science, we introduce a Network-based Frequency Analysis (NFA) method to track sustainable development in world countries from 1990 to 2014. The method compares every country with every other and links them when values are close. The country with the most links becomes the main trend, and the performance of every other country is assessed based on its 'orbital' distance from the main trend. Orbital speeds are then calculated to evaluate country-specific dynamic trends. Overall, we find an optimistic trend for HC only, indicating positive impacts of global initiatives aiming towards socio-economic development in developing countries like the Millennium Development Goals and 'Agenda 21'. However, we also find that the relative performance of most countries has not changed significantly in this period, regardless of their gradual development. Specifically, we measure a decrease in produced and natural capital for most countries, despite an increase in GDP, suggesting unsustainable development. Furthermore, we develop a technique to cluster countries and project the results to 2050, and we find a significant decrease in NC for nearly all countries, suggesting an alarming depletion of natural resources worldwide. Copyright © 2018 Elsevier Ltd. All rights reserved.

  14. Wireless Hydrogen Smart Sensor Based on Pt/Graphene-Immobilized Radio-Frequency Identification Tag.

    Science.gov (United States)

    Lee, Jun Seop; Oh, Jungkyun; Jun, Jaemoon; Jang, Jyongsik

    2015-08-25

    Hydrogen, a clean-burning fuel, is of key importance to various industrial applications, including fuel cells and the aerospace and automotive industries. However, hydrogen gas is odorless, colorless, and highly flammable; thus, appropriate safety protocol implementation and monitoring are essential. Highly sensitive hydrogen-gas leak detection and surveillance systems are needed; additionally, the ability to monitor large areas (e.g., cities) via wireless networks is becoming increasingly important. In this report, we introduce a radio frequency identification (RFID)-based wireless smart-sensor system, composed of a Pt-decorated reduced graphene oxide (Pt_rGO)-immobilized RFID sensor tag and an RFID-reader antenna-connected network analyzer to detect hydrogen gas. The Pt_rGOs, produced using a simple chemical reduction process, were immobilized on an antenna pattern in the sensor tag through spin coating. The resulting Pt_rGO-based RFID sensor tag exhibited a high sensitivity to hydrogen gas at unprecedentedly low concentrations (1 ppm), with wireless communication between the sensor tag and RFID-reader antenna. The wireless sensor tag demonstrated flexibility and a long lifetime due to the strong immobilization of Pt_rGOs on the substrate and battery-independent operation during hydrogen sensing, respectively.

  15. Wind farms providing secondary frequency regulation: Evaluating the performance of model-based receding horizon control

    International Nuclear Information System (INIS)

    Shapiro, Carl R.; Meneveau, Charles; Gayme, Dennice F.; Meyers, Johan

    2016-01-01

    We investigate the use of wind farms to provide secondary frequency regulation for a power grid. Our approach uses model-based receding horizon control of a wind farm that is tested using a large eddy simulation (LES) framework. In order to enable real-time implementation, the control actions are computed based on a time-varying one-dimensional wake model. This model describes wake advection and interactions, both of which play an important role in wind farm power production. This controller is implemented in an LES model of an 84-turbine wind farm represented by actuator disk turbine models. Differences between the velocities at each turbine predicted by the wake model and measured in LES are used for closed-loop feedback. The controller is tested on two types of regulation signals, “RegA” and “RegD”, obtained from PJM, an independent system operator in the eastern United States. Composite performance scores, which are used by PJM to qualify plants for regulation, are used to evaluate the performance of the controlled wind farm. Our results demonstrate that the controlled wind farm consistently performs well, passing the qualification threshold for all fastacting RegD signals. For the RegA signal, which changes over slower time scales, the controlled wind farm's average performance surpasses the threshold, but further work is needed to enable the controlled system to achieve qualifying performance all of the time. (paper)

  16. Angle-of-arrival-based gesture recognition using ultrasonic multi-frequency signals

    KAUST Repository

    Chen, Hui

    2017-11-02

    Hand gestures are tools for conveying information, expressing emotion, interacting with electronic devices or even serving disabled people as a second language. A gesture can be recognized by capturing the movement of the hand, in real time, and classifying the collected data. Several commercial products such as Microsoft Kinect, Leap Motion Sensor, Synertial Gloves and HTC Vive have been released and new solutions have been proposed by researchers to handle this task. These systems are mainly based on optical measurements, inertial measurements, ultrasound signals and radio signals. This paper proposes an ultrasonic-based gesture recognition system using AOA (Angle of Arrival) information of ultrasonic signals emitted from a wearable ultrasound transducer. The 2-D angles of the moving hand are estimated using multi-frequency signals captured by a fixed receiver array. A simple redundant dictionary matching classifier is designed to recognize gestures representing the numbers from `0\\' to `9\\' and compared with a neural network classifier. Average classification accuracies of 95.5% and 94.4% are obtained, respectively, using the two classification methods.

  17. Prototype fiber Bragg Grattings (FBG) sensor based on intensity modulation of the laser diode low frequency vibrations measurement

    Science.gov (United States)

    Setiono, Andi; Ula, Rini Khamimatul; Hanto, Dwi; Widiyatmoko, Bambang; Purnamaningsih, Retno Wigajatri

    2016-02-01

    In general, Fiber Bragg Grating (FBG) sensor works based on observation of spectral response characteristic to detect the desired parameter. In this research, we studied intensity response characteristic of FBG to detect the dynamic strain. Experiment result show that the reflected intensity had linier relationships with dynamic strain. Based on these characteristics, we developed the FBG sensor to detect low frequency vibration. This sensor is designed by attaching the FBG on the bronze cantilever with dimensions of 85×3×0.5 mm. Measurement results showed that the sensor was able to detect vibrations in the frequency range of 7-10 Hz at temperature range of 25-45 ˚C. The measured frequency range is still within the frequency range of digging activity, therefore this vibration sensor can be applied for oil pipelines vandalisation detection system.

  18. Frequency domain analysis and design of nonlinear systems based on Volterra series expansion a parametric characteristic approach

    CERN Document Server

    Jing, Xingjian

    2015-01-01

    This book is a systematic summary of some new advances in the area of nonlinear analysis and design in the frequency domain, focusing on the application oriented theory and methods based on the GFRF concept, which is mainly done by the author in the past 8 years. The main results are formulated uniformly with a parametric characteristic approach, which provides a convenient and novel insight into nonlinear influence on system output response in terms of characteristic parameters and thus facilitate nonlinear analysis and design in the frequency domain.  The book starts with a brief introduction to the background of nonlinear analysis in the frequency domain, followed by recursive algorithms for computation of GFRFs for different parametric models, and nonlinear output frequency properties. Thereafter the parametric characteristic analysis method is introduced, which leads to the new understanding and formulation of the GFRFs, and nonlinear characteristic output spectrum (nCOS) and the nCOS based analysis a...

  19. Compact field programmable gate array-based pulse-sequencer and radio-frequency generator for experiments with trapped atoms

    Energy Technology Data Exchange (ETDEWEB)

    Pruttivarasin, Thaned, E-mail: thaned.pruttivarasin@riken.jp [Quantum Metrology Laboratory, RIKEN, Wako-shi, Saitama 351-0198 (Japan); Katori, Hidetoshi [Quantum Metrology Laboratory, RIKEN, Wako-shi, Saitama 351-0198 (Japan); Innovative Space-Time Project, ERATO, JST, Bunkyo-ku, Tokyo 113-8656 (Japan); Department of Applied Physics, Graduate School of Engineering, The University of Tokyo, Bunkyo-ku, Tokyo 113-8656 (Japan)

    2015-11-15

    We present a compact field-programmable gate array (FPGA) based pulse sequencer and radio-frequency (RF) generator suitable for experiments with cold trapped ions and atoms. The unit is capable of outputting a pulse sequence with at least 32 transistor-transistor logic (TTL) channels with a timing resolution of 40 ns and contains a built-in 100 MHz frequency counter for counting electrical pulses from a photo-multiplier tube. There are 16 independent direct-digital-synthesizers RF sources with fast (rise-time of ∼60 ns) amplitude switching and sub-mHz frequency tuning from 0 to 800 MHz.

  20. Phase unwrapping algorithm based on multi-frequency fringe projection and fringe background for fringe projection profilometry

    International Nuclear Information System (INIS)

    Zhang, Chunwei; Zhao, Hong; Gu, Feifei; Ma, Yueyang

    2015-01-01

    A phase unwrapping algorithm specially designed for the phase-shifting fringe projection profilometry (FPP) is proposed. It combines a revised dual-frequency fringe projectionalgorithm and a proposed fringe background based quality guided phase unwrapping algorithm (FB-QGPUA). Phase demodulated from the high-frequency fringe patterns is partially unwrapped by that demodulated from the low-frequency ones. Then FB-QGPUA is adopted to further unwrap the partially unwrapped phase. Influences of the phase error on the measurement are researched. Strategy to select the fringe pitch is given. Experiments demonstrate that the proposed method is very robust and efficient. (paper)

  1. Student production: making a realistic stereo CG short film in six months

    Science.gov (United States)

    Ramasamy, Celambarasan

    2010-02-01

    This paper breaks down the R&D and production challenges faced on a stereoscopic CG short film that was developed on a six month time budget. Using this film as an example, the manner in which technical innovation and story telling techniques can be used to emphasize the strengths and hide the weaknesses of a limited timeframe student production is discussed.

  2. First Impressions of a Scintrex CG-6 Portable Gravimeter in an Extensive Field Campaign

    Science.gov (United States)

    van Westrum, D.; Kanney, J.

    2017-12-01

    First Impressions of a Scintrex CG-6 Portable Gravimeter in an Extensive Field Campaign AGU Fall Meeting 2017 Derek van Westrum and Jeff Kanney NOAA's National Geodetic Survey conducted its third and final Geoid Slope Validation Survey (GSVS) this past summer in the rugged mountains of southern Colorado. In addition to leveling, long period GPS, and defelction of vertical observations, absolute gravity and vertical gravity gradients were measured at 235 bench marks (approximately 1.5 km spacing) along US-160 between Durango and Walsenburg, Colorado. In previous surveys (Texas-2011 and Iowa-2014), an A10 absolute gravimeter was used to measure graivty at approximately 10-15% of the bench marks. The remaining marks were determined by using LaCoste & Romberg relative gravimeters. The same relative instruments were also used to measure two-tier (linear) vertical gravity gradients at the A10 sites. In the current work - becuase of the rapidly changing terrain in the Rocky Mountains - it was decided to employ the A10 at all 235 bench marks, and acquire three-tier (quadratic) gradients at every bench mark using the new Scintrex CG-6 Autograv relative gravimeter. Using these results, we will provide a real worldsummary of the CG-6's behavior by examining noise levels, repeatability, and acquisition rates. In addition, the coincident A10 absolute data set allows us to evaluate the CG-6's accuracy, and allows us to simulate and discuss various relative gravity survey designs.

  3. Empty follicle syndrome after GnRHa triggering versus hCG triggering in COS

    DEFF Research Database (Denmark)

    Castillo, Juan C; Garcia-Velasco, Juan; Humaidan, Peter

    2012-01-01

    This study aimed to explore the incidence of empty follicle syndrome (EFS) in oocyte donors who had final oocyte maturation triggered with GnRHa and to compare the incidence of EFS in this group of patients with IVF patients who had final oocyte maturation with hCG....

  4. Targeted therapy of renal cell carcinoma: synergistic activity of cG250-TNF and IFNg.

    NARCIS (Netherlands)

    Bauer, S.; Oosterwijk-Wakka, J.C.; Adrian, N.; Oosterwijk, E.; Fischer, E.; Wuest, T.; Stenner, F.; Perani, A.; Cohen, L.; Knuth, A.; Divgi, C.; Jager, D.; Scott, A.M.; Ritter, G.; Old, L.J.; Renner, C.

    2009-01-01

    Immunotherapeutic targeting of G250/Carbonic anhydrase IX (CA-IX) represents a promising strategy for treatment of renal cell carcinoma (RCC). The well characterized human-mouse chimeric G250 (cG250) antibody has been shown in human studies to specifically enrich in CA-IX positive tumors and was

  5. Pre-evacuation hCG glycoforms in uneventful complete hydatidiform mole and persistent trophoblastic disease.

    NARCIS (Netherlands)

    Thomas, C.M.G.; Kerkmeijer, L.G.W.; Ariaens, H.J.; Steen, R. van der; Massuger, L.F.A.G.; Sweep, F.C.

    2010-01-01

    OBJECTIVE: To investigate whether the glycoform distribution patterns of human chorionic gonadotropin (hCG) obtained by chromatofocusing in pre-evacuation serum are different for patients who will eventually develop into persistent trophoblastic disease in case of complete hydatidiform mole

  6. Prediction of late failure after medical abortion from serial beta-hCG measurements and ultrasonography

    DEFF Research Database (Denmark)

    Rørbye, C; Nørgaard, M; Nilas, Lisbeth

    2004-01-01

    BACKGROUND: Surgical treatment of failed medical abortion may be performed several weeks after initiation of the abortion. There are no recognized methods for early identification of these late failures. We assessed the prognostic values of beta-hCG and ultrasonography in predicting late failure ...

  7. Methotrexate treatment in progressive tubal ectopic pregnancies and hCG-related clinicosurgical implications

    Directory of Open Access Journals (Sweden)

    Askin Dogan

    2016-06-01

    Full Text Available Our aim was to evaluate the relationship between the success of methotrexate treatment and β-hCG levels in progressive tubal ectopic pregnancies. We defined a retrospective cohort of 394 progressive tubal ectopic pregnancy patients treated with methotrexate. A single-dose methotrexate protocol using 50 mg/m2 was administered to patients with progressive tubal ectopic pregnancy. Surgery was performed in patients who exhibited signs of acute abdomen due to tubal rupture. Of 394 patients that received methotrexate treatment, 335 (84.6% responded to medical treatment, while the remaining 59 (15.36% underwent surgery due to treatment failure. β-hCG levels in the failure group were significantly higher as compared with the success group at Day 1, Day 4, and Day 7 (2116±3157 vs. 4178±3422, 2062±3551 vs. 4935±4103, and 1532±3007 vs. 3900±4783, respectively. The receiver operating characteristics curve for β-hCG levels at Day 1 was 0.738, with a cutoff value of 1418 mIU/mL, while sensitivity and specificity values reached the optimum for treatment success (83.1% and 59.4%, respectively. Medical treatment with methotrexate achieved an 85.02% success rate for the treatment of progressive tubal ectopic pregnancy, while success rates for medical treatment decreased significantly when initial β-hCG levels were >1418 mIU/mL.

  8. Vaginal Fluid hCG Levels for Detecting Premature Rupture of Membranes

    Directory of Open Access Journals (Sweden)

    T. Artimani

    2004-04-01

    Full Text Available The aim of this study was to determine whether there is any different in hCG levels of vaginal fluids from normal pregnant women, women with confirmed PROM and with suspected PROM. After irrigating the posterior vaginal fornix with 3 ml of sterile saline and procuring vaginal washing , we measured hCG levels. Samples were analyzed from 38 normal pregnant women , 31 women with confirmed PROM , 28 women with suspected PROM. The mean of vaginal fluid hCG levels of normal pregnant women were 11.2 (0.00-98.6 mIu/ml. That of women with PROM was 140.2 (0.5 , 390.1 and that of women with suspected PROM was 21.5 (0.0 , 143.9. Sensivity was 80%, specility 83% , positive predictive value 73.7% , negative predictive value 88.1% , using a cut-value 20. It was concluded that the hCG level in vaginal fluid is a marker of PROM during third trimester.

  9. Data of evolutionary structure change: 1CG8B-1OUTA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available DHKQI >HHHH -- HHHH> ATOM 1228 C...ryIDChain>1OUTA FWGKISGKADVV ucture>HHHHHGGGHHHH...1CG8B GKHQE-IGVDT >HHHHH- G... >HHHH > ATOM 631 CA ASP A 86 48...ure>G - re> ATOM 329 CA PHE A 43 34.744

  10. Bridging CAGD knowledge into CAD/CG applications: Mathematical theories as stepping stones of innovations

    Science.gov (United States)

    Gobithaasan, R. U.; Miura, Kenjiro T.; Hassan, Mohamad Nor

    2014-07-01

    Computer Aided Geometric Design (CAGD) which surpasses the underlying theories of Computer Aided Design (CAD) and Computer Graphics (CG) has been taught in a number of Malaysian universities under the umbrella of Mathematical Sciences' faculty/department. On the other hand, CAD/CG is taught either under the Engineering or Computer Science Faculty. Even though CAGD researchers/educators/students (denoted as contributors) have been enriching this field of study by means of article/journal publication, many fail to convert the idea into constructive innovation due to the gap that occurs between CAGD contributors and practitioners (engineers/product/designers/architects/artists). This paper addresses this issue by advocating a number of technologies that can be used to transform CAGD contributors into innovators where immediate impact in terms of practical application can be experienced by the CAD/CG practitioners. The underlying principle of solving this issue is twofold. First would be to expose the CAGD contributors on ways to turn mathematical ideas into plug-ins and second is to impart relevant CAGD theories to CAD/CG to practitioners. Both cases are discussed in detail and the final section shows examples to illustrate the importance of turning mathematical knowledge into innovations.

  11. EDA-BASED ESTIMATION OF VISUAL ATTENTION BY OBSERVATION OF EYE BLINK FREQUENCY

    OpenAIRE

    Sakai, Tsugunosuke; Tamaki, Haruya; Ota, Yosuke; Egusa, Ryohei; Inagaki, Shigenori; Kusunoki, Fusako; Sugimoto, Masanori; Mizoguchi, Hiroshi

    2017-01-01

    This paper describes the relationship between visual attention and eye blink frequency. In an experiment, we prompted the activation of a subject's visual attention and examined the influence of visual attention (as measured using electrodermal activity (EDA), which is meaningfully correlated with visual attention) on the subject's eye blink frequency. Experimental results show that engagement of visual attention decreased eye blink frequency and that when visual attention was not activated, ...

  12. Relationship of metabolic syndrome and its components with -844 G/A and HindIII C/G PAI-1 gene polymorphisms in Mexican children

    Directory of Open Access Journals (Sweden)

    De la Cruz-Mosso Ulises

    2012-03-01

    Full Text Available Abstract Background Several association studies have shown that -844 G/A and HindIII C/G PAI-1 polymorphisms are related with increase of PAI-1 levels, obesity, insulin resistance, glucose intolerance, hypertension and dyslipidemia, which are components of metabolic syndrome. The aim of this study was to analyze the allele and genotype frequencies of these polymorphisms in PAI-1 gene and its association with metabolic syndrome and its components in a sample of Mexican mestizo children. Methods This study included 100 children with an age range between 6-11 years divided in two groups: a 48 children diagnosed with metabolic syndrome and b 52 children metabolically healthy without any clinical and biochemical alteration. Metabolic syndrome was defined as the presence of three or more of the following criteria: fasting glucose levels ≥ 100 mg/dL, triglycerides ≥ 150 mg/dL, HDL-cholesterol th percentile, systolic blood pressure (SBP and diastolic blood pressure (DBP ≥ 95th percentile and insulin resistance HOMA-IR ≥ 2.4. The -844 G/A and HindIII C/G PAI-1 polymorphisms were analyzed by PCR-RFLP. Results For the -844 G/A polymorphism, the G/A genotype (OR = 2.79; 95% CI, 1.11-7.08; p = 0.015 and the A allele (OR = 2.2; 95% CI, 1.10-4.43; p = 0.015 were associated with metabolic syndrome. The -844 G/A and A/A genotypes were associated with increase in plasma triglycerides levels (OR = 2.6; 95% CI, 1.16 to 6.04; p = 0.02, decrease in plasma HDL-cholesterol levels (OR = 2.4; 95% CI, 1.06 to 5.42; p = 0.03 and obesity (OR = 2.6; 95% CI, 1.17-5.92; p = 0.01. The C/G and G/G genotypes of the HindIII C/G polymorphism contributed to a significant increase in plasma total cholesterol levels (179 vs. 165 mg/dL; p = 0.02 in comparison with C/C genotype. Conclusions The -844 G/A PAI-1 polymorphism is related with the risk of developing metabolic syndrome, obesity and atherogenic dyslipidemia, and the HindIII C/G PAI-1 polymorphism was associated with the

  13. School-Based Racial and Gender Discrimination among African American Adolescents: Exploring Gender Variation in Frequency and Implications for Adjustment

    OpenAIRE

    Cogburn, Courtney D.; Chavous, Tabbye M.; Griffin, Tiffany M.

    2011-01-01

    The present study examined school-based racial and gender discrimination experiences among African American adolescents in Grade 8 (n = 204 girls; n = 209 boys). A primary goal was exploring gender variation in frequency of both types of discrimination and associations of discrimination with academic and psychological functioning among girls and boys. Girls and boys did not vary in reported racial discrimination frequency, but boys reported more gender discrimination experiences. Multiple reg...

  14. High-power dual-wavelength external-Cavity diode laser based on tapered amplifier with tunable terahertz frequency difference

    DEFF Research Database (Denmark)

    Chi, Mingjun; Jensen, Ole Bjarlin; Petersen, Paul Michael

    2011-01-01

    Tunable dual-wavelength operation of a diode laser system based on a tapered diode amplifier with double-Littrow external-cavity feedback is demonstrated around 800nm. The two wavelengths can be tuned individually, and the frequency difference of the two wavelengths is tunable from 0.5 to 5:0 THz......, this is the highest output power from a dual-wavelength diode laser system operating with tunable terahertz frequency difference. © 2011 Optical Society of America....

  15. Enhancing interaural-delay-based extents of laterality at high frequencies by using ``transposed stimuli''

    Science.gov (United States)

    Bernstein, Leslie R.; Trahiotis, Constantine

    2003-06-01

    An acoustic pointing task was used to determine whether interaural temporal disparities (ITDs) conveyed by high-frequency ``transposed'' stimuli would produce larger extents of laterality than ITDs conveyed by bands of high-frequency Gaussian noise. The envelopes of transposed stimuli are designed to provide high-frequency channels with information similar to that conveyed by the waveforms of low-frequency stimuli. Lateralization was measured for low-frequency Gaussian noises, the same noises transposed to 4 kHz, and high-frequency Gaussian bands of noise centered at 4 kHz. Extents of laterality obtained with the transposed stimuli were greater than those obtained with bands of Gaussian noise centered at 4 kHz and, in some cases, were equivalent to those obtained with low-frequency stimuli. In a second experiment, the general effects on lateral position produced by imposed combinations of bandwidth, ITD, and interaural phase disparities (IPDs) on low-frequency stimuli remained when those stimuli were transposed to 4 kHz. Overall, the data were fairly well accounted for by a model that computes the cross-correlation subsequent to known stages of peripheral auditory processing augmented by low-pass filtering of the envelopes within the high-frequency channels of each ear.

  16. Word frequencies in written and spoken English based on the British National Corpus

    CERN Document Server

    Leech, Geoffrey; Wilson, Andrew (All Of Lancaster University)

    2014-01-01

    Word Frequencies in Written and Spoken English is a landmark volume in the development of vocabulary frequency studies. Whereas previous books have in general given frequency information about the written language only, this book provides information on both speech and writing. It not only gives information about the language as a whole, but also about the differences between spoken and written English, and between different spoken and written varieties of the language. The frequencies are derived from a wide ranging and up-to-date corpus of English: the British Na

  17. Exfoliated BN shell-based high-frequency magnetic core-shell materials.

    Science.gov (United States)

    Zhang, Wei; Patel, Ketan; Ren, Shenqiang

    2017-09-14

    The miniaturization of electric machines demands high frequency magnetic materials with large magnetic-flux density and low energy loss to achieve a decreased dimension of high rotational speed motors. Herein, we report a solution-processed high frequency magnetic composite (containing a nanometal FeCo core and a boron nitride (BN) shell) that simultaneously exhibits high electrical resistivity and magnetic permeability. The frequency dependent complex initial permeability and the mechanical robustness of nanocomposites are intensely dependent on the content of BN insulating phase. The results shown here suggest that insulating magnetic nanocomposites have potential for application in next-generation high-frequency electric machines with large electrical resistivity and permeability.

  18. "hCG priming" effect in controlled ovarian stimulation through a long protocol

    Directory of Open Access Journals (Sweden)

    Antsaklis Aris

    2009-08-01

    Full Text Available Abstract Background Recently, it has been demonstrated that, in patients down-regulated by GnRH analogues (GnRHa, a short-term pre-treatment with recombinant LH (rLH, prior to recombinant FSH (rFSH administration, increases the number of small antral follicle prior to FSH stimulation and the yield of normally fertilized embryos. However, no data exist in the literature regarding the potential beneficial effect of "hCG priming" in controlled ovarian hyperstimulation (COH through a long GnRH-a protocol, which binds the same receptor (LH/hCGR, though it is a much more potent compared to LH. The primary aims of this study were to assess the effect of short-term pre-rFSH administration of hCG in women entering an ICSI treatment cycle on follicular development, quality of oocytes and early embryo development. The secondary endpoints were to record the effects on endometrial quality and pregnancy rate. Methods Patients with a history of at least one previous unsuccessful ICSI cycle were randomly assigned into two groups to receive treatment with either a long protocol with rFSH (control group or a long protocol with rFSH and pre-treatment with hCG (hCG group. In particular, in the latter group, a fixed 7 days course of 200 IU/day hCG was administered as soon as pituitary desensitization was confirmed. Results The mean number of oocytes retrieved was not significantly different between the two treatment groups, although the percentage of mature oocytes tended to be higher but not significantly different in hCG-treated patients. The percentage of patients with more than one grade 3 embryos was higher in the pre-treatment group, which also showed a higher pregnancy rate. Conclusion All the above clinical observations, in conjunction with previous data, suggest a point towards a beneficial "hCG priming" effect in controlled ovarian hyperstimulation through a long GnRH-a down-regulation protocol, particularly in patients with previous ART failures.

  19. Nano-optomechanical system based on microwave frequency surface acoustic waves

    Science.gov (United States)

    Tadesse, Semere Ayalew

    Cavity optomechnics studies the interaction of cavity confined photons with mechanical motion. The emergence of sophisticated nanofabrication technology has led to experimental demonstrations of a wide range of novel optomechanical systems that exhibit strong optomechanical coupling and allow exploration of interesting physical phenomena. Many of the studies reported so far are focused on interaction of photons with localized mechanical modes. For my doctoral research, I did experimental investigations to extend this study to propagating phonons. I used surface travelling acoustic waves as the mechanical element of my optomechanical system. The optical cavities constitute an optical racetrack resonator and photonic crystal nanocavity. This dissertation discusses implementation of this surface acoustic wave based optomechanical system and experimental demonstrations of important consequences of the optomechanical coupling. The discussion focuses on three important achievements of the research. First, microwave frequency surface acoustic wave transducers were co-integrated with an optical racetrack resonator on a piezoelectric aluminum nitride film deposited on an oxidized silicon substrate. Acousto-optic modulation of the resonance modes at above 10 GHz with the acoustic wavelength significantly below the optical wavelength was achieved. The phase and modal matching conditions in this paradigm were investigated for efficient optmechanical coupling. Second, the optomechanical coupling was pushed further into the sideband resolved regime by integrating the high frequency surface acoustic wave transducers with a photonic crystal nanocavity. This device was used to demonstrate optomecahnically induced transparency and absorption, one of the interesting consequences of cavity optomechanics. Phase coherent interaction of the acoustic wave with multiple nanocavities was also explored. In a related experiment, the photonic crystal nanoscavity was placed inside an acoustic

  20. Uncertainties of flood frequency estimation approaches based on continuous simulation using data resampling

    Science.gov (United States)

    Arnaud, Patrick; Cantet, Philippe; Odry, Jean

    2017-11-01

    Flood frequency analyses (FFAs) are needed for flood risk management. Many methods exist ranging from classical purely statistical approaches to more complex approaches based on process simulation. The results of these methods are associated with uncertainties that are sometimes difficult to estimate due to the complexity of the approaches or the number of parameters, especially for process simulation. This is the case of the simulation-based FFA approach called SHYREG presented in this paper, in which a rainfall generator is coupled with a simple rainfall-runoff model in an attempt to estimate the uncertainties due to the estimation of the seven parameters needed to estimate flood frequencies. The six parameters of the rainfall generator are mean values, so their theoretical distribution is known and can be used to estimate the generator uncertainties. In contrast, the theoretical distribution of the single hydrological model parameter is unknown; consequently, a bootstrap method is applied to estimate the calibration uncertainties. The propagation of uncertainty from the rainfall generator to the hydrological model is also taken into account. This method is applied to 1112 basins throughout France. Uncertainties coming from the SHYREG method and from purely statistical approaches are compared, and the results are discussed according to the length of the recorded observations, basin size and basin location. Uncertainties of the SHYREG method decrease as the basin size increases or as the length of the recorded flow increases. Moreover, the results show that the confidence intervals of the SHYREG method are relatively small despite the complexity of the method and the number of parameters (seven). This is due to the stability of the parameters and takes into account the dependence of uncertainties due to the rainfall model and the hydrological calibration. Indeed, the uncertainties on the flow quantiles are on the same order of magnitude as those associated with