WorldWideScience

Sample records for barley hordeum vulgare

  1. High capacity of plant regeneration from callus of interspecific hybrids with cultivated barley (Hordeum vulgare L.)

    DEFF Research Database (Denmark)

    Bagger Jørgensen, Rikke; Jensen, C. J.; Andersen, B.

    1986-01-01

    Callus was induced from hybrids between cultivated barley (Hordeum vulgare L. ssp. vulgare) and ten species of wild barley (Hordeum L.) as well as from one backcross line ((H. lechleri .times. H. vulgare) .times. H. vulgare). Successful callus induction and regeneration of plants were achieved from...

  2. FERTILIZING BREWING BARLEY (Hordeum vulgare L.

    Directory of Open Access Journals (Sweden)

    I. Kádár

    2000-12-01

    Full Text Available Four levels of N, P and K nutrition (poor, moderate, satisfactory and high and all their possible combinations with 64 treatments in two replications (128 plots were studied in a long term field trial on barley yield and malting quality. A standard East-European spring barley "Opal" (bred in Czechoslovakia was grown in 1986, 13th year of the agricultural experiment, involving various crops in previous years, on a calcareous loamy chernozem soil. The optimum fertility levels for yield enhancement resulted in the poorest malting quality: low modification and extract but long saccharification time and high protein. To solve this problem the brewing industry will have to apply the well-known technological methods available since growers are not likely to give up their fertilizers. Applying soil and plant analysis data, having knowledge about both soil and plant optimum values, the danger of the excessive use of fertilizers can be realized and decreased.

  3. Development and Meiosis of Three Interspecific Hybrids with Cultivated Barley (Hordeum vulgare L.)

    DEFF Research Database (Denmark)

    Von Bothmer, R.; Flink, J.; Linde-Laursen, Ib

    1986-01-01

    The development and meiosis of three interspecific hybrids between cultivated barley (Hordeum vulgare L.) and H. secalinum Schreb., H. tetraploidum Covas, and H. parodii Covas, respectively, were studied. All three hybrid combinations developed very slowly vegetatively. Meiosis of the hybrids...

  4. Nitrate Uptake into Barley (Hordeum vulgare) Plants 1

    Science.gov (United States)

    Deane-Drummond, Celia E.; Glass, Anthony D. M.

    1982-01-01

    Evidence is presented that chlorate is an extremely good analog for nitrate during nitrate uptake by intact barley (Hordeum vulgare cv. Fergus) roots. The depletion of ClO3− or NO3− from uptake media over 2 to 6 hours by seedlings was found to be dependent on combined NO3− plus ClO3− concentrations, and total anion uptake was equivalent at different NO3−/ClO3− ratios. After loading barley seedlings with 36ClO3− for 6 hours, kinetic parameters were derived from the analysis of efflux of [36Cl] chlorate into unlabeled solution. On the basis of this analysis, the half times for exchange for the cytoplasmic and vacuolar phases were 17 minutes and 20 hours, respectively. Data pooled from a number of different experiments were used to calculate kinetic constants (Km and Vmax) for 36ClO3− influx into barley roots at different external ClO3−/NO3− ratios, using short (10 minutes) influx times. There appeared to be no discrimination by the root cells between ClO3− and NO3−. Lineweaver-Burk analysis of the interaction between nitrate and chlorate were characteristic of competitive inhibition at low nitrate concentrations (0-0.5 mm). At higher concentrations, in the range of >1 mm, similar interactions between these ions were evident. PMID:16662478

  5. Genetic dissection of grain beta-glucan and amylose content in barley (Hordeum vulgare L.)

    Science.gov (United States)

    High beta glucan (BG) barleys (Hordeum vulgare L.) have major potential as food ingredients due to the well know health benefits. Quantitative trait loci (QTLs) associated with BG have been reported in hulled barley, however no QTL studies have been reported in hulless barley. In this study, QTL an...

  6. Malt quality of 4 barley ( Hordeum vulgare L.) grain varieties grown ...

    African Journals Online (AJOL)

    Malt quality of 4 barley ( Hordeum vulgare L.) grain varieties grown under low ... Thousand-kernel malting weight loss (TKMWL) was 11 to 13% and is in the ... and refined wheat flour starch as a substrate (1:29) showed a reduction in peak ...

  7. Quantitative trait locus analysis of nitrogen use efficiency in barley (Hordeum vulgare L.)

    NARCIS (Netherlands)

    Kindu, G.A.; Tang, J.; Yin, X.; Struik, P.C.

    2014-01-01

    Quantitative trait locus (QTL) analysis of nitrogen use efficiency (NUE) of barley (Hordeum vulgare L.) was conducted on data generated from two pot experiments carried out in 2005 (using four nitrogen rates) and 2008 (with three rates) with AFLP markers and 94 recombinant inbred lines (RILs) of the

  8. Identification of two key genes controlling chill haze stability of beer in barley (Hordeum vulgare L)

    OpenAIRE

    Ye, Lingzhen; Huang, Yuqing; Dai, Fei; Ning, Huajiang; Li, Chengdao; Zhou, Meixue; Zhang, Guoping

    2015-01-01

    Background In bright beer, haze formation is a serious quality problem, degrading beer quality and reducing its shelf life. The quality of barley (Hordeum vulgare L) malt, as the main raw material for beer brewing, largely affects the colloidal stability of beer. Results In this study, the genetic mechanism of the factors affecting beer haze stability in barley was studied. Quantitative trait loci (QTL) analysis of alcohol chill haze (ACH) in beer was carried out using a Franklin/Yerong doubl...

  9. Uzu mutation in barley (Hordeum vulgare L.) reduces the leaf unrolling response to brassinolide.

    Science.gov (United States)

    Honda, Ichiro; Zeniya, Haruko; Yoneyama, Koichi; Chono, Makiko; Kaneko, Shigenobu; Watanabe, Yoshiaki

    2003-05-01

    A sensitive method to examine the brassinolide (BL) response of barley (Hordeum vulgare L.) using dark-grown leaf segments was established based on the known method for wheat. BL responses of 53 dwarf isogenic lines of barley were examined, and two lines were found having a uzu gene that doesn't respond significantly. These results indicate that uzu dwarfism may be caused by the non-responding character to BL.

  10. Complex Interspecific Hybridization in Barley (Hordeum vulgare L.) and the Possible Occurrence of Apomixis

    DEFF Research Database (Denmark)

    Bothmer, R. von; Bengtsson, M.; Flink, J.

    1988-01-01

    Several complex hybrids were produced from the combination [(Hordeum lechleri, 6 .times. .times. H. procerum, 6 .times.) .times. H. vulgare, 2 .times.]. Crosses with six diploid barley lines resulted in triple hybrids, most of which had a full complement of barley chromosomes (no. 1-7), but were ...... is that an unreduced gamete from the amphiploid was fertilized by a normal gamete from the backcross parent, and during early embryo development, some chromosomes were eliminated....

  11. NAC Transcription Factors of Barley (Hordeum vulgare L.) and their Involvement in Leaf Senescence

    DEFF Research Database (Denmark)

    Wagner, Michael

    yielding cereal crops are generated. In cereals, the process of leaf senescence is of utmost relevance when discussing yield. It is during the senescence process that all nutrients are transported from the withering leaf to the developing grains. Furthermore, the timing of senescence determines...... parts of the senescence process. The specific aims of this study were therefore (1) to establish and characterise the NAC transcription factors of the model cereal crop barley (Hordeum vulgare L.) (2) to identify and study putative barley NAC transcription factors involved in the regulation of leaf...

  12. Triple Hybridization with Cultivated Barley (Hordeum vulgare L.)

    DEFF Research Database (Denmark)

    Bothmer, R. von; Claesson, L.; Flink, J.;

    1989-01-01

    represented species closely or distantly related to H. jubatum and H. lechleri. In trispecific crosses with diploid barley, the seed set was 5.7%. Crosses with tetraploid barley were highly unsuccessful (0.2% seed set). Three lines of diploid barley were used in the crosses, i.e. 'Gull', 'Golden Promise...

  13. Agrobacterium-mediated transformation of barley (Hordeum vulgare L.).

    Science.gov (United States)

    Ismagul, Ainur; Mazonka, Iryna; Callegari, Corinne; Eliby, Serik

    2014-01-01

    Barley biotechnology requires efficient genetic engineering tools for producing transgenic plants necessary for conducting reverse genetics analyses in breeding and functional genomics research. Agrobacterium-mediated genetic transformation is an important technique for producing barley transgenics with simple low-copy number transgenes. This chapter reports a refined protocol for the systematic high-throughput transformation of the advanced Australian spring barley breeding line WI4330.

  14. Characterization of senscence-associated NAC transcription factors in Barley (Hordeum Vulgare L.)

    DEFF Research Database (Denmark)

    Podzimska, Dagmara Agata

    the senescence process has been extensively studied in the model plant Arabidopsis, knowledge about the molecular mechanism driving senescence in crop plants is still limited. Extending our knowledge about the genes that control senescence in cereals is very important for future improvement of agronomic traits......, such as yield, biomass production and nutrient quality, and NAC (NAM, ATAF1/2 and CUC2) transcription factors are promising targets for the breeding. The aim of this thesis was thus to assess the role of NAC transcription factors in regulation of senescence in barley (Hordeum vulgare L.) and to contribute...

  15. Identification of a phytase gene in barley (Hordeum vulgare L..

    Directory of Open Access Journals (Sweden)

    Fei Dai

    Full Text Available BACKGROUND: Endogenous phytase plays a crucial role in phytate degradation and is thus closely related to nutrient efficiency in barley products. The understanding of genetic information of phytase in barley can provide a useful tool for breeding new barley varieties with high phytase activity. METHODOLOGY/PRINCIPAL FINDINGS: Quantitative trait loci (QTL analysis for phytase activity was conducted using a doubled haploid population. Phytase protein was purified and identified by the LC-ESI MS/MS Shotgun method. Purple acid phosphatase (PAP gene was sequenced and the position was compared with the QTL controlling phytase activity. A major QTL for phytase activity was mapped to chromosome 5 H in barley. The gene controlling phytase activity in the region was named as mqPhy. The gene HvPAP a was mapped to the same position as mqPhy, supporting the colinearity between HvPAP a and mqPhy. CONCLUSIONS/SIGNIFICANCE: It is the first report on QTLs for phytase activity and the results showed that HvPAP a, which shares a same position with the QTL, is a major phytase gene in barley grains.

  16. Isolating Barley (Hordeum vulgare L.) B1 Hordein Gene Promoter ...

    African Journals Online (AJOL)

    Yomi

    2012-04-10

    Apr 10, 2012 ... region of B1 hordein gene was isolated from the genomic DNA of Walfajre and Alger barley by ... plasmid DNA extraction kits were provided from Bioneer ... The E. coli competent cells were used for transformation by 5 µL of.

  17. Characterization of Gibberellin Receptor Mutants of Barley (Hordeum vulgare L.)

    Institute of Scientific and Technical Information of China (English)

    Peter M.Chandler; Carol A.Harding; Anthony R.Ashton; Mark D.Mulcair; Nicholas E.Dixon; Lewis N.Mander

    2008-01-01

    The sequence of Gidl (a gene for a gibberellin (GA) receptor from rice) was used to identify a putative orthoIogue from barley.This was expressed in E.coil,and produced a protein that was able to bind GA in vitro with both structural specificity and saturability.Its potential role in GA responses was investigated using barley mutants with reduced GA sensitivity (gsel mutants).Sixteen different gsel mutants each carried a unique nucleotide substitution in this sequence.In all but one case,these changes resulted in single amino acid substitutions,and,for the remaining mutant,a substitution in the 5' untranslated region of the mRNA is proposed to interfere with translation initiation.There was perfect linkage in segregating populations between new mutant alleles and the gsel phenotype,leading to the conclusion that the putative GID1 GA receptor sequence in barley corresponds to the Gsel locus.Determination of endogenous GA contents in one of the mutants revealed enhanced accumulation of bioactive GA1,and a deficit of C20 GA precursors.All of the gsel mutants had reduced sensitivity to exogenous GA3,and to AC94377 (a GA analogue) at concentrations that are normally 'saturating',but,at much higher concentrations,there was often a considerable response.The comparison between barley and rice mutants reveals interesting differences between these two cereal species in GA hormonal physiology.

  18. Latent manganese deficiency increases transpiration in barley (Hordeum vulgare)

    DEFF Research Database (Denmark)

    Hebbern, Christopher Alan; Laursen, Kristian Holst; Ladegaard, Anne Hald

    2009-01-01

    To investigate if latent manganese (Mn) deficiency leads to increased transpiration, barley plants were grown for 10 weeks in hydroponics with daily additions of Mn in the low nM range. The Mn-starved plants did not exhibit visual leaf symptoms of Mn deficiency, but Chl a fluorescence measurements...

  19. Genetic diversity of some Saudi barley (Hordeum Vulgare L ...

    African Journals Online (AJOL)

    enoh

    2012-03-13

    Mar 13, 2012 ... These results could be used for barley germplasm management in terms of biodiversity ... animal feed, malt manufactures and human food. Its importance ... indigenous crop genetic resources of KSA are potentially threatened and ... and Hayes, 2002; Turpeinen et al., 2003; Nevo et al.,. 2005; Chaabane et ...

  20. Pollen grain of barley (Hordeum vulgare L. - pattern of development

    Directory of Open Access Journals (Sweden)

    Maria Charzyńska

    2014-01-01

    Full Text Available Pollen development in barley follows the general pattern established for other species of Poaceae: 1 microspore division occurs at the vacuolate microspore stage with polarly located nucleus; 2 microspore mitosis is immediately followed by phragmoplast and cell plate formation; 3 in consequence or unequal microspore division, the generative cell, at first attached to the pollen wall, is separated from the vegetative cell by a callosic wall; 4 during the postmitotic two-cell stage of development, the vegetative nucleus migrates to the aperture pole and is followed by the generative cell that is detached and free of callose wall. In this position the generative cell divides into two sperm cells. These data do not confirm the interpretation of pollen grain development in barley given by Cass and Karas in Can. J. Bot. 53: 1051-1062, 1975.

  1. Differential Antioxidative Responses to Water Deficit Among four Barley (Hordeum vulgare L. Genotypes

    Directory of Open Access Journals (Sweden)

    Z Amini

    2013-08-01

    Full Text Available Future climate changes are expected to increase risks of drought, which already represent the most common stress factor for stable barley (Hordeum vulgare L. production in Iran. Up to now, extensive research projects have been done to study effects of drought stress on the antioxidant enzyme activity. While there is a few works of such studies on the field condition. In order to study of water deficit effects on the antioxidant enzymes activities as a secondary stress, we evaluate the effects of mild and severe drought stress on activities of antioxidative enzymes including superoxide dismutases, ascorbate peroxidase, catalase and peroxidase, among four barley genotypes, differing in the capacity to maintain the grain yield under drought condition during beginning on anthesis, kernel watery ripe and late milk stages under field condition. Results showed that drought increased the activity of antioxidant enzymes in all genotypes. At beginning of anthesis, POX activity of Q22 was higher than it in other genotypes ( P

  2. Abscisic acid effects on activity and expression of barley (Hordeum vulgare) plastidial glucose-6-phosphate dehydrogenase.

    Science.gov (United States)

    Cardi, Manuela; Chibani, Kamel; Cafasso, Donata; Rouhier, Nicolas; Jacquot, Jean-Pierre; Esposito, Sergio

    2011-07-01

    Total glucose-6-phosphate dehydrogenase (G6PDH) activity, protein abundance, and transcript levels of G6PDH isoforms were measured in response to exogenous abscisic acid (ABA) supply to barley (Hordeum vulgare cv Nure) hydroponic culture. Total G6PDH activity increased by 50% in roots treated for 12 h with exogenous 0.1 mM ABA. In roots, a considerable increase (35%) in plastidial P2-G6PDH transcript levels was observed during the first 3 h of ABA treatment. Similar protein variations were observed in immunoblotting analyses. In leaves, a 2-fold increase in total G6PDH activity was observed after ABA treatment, probably related to an increase in the mRNA level (increased by 50%) and amount of protein (increased by 85%) of P2-G6PDH. Together these results suggest that the plastidial P2-isoform plays an important role in ABA-treated barley plants.

  3. Zinc Blotting Assay for Detection of Zinc-Binding Prolamin in Barley (Hordeum vulgare) Grain

    DEFF Research Database (Denmark)

    Uddin, Mohammad Nasir; Langkilde, Ane; Vincze, Éva

    2014-01-01

    In plants, zinc is commonly found bound to proteins. In barley (Hordeum vulgare), major storage proteins are alcohol-soluble prolamins known as hordeins, and some of them have the potential to bind or store zinc. 65Zn overlay and blotting techniques have been widely used for detecting zinc...

  4. The Mystery of Spot Blotch Disease Caused by the Fungal Pathogen Bipolaris sorokiniana on Barley (Hordeum vulgare L)

    DEFF Research Database (Denmark)

    Gjendal, Nele

    The fungal pathogen Bipolaris sorokiniana causes a wide spectrum of diseases including spot blotch disease. To achieve a better understanding of the biology of the fungus, the interaction of B. sorokiniana with the host barley (Hordeum vulgare L) and the resulting disease spot blotch was investig...

  5. The Mystery of Spot Blotch Disease Caused by the Fungal Pathogen Bipolaris sorokiniana on Barley (Hordeum vulgare L)

    DEFF Research Database (Denmark)

    Gjendal, Nele

    The fungal pathogen Bipolaris sorokiniana causes a wide spectrum of diseases including spot blotch disease. To achieve a better understanding of the biology of the fungus, the interaction of B. sorokiniana with the host barley (Hordeum vulgare L) and the resulting disease spot blotch was investig...

  6. Reconstitution of cyanogenesis in barley (Hordeum vulgare L.) and its implications for resistance against the barley powdery mildew fungus.

    Science.gov (United States)

    Nielsen, Kirsten A; Hrmova, Maria; Nielsen, Janni Nyvang; Forslund, Karin; Ebert, Stefan; Olsen, Carl E; Fincher, Geoffrey B; Møller, Birger Lindberg

    2006-04-01

    Barley (Hordeum vulgare L.) produces a leucine-derived cyanogenic beta-D-glucoside, epiheterodendrin that accumulates specifically in leaf epidermis. Barley leaves are not cyanogenic, i.e. they do not possess the ability to release hydrogen cyanide, because they lack a cyanide releasing beta-D-glucosidase. Cyanogenesis was reconstituted in barley leaf epidermal cells through single cell expression of a cDNA encoding dhurrinase-2, a cyanogenic beta-D-glucosidase from sorghum. This resulted in a 35-60% reduction in colonization rate by an obligate parasite Blumeria graminis f. sp. hordei, the causal agent of barley powdery mildew. A database search for barley homologues of dhurrinase-2 identified a (1,4)-beta-D-glucan exohydrolase isozyme betaII that is located in the starchy endosperm of barley grain. The purified barley (1,4)-beta-D-glucan exohydrolase isozyme betaII was found to hydrolyze the cyanogenic beta-D-glucosides, epiheterodendrin and dhurrin. Molecular modelling of its active site based on the crystal structure of linamarase from white clover, demonstrated that the disposition of the catalytic active amino acid residues was structurally conserved. Epiheterodendrin stimulated appressoria and appressorial hook formation of B. graminis in vitro, suggesting that loss of cyanogenesis in barley leaves has enabled the fungus to utilize the presence of epiheterodendrin to facilitate host recognition and to establish infection.

  7. Evaluation of Toxic Effects and Bioaccumulation of Cadmium and Copper in Spring Barley (Hordeum vulgare L.

    Directory of Open Access Journals (Sweden)

    Jūratė Žaltauskaitė

    2013-07-01

    Full Text Available This paper deals with the analysis of toxic effects of cadmium and copper on the growth of spring barley (Hordeum vulgare L. cultivated in hydroponics. The seedlings of barley were treated with four different concentrations of cadmium and copper, ranging from 0.1 to 10 mg L-1. The aim of the study was to assess toxic effects of cadmium (Cd and copper (Cu on the growth of spring barley, and to determine metal accumulation in above-ground and underground parts of the plant. The impact of Cu and Cd on photosynthetic pigments (chlorophyll a, b, the content of malondialdehyde (MDA, and the essential micronutrients (Mn, Fe were examined. Metal treatment reduced the growth of roots (by 60%, shoots (Cd – 48 %, Cu – 57% and dry weight (Cd – 47 %, Cu – 52% of barley. Exposure to metals altered the content of photosynthetic pigments and caused lipid peroxidation. Regression analysis revealed that there was significant negative relationship between MDA content and biomass of barley treated with Cu (r=-0.99, p=0.01. The examined heavy metals were accumulated mainly in the roots and bioconcentration of Cu there was higher than that of Cd, indicating that roots tended to accumulate higher amounts of Cu than Cd. Though translocation of Cd from roots to above-ground tissues was higher, higher levels of Cd were observed in leaves.DOI: http://dx.doi.org/10.5755/j01.erem.64.2.1951

  8. Dawn and Dusk Set States of the Circadian Oscillator in Sprouting Barley (Hordeum vulgare Seedlings.

    Directory of Open Access Journals (Sweden)

    Weiwei Deng

    Full Text Available The plant circadian clock is an internal timekeeper that coordinates biological processes with daily changes in the external environment. The transcript levels of clock genes, which oscillate to control circadian outputs, were examined during early seedling development in barley (Hordeum vulgare, a model for temperate cereal crops. Oscillations of clock gene transcript levels do not occur in barley seedlings grown in darkness or constant light but were observed with day-night cycles. A dark-to-light transition influenced transcript levels of some clock genes but triggered only weak oscillations of gene expression, whereas a light-to-dark transition triggered robust oscillations. Single light pulses of 6, 12 or 18 hours induced robust oscillations. The light-to-dark transition was the primary determinant of the timing of subsequent peaks of clock gene expression. After the light-to-dark transition the timing of peak transcript levels of clock gene also varied depending on the length of the preceding light pulse. Thus, a single photoperiod can trigger initiation of photoperiod-dependent circadian rhythms in barley seedlings. Photoperiod-specific rhythms of clock gene expression were observed in two week old barley plants. Changing the timing of dusk altered clock gene expression patterns within a single day, showing that alteration of circadian oscillator behaviour is amongst the most rapid molecular responses to changing photoperiod in barley. A barley EARLY FLOWERING3 mutant, which exhibits rapid photoperiod-insensitive flowering behaviour, does not establish clock rhythms in response to a single photoperiod. The data presented show that dawn and dusk cues are important signals for setting the state of the circadian oscillator during early development of barley and that the circadian oscillator of barley exhibits photoperiod-dependent oscillation states.

  9. Identification and Expression Analysis of the Barley (Hordeum vulgare L. Aquaporin Gene Family.

    Directory of Open Access Journals (Sweden)

    Runyararo M Hove

    Full Text Available Aquaporins (AQPs are major intrinsic proteins (MIPs that mediate bidirectional flux of water and other substrates across cell membranes, and play critical roles in plant-water relations, dehydration stress responses and crop productivity. However, limited data are available as yet on the contributions of these proteins to the physiology of the major crop barley (Hordeum vulgare. The present work reports the identification and expression analysis of the barley MIP family. A comprehensive search of publicly available leaf mRNA-seq data, draft barley genome data, GenBank transcripts and sixteen new annotations together revealed that the barley MIP family is comprised of at least forty AQPs. Alternative splicing events were likely in two plasma membrane intrinsic protein (PIP AQPs. Analyses of the AQP signature sequences and specificity determining positions indicated a potential of several putative AQP isoforms to transport non-aqua substrates including physiological important substrates, and respond to abiotic stresses. Analysis of our publicly available leaf mRNA-seq data identified notable differential expression of HvPIP1;2 and HvTIP4;1 under salt stress. Analyses of other gene expression resources also confirmed isoform-specific responses in different tissues and/or in response to salinity, as well as some potentially inter-cultivar differences. The work reports systematic and comprehensive analysis of most, if not all, barley AQP genes, their sequences, expression patterns in different tissues, potential transport and stress response functions, and a strong framework for selection and/or development of stress tolerant barley varieties. In addition, the barley data would be highly valuable for genetic studies of the evolutionarily closely related wheat (Triticum aestivum L..

  10. Haploid Barley from the Intergeneric Cross Hordeum vulgare x Psathyrostachys fragilis

    DEFF Research Database (Denmark)

    Bothmer, Roland; Jacobsen, Niels; Bagger Jørgensen, Rikke

    1984-01-01

    The intergeneric hybrid Hordeum vulgare x Psathyrostachys fragilis was fairly easily obtained. During each growing season the intermediate, perennial hybrid yielded haploid tillers of H. vulgare. Late in one season few, hybrid tillers headed. The morphology, cytology and enzymatic patterns...... of hybrid and haploid tillers were investigated....

  11. Non-reciprocal interactions between K+ and Na+ ions in barley (Hordeum vulgare L.)

    Science.gov (United States)

    Kronzucker, Herbert J.; Szczerba, Mark W.; Schulze, Lasse M.; Britto, Dev T.

    2008-01-01

    The interaction of sodium and potassium ions in the context of the primary entry of Na+ into plant cells, and the subsequent development of sodium toxicity, has been the subject of much recent attention. In the present study, the technique of compartmental analysis with the radiotracers 42K+ and 24Na+ was applied in intact seedlings of barley (Hordeum vulgare L.) to test the hypothesis that elevated levels of K+ in the growth medium will reduce both rapid, futile Na+ cycling at the plasma membrane, and Na+ build-up in the cytosol of root cells, under saline conditions (100 mM NaCl). We reject this hypothesis, showing that, over a wide (400-fold) range of K+ supply, K+ neither reduces the primary fluxes of Na+ at the root plasma membrane nor suppresses Na+ accumulation in the cytosol. By contrast, 100 mM NaCl suppressed the cytosolic K+ pool by 47–73%, and also substantially decreased low-affinity K+ transport across the plasma membrane. We confirm that the cytosolic [K+]:[Na+] ratio is a poor predictor of growth performance under saline conditions, while a good correlation is seen between growth and the tissue ratios of the two ions. The data provide insight into the mechanisms that mediate the toxic influx of sodium across the root plasma membrane under salinity stress, demonstrating that, in the glycophyte barley, K+ and Na+ are unlikely to share a common low-affinity pathway for entry into the plant cell. PMID:18562445

  12. The Influence of Processing by Impulse Pressure on the Productivity of the Don Barley (Hordeum vulgare L.

    Directory of Open Access Journals (Sweden)

    Pavlova Violetta Aleksandrovna

    2014-04-01

    Full Text Available Plant productivity is the important indicator, which determines the amount of yield. The productivity of plants depends on the number of bruchids per plant and on the weight of 1000 bruchids. The article studies the influence of impulse pressure of various magnitudes on plant productivity of Don barley (Hordeum vulgare L.. It was found that the pressure of 17 MPa was the most effective for increasing the productivity. Impulse pressure of other magnitudes also had influence on the productivity of Don barley.

  13. Identification of two key genes controlling chill haze stability of beer in barley (Hordeum vulgare L).

    Science.gov (United States)

    Ye, Lingzhen; Huang, Yuqing; Dai, Fei; Ning, Huajiang; Li, Chengdao; Zhou, Meixue; Zhang, Guoping

    2015-06-11

    In bright beer, haze formation is a serious quality problem, degrading beer quality and reducing its shelf life. The quality of barley (Hordeum vulgare L) malt, as the main raw material for beer brewing, largely affects the colloidal stability of beer. In this study, the genetic mechanism of the factors affecting beer haze stability in barley was studied. Quantitative trait loci (QTL) analysis of alcohol chill haze (ACH) in beer was carried out using a Franklin/Yerong double haploid (DH) population. One QTL, named as qACH, was detected for ACH, and it was located on the position of about 108 cM in chromosome 4H and can explain about 20 % of the phenotypic variation. Two key haze active proteins, BATI-CMb and BATI-CMd were identified by proteomics analysis. Bioinformatics analysis showed that BATI-CMb and BATI-CMd had the same position as qACH in the chromosome. It may be deduced that BATI-CMb and BATI-CMd are candidate genes for qACH, controlling colloidal stability of beer. Polymorphism comparison between Yerong and Franklin in the nucleotide and amino acid sequence of BATI-CMb and BATI-CMd detected the corresponding gene specific markers, which could be used in marker-assisted selection for malt barley breeding. We identified a novel QTL, qACH controlling chill haze of beer, and two key haze active proteins, BATI-CMb and BATI-CMd. And further analysis showed that BATI-CMb and BATI-CMd might be the candidate genes associated with beer chill haze.

  14. Further molecular evidence for the Hordeum vulgare ssp. spontaneum in Tibet as ultimate progenitor of Chinese cultivated barley

    Institute of Scientific and Technical Information of China (English)

    2005-01-01

    106 accessions of Tibetan wild barley, including 50 accessions of the two-rowed wild barley Hordeum vulgare ssp. spontaneum(HS), 27 accessions of the six-rowed bottle-shaped wild barley H. lagunculiforme(HL) and 29 accessions of the six-rowed wild barley H. agriocrithon(HA) that separately represent different agrigeographical regions of Tibet, were used to study the genetic diversity and genetic differentiation using SSR markers selected from seven barley linkage groups. 229 allelic variants were identified with an average of 7.6 alleles/locus. The average of total number of alleles per locus in HA(6.4) is much higher than that in HS(3.9) and HL(3.4). The genetic diversity and its standard deviation among the three subspecies were in the order of HS>HL>HA. Very significant genetic differentiation was observed among the three subspecies of wild barley. Comparisons of the results from this and previous studies showed a strong Oriental-Occidental differentiation of barley, and that Shannan region of Tibet might be the center of origin of the Tibetan two-rowed wild barley, thus supporting not only the hypothesis of a mono-phyletic origin of cultivated barley but also the proposition that the Tibetan two-rowed wild barley as ultimate progenitor of Chinese cultivated barley.

  15. Hordein Variation in Wild (Hordeum Spontaneum) and Cultivated (H. Vulgare) Barley

    DEFF Research Database (Denmark)

    Doll, Hans; Brown, A. H. D.

    1979-01-01

    The storage protein hordein contains two major groups of polypeptides which are highly polymorphic in barley, and in its evolutionary progenitor Hordeum spontaneum Koch. Crosses between the two species showed that the complex electrophoretic phenotypes within the two groups of polypeptides are go...

  16. Characterization of barley (Hordeum vulgare L. NAC transcription factors suggests conserved functions compared to both monocots and dicots

    Directory of Open Access Journals (Sweden)

    Gregersen Per L

    2011-08-01

    Full Text Available Abstract Background The NAC transcription factor family is involved in the regulation of traits in both monocots and dicots of high agronomic importance. Understanding the precise functions of the NAC genes can be of utmost importance for the improvement of cereal crop plants through plant breeding. For the cereal crop plant barley (Hordeum vulgare L. only a few NAC genes have so far been investigated. Results Through searches in publicly available barley sequence databases we have obtained a list of 48 barley NAC genes (HvNACs with 43 of them representing full-length coding sequences. Phylogenetic comparisons to Brachypodium, rice, and Arabidopsis NAC proteins indicate that the barley NAC family includes members from all of the eight NAC subfamilies, although by comparison to these species a number of HvNACs still remains to be identified. Using qRT-PCR we investigated the expression profiles of 46 HvNACs across eight barley tissues (young flag leaf, senescing flag leaf, young ear, old ear, milk grain, late dough grain, roots, and developing stem and two hormone treatments (abscisic acid and methyl jasmonate. Conclusions Comparisons of expression profiles of selected barley NAC genes with the published functions of closely related NAC genes from other plant species, including both monocots and dicots, suggest conserved functions in the areas of secondary cell wall biosynthesis, leaf senescence, root development, seed development, and hormone regulated stress responses.

  17. Cloning and Characterization of Purple Acid Phosphatase Phytases from Wheat (Triticum aestivum L.), Barley (Hordeum vulgare L.), Maize (Zea maize L.) and Rice (Oryza sativa L.)

    DEFF Research Database (Denmark)

    Dionisio, Giuseppe; Madsen, Claus Krogh; Holm, Preben Bach;

    2011-01-01

    Barley (Hordeum vulgare L.) and wheat (Triticum aestivum L.) possess a significant phytase activity in the mature grains. Maize (Zea mays L.) and rice (Oryza sativa L.) possess little or virtually no pre-formed phytase activity in the mature grain and depend fully on de novo synthesis during...

  18. Efficient production of tetraploid barley (Hordeum vulgare L. by colchicine treatment of diploid barley

    Directory of Open Access Journals (Sweden)

    Ayed Sourour

    2014-03-01

    Full Text Available An experiment was conducted to induce tetraploidy in three diploid barley varieties (Martin, Rihane and Manel through different colchicines treatments. Colchicine was added for three different concentrations at three different stages of plant development i.e. on seed (0.05% for 48 hours, on pre-germinated seeds (0.1% for 2 hours and on three leaf stage (0.1% for 16 hours. Colchicine application reduced significantly germination percentage and viability of plants. Seed germination was completely inhibited in Martin, while a reduction of 20% and 30% for germination percentage compared to control was recorded in varieties Manel and Rihane, respectively at 0.1% colchicine concentration. Ploidy evaluation showed no tetraploidy in all the three tested varieties by colchicine application of 0.05% for 48 hours on seeds and 0.1% for 2 hours on pre-germinated seeds. However, tetraploid plants were produced only by treatment with 0.1% for 16 hours of seedlings. The percentages of plants were 40%, 44% and 100% for Rihane, Manel and Martin, respectively. Cytological analyses showed the increase of chromosome numbers from 2n=2x=14 to 2n=4x=28. The increase of ploidy levels caused major changes in some morphological traits. In fact, the induced tetraploids in barley was accompanied by significant (P<0.01 decrease in plant height, tiller height, leaf number and leaf length compared to diploid control plants. colchicine treatment induce successfully the production of tetraploid barley plants and could be used in breeding programs.

  19. Estimation of Barley (Hordeum Vulgare L. Crop Water Requirements Using Cropwat Software in Ksar-Chellala Region, Algeria

    Directory of Open Access Journals (Sweden)

    M. B. Laouisset

    2016-09-01

    Full Text Available This paper estimates the reference Evapotranspiration (ET0 and Water requirements of barley (Hordeum vulgare L. in Ksar-Chellala region, Algeria, for one dry year by using CROPWAT software. Determination of Evapotranspiration ( ET is important in application such as irrigation design, irrigation scheduling, water resource management, hydrology and cropping systems modeling. Estimation of crop water requirements of barley ( CWR b respected the methodology adopted by the service of development and management service of FAO, based on the use of software CROPWAT 8.0. The total water requirements for barley depend on a variety of target yields and crops management. The period of climatic data used is 23 years (1990-2012, the average rain in this period is 254 mm. The total rain of the dry year is 190 mm. The results of this study show, during the vegetative cycle of barley which is 6 months, the calculation of ET 0 is 453 mm, the potential water which was used by the crop barley is estimated at 281.4 mm, the efficiency of rainfall is 69 mm and a total water requirements of barley ( CWR b equals to 211 mm, this amount distributed on three months coincided with important stages of development in barley. The supplementary irrigation in these conditions with optimal contents equals water requirements estimated by CROPWAT software that increases significantly grain yield of barely. Consequently, the gross irrigation water requirements ( GIWR of 1250000 ha which project to grow barley in the Algerian steppes regions are estimated at 3.77 billion and this for a dry year and a irrigation efficiency of 70%.

  20. Barley (Hordeum vulgare L.) low phytic acid 1-1: an endosperm-specific, filial determinant of seed total phosphorus.

    Science.gov (United States)

    Raboy, Victor; Cichy, Karen; Peterson, Kevin; Reichman, Sarah; Sompong, Utumporn; Srinives, Peerasak; Saneoka, Hirofumi

    2014-01-01

    Inositol hexaphosphate (Ins P6 or "phytic acid") typically accounts for 75 (± 10%) of seed total phosphorus (P). In some cases, genetic blocks in seed Ins P6 accumulation can also alter the distribution or total amount of seed P. In nonmutant barley (Hordeum vulgare L.) caryopses, ~80% of Ins P6 and total P accumulate in the aleurone layer, the outer layer of the endosperm, with the remainder in the germ. In barley low phytic acid 1-1 (Hvlpa1-1) seed, both endosperm Ins P6 and total P are reduced (~45% and ~25%, respectively), but germs are phenotypically wild type. This translates into a net reduction in whole-seed total P of ~15%. Nutrient culture studies demonstrate that the reduction in endosperm total P is not due to a reduction in the uptake of P into the maternal plant. Genetic tests (analyses of testcross and F2 seed) reveal that the Hvlpa1-1 genotype of the filial seed conditions the seed total P reduction; sibling seed in the same head of barley that differ in their Hvlpa1-1 genotype (heterozygous vs. homozygous recessive) differ in their total P (normal vs. reduced, respectively). Therefore, Hvlpa1 functions as a seed-specific or filial determinant of barley endosperm total P.

  1. Nitrogen deficiency in barley (Hordeum vulgare) seedlings induces molecular and metabolic adjustments that trigger aphid resistance.

    Science.gov (United States)

    Comadira, Gloria; Rasool, Brwa; Karpinska, Barbara; Morris, Jenny; Verrall, Susan R; Hedley, Peter E; Foyer, Christine H; Hancock, Robert D

    2015-06-01

    Agricultural nitrous oxide (N2O) pollution resulting from the use of synthetic fertilizers represents a significant contribution to anthropogenic greenhouse gas emissions, providing a rationale for reduced use of nitrogen (N) fertilizers. Nitrogen limitation results in extensive systems rebalancing that remodels metabolism and defence processes. To analyse the regulation underpinning these responses, barley (Horedeum vulgare) seedlings were grown for 7 d under N-deficient conditions until net photosynthesis was 50% lower than in N-replete controls. Although shoot growth was decreased there was no evidence for the induction of oxidative stress despite lower total concentrations of N-containing antioxidants. Nitrogen-deficient barley leaves were rich in amino acids, sugars and tricarboxylic acid cycle intermediates. In contrast to N-replete leaves one-day-old nymphs of the green peach aphid (Myzus persicae) failed to reach adulthood when transferred to N-deficient barley leaves. Transcripts encoding cell, sugar and nutrient signalling, protein degradation and secondary metabolism were over-represented in N-deficient leaves while those associated with hormone metabolism were similar under both nutrient regimes with the exception of mRNAs encoding proteins involved in auxin metabolism and responses. Significant similarities were observed between the N-limited barley leaf transcriptome and that of aphid-infested Arabidopsis leaves. These findings not only highlight significant similarities between biotic and abiotic stress signalling cascades but also identify potential targets for increasing aphid resistance with implications for the development of sustainable agriculture.

  2. Overexpression, purification and enzymatic characterization of a recombinant plastidial glucose-6-phosphate dehydrogenase from barley (Hordeum vulgare cv. Nure) roots.

    Science.gov (United States)

    Cardi, Manuela; Chibani, Kamel; Castiglia, Daniela; Cafasso, Donata; Pizzo, Elio; Rouhier, Nicolas; Jacquot, Jean-Pierre; Esposito, Sergio

    2013-12-01

    In plant cells, the plastidial glucose 6-phosphate dehydrogenase (P2-G6PDH, EC 1.1.1.49) represents one of the most important sources of NADPH. However, previous studies revealed that both native and recombinant purified P2-G6PDHs show a great instability and a rapid loss of catalytic activity. Therefore it has been difficult to describe accurately the catalytic and physico-chemical properties of these isoforms. The plastidial G6PDH encoding sequence from barley roots (Hordeum vulgare cv. Nure), devoid of a long plastidial transit peptide, was expressed as recombinant protein in Escherichia coli, either untagged or with an N-terminal his-tag. After purification from both the soluble fraction and inclusion bodies, we have explored its kinetic parameters, as well as its sensitivity to reduction. The obtained results are consistent with values determined for other P2-G6PDHs previously purified from barley roots and from other land plants. Overall, these data shed light on the catalytic mechanism of plant P2-G6PDH, summarized in a proposed model in which the sequential mechanism is very similar to the mammalian cytosolic G6PDH. This study provides a rational basis to consider the recombinant barley root P2-G6PDH as a good model for further kinetic and structural studies.

  3. BAC library resources for map-based cloning and physical map construction in barley (Hordeum vulgare L.

    Directory of Open Access Journals (Sweden)

    Wu Cheng-Cang

    2011-05-01

    Full Text Available Background Although second generation sequencing (2GS technologies allow re-sequencing of previously gold-standard-sequenced genomes, whole genome shotgun sequencing and de novo assembly of large and complex eukaryotic genomes is still difficult. Availability of a genome-wide physical map is therefore still a prerequisite for whole genome sequencing for genomes like barley. To start such an endeavor, large insert genomic libraries, i.e. Bacterial Artificial Chromosome (BAC libraries, which are unbiased and representing deep haploid genome coverage, need to be ready in place. Result Five new BAC libraries were constructed for barley (Hordeum vulgare L. cultivar Morex. These libraries were constructed in different cloning sites (HindIII, EcoRI, MboI and BstXI of the respective vectors. In order to enhance unbiased genome representation and to minimize the number of gaps between BAC contigs, which are often due to uneven distribution of restriction sites, a mechanically sheared library was also generated. The new BAC libraries were fully characterized in depth by scrutinizing the major quality parameters such as average insert size, degree of contamination (plate wide, neighboring, and chloroplast, empty wells and off-scale clones (clones with 250 fragments. Additionally a set of gene-based probes were hybridized to high density BAC filters and showed that genome coverage of each library is between 2.4 and 6.6 X. Conclusion BAC libraries representing >20 haploid genomes are available as a new resource to the barley research community. Systematic utilization of these libraries in high-throughput BAC fingerprinting should allow developing a genome-wide physical map for the barley genome, which will be instrumental for map-based gene isolation and genome sequencing.

  4. Bioaccumulation of cadmium by spring barley (Hordeum vulgare L. and its effect on selected physiological and morphological parameters

    Directory of Open Access Journals (Sweden)

    Miriama Kopernická

    2016-01-01

    Full Text Available Heavy metals and other toxic elements in the environment, mainly located in soil and groundwater, have a significant effect on plant and its productivity that has a huge attention in recent years. Accumulation of heavy metals in soil cause toxicity to plants, and contaminate the food chain. The industrial areas, as well as developing countries have been contaminated with high concentration of heavy metals. Main sources of contamination are mining and other industrial processes, as well as military and or lanfills, sludge dumps or waste disposal sites. The heavy metals are very dangerous to environment and pose serious danger to public health by entering throught the food chain or into drinking water. Phytoextraction is one way how to remove the contaminants from soil by plants. Phytoextraction of heavy metals is a technology that has been studied for several years. It is more ecological and cheaper way how to clean our environment.Several plant species are known becauce they hyperaccumulate a high contents of metals from the soil. The accumulators are mainly herbaceous species, crops and nowadays angiosperm trees with a high growth such as poplars or willows. We have focused on the determination of some morphological (lenght and weight of roots and biomass and physiological (contents of dry mass and number of lief stomata characteristics and the determination of the bioaccumulation factor and the translocation factor of cadmium by spring barley (Hordeum vulgare L.. Imprints of leaves were evaluated using an optical microscope Axiostar Plus, Carl Zeiss, lens CP Achromat 40x/0.65, eyepiece PI 10x / 18, Canon Utilities Software Zoom Browser EX 4.6 and hardware Acer Travel Mate 4600, Canon Power Shot A95. The density of stomata was evaluated on an area of 1 mm2. Samples of the dried plants (leaves and roots were mineralized by acid digestion using microwave digestion device MARS X - press 5. The end of determination to obtain the cadmium content was

  5. Rph22: mapping of a novel leaf rust resistance gene introgressed from the non-host Hordeum bulbosum L. into cultivated barley (Hordeum vulgare L.)

    NARCIS (Netherlands)

    Johnston, P.A.; Niks, R.E.; Meiyalaghan, V.; Blanchet, E.; Pickering, R.

    2013-01-01

    A resistance gene (Rph22) to barley leaf rust caused by Puccinia hordei was introgressed from the non-host species Hordeum bulbosum into cultivated barley. The H. bulbosum introgression in line ‘182Q20’ was located to chromosome 2HL using genomic in situ hybridisation (GISH). Using molecular markers

  6. Purification and characterization of soluble (cytosolic) and bound (cell wall) isoforms of invertases in barley (Hordeum vulgare) elongating stem tissue

    Science.gov (United States)

    Karuppiah, N.; Vadlamudi, B.; Kaufman, P. B.

    1989-01-01

    Three different isoforms of invertases have been detected in the developing internodes of barley (Hordeum vulgare). Based on substrate specificities, the isoforms have been identified to be invertases (beta-fructosidases EC 3.2.1.26). The soluble (cytosolic) invertase isoform can be purified to apparent homogeneity by diethylaminoethyl cellulose, Concanavalin-A Sepharose, organo-mercurial Sepharose, and Sephacryl S-300 chromatography. A bound (cell wall) invertase isoform can be released by 1 molar salt and purified further by the same procedures as above except omitting the organo-mercurial Sepharose affinity chromatography step. A third isoform of invertase, which is apparently tightly associated with the cell wall, cannot be isolated yet. The soluble and bound invertase isoforms were purified by factors of 60- and 7-fold, respectively. The native enzymes have an apparent molecular weight of 120 kilodaltons as estimated by gel filtration. They have been identified to be dimers under denaturing and nondenaturing conditions. The soluble enzyme has a pH optimum of 5.5, Km of 12 millimolar, and a Vmax of 80 micromole per minute per milligram of protein compared with cell wall isozyme which has a pH optimum of 4.5, Km of millimolar, and a Vmax of 9 micromole per minute per milligram of protein.

  7. Limitation of Cell Elongation in Barley (Hordeum vulgare L.) Leaves Through Mechanical and Tissue-Hydraulic Properties.

    Science.gov (United States)

    Touati, Mostefa; Knipfer, Thorsten; Visnovitz, Tamás; Kameli, Abdelkrim; Fricke, Wieland

    2015-07-01

    The aim of the present study was to assess the mechanical and hydraulic limitation of growth in leaf epidermal cells of barley (Hordeum vulgare L.) in response to agents which affect cellular water (mercuric chloride, HgCl(2)) and potassium (cesium chloride, CsCl; tetraethylammonium, TEA) transport, pump activity of plasma membrane H(+)-ATPase and wall acidification (fusicoccin, FC). Cell turgor (P) was measured with the cell pressure probe, and cell osmotic pressure (π) was analyzed through picoliter osmometry of single-cell extracts. A wall extensibility coefficient (M) and tissue hydraulic conductance coefficient (L) were derived using the Lockhart equation. There was a significant positive linear relationship between relative elemental growth rate and P, which fit all treatments, with an overall apparent yield threshold of 0.368 MPa. Differences in growth between treatments could be explained through differences in P. A comparison of L and M showed that growth in all except the FC treatment was co-limited through hydraulic and mechanical properties, though to various extents. This was accompanied by significant (0.17-0.24 MPa) differences in water potential (ΔΨ) between xylem and epidermal cells in the leaf elongation zone. In contrast, FC-treated leaves showed ΔΨ close to zero and a 10-fold increase in L. © The Author 2015. Published by Oxford University Press on behalf of Japanese Society of Plant Physiologists. All rights reserved. For permissions, please email: journals.permissions@oup.com.

  8. Calcium transport in protoplasts isolated from ml-o barley isolines resistant and susceptible to powdery mildew. [Hordeum vulgare L

    Energy Technology Data Exchange (ETDEWEB)

    Wrona, A.F.; Spanswick, R.M.; Aist, J.R. (Cornell Univ., Ithaca, NY (USA))

    1988-12-01

    Free cytoplasmic calcium has been postulated to play a role in preventing powdery mildew in a series of homozygous ml-o mutants of barley, Hordeum vulgare L. Protoplasts isolated from 7-day-old plants of the ml-o resistant-susceptible (R-S) barley isolines, Riso 5678/3* {times} Carlsberg II R and S, were used to test for differences in fluxes of Ca{sup 2+} across the plasmalemma. Greater influx or lesser efflux might account for a higher free cytosolic Ca{sup 2+} postulated to exist in ml-o R mutants. Uniform patterns of uptake were maintained for 3 hours from solutions of 0.2 and 2 millimolar Ca{sup 2+}. Washout curves of {sup 45}Ca{sup 2+} from R and S protoplasts revealed three compartments - presumed to represent release from the vacuole, organelles, and the cytoplasm (which included bound as well as free Ca{sup 2+}). Uptake and washout did not differ between isolines. On the basis of recent determinations of submicromolar levels of free cytoplasmic Ca{sup 2+} and their initial rates of {sup 45}ca-labeled Ca{sup 2+} uptake, they show that measurement of the unidirectional influx of Ca{sup 2+} across the plasmalemma is not feasible because the specific activity of the pool of free cytoplasmic calcium increases almost instantaneously to a level that would result in a significant, but unknown, efflux of label. Similarly, measurement of the efflux of Ca{sup 2+} across the plasmalemma is not possible since the activity of the pool of free cytoplasmic calcium is a factor of 350 smaller than the most rapid component of the washout experiment. This pool of cytoplasmic free Ca{sup 2+} will wash out too rapidly and be too small to detect under the conditions of these experiments.

  9. Effects of Cerium and Titanium Oxide Nanoparticles in Soil on the Nutrient Composition of Barley (Hordeum vulgare L. Kernels

    Directory of Open Access Journals (Sweden)

    Filip Pošćić

    2016-06-01

    Full Text Available The implications of metal nanoparticles (MeNPs are still unknown for many food crops. The purpose of this study was to evaluate the effects of cerium oxide (nCeO2 and titanium oxide (nTiO2 nanoparticles in soil at 0, 500 and 1000 mg·kg−1 on the nutritional parameters of barley (Hordeum vulgare L. kernels. Mineral nutrients, amylose, β-glucans, amino acid and crude protein (CP concentrations were measured in kernels. Whole flour samples were analyzed by ICP-AES/MS, HPLC and Elemental CHNS Analyzer. Results showed that Ce and Ti accumulation under MeNPs treatments did not differ from the control treatment. However, nCeO2 and nTiO2 had an impact on composition and nutritional quality of barley kernels in contrasting ways. Both MeNPs left β-glucans unaffected but reduced amylose content by approximately 21%. Most amino acids and CP increased. Among amino acids, lysine followed by proline saw the largest increase (51% and 37%, respectively. Potassium and S were both negatively impacted by MeNPs, while B was only affected by 500 mg nCeO2·kg−1. On the contrary Zn and Mn concentrations were improved by 500 mg nTiO2·kg−1, and Ca by both nTiO2 treatments. Generally, our findings demonstrated that kernels are negatively affected by nCeO2 while nTiO2 can potentially have beneficial effects. However, both MeNPs have the potential to negatively impact malt and feed production.

  10. Heterologous expression of Hordeum vulgare cysteine protease in yeast

    DEFF Research Database (Denmark)

    Rosenkilde, Anne Lind; Dionisio, Giuseppe; Holm, Preben B

    Cysteine Proteases accounts for more than 90 % of the total proteolytic activity in the degradation of barley seed storage proteins during germination. Several Cysteine proteases have been identified in barley. One of the key enzymes, Hordeum vulgare endoprotease B2 (HvEPB2) was cloned...... for the full length protease...

  11. Heterologous expression of Hordeum vulgare cysteine protease in yeast

    DEFF Research Database (Denmark)

    Rosenkilde, Anne Lind; Dionisio, Giuseppe; Holm, Preben B

    Cysteine Proteases accounts for more than 90 % of the total proteolytic activity in the degradation of barley seed storage proteins during germination. Several Cysteine proteases have been identified in barley. One of the key enzymes, Hordeum vulgare endoprotease B2 (HvEPB2) was cloned with and w...

  12. Effects of Seed Priming on Root Characteristics of Two Barley (Hordeum vulgare L.) Cultivars in Different Levels of Salinity Stress by using Gel Chamber Technique

    OpenAIRE

    H. R Khazaei; A Nezami; B Saadatian; O Armand Pishe

    2015-01-01

    The study was conducted to evaluate the effect of seed priming on root growth of two barley cultivars (Hordeum vulgare L.) under salinity stress was performed in phytogel. The treatments included two cultivars of barely (Yusuf and Maquie), levels of seed priming (control, hydro-priming and priming with 4.35 g l-1 of urea) and four levels of NaCl salinity stress (0, 0.2, 0.3 M). The experiment was conducted in Factorial experiment based on a completely randomized design (CRD) with three replic...

  13. Genetic Transformation of Common Bean (Phaseolus vulgaris L. with the Gus Color Marker, the Bar Herbicide Resistance, and the Barley (Hordeum vulgare HVA1 Drought Tolerance Genes

    Directory of Open Access Journals (Sweden)

    Kingdom Kwapata

    2012-01-01

    Full Text Available Five common bean (Phaseolus vulgaris L. varieties including “Condor,” “Matterhorn,” “Sedona,” “Olathe,” and “Montcalm” were genetically transformed via the Biolistic bombardment of the apical shoot meristem primordium. Transgenes included gus color marker which visually confirmed transgenic events, the bar herbicide resistance selectable marker used for in vitro selection of transgenic cultures and which confirmed Liberty herbicide resistant plants, and the barley (Hordeum vulgare late embryogenesis abundant protein (HVA1 which conferred drought tolerance with a corresponding increase in root length of transgenic plants. Research presented here might assist in production of better P. vulgaris germplasm.

  14. Microarray Analysis of Late Response to Boron Toxicity in Barley (Hordeum vulgare L.) Leaves

    NARCIS (Netherlands)

    Oz, M.T.; Yilmaz, R.; Eyidogan, F.; Graaff, de L.H.; Yucel, M.; Oktem, H.A.

    2009-01-01

    DNA microarrays, being high-density and high-throughput, allow quantitative analyses of thousands of genes and their expression patterns in parallel. In this study, Barley1 GereChip was used to investigate transcriptome changes associated with boron (B) toxicity in a sensitive barley cultivar (Horde

  15. Transformation of Barley (Hordeum vulgar L.) by Agrobacterium tumefasciens Infection of In Vitro Cultured Ovules

    DEFF Research Database (Denmark)

    Holme, Inger Bæksted; Brinch-Pedersen, Henrik; Lange, Mette;

    2012-01-01

    Agrobacterium-mediated transformation of in vitro cultured barley ovules is an attractive alternative to well-established barley transformation methods of immature embryos. The ovule culture system can be used for transformation with and without selection and has successfully been used to transform...

  16. Barley (Hordeum vulgare L.) cysteine proteases: heterologous expression, purification and characterization

    DEFF Research Database (Denmark)

    Rosenkilde, Anne Lind; Dionisio, Giuseppe; Holm, Preben Bach

    2011-01-01

    During germination of barley seeds, mobilization of protein is essential and cysteine proteases accounts for more than 90 % of the total proteolytic activity in the degradation of barley seed storage proteins. Cysteine proteases exist as pro-enzyme and is activated through reduction of the active...

  17. Comparative Proteomic Analysis of Two Barley Cultivars (Hordeum vulgare L.) with Contrasting Grain Protein Content

    Science.gov (United States)

    Guo, Baojian; Luan, Haiye; Lin, Shen; Lv, Chao; Zhang, Xinzhong; Xu, Rugen

    2016-01-01

    Grain protein contents (GPCs) of barley seeds are significantly different between feed and malting barley cultivars. However, there is still no insight into the proteomic analysis of seed proteins between feed and malting barley cultivars. Also, the genetic control of barley GPC is still unclear. GPCs were measured between mature grains of Yangsimai 3 and Naso Nijo. A proteome profiling of differentially expressed protein was established by using a combination of 2-DE and tandem mass spectrometry. In total, 502 reproducible protein spots in barley seed proteome were detected with a pH range of 4–7 and 6–11, among these 41 protein spots (8.17%) were detected differentially expressed between Yangsimai 3 and Naso Nijo. Thirty-four protein spots corresponding to 23 different proteins were identified, which were grouped into eight categories, including stress, protein degradation and post-translational modification, development, cell, signaling, glycolysis, starch metabolism, and other functions. Among the identified proteins, enolase (spot 274) and small subunit of ADP-glucose pyrophosphorylase (spot 271) are exclusively expressed in barley Yangsimai 3, which may be involved in regulating seed protein expression. In addition, malting quality is characterized by an accumulation of serpin protein, Alpha-amylase/trypsin inhibitor CMb and Alpha-amylase inhibitor BDAI-1. Most noticeably, globulin, an important storage protein in barley seed, undergoes post-translational processing in both cultivars, and also displays different expression patterns. PMID:27200019

  18. Heterologous expression and purification of barley (Hordeum vulgare L.) cysteine protease in yeast

    DEFF Research Database (Denmark)

    Rosenkilde, Anne Lind; Dionisio, Giuseppe; Holm, Preben Bach

    2011-01-01

    The mobilization of protein during germination of barley seeds is essential and Cysteine Proteases accounts for more than 90 % of the total proteolytic activity in the degradation of barley seed storage proteins [1]. Cysteine proteases exist as pro-enzyme until activated through reduction...... of the active site cysteines and via removal of the pro-domain. The complement of cysteine proteases is comprehensive and for detailed studies of the individual components of this complement, a fast and efficient eukaryotic expression platform is highly desirable. The barley key cysteine protease, endoprotease...

  19. Population-genetic analysis of HvABCG31 promoter sequence in wild barley (Hordeum vulgare ssp. spontaneum

    Directory of Open Access Journals (Sweden)

    Ma Xiaoying

    2012-09-01

    Full Text Available Abstract Background The cuticle is an important adaptive structure whose origin played a crucial role in the transition of plants from aqueous to terrestrial conditions. HvABCG31/Eibi1 is an ABCG transporter gene, involved in cuticle formation that was recently identified in wild barley (Hordeum vulgare ssp. spontaneum. To study the genetic variation of HvABCG31 in different habitats, its 2 kb promoter region was sequenced from 112 wild barley accessions collected from five natural populations from southern and northern Israel. The sites included three mesic and two xeric habitats, and differed in annual rainfall, soil type, and soil water capacity. Results Phylogenetic analysis of the aligned HvABCG31 promoter sequences clustered the majority of accessions (69 out of 71 from the three northern mesic populations into one cluster, while all 21 accessions from the Dead Sea area, a xeric southern population, and two isolated accessions (one from a xeric population at Mitzpe Ramon and one from the xeric ‘African Slope’ of “Evolution Canyon” formed the second cluster. The southern arid populations included six haplotypes, but they differed from the consensus sequence at a large number of positions, while the northern mesic populations included 15 haplotypes that were, on average, more similar to the consensus sequence. Most of the haplotypes (20 of 22 were unique to a population. Interestingly, higher genetic variation occurred within populations (54.2% than among populations (45.8%. Analysis of the promoter region detected a large number of transcription factor binding sites: 121–128 and 121–134 sites in the two southern arid populations, and 123–128,125–128, and 123–125 sites in the three northern mesic populations. Three types of TFBSs were significantly enriched: those related to GA (gibberellin, Dof (DNA binding with one finger, and light. Conclusions Drought stress and adaptive natural selection may have been important

  20. Evaluation of phytotoxicity effect of olive mill wastewater treated by different technologies on seed germination of barley (Hordeum vulgare L.).

    Science.gov (United States)

    Rusan, Munir J M; Albalasmeh, Ammar A; Zuraiqi, Said; Bashabsheh, Mohammad

    2015-06-01

    Olive-mill wastewater (OMW) is a by-product effluent of olive oil extraction process that is produced in large amount in the Mediterranean region. OMW is believed to induce phytotoxic effect on organisms including seed germination and plant growth. The objective of this study was to evaluate the impact of untreated and treated OMW with different techniques on seed germination of barley (Hordeum vulgare L.). The following treatments were investigated: (1) tap water (control); (2) OMW treated by aerobic biological technology in a Jacto Reactor (JR); (3) OMW treated by solar fenton oxidation (SFO); (4) OMW treated by microfiltration followed by nanofiltration (MF+NF); (5) OMW treated by microfiltration followed by reverse osmosis (MF+RO) process; (6) diluted OMW with tap water (25 % OMW); (7) diluted OMW with tap water (50 % OMW); (8) diluted OMW with tap water (75 % OMW); and (9) untreated OMW (100 % OMW). A germination test was conducted in an incubator at temperature of 23 (∘)C. In each petri dish, a filter paper was mounted and ten seeds of barley were placed on the filter paper. Five milliliter of water were added to each petri dish. The seed germination was determined by counting the number of germinated seeds to calculate the percentage of germination (G %). Germination rate index (GRI), seed vigor index (SVI), and phytotoxicity index (PI) were also calculated. Then, the dry weights and lengths of the shoots and the roots of the germinated seeds were measured. The results show that 100, 75, and 50 %OMW were very phytotoxic and completely prohibited seed germination. However, phytotoxicity decreased significantly following treatments of OMW with all techniques investigated and by the 25 % OMW dilution, as results of removing the phenols and other phytotoxic organic compounds from the OMW or by diluting it. This was evidenced by relative enhancement of the dry weights and lengths of shoot and root as well as the G %, GRI, SVG, and PI. It was concluded that if

  1. [Hordein locus polymorphism of cultivated barley (Hordeum vulgare L.) in Turkey].

    Science.gov (United States)

    Pomortsev, A A; Martynov, S P; Lialina, E V

    2007-11-01

    Starch gel electrophoresis has been used to study the polymorphism of hordeins encoded by the Hrd A, Hrd B, and Hrd F loci in 93 landrace specimens of barley assigned to 17 ancient provinces located in modem Turkey. Forty-five alleles of Hrd A with frequencies of 0.11-29.34%, 51 alleles of Hrd B with frequencies of 0.11-8.07%, and 5 alleles of Hrd F with frequencies of 0.75-41.29% have been detected. Cluster analysis of the matrix of allele frequencies has demonstrated that barley populations from different old provinces of Turkey are similar to one another. Cluster structure of local barley populations has been found, most populations (82%) falling into three clusters. The first cluster comprises barley populations from six provinces (Thracia, Bithynia, Pontus, Lydia, Cappadocia, and Armenia); the second cluster, populations from five provinces (Paphlagonia, Galatia, Lycaonia, Cilicia, and Mesopotamia); and the third one, populations from three provinces (Phrygia, Karia, and Lycia). Barley populations from Mysia, Pamphlya, and Syria do not fall in any cluster.

  2. Review:Aluminium tolerance in barley (Hordeum vulgare L.): physiological mechanisms, genetics and screening methods

    Institute of Scientific and Technical Information of China (English)

    WANG Jun-ping; RAMAN Harsh; ZHANG Guo-ping; MENDHAM Neville; ZHOU Mei-xue

    2006-01-01

    Aluminium (Al) toxicity is one of the major limiting factors for barley production on acid soils. It inhibits root cell division and elongation, thus reducing water and nutrient uptake, consequently resulting in poor plant growth and yield. Plants tolerate Al either through external resistance mechanisms, by which Al is excluded from plant tissues or internal tolerance mechanisms, conferring the ability of plants to tolerate Al ion in the plant symplasm where Al that has permeated the plasmalemma is sequestered or converted into an innocuous form. Barley is considered to be most sensitive to Al toxicity among cereal species. Al tolerance in barley has been assessed by several methods, such as nutrient solution culture, soil bioassay and field screening. Genetic and molecular mapping research has shown that Al tolerance in barley is controlled by a single locus which is located on chromosome 4H. Molecular markers linked with Al tolerance loci have been identified and validated in a range of diverse populations. This paper reviews the (1) screening methods for evaluating Al tolerance, (2) genetics and (3) mechanisms underlying Al tolerance in barley.

  3. Important Quality Attributes of Malt Barley (Hordeum vulgare L. ): Effect of Genetics, Environments and Agronomic Factors

    Institute of Scientific and Technical Information of China (English)

    Virender Sardana; ZHANG Guo-ping

    2003-01-01

    Barley has been in use as food and fodder for thousands of years, and also used currently as themost important raw material in malting and brewing. The quality of malt barley is not much satisfied with therequirement by malting and brewing industry worldwide, although the great effort has been devoted to its im-provement through breeding and agronomy. The quality of malt barley is involved in many physical and chemi-cal traits, including hydrolytic enzymes. Of them, kernel protein content, beta-amylase activity, beta-glucancontent and kernel plumpness have dramatic influence on malting or brewing quality. The expression of thesequality parameters varies greatly in genotypes and is easily changed by diverse environments and agronomicpractices. This paper reviewed the important role of various parameters influencing the quality of malt barleyand the effect of different factors on them.

  4. Proteomic analysis of differences in barley (Hordeum vulgare) malts with distinct filterability by DIGE.

    Science.gov (United States)

    Jin, Zhao; Li, Xiao-Min; Gao, Fei; Sun, Jun-Yong; Mu, Yu-Wen; Lu, Jian

    2013-11-20

    Filterability is an essential quality parameter of barley malt and significantly impacts productive efficiency and quality of beer. In the study, differences of metabolic capability, rather than of initial contents of macromolecules in barleys, were found to be the main reason for malt filterability gap between the widely used cultivars Dan'er and Metcalfe in China. Comparative proteomics based on fluorescent difference gel electrophoresis (DIGE) was employed to quantitatively analyze proteins of four commercial malts belonging to the two cultivars, and 51 cultivar-differential spots were identified to 40 metabolic proteins by MALDI-TOF/TOF mass spectrometry, mainly including hydrolases and pathogen-related proteins. According to their function analysis and abundance comparison between cultivars, filterability-beneficial and -adverse proteins were putatively proposed. Two most remarkable differential proteins, β-amylase and serpin Z7, were further investigated to verify their effects on Dan'er malt filterability. These results provide biological markers for barley breeders and maltsters to improve malt filterability. To the best of our knowledge, this is the first report of comprehensive investigation of metabolic proteins related to wort filterability of barley malts, and sheds light on clues for filterability improvement. Visible differences in the expression level of metabolic proteins between Dan'er and Metcalfe malts using 2D-DIGE signify a valuable tool for cultivar comparison, illustration of key proteins responsible for filterability and even other qualities of barley malts. And with these explorations on biomarkers of malt filterability and other aspects, there will be higher efficiency and quality of beer brewing, less application of exogenous hydrolases and more expending market for Chinese malting barleys. This article is part of a Special Issue entitled: Translational Plant Proteomics. Copyright © 2013 Elsevier B.V. All rights reserved.

  5. A weed suppressive index for spring barley (Hordeum vulgare) varieties

    DEFF Research Database (Denmark)

    Hansen, P K; Kristensen, K; Willas, J

    2008-01-01

    successfully developed a method for indexing the weed suppressive ability of spring barley varieties. The suppressive index ranged from 12% in Lux and 55% in Modena in proportion to the 90% quantile coverage of all varieties. The index was validated against independent data from two locations in 2005 with 14...

  6. Risk assessment by sowing date for barley (Hordeum vulgare) in northern Ethiopia

    NARCIS (Netherlands)

    Berhe, A.A.; Stroosnijder, L.; Habtu, S.; Keesstra, S.D.; Berhe, M.; Hadgu Meles, K.

    2012-01-01

    Risks of dry and wet sowing methods of rainfed barley were evaluated in northern Ethiopia. The evaluation was based on yield simulation using a validated AquaCrop model. Risks of failure (false start) were assessed by taking biomass threshold levels (

  7. Barley (Hordeum vulgare L.) inositol monophosphatase: gene structure and enzyme characteristics

    Science.gov (United States)

    The de novo synthesis of myo-inositol (Ins) is catalyzed by two enzymatic activities; Ins(3)P1 synthase (MIPS; EC. 5.5.1.4) and Ins monophosphatase (IMPase; EC 3.1.3.25). The barley IMP-1 gene and gene products were studied to facilitate research into the regulation of Ins synthesis and supply. In m...

  8. Frequency of Aneuploids in Progenies of Autotriploid Barley, Hordeum Vulgare L

    DEFF Research Database (Denmark)

    Sandfær, J.

    1979-01-01

    Chromosome counts of 863 progeny plants originating from 68 autotriploid barley plants revealed a considerable variation in chromosome numbers ranging from the diploid number (2n= 14) to 2n= 39. The most frequent groups were plants with 15 and 16 chromosomes each constituting about 27% of all pro...

  9. Risk assessment by sowing date for barley (Hordeum vulgare) in northern Ethiopia

    NARCIS (Netherlands)

    Berhe, A.A.; Stroosnijder, L.; Habtu, S.; Keesstra, S.D.; Berhe, M.; Hadgu Meles, K.

    2012-01-01

    Risks of dry and wet sowing methods of rainfed barley were evaluated in northern Ethiopia. The evaluation was based on yield simulation using a validated AquaCrop model. Risks of failure (false start) were assessed by taking biomass threshold levels (

  10. CLIMATE CHANGE IN CENTRAL MEXICO: IMPACT ON BARLEY PRODUCTION (Hordeum vulgare IN TLAXCALA

    Directory of Open Access Journals (Sweden)

    Joel O. Calderón-García

    2015-07-01

    Full Text Available Historical production of barley for ten years (2003-2012 as well as under climate change scenarios for near future (2015-2039 and for near future (2075-2099 in Calpulalpan, Tlaxcala was evaluated. An assessment of suitable regions for production was performed as well as historical performance and barley considering future climate change scenarios through the model AquaCrop (FAO also was estimated. Finally, the average production costs in the region were estimated through surveys with barley producers. The results show that over 70% of the area of the municipality has some degree of aptitude for producing barley. Climate change scenarios indicate increases proficiency in 2% of the surface and reductions of up to 16%. The production model shows very close results with those obtained by farmers in the municipality yields (2.53 t/ha, thus estimated future changes show a decline in yields of about 5% up to 100% depending on the future horizon. Considering current production costs, the benefit-cost relationship could be reduced from 1.4 and to 0.0 in the future. This will certainly affect the economy of the producers in the region.

  11. AFLP marker linked to water-stress-tolerant bulks in barley (Hordeum vulgare L.

    Directory of Open Access Journals (Sweden)

    A. Altinkut

    2003-01-01

    Full Text Available The amplified fragment length polymorphism (AFLP assay is an efficient method for the identification of molecular markers, useful in the improvement of numerous crop species. Bulked Segregant Analysis (BSA was used to identify AFLP markers associated with water-stress tolerance in barley, as this would permit rapid selection of water-stress tolerant genotypes in breeding programs. AFLP markers linked to water-stress tolerance was identified in two DNA pools (tolerant and sensitive, which were established using selected F2 individuals resulting from a cross between water-stress-tolerant and sensitive barley parental genotypes, based on their paraquat (PQ tolerance, leaf size, and relative water content (RWC. All these three traits were previously shown to be associated with water-stress tolerance in segregating F2 progeny of the barley cross used in a previous study. AFLP analysis was then performed on these DNA pools, using 40 primer pairs to detect AFLP fragments that are present/absent, respectively, in the two pools and their parental lines. One separate AFLP fragment, which was present in the tolerant parent and in the tolerant bulk, but absent in the sensitive parent and in the sensitive bulk, was identified. Polymorphism of the AFLP marker was tested among tolerant and sensitive F2 individuals. The presence of this marker that is associated with water-stress tolerance will greatly enhance selection for paraquat and water-stress tolerant genotypes in future breeding programs.

  12. Genetic evaluation of barley (Hordeum vulgare L. germplasm for resistance components of spot blotch disease

    Directory of Open Access Journals (Sweden)

    Tejveer Singh, V. K. Mishra*, L. C. Prasad, Ankitand R. Chand

    2014-06-01

    Full Text Available Spot blotch caused by Bipolaris sorokiniana is an important fungal disease of Barley in warm humid areas of the world. In present study, 124 genotypes that includes 122 un-adapted germplasm accessions and 2 cultivars of barley were evaluated for three years, to select resistant and susceptible accessions based on five components of spot blotch resistance viz., disease severity, latent period, spore load, number of spots and incubation period. Significant differences were observed among the evaluated accessions for all of the components of resistance. A significant positive correlation was recorded between disease severity, number of spots, and spore load while a significant negative correlation of disease severity was recorded with latent period and incubation period. Multiple regression analysis revealed that number of spots contributed maximum followed by latent period, spore load and incubation period towards the variation in disease severity. Clustering of accessions based on different components identified three groups. Based on the studied components, accessions BCU422, BCU1204 and BCU5092 demonstrated good performance, while BCU711, K603 and RD2506 were the most susceptible to spot blotch pathogen. Identified accessions BCU422, BCU1204 and BCU5092 can be recommended for use in breeding programs that aim to generate barley genotypes resistant to Bipolaris sorokiniana.

  13. The composite water and solute transport of barley (Hordeum vulgare) roots: effect of suberized barriers.

    Science.gov (United States)

    Ranathunge, Kosala; Kim, Yangmin X; Wassmann, Friedrich; Kreszies, Tino; Zeisler, Viktoria; Schreiber, Lukas

    2017-03-01

    Roots have complex anatomical structures, and certain localized cell layers develop suberized apoplastic barriers. The size and tightness of these barriers depend on the growth conditions and on the age of the root. Such complex anatomical structures result in a composite water and solute transport in roots. Development of apoplastic barriers along barley seminal roots was detected using various staining methods, and the suberin amounts in the apical and basal zones were analysed using gas chromatography-mass spectometry (GC-MS). The hydraulic conductivity of roots ( Lp r ) and of cortical cells ( Lp c ) was measured using root and cell pressure probes. When grown in hydroponics, barley roots did not form an exodermis, even at their basal zones. However, they developed an endodermis. Endodermal Casparian bands first appeared as 'dots' as early as at 20 mm from the apex, whereas a patchy suberin lamellae appeared at 60 mm. The endodermal suberin accounted for the total suberin of the roots. The absolute amount in the basal zone was significantly higher than in the apical zone, which was inversely proportional to the Lp r . Comparison of Lp r and Lp c suggested that cell to cell pathways dominate for water transport in roots. However, the calculation of Lp r from Lp c showed that at least 26 % of water transport occurs through the apoplast. Roots had different solute permeabilities ( P sr ) and reflection coefficients ( σ sr ) for the solutes used. The σ sr was below unity for the solutes, which have virtually zero permeability for semi-permeable membranes. Suberized endodermis significantly reduces Lp r of seminal roots. The water and solute transport across barley roots is composite in nature and they do not behave like ideal osmometers. The composite transport model should be extended by adding components arranged in series (cortex, endodermis) in addition to the currently included components arranged in parallel (apoplastic, cell to cell pathways).

  14. Cuticular permeance in relation to wax and cutin development along the growing barley (Hordeum vulgare) leaf.

    Science.gov (United States)

    Richardson, Andrew; Wojciechowski, Tobias; Franke, Rochus; Schreiber, Lukas; Kerstiens, Gerhard; Jarvis, Mike; Fricke, Wieland

    2007-05-01

    The developing leaf three of barley provides an excellent model system for the direct determination of relationships between amounts of waxes and cutin and cuticular permeance. Permeance of the cuticle was assessed via the time-course of uptake of either toluidine blue or (14)C-labelled benzoic acid ([(14)C] BA) along the length of the developing leaf. Toluidine blue uptake only occurred within the region 0-25 mm from the point of leaf insertion (POLI). Resistance--the inverse of permeance--to uptake of [(14)C] BA was determined for four leaf regions and was lowest in the region 10-20 mm above POLI. At 20-30 and 50-60 mm above POLI, it increased by factors of 6 and a further 32, respectively. Above the point of emergence of leaf three from the sheath of leaf two, which was 76-80 mm above POLI, resistance was as high as at 50-60 mm above POLI. GC-FID/MS analyses of wax and cutin showed that: (1) the initial seven fold increase in cuticular resistance coincided with increase in cutin coverage and appearance of waxes; (2) the second, larger and final increase in cuticle resistance was accompanied by an increase in wax coverage, whereas cutin coverage remained unchanged; (3) cutin deposition in barley leaf epidermis occurred in parallel with cell elongation, whereas deposition of significant amounts of wax commenced as cells ceased to elongate.

  15. Some Root Traits of Barley (Hordeum vulgare L. as Affected by Mycorrhizal Symbiosis under Drought Stress

    Directory of Open Access Journals (Sweden)

    R. Bayani

    2016-05-01

    Full Text Available The effect of drought stress and mycorrhizal symbiosis on the colonization, root and leaf phosphorous content, root and leaf phosphatase activity, root volume and area as well as shoot dry weight of a variety of hulless barley were evaluated using a completely randomized experimental design (CRD with 3 replications. Treatments were three levels of drought stress of 30, 60 and 90% field capacity and two levels of mycorrhizal with and without inoculation. According to the results, the highest value of leaf phosphorous (1.54 mg/g was observed at mycorrhizal symbiosis against severe drought treatment. Root phosphatase activity was highest (297.9 OD min -1 FW-1 at severe drought stress with mycorrhizal symbiosis which in comparison with mild stress in the presence of mycorrhiza showed 16.6 fold increasing. The control and non-mycorrhizal symbiosis treatments had highest root dry weight (0.091 g. The lowest root volume (0.016 cm2 observed at mycorrhizal symbiosis × severe drought treatment. Generally, Inoculation of barley seed with mycorrhiza at severe water stress could transport more phosphorous to shoot, especially leaf via inducing of leaf and root phosphatase activity. Also, in addition to supply of nutrient sources especially phosphorous for plant, mycorrhizal symbiosis could play an important role in withstanding water stress in plant via increasing of root dry weight and area.

  16. Plant regeneration by pollen embryogenesis from cultured whole spikes of barley (Hordeum vulgare).

    Science.gov (United States)

    Datta, S K

    1987-05-01

    Pollen embryogenesis and subsequent plant regeneration have been established from cultured whole barley spikes in agitated N6 liquid medium (Chu 1978) containing high levels of 2,4-D, Ficoll and potato extract. Microspore division within the anthers and subsequent embryogenic development were obtained in medium containing high amounts of reduced nitrogen with Zeatin, NAA and BAP (all at 0.5 mg/l levels, pH 6.2). Once embryoids were formed in the liquid medium, they produced secondary embryoids from the scutellum and subsequently plants on MS (Murashige and Skoog 1962) agar medium containing BAP and NAA. The ratio of green plants to albino was 1∶8.7.

  17. Barley (Hordeum vulgare L. yield with normal and coated urea in Pintag, Quito, Ecuador.

    Directory of Open Access Journals (Sweden)

    Andrea C. Lema-Aguirre

    2016-12-01

    Full Text Available The objective of this investigation was to evaluate the response of barley production to nitrogenized fertilization (NF and its impact on the protein content of the grain and the availability of nutrients on the soil. The study was carried out in two sites in Hacienda Valencia, in Pintag, Quito, Ecuador, between March 2014 and February 2015. A variety of INIAP Cañicapa 2003 was used, and the NF was done with normal urea and polymerized (urea + tiophosphate of N-nbutiltriamida. An experimental design of randomized full blocks in four repetitions of divided lots [the urea (normal and polymerized was used in the main lot and the NF (0, 30, 60, 90, 120, y 150 kg N/ha in the sub-lot]. 110 kg/ha of seed was used; 50% of the NF was applied three weeks after planting (broadcast and 50% eight weeks after. The type of urea did not affect the production (p>0,10, although the average was different between two sites (4,33 y 2,08 t/ha for sites 1 and 2, respectively. Excess of rain could have limit the effect on the urea type. On average a cuadratic response to NF was obtined, with an optimum dose of N (DON of 90 kg N/ha and a production of 3,41 t/ ha. This DON was similar to the dose of N recomended for barley in Ecuador. The NF augmented the protein content up to 14,50% (p<0,01 and acidi ed the ground, because the urea nitri cation produces H+.

  18. In vitro influences of TiO₂ nanoparticles on barley (Hordeum vulgare L.) tissue culture.

    Science.gov (United States)

    Mandeh, Mahnaz; Omidi, Mansoor; Rahaie, Mahdi

    2012-12-01

    In the last decades, extensive research on the effects of nano-TiO₂ on plant systems and different microorganisms has confirmed its photocatalytic and antimicrobial activity. However, there is no report on its application in plant cell and tissue culture as well as its role in eliminating contaminating microorganisms in tissue culture. In this work, barley mature embryos were cultured in Murashige and Skoog medium with four concentrations (0, 10, 30, 60 μg/ml) of TiO₂ suspension in four repetitions. Quantitative and qualitative characteristics of calli were analyzed after each subculture. Data analysis for calli number in the first culture and callus size in all three cultures showed that the effect of treatment was significant at p > 0.95. As a result, quantitative features such as callus color, shape, embryogenesis, etc. were completely similar in both control and TiO₂ nanoparticle treatments; there is no doubt that TiO₂ nanoparticles could dramatically increase callugenesis and the size of calli. As well, TiO₂ nanoparticles are effective bactericides with an aseptic effect, causing no negative change in the quality of the callus. It is necessary to do more complementary works to identify mechanisms involved for the increased calli size and embryogenesis of explants in darkness.

  19. Quantification of the tissue-culture induced variation in barley (Hordeum vulgare L.

    Directory of Open Access Journals (Sweden)

    Bednarek Piotr T

    2007-03-01

    Full Text Available Abstract Background When plant tissue is passaged through in vitro culture, many regenerated plants appear to be no longer clonal copies of their donor genotype. Among the factors that affect this so-called tissue culture induced variation are explant genotype, explant tissue origin, medium composition, and the length of time in culture. Variation is understood to be generated via a combination of genetic and/or epigenetic changes. A lack of any phenotypic variation between regenerants does not necessarily imply a concomitant lack of genetic (or epigenetic change, and it is therefore of interest to assay the outcomes of tissue culture at the genotypic level. Results A variant of methylation sensitive AFLP, based on the isoschizomeric combinations Acc65I/MseI and KpnI/MseI was applied to analyze, at both the sequence and methylation levels, the outcomes of regeneration from tissue culture in barley. Both sequence mutation and alteration in methylation pattern were detected. Two sets of regenerants from each of five DH donor lines were compared. One set was derived via androgenesis, and the other via somatic embryogenesis, developed from immature embryos. These comparisons delivered a quantitative assessment of the various types of somaclonal variation induced. The average level of variation was 6%, of which almost 1.7% could be accounted for by nucleotide mutation, and the remainder by changes in methylation state. The nucleotide mutation rates and the rate of epimutations were substantially similar between the andro- and embryo-derived sets of regenerants across all the donors. Conclusion We have developed an AFLP based approach that is capable of describing the qualitative and quantitative characteristics of the tissue culture-induced variation. We believe that this approach will find particular value in the study of patterns of inheritance of somaclonal variation, since non-heritable variation is of little interest for the improvement of plant

  20. Low-resolution structure of the full-length barley (Hordeum vulgare SGT1 protein in solution, obtained using small-angle X-ray scattering.

    Directory of Open Access Journals (Sweden)

    Michał Taube

    Full Text Available SGT1 is an evolutionarily conserved eukaryotic protein involved in many important cellular processes. In plants, SGT1 is involved in resistance to disease. In a low ionic strength environment, the SGT1 protein tends to form dimers. The protein consists of three structurally independent domains (the tetratricopeptide repeats domain (TPR, the CHORD- and SGT1-containing domain (CS, and the SGT1-specific domain (SGS, and two less conserved variable regions (VR1 and VR2. In the present study, we provide the low-resolution structure of the barley (Hordeum vulgare SGT1 protein in solution and its dimer/monomer equilibrium using small-angle scattering of synchrotron radiation, ab-initio modeling and circular dichroism spectroscopy. The multivariate curve resolution least-square method (MCR-ALS was applied to separate the scattering data of the monomeric and dimeric species from a complex mixture. The models of the barley SGT1 dimer and monomer were formulated using rigid body modeling with ab-initio structure prediction. Both oligomeric forms of barley SGT1 have elongated shapes with unfolded inter-domain regions. Circular dichroism spectroscopy confirmed that the barley SGT1 protein had a modular architecture, with an α-helical TPR domain, a β-sheet sandwich CS domain, and a disordered SGS domain separated by VR1 and VR2 regions. Using molecular docking and ab-initio protein structure prediction, a model of dimerization of the TPR domains was proposed.

  1. Purification and characterization of three chitinases and one beta-1,3-glucanase accumulating in the medium of cell suspension cultures of barley (Hordeum vulgare L.)

    DEFF Research Database (Denmark)

    Kragh, K.M.; Jacobsen, S.; Dalgaard Mikkelsen, J.

    1991-01-01

    Three basic chitinases and one basic beta-1,3-glucanase were secreted into the medium when embryogenic cell suspensions of barley (Hordeum vulgare L.) cv. 'Igri' were cultured as undifferentiated aggregates in the presence of 2,4-D. The enzymes were purified by affinity and ion exchange...... chromatography. Two of the chitinases were identified as the previously described endochitinases T and C from barley grain. The third and novel chitinase, designated K, was the major basic chitinase in the medium constituting 4% of the soluble protein. Chitinase K was found to be a 33-kDa endochitinase with p...... chitinases from barley aleurone and barley, bean and potato leaves. The purified beta-1,3-glucanase with a molecular weight (MW) of 32 kDa and pI greater-than-or-equal-to 9.8 constituted 1% of the soluble protein in the medium. Based on similar MW, pI and amino acid composition as well as identical N...

  2. [Cold induced cDNA library construction of highland barley (Hordeum vulgare L. var. nudum Hk. f.) using suppression subtractive hybridization technology].

    Science.gov (United States)

    He, Tao; Jia, Jing Fen

    2008-12-01

    Cold-induced genes of highland barley (Hordeum vulgare L. var. nudum Hk. f.) were studied using suppression subtractive hybridization (SSH) technique. The cDNA from the materials treated with 4 degrees C was used as "tester", and that from the materials growing in green house (20+/-2 degrees C) as "driver". A subtractive library of highland barley including 640 cDNA clones was constructed in this study. Enzyme digestion of 32 clones chosen randomly from the library indicated that 87.5% of them contained inserts. The cDNA inserts of 16 clones were sequenced. Blast search analyses showed that these cDNAs were homologies to genes encoding the following proteins: metallothionein, protein kinase, ethylene signal transcription factor, bZIP transcription factor, zing finger transcription factor, ribulose-1,5-bisphosphate carboxylase, ribosomal protein, sodium: hydrogen antiporter, catalase, NADPH-cytochrome reductase, ascorbate peroxidase, DNA binding protein, and sugar transporter-like protein. These results indicated that the cDNA clones in the library were related to cold-induced genes, and suggested that the cold-tolerant mechanism of highland barley might be a complicated, interactive system involving multiple approaches and genes. Construction of subtractive cDNA library provided an advantage for further studies to isolate and clone cold-induced genes in highland barley.

  3. Cell-type-specific H+-ATPase activity in root tissues enables K+ retention and mediates acclimation of barley (Hordeum vulgare) to salinity stress

    DEFF Research Database (Denmark)

    Shabala, Lana; Zhang, Jingyi; Pottosin, Igor

    2016-01-01

    While the importance of cell type specificity in plant adaptive responses is widely accepted, only a limited number of studies have addressed this issue at the functional level. We have combined electrophysiological, imaging, and biochemical techniques to reveal the physiological mechanisms...... compared with the mature zone, mature root cells accumulated more cytosolic and vacuolar Na(+), suggesting that the higher sensitivity of apical cells to salt is not related to either enhanced Na(+) exclusion or sequestration inside the root. Rather, the above differential sensitivity between the two zones...... conferring higher sensitivity of apical root cells to salinity in barley (Hordeum vulgare). We show that salinity application to the root apex arrests root growth in a highly tissue- and treatment-specific manner. Although salinity-induced transient net Na(+) uptake was about 4-fold higher in the root apex...

  4. Use of Co speciation and soil properties to explain variation in Co toxicity to root growth of barley (Hordeum vulgare L.) in different soils.

    Science.gov (United States)

    Micó, C; Li, H F; Zhao, F J; McGrath, S P

    2008-12-01

    The influence of soil properties on the bioavailability and toxicity of Co to barley (Hordeum vulgare L.) root elongation was investigated. Ten soils varying widely in soil properties were amended with seven doses of CoCl2. Soil properties greatly influenced the expression of Co toxicity. The effective concentration of added Co causing 50% inhibition (EC50) ranged from 45 to 863 mg kg(-1), representing almost 20-fold variation among soils. Furthermore, we investigated Co toxicity in relation to Co concentrations and free Co2+ activity in soil solution. The EC50 values showed variation among soils of 17- and 29-fold, based on the Co concentration in soil solution and free Co2+ activity, respectively. Single regressions were carried out between Co toxicity threshold values and selected soil properties. Models obtained showed that soil effective cation exchange capacity (eCEC) and exchangeable calcium were the most consistent single predictors of the EC50 values based on soil added Co.

  5. Effects of the Application of Different Concentrations of NaN3 for Different Times on the Morphological and Cytogenetic Characteristics of Barley (Hordeum vulgare L.) Seedlings

    Institute of Scientific and Technical Information of China (English)

    Ali Irfan ILBAS; Yasemin EROGLU; Halil Erhan EROGLU

    2005-01-01

    Sodium azide (NaN3) has been used in many biological studies as a mutagen. In the present study, the morphological and cytogenetic effects of NaN3 on barley (Hordeum vulgare L.) seedlings were investigated. Seeds of barley were treated with different concentrations of NaN3 (0.5, 1.0, 1.5, 2.0, 2.5, and3.0 mmol/L) and applied for different periods of time (3 and 4 h). Parameters investigated, except for the mitotic index, were determined on Days 7 and 14. Increasing concentrations of NaN3 affected germination rates on Days 7 and 14 following application for 3 and 4 h. Although the length of the roots and leaves was affected by treatment with NaN3 on Day 14 of the germination period, coleoptile length was affected by NaN3 treatment on Day 7. Increasing concentrations of NaN3 and increased treatment period decreased the mitotic index compared with the untreated control. The inhibitory effects of NaN3 on the mitotic index indicate that NaN3 can have genotoxic and mutagenic effects on barley seedlings.

  6. Comparative effect of salinity on ion accumulation, grain yield and stability salt tolerance degree of barley (Hordeum vulgare L. in different growth stage

    Directory of Open Access Journals (Sweden)

    Abdennaceur Ben Khaled

    2016-12-01

    Full Text Available In arid and semi-arid regions of the world, excess salts in agricultural land can limit crop production. Barley (Hordeum vulgare L. is one of the most salt tolerant crop species. This study was conducted to determine the effects of salinity on seed germination, mineral content and yield production of 14 barley accessions from two regions in the Southern Tunisia. First experiment was conducted in laboratory to test the effect of nine levels of NaCl concentrations in different germination parameter. Second experiments were conducted in a greenhouse. The accessions were grown in soil and exposed to three salinity levels. Salinity decreased significantly the germination rate and the germination rate index for all accessions. Na+ content, total dry matter and grain yield vary significantly with increasing salinity levels. The degree of tolerance varies between accessions in the different growth stage. A significant correlation were observed between ranking using grain yield and multivariate parameter. The tolerance degree based in germination rate and Na+ content don’t present significant correlation with yield ranking. Therefore, ranking using multivariate parameter can be the appropriate method to analysis the tolerance degree of barley under saline conditions. The differences response between accessions of local population of barley “Ardhaoui” reflected an important internal genetic variability against the salinity. This variability could be more explored and used for the barley breeding program. The accessions Ettalah, Chneni Tatouine and Elhezma showed more salt tolerance at 13 dS/m as indicated by the multivariate ranking using germination rate, Na+ content and grain yield.

  7. Mitochondria during androgenesis in Hordeum vulgare

    Directory of Open Access Journals (Sweden)

    Krystyna Idzikowska

    2014-01-01

    Full Text Available Different number of mitochondria of varying structure was observed in particular stages of the development of barley (Hordeum vulgare microspores, stimulated by the in vitro culture to form embryoids. This variability was reflected in different shape of sections, different ratio between total area of mitochondria profiles and area of cytoplasm sections, varying number of cristae, and different density of the matrix. Within the cristae of some mitochondria crystalline inclusions were observed. Mitochondria divided by a contraction. In the matrix of some mitochondria spheric bodies were formed. They were surrounded by one or two membranes. It is suggested that the bi-membrane forms constituted promitochandria, whereas unimembrane forms could constitute promicrobodies.

  8. A laser ablation ICP-MS based method for multiplexed immunoblot analysis: applications to manganese-dependent protein dynamics of photosystem II in barley (Hordeum vulgare L.)

    DEFF Research Database (Denmark)

    de Bang, Thomas Christian; Petersen, Jørgen; Pedas, Pai Rosager

    2015-01-01

    developed a multiplexed antibody-based assay and analysed selected PSII subunits in barley (Hordeum vulgare L.). A selection of antibodies were labelled with specific lanthanides and immunoreacted with thylakoids exposed to Mn deficiency after western blotting. Subsequently, western blot membranes were...... analysed by laser ablation inductively coupled plasma mass spectrometry (LA-ICP-MS), which allowed selective and relative quantitative analysis via the different lanthanides. The method was evaluated against established liquid chromatography electrospray ionization tandem mass spectrometry (LC...

  9. Zinc absorption from low phytic acid genotypes of maize (Zea mays L.), Barley (Hordeum vulgare L.), and Rice (Oryza sativa L.) assessed in a suckling rat pup model.

    Science.gov (United States)

    Lönnerdal, Bo; Mendoza, Concepcion; Brown, Kenneth H; Rutger, J Neil; Raboy, Victor

    2011-05-11

    Dietary phytic acid is a major causative factor for low Zn bioavailability in many cereal- and legume-based diets. The bioavailability of Zn in seed of low phytic acid (lpa) variants of maize ( Zea mays L.), rice ( Oryza sativa L.), and barley ( Hordeum vulgare L.) was evaluated using a suckling rat pup model. Suckling rat pups (14 days old, n = 6-8/treatment) were fasted for 6 h and intubated with (65)Zn-radiolabeled suspensions prepared using seed produced by either wild-type (normal phytic acid) or lpa genotypes of each cereal. Test solutions were radiolabeled overnight (all genotypes) or immediately prior to intubation (barley genotypes). Pups were killed 6 h postintubation and tissues removed and counted in a gamma counter. Zn absorption was low from wild-type genotypes of maize (21, 33%) and rice (26%), and phytic acid reduction resulted in significantly higher Zn absorption, 47-52 and 35-52%, respectively. Zn absorption from wild-type barley incubated overnight was high (86-91%), and phytate reduction did not improve Zn absorption (84-90%), which is likely due to endogenous phytase activity. When the wild-type barley solutions were prepared immediately before intubation, Zn absorption was significantly lower (63, 78%) than from the lpa cultivars (92, 96%). Variation in seed or flour phenolic acid levels did not affect Zn absorption. Differences in seed Zn levels did not substantially affect Zn absorption. Thus, when phytic acid is abundant in a diet, it has a larger effect on Zn absorption than the level of Zn. Therefore, reducing the phytic acid content of staple cereal grains may contribute to enhancing Zn nutrition of populations consuming these staple foods.

  10. Phylogenetic and comparative gene expression analysis of barley (Hordeum vulgare)WRKY transcription factor family reveals putatively retained functions betweenmonocots and dicots

    Energy Technology Data Exchange (ETDEWEB)

    Mangelsen, Elke; Kilian, Joachim; Berendzen, Kenneth W.; Kolukisaoglu, Uner; Harter, Klaus; Jansson, Christer; Wanke, Dierk

    2008-02-01

    WRKY proteins belong to the WRKY-GCM1 superfamily of zinc finger transcription factors that have been subject to a large plant-specific diversification. For the cereal crop barley (Hordeum vulgare), three different WRKY proteins have been characterized so far, as regulators in sucrose signaling, in pathogen defense, and in response to cold and drought, respectively. However, their phylogenetic relationship remained unresolved. In this study, we used the available sequence information to identify a minimum number of 45 barley WRKY transcription factor (HvWRKY) genes. According to their structural features the HvWRKY factors were classified into the previously defined polyphyletic WRKY subgroups 1 to 3. Furthermore, we could assign putative orthologs of the HvWRKY proteins in Arabidopsis and rice. While in most cases clades of orthologous proteins were formed within each group or subgroup, other clades were composed of paralogous proteins for the grasses and Arabidopsis only, which is indicative of specific gene radiation events. To gain insight into their putative functions, we examined expression profiles of WRKY genes from publicly available microarray data resources and found group specific expression patterns. While putative orthologs of the HvWRKY transcription factors have been inferred from phylogenetic sequence analysis, we performed a comparative expression analysis of WRKY genes in Arabidopsis and barley. Indeed, highly correlative expression profiles were found between some of the putative orthologs. HvWRKY genes have not only undergone radiation in monocot or dicot species, but exhibit evolutionary traits specific to grasses. HvWRKY proteins exhibited not only sequence similarities between orthologs with Arabidopsis, but also relatedness in their expression patterns. This correlative expression is indicative for a putative conserved function of related WRKY proteins in mono- and dicot species.

  11. Transgenic barley (Hordeum vulgare L.) expressing the wheat aluminium resistance gene (TaALMT1) shows enhanced phosphorus nutrition and grain production when grown on an acid soil.

    Science.gov (United States)

    Delhaize, Emmanuel; Taylor, Phillip; Hocking, Peter J; Simpson, Richard J; Ryan, Peter R; Richardson, Alan E

    2009-06-01

    Barley (Hordeum vulgare L.), genetically modified with the Al(3+) resistance gene of wheat (TaALMT1), was compared with a non-transformed sibling line when grown on an acidic and highly phosphate-fixing ferrosol supplied with a range of phosphorus concentrations. In short-term pot trials (26 days), transgenic barley expressing TaALMT1 (GP-ALMT1) was more efficient than a non-transformed sibling line (GP) at taking up phosphorus on acid soil, but the genotypes did not differ when the soil was limed. Differences in phosphorus uptake efficiency on acid soil could be attributed not only to the differential effects of aluminium toxicity on root growth between the genotypes, but also to differences in phosphorus uptake per unit root length. Although GP-ALMT1 out-performed GP on acid soil, it was still not as efficient at taking up phosphorus as plants grown on limed soil. GP-ALMT1 plants grown in acid soil possessed substantially smaller rhizosheaths than those grown in limed soil, suggesting that root hairs were shorter. This is a probable reason for the lower phosphorus uptake efficiency. When grown to maturity in large pots, GP-ALMT1 plants produced more than twice the grain as GP plants grown on acid soil and 80% of the grain produced by limed controls. Expression of TaALMT1 in barley was not associated with a penalty in either total shoot or grain production in the absence of Al(3+), with both genotypes showing equivalent yields in limed soil. These findings demonstrate that an important crop species can be genetically engineered to successfully increase grain production on an acid soil.

  12. Phylogenetic and comparative gene expression analysis of barley (Hordeum vulgare WRKY transcription factor family reveals putatively retained functions between monocots and dicots

    Directory of Open Access Journals (Sweden)

    Jansson Christer

    2008-04-01

    Full Text Available Abstract Background WRKY proteins belong to the WRKY-GCM1 superfamily of zinc finger transcription factors that have been subject to a large plant-specific diversification. For the cereal crop barley (Hordeum vulgare, three different WRKY proteins have been characterized so far as regulators in sucrose signaling, pathogen defense, and in response to cold and drought. However, their phylogenetic relationship remained unresolved. Results In this study, we used available sequence information to identify a minimum number of 45 barley WRKY transcription factor (HvWRKY genes. According to their structural features, the HvWRKY factors were classified into the previously defined polyphyletic WRKY subgroups 1 to 3. Furthermore, we could assign putative orthologs of the HvWRKY proteins in Arabidopsis and rice. While in most cases clades of orthologous proteins were formed within each group or subgroup, other clades were composed of paralogous proteins for the grasses and Arabidopsis only, which is indicative of specific gene radiation events. To gain insight into their putative functions, we examined expression profiles of WRKY genes from publicly available microarray data resources and found group specific expression patterns. While putative orthologs of the HvWRKY transcription factors have been inferred from phylogenetic sequence analysis, we performed a comparative expression analysis of WRKY genes in Arabidopsis and barley. Indeed, highly correlative expression profiles were found between some of the putative orthologs. Conclusion HvWRKY genes have not only undergone radiation in monocot or dicot species, but exhibit evolutionary traits specific to grasses. HvWRKY proteins exhibited not only sequence similarities between orthologs with Arabidopsis, but also relatedness in their expression patterns. This correlative expression is indicative for a putative conserved function of related WRKY proteins in monocot and dicot species.

  13. Quantitative trait loci for water-use efficiency in barley (Hordeum vulgare L.) measured by carbon isotope discrimination under rain-fed conditions on the Canadian Prairies.

    Science.gov (United States)

    Chen, Jing; Chang, Scott X; Anyia, Anthony O

    2012-06-01

    Barley (Hordeum vulgare L.) yield is commonly limited by low rainfall and high temperature during the growing season on the Canadian Prairies. Empirical knowledge suggests that carbon isotope discrimination (Δ(13)C), through its negative relationship with water-use efficiency (WUE), is a good index for selecting stable yielding crops in some rain-fed environments. Identification of quantitative trait loci (QTL) and linked markers for Δ(13)C will enhance its use efficiency in breeding programs. In the present study, two barley populations (W89001002003 × I60049 or W × I, six-row type, and Merit × H93174006 or M × H, two-row type), containing 200 and 127 recombinant inbred lines (RILs), were phenotyped for leaf Δ(13)C and agronomic traits under rain-fed environments in Alberta, Canada. A transgressive segregation pattern for leaf Δ(13)C was observed among RILs. The broad-sense heritability (H (2)) of leaf Δ(13)C was 0.8, and there was no significant interaction between genotype and environment for leaf Δ(13)C in the W × I RILs. A total of 12 QTL for leaf Δ(13)C were detected in the W × I RILs and 5 QTL in the M × H RILs. For the W × I RILs, a major QTL located on chromosome 3H near marker Bmag606 (9.3, 9.4 and 10.7 cM interval) was identified. This major QTL overlapped with several agronomic traits, with W89001002003 alleles favoring lower leaf Δ(13)C, increased plant height, and reduced leaf area index, grain yield, harvest index and days to maturity at this locus or loci. This major QTL and its associated marker, when validated, maybe useful in breeding programs aimed at improving WUE and yield stability of barley on the Canadian Prairies.

  14. An evaluation of the impact of the endophyte fungus Piriformospora indica on some traits of barley (Hordeum vulgare L. in drought stress

    Directory of Open Access Journals (Sweden)

    M. Ghabouli

    2016-05-01

    Full Text Available Microbial endophytes, which make one of the most important classes of soil microorganisms, induce genetic, physiological and ecological alterations in their host plant and thus increase its yield and enable its cultivation in saline or dry soils or in climates facing biotic and abiotic stresses. The endophyte fungus Piriformospora indica exhibits a high effect in plant growth and increased resistance against environmental tensions like drought and salinity, as well as against phytopathogens. This work was intended to study the potential of P. indica in enhancing growth and elevating drought resistance in barley (Hordeum vulgare L. during 2010. A greenhouse trial of completely randomized design with two fungal treatments (inoculated vs. non-inoculated and three drought levels (F.C., 50% F.C. and 25% F.C. with four repeats was conducted in greenhouse of Agricultural Biotechnology Research Institute (Isfahan. The results indicate that the fungus P. indica has accompanied biomass increments of both shoot and root parts in the inoculated plant compared to the control, as in inoculated plant, total shoot dry weight and root dry weight were increased by 39 and 46 percent, respectively. Also, in stress conditions RWC in inoculated plant was greater. In addition to the growth increasing activity, the effective role of the fungus in enhancing barley growth and yield under drought conditions (especially at the 25% F.C. level is evident. According to the results, and to the fact that the fungus can be cultured on artificial (host-plant-free growth medium, this fungus can be contemplated as making a growth stimulating agent and in producing biological fertilizer for use in crops; and it might take a significant role toward a sustainable agriculture. The application of this fungus can also be beneficial in increasing growth and production of crops such as barley and wheat under the dry conditions widely encountered in Iran.

  15. Taxonomy Icon Data: barley [Taxonomy Icon

    Lifescience Database Archive (English)

    Full Text Available barley Hordeum vulgare Hordeum_vulgare_L.png Hordeum_vulgare_NL.png Hordeum_vulgare_S.png Hordeum_vu...lgare_NS.png http://biosciencedbc.jp/taxonomy_icon/icon.cgi?i=Hordeum+vulgare&t=L http://bi...osciencedbc.jp/taxonomy_icon/icon.cgi?i=Hordeum+vulgare&t=NL http://biosciencedbc.jp/taxonomy_icon/icon.cgi?i=Hordeum+vu...lgare&t=S http://biosciencedbc.jp/taxonomy_icon/icon.cgi?i=Hordeum+vulgare&t=NS ...

  16. Nematode assemblages in the rhizosphere of spring barley (Hordeum vulgare L.) depended on fertilisation and plant growth phase

    DEFF Research Database (Denmark)

    Madsen, Mette Vestergård

    2004-01-01

    rhizosphere; nitrogen and phosphorus fertilisation; nematode assemblages; plant parasites; barley......rhizosphere; nitrogen and phosphorus fertilisation; nematode assemblages; plant parasites; barley...

  17. Molecular size and net charge of pathogenesis-related enzymes from barley (Hordeum vulgare L., v. Karat) infected with Drechslera teres f. teres (Sacch.) Shoem.

    Science.gov (United States)

    Rothe, G M; Welschbillig, N; Reiss, E

    1998-05-01

    Molecular size and net charge of isoforms of pathogenesis-related (PR) chitinase, beta-1,3-glucanase and peroxidase were studied in uninfected barley (Hordeum vulgare L., v. Karat) leaves and in barley leaves infected with the pathogenic fungus Drechslera teres f. teres (Sacch.) Shoem. Molecular characteristics were determined by time-dependent polyacrylamide gradient gel electrophoresis under native conditions and by applying an extended version of the computer program MOL-MASS (Rothe, G. M., Weidmann, H., Electrophoresis 1991, 12, 703-709). Uninfected barley leaves contained predominantly one peroxidase isozyme but also three very weak peroxidases. Activities of all of these three peroxidases increased considerably after infection with Drechslera teres. The molecular masses of peroxidases 1 and 3 were estimated to be 38 +/- 5 and 42 +/- 7 kDa and their apparent valences at pH 8.4 were Z = 3.13 and 3.20, respectively. Amongst the chitinase isoforms, chitinase 1 and chitinase 2 appeared after infection, while chitinase 3 was also observed in uninfected leaves of barley. The molecular mass of chitinase 3 (31 +/- 6 kDa; f/fo = 1.20) was larger than that of chitinase 1 (20 +/- 2 kDa; f/fo = 1.04) and chitinase 2 (23 +/- 3 kDa; f/fo = 1.06). The valence of constitutive chitinase 3 (Z = 1.44 +/- 0.81) at pH 8.4 was lower than that of adaptive chitinase 1 (Z = 3.27 +/- 1.02) and chitinase 2 (Z = 2.96 +/- 1.38). Infection of barley leaves with Drechslera teres also induced the hydrolytic enzyme beta-1,3-glucanase 1; beta-1,3-glucanase 2 appeared in uninfected and in infected leaves. Constitutive beta-1,3-glucanase 2 was smaller (molecular mass 19 +/- kDa; f/fo = 1.05) than adaptive beta-1,3-glucanase 1 (molecular mass 26 +/- 4 kDa; f/fo = 1.07). The valence of adaptive beta-1,3-glucanase 1 (Z = 9.58 +/- 4.17) was approximately threefold that of beta-1,3-glucanase 2 (Z = 2.80 +/- 0.93).

  18. Interactive effects of salinity and phosphorus availability on growth, water relations, nutritional status and photosynthetic activity of barley (Hordeum vulgare L.).

    Science.gov (United States)

    Talbi Zribi, O; Abdelly, C; Debez, A

    2011-11-01

    The interactive effects of salinity and phosphorus availability on growth, water relations, nutritional status and photosynthetic activity were investigated in barley (Hordeum vulgare L. cv. Manel). Seedlings were grown hydroponically under low or sufficient phosphorus (P) supply (5 or 180 μmol KH(2) PO(4) plant(-1) week(-1) , respectively), with or without 100 mm NaCl. Phosphorus deficiency or salinity significantly decreased whole plant growth, leaf water content, leaf osmotic potential and gas exchange parameters, with a more marked impact of P stress. The effect of both stresses was not additive since the response of plants to combined salinity and P deficiency was similar to that of plants grown under P deficiency alone. In addition, salt-treated plants exposed to P deficiency showed higher salt tolerance compared to plants grown with sufficient P supply. This was related to plant ability to significantly increase root:shoot DW ratio, root length, K(+)/Na(+) ratio, leaf proline and soluble sugar concentrations and total non-enzymatic antioxidant capacity, together with restricting Na(+) accumulation in the upper leaves. As a whole, our results indicate that under concomitant exposure to both salt and P deficiency, the impact of the latter constraint is pre-dominant.

  19. Identifying inflorescence phytoliths from selected species of wheat (Triticum monococcum, T. dicoccon, T. dicoccoides, and T. aestivum) and barley (Hordeum vulgare and H. spontaneum) (Gramineae).

    Science.gov (United States)

    Ball, T B; Gardner, J S; Anderson, N

    1999-11-01

    Analysis of microfossil silica phytoliths is becoming an increasingly important research tool for taxonomists, archaeobotanists, and paleoecologists. Expanded use of phytolith analysis by researchers is dependent upon development of phytolith systematics. In this study phytoliths produced by the inflorescence bracts from four species of wheat, Triticum monoccocum, T. dicoccon, T. dicoccoides, and T. aestivum, and two species of barley, Hordeum vulgare, and H. spontaneum, were analyzed using computer-assisted image and statistical analysis with the intent to develop taxonomic tools to distinguish among the taxa. A classification key based on significant differences among the mean morphometries of the inflorescence phytoliths produced by each species was created and tested. Discriminant analysis of the morphometries of several morphotypes of phytoliths was also conducted to determine whether this computer-assisted statistical procedure could be used as another method to classify the taxa and to determine which morphotypes have measurements that can best be used in discriminant functions. Test results indicated that, at the genus level, both the classification key and discriminant analysis of certain morphotypes of phytoliths were relatively reliable tools for distinguishing among phytoliths produced in the inflorescence bracts of the taxa considered. For distinguishing among the taxa at the species level, the classification key was most reliable. Of the discriminant analyses tested, that based on all the phytolith morphotypes combined was more reliable than those based on only one morphotype.

  20. Growth parameters and resistance against Drechslera teres of spring barley (Hordeum vulgare L. cv. Scarlett) grown at elevated ozone and carbon dioxide concentrations.

    Science.gov (United States)

    Plessl, M; Heller, W; Payer, H-D; Elstner, E F; Habermeyer, J; Heiser, I

    2005-11-01

    Spring barley ( Hordeum vulgare L. cv. Scarlett) was grown at two CO2 levels (400 vs. 700 ppm) combined with two ozone regimes (ambient vs. double ambient) in climate chambers for four weeks, beginning at seedling emergence. Elevated CO2 concentration significantly increased aboveground biomass, root biomass, and tiller number, whereas double ambient ozone significantly decreased these parameters. These ozone-induced reductions in growth parameters were strongly overridden by 700 ppm CO2. The elevated CO2 level increased C : N ratio of the leaf tissue and leaf starch content but decreased leaf protein levels. Exposure to double ambient ozone did not affect protein content and C : N ratio but dramatically increased leaf starch levels at 700 ppm CO2. Resistance against Drechslera teres (Sacc.) Shoemaker was increased in leaves grown at double ambient ozone but was less obvious at 700 ppm than at 400 ppm CO2. Constitutive activities of beta-1,3-glucanase and chitinase were significantly higher in leaves grown at double ambient ozone compared to ambient ozone levels. The sum of methanol-soluble and alkali-released cell wall-bound aromatic metabolites (i.e., C-glycosylflavones and several structurally unidentified metabolites) and lignin contents did not show any treatment-dependent differences.

  1. Effect of salinity stress on chlorophyll content, proline, water soluble carbohydrate, germination, growth and dry weight of three seedling barley (Hordeum vulgare L. cultivars

    Directory of Open Access Journals (Sweden)

    Movafegh S.

    2012-11-01

    Full Text Available Salinity is a serious environmental constraint to crop production in many parts of the world and the development of crops with improved salt tolerance is proposed as part of solution to this problem. This research was performed out in order to study the effects of different salinity levels on germination, growth, dry weight, proline, water soluble carbohydrate and chlorophyll content of three barley (Hordeum vulgare L. cultivars named Jonoob (INC-54, Reyhan (INC-45 & Nosrat (INC -47.The experiment was carried out using factorial based on completely randomized design with three replications.Seven old seedlings after germination were transferred to Hoagland nutrient solution under the effect of salinity levels (0, 50, 150 and 250 mM NaClin during seven days. Data variance analysis showed that seed germination of three barley cultivars was significantly (PReyhan>Nosrat. The results showed that, increasing in salinity decreased all growth parameters. Salinity stress decreased shoot and root length, root dry weight and chlorophyll contents in every three cultivars. But decreasing of chlorophyll was less in Nosrat compared to two other items. Proline content and soluble carbohydrate were increased in all of the three cultivars with enhance of NaCl concentration. By increasing of salinity stress accumulation of proline and soluble sugar content in leaves of Nosrat cultivar was more than other cultivars.As saltiness increases resistance natural responses in this plant gets better considering less decrease in chlorophyll amount and strategy of more production about praline and sugar solution compared to two other items.

  2. Cytogenetisch en embryologisch onderzoek aan kruisingen tussen Hordeum vulgare en H. bulbosum

    NARCIS (Netherlands)

    Lange, W.

    1969-01-01

    Crosses between barley (Hordeum vulgare) and bulbous barleygrass ( H.bulbosum) could be valuable for the transfer of such properties as resistance to cold or diseases from H. bulbosum to H. vulgare. From the literature it was known that difficulties a

  3. Red:far-red light conditions affect the emission of volatile organic compounds from barley (Hordeum vulgare), leading to altered biomass allocation in neighbouring plants.

    Science.gov (United States)

    Kegge, Wouter; Ninkovic, Velemir; Glinwood, Robert; Welschen, Rob A M; Voesenek, Laurentius A C J; Pierik, Ronald

    2015-05-01

    Volatile organic compounds (VOCs) play various roles in plant-plant interactions, and constitutively produced VOCs might act as a cue to sense neighbouring plants. Previous studies have shown that VOCs emitted from the barley (Hordeum vulgare) cultivar 'Alva' cause changes in biomass allocation in plants of the cultivar 'Kara'. Other studies have shown that shading and the low red:far-red (R:FR) conditions that prevail at high plant densities can reduce the quantity and alter the composition of the VOCs emitted by Arabidopsis thaliana, but whether this affects plant-plant signalling remains unknown. This study therefore examines the effects of far-red light enrichment on VOC emissions and plant-plant signalling between 'Alva' and 'Kara'. The proximity of neighbouring plants was mimicked by supplemental far-red light treatment of VOC emitter plants of barley grown in growth chambers. Volatiles emitted by 'Alva' under control and far-red light-enriched conditions were analysed using gas chromatography-mass spectrometry (GC-MS). 'Kara' plants were exposed to the VOC blend emitted by the 'Alva' plants that were subjected to either of the light treatments. Dry matter partitioning, leaf area, stem and total root length were determined for 'Kara' plants exposed to 'Alva' VOCs, and also for 'Alva' plants exposed to either control or far-red-enriched light treatments. Total VOC emissions by 'Alva' were reduced under low R:FR conditions compared with control light conditions, although individual volatile compounds were found to be either suppressed, induced or not affected by R:FR. The altered composition of the VOC blend emitted by 'Alva' plants exposed to low R:FR was found to affect carbon allocation in receiver plants of 'Kara'. The results indicate that changes in R:FR light conditions influence the emissions of VOCs in barley, and that these altered emissions affect VOC-mediated plant-plant interactions. © The Author 2015. Published by Oxford University Press on

  4. Influence of crop rotation and meteorological conditons on density and biomass of weeds in spring barley (Hordeum vulgare L.

    Directory of Open Access Journals (Sweden)

    Maria Wanic

    2012-12-01

    Full Text Available The paper presents the analysis of changes in weed infestation in spring barley cultivated in the years 1990-2004 in crop rotation with a 25% proportion of this cereal (potato - spring barley - sowing peas - winter triticale, when it was grown after potato, and in crop rotation with its 75% proportion (potato - spring barley - spring barley - spring barley, when it was grown once or twice after spring barley. In the experiment, no weed control was applied. Every year in the spring (at full emergence of the cereal and before the harvest, the composition of weed species and weed density of particular weed species were determined, and before the harvest also their biomass. Weed density increased linearly on all plots during the 15-year period. The average values confirm the increase in weed biomass in the case when spring barley was grown once or twice after this crop; however, those differences were influenced by the previous situation only during some seasons. Weed density and biomass showed high year-to-year variability and a positive correlation with the amount of precipitation and a negative correlation with temperature during the period of the study. A negative correlation between the yield of barley and weed biomass was shown.

  5. Induction by chromium ions of chitinases and polyamines in barley (Hordeum vulgare L.) and rape (Brassica napus L. ssp. oleifera)

    DEFF Research Database (Denmark)

    Jacobsen, S.; Hauschild, M.Z.; Rasmussen, U.

    1992-01-01

    Barley and rape seedlings were grown in hydroponic culture with increasing concentrations of CrO3 (Cr(VI)) or CrCl3 (Cr(III)). The chitinase activity and the concentrations of putrescine, spennidine and spermine were determined in the third leaf of barley seed-lings and in the second leaf of rape...

  6. An eceriferum locus, cer-zv, is associated with a defect in cutin responsible for water retention in barley (Hordeum vulgare) leaves.

    Science.gov (United States)

    Li, Chao; Wang, Aidong; Ma, Xiaoying; Pourkheirandish, Mohammad; Sakuma, Shun; Wang, Ning; Ning, Shunzong; Nevo, Eviatar; Nawrath, Christiane; Komatsuda, Takao; Chen, Guoxiong

    2013-03-01

    Drought limits plant growth and threatens crop productivity. A barley (Hordeum vulgare) ethylene imine-induced monogenic recessive mutant cer-zv, which is sensitive to drought, was characterized and genetically mapped in the present study. Detached leaves of cer-zv lost 34.2 % of their initial weight after 1 h of dehydration. The transpiration was much higher in cer-zv leaves than in wild-type leaves under both light and dark conditions. The stomata of cer-zv leaves functioned normally, but the cuticle of cer-zv leaves showed increased permeability to ethanol and toluidine blue dye. There was a 50-90 % reduction in four major cutin monomers, but no reduction in wax loads was found in the cer-zv mutant as compared with the wild type. Two F(2) mapping populations were established by the crosses of 23-19 × cer-zv and cer-zv × OUH602. More polymorphisms were found in EST sequences between cer-zv and OUH602 than between cer-zv and 23-19. cer-zv was located in a pericentromeric region on chromosome 4H in a 10.8 cM interval in the 23-19 × cer-zv map based on 186 gametes tested and a 1.7 cM interval in the cer-zv × OUH602 map based on 176 gametes tested. It co-segregated with EST marker AK251484 in both maps. The results indicated that the cer-zv mutant is defective in cutin, which might be responsible for the increased transpiration rate and drought sensitivity, and that the F(2) of cer-zv × OUH602 might better facilitate high resolution mapping of cer-zv.

  7. Transformation of isolated barley (Hordeum vulgare L.) microspores: I. the influence of pretreatments and osmotic treatment on the time of DNA synthesis.

    Science.gov (United States)

    Shim, Youn-Seb; Pauls, K Peter; Kasha, Ken J

    2009-02-01

    The objective of this study was to determine when DNA synthesis occurred during pretreatments of cultured barley (Hordeum vulgare L.) microspores and during their preparation for particle bombardment. Based on this information, an investigation of the influence of cell cycle stage on the ability to obtain homozygous transgenic plants by particle bombardment will be presented in paper II of this series. It was hypothesized that the introduction of foreign genes at the G1 cell cycle stage in cultured uninucleate microspores would produce homozygous transgenic plants. Experiments were conducted with two different commonly used pretreatments to induce microspore embryogenesis: cold (4 degrees C) for 21days and cold plus 0.3 mol/L mannitol for 4 days. After pretreatment, the microspores were placed in a higher osmotic medium for 4 h prior to and for 18 h following bombardment. It was confirmed that during the cold plus mannitol pretreatment, there was no apparent change in the cell cycle stage, with the majority of the microspores remaining at the G1 stage. While in the cold for 21 days, the microspores progressed slowly through to G2, with a few progressing further into the mitosis and binucleate stages. Hourly DNA density measurements that were taken during the 4 h osmotic adjustment period following the cold plus mannitol pretreatment indicated that DNA synthesis began during this period at 25 degrees C, while at 4 degrees C, there was no apparent change in cell cycle stage or in DNA density. Thus, one might expect to find a higher frequency of homozygous doubled haploids by maintaining the temperature low during the 4 h osmotic adjustment period following the cold plus mannitol pretreatment than following the 21 day cold pretreatment. However, it is also not known what effect the temperatures during the whole high-osmotic treatments will have on the rate and time of incorporation of the transgene.

  8. Comparative kinetics and reciprocal inhibition of nitrate and nitrite uptake in roots of uninduced and induced barley (Hordeum vulgare L.) seedlings

    Science.gov (United States)

    Aslam, M.; Travis, R. L.; Huffaker, R. C.

    1992-01-01

    Nitrate and NO2- transport by roots of 8-day-old uninduced and induced intact barley (Hordeum vulgare L. var CM 72) seedlings were compared to kinetic patterns, reciprocal inhibition of the transport systems, and the effect of the inhibitor, p-hydroxymercuribenzoate. Net uptake of NO3- and NO2- was measured by following the depletion of the ions from the uptake solutions. The roots of uninduced seedlings possessed a low concentration, saturable, low Km, possibly a constitutive uptake system, and a linear system for both NO3- and NO2-. The low Km system followed Michaelis-Menten kinetics and approached saturation between 40 and 100 micromolar, whereas the linear system was detected between 100 and 500 micromolar. In roots of induced seedlings, rates for both NO3- and NO2- uptake followed Michaelis-Menten kinetics and approached saturation at about 200 micromolar. In induced roots, two kinetically identifiable transport systems were resolved for each anion. At the lower substrate concentrations, less than 10 micromolar, the apparent low Kms of NO3- and NO2- uptake were 7 and 9 micromolar, respectively, and were similar to those of the low Km system in uninduced roots. At substrate concentrations between 10 and 200 micromolar, the apparent high Km values of NO3- uptake ranged from 34 to 36 micromolar and of NO2- uptake ranged from 41 to 49 micromolar. A linear system was also found in induced seedlings at concentrations above 500 micromolar. Double reciprocal plots indicated that NO3- and NO2- inhibited the uptake of each other competitively in both uninduced and induced seedlings; however, Ki values showed that NO3- was a more effective inhibitor than NO2-. Nitrate and NO2- transport by both the low and high Km systems were greatly inhibited by p-hydroxymercuribenzoate, whereas the linear system was only slightly inhibited.

  9. Development and characterization of recombinant chromosome substitution lines (RCSLs) using Hordeum vulgare subsp. spontaneum as a source of donor alleles in a Hordeum vulgare subsp. vulgare background.

    Science.gov (United States)

    Matus, I; Corey, A; Filichkin, T; Hayes, P M; Vales, M I; Kling, J; Riera-Lizarazu, O; Sato, K; Powell, W; Waugh, R

    2003-12-01

    The ancestor of barley (Hordeum vulgare subsp. spontaneum) may be a source of novel alleles for crop improvement. We developed a set of recombinant chromosome substitution lines (RCSLs) using an accession of H. vulgare subsp. spontaneum (Caesarea 26-24, from Israel) as the donor and Hordeum vulgare subsp. vulgare 'Harrington' (the North American malting quality standard) as the recurrent parent via two backcrosses to the recurrent parent, followed by six generations of selfing. Here we report (i) the genomic architecture of the RCSLs, as inferred by simple sequence repeat (SSR) markers, and (ii) the effects of H. vulgare subsp. spontaneum genome segment introgressions in terms of three classes of phenotypes: inflorescence yield components, malting quality traits, and domestication traits. Significant differences among the RCSLs were detected for all phenotypes measured. The phenotypic effects of the introgressions were assessed using association analysis, and these were referenced to quantitative trait loci (QTL) reported in the literature. Hordeum vulgare subsp. spontaneum, despite its overall inferior phenotype, contributed some favorable alleles for agronomic and malting quality traits. In most cases, the introgression of the ancestral genome resulted in a loss of desirable phenotypes in the cultivated parent. Although disappointing from a plant breeding perspective, this finding may prove to be a useful tool for gene discovery.

  10. Pollen dimorphism and androgenesis in Hordeum vulgare

    Directory of Open Access Journals (Sweden)

    Krystyna Idzikowska

    2014-01-01

    Full Text Available Dimorphism of binucleate pollen grains of Hordeum vulgare has been confirmed. It is considered, however, in contrast to the accepted opinions, that some of the large pollen grains with dense cytoplasm lying close to the tapetum are the outset forms for embryoids, and not the small pollen grains with scarce cytoplasm lying in the pollen sac centre.

  11. Molecular analysis of cultivated naked barley (Hordeum vulgare L.) from Qinghai-Tibet Plateau in China using SSR markers

    Institute of Scientific and Technical Information of China (English)

    Zhifen PAN; Guangbing DENG; Xuguang ZHAI; Hai LONG; Yawei TANG; Xiaolin QIANG; Maoqun YU

    2008-01-01

    Naked barley is widely planted in Qinghai-Tibet Plateau in China and is essential for the daily life of Tibetans in those regions. In this study, the genetic diversity of 64 cultivated naked barley accessions from Qinghai-Tibet Plateau in China was analyzed using 30 mapped SSRs linked with the important traits of barley improvement. A total of 132 alleles were identified at 22 polymorphic SSR loci, with the number of each locus ranging from 2 to 15, the polymorphism information con-tent (PIC) values ranging from 0.16 to 0.91, and with an average of 0.65. Of the selected SSRs, 13 SSR markers with high PIC value were highly efficient for the genetic analysis of Chinese barley. The accessions were divided into five main groups by cluster analysis and could be differentiated from each other. The genetic diversity in the Tibet accessions was slightly higher than in the Sichuan accessions. It is found that there were specific genes linked with the collecting sites. These results indi-cate the cultivated naked barley from Qinghai-Tibet Plateau in China are highly polymorphic and could be considered as an important resource bank for cultivated naked barley breeding in the future.

  12. Antidepressant-like effects of young green barley leaf (Hordeum vulgare L. in the mouse forced swimming test

    Directory of Open Access Journals (Sweden)

    Katsunori Yamaura

    2012-01-01

    Full Text Available Background: Young green barley leaf is one of the richest sources of antioxidants and has been widely consumed for health management in Japan. In this study, we examined whether oral administration of young green barley leaf has an antidepressant effect on the forced swimming test in mice. Materials and Methods: Mice were individually forced to swim in an open cylindrical container, one hour after oral administration of young green barley leaf (400 or 1000 mg / kg or imipramine (100 mg / kg. Expression of mRNA for nerve growth factor (NGF, brain-derived neurotrophic factor, and glucocorticoid receptor in the brain was analyzed using real-time quantitative polymerase chain reaction (PCR. Results: There was a significant antidepressant-like effect in the forced swimming test; both 400 and 1000 mg / kg young green barley leaves, as well as the positive control imipramine (100 mg / kg, reduced the immobility duration compared to the vehicle group. The expression of mRNA for NGF detected in the hippocampus immediately after the last swimming test was higher than that in the non-swimming group (Nil. Oral administration of imipramine suppressed this increase to the level of the Nil group. Young green barley leaf (400 and 1000 mg / kg also showed a moderate decrease in the expression of mRNA for NGF, in a dose-dependent manner. Conclusion: Oral administration of young green barley leaf is able to produce an antidepressant-like effect in the forced swimming test. Consequently it is possible that the antidepressant-like effects of the young green barley leaf are, at least in part, mediated by an inhibition of the increase in the hippocampus levels of NGF.

  13. Improving nitrogen use efficiency in barley (Hordeum vulgare L.) through the cisgenic approach

    DEFF Research Database (Denmark)

    Kichey, Thomas; Holme, Inger; Møller, Inge Skrumsager

    2009-01-01

    Barley is one of the major crops cultivated worldwide and constitutes an important basis for animal feed. However, the production is facing a number of challenges that will be accentuated in the years to come, in particular restrictions on the use of nitrogen (N) fertilizer. In order to improve t...... the N use efficiency in barley, we are developing a new generation of genetically modified plants based on the concept of cisgenesis. In this approach, plants are transformed only with their own genetic material. The genes encoding the cytosolic isoform of the glutamine synthetase (GS1...... into the pGreenII binary vector. The genes have been inserted into barley by Agrobacterium-mediated transformation using the hygromycin phosphotransferase gene for selection of transformed lines on hygromycin. In this system, the resistance gene is placed on the helper plasmid pSoup allowing for separate...

  14. Identification of SNPs in barley(Hordeum vulgare L.)by deep sequencing of six reduced representation libraries

    Institute of Scientific and Technical Information of China (English)

    Ganggang; Guo; Dawa; Dondup; Lisha; Zhang; Sha; Hu; Xingmiao; Yuan; Jing; Zhang

    2014-01-01

    High-density genetic markers are required for genotyping and linkage mapping in identifying genes from crops with complex genomes, such as barley. As the most common variation, single nucleotide polymorphisms(SNPs) are suitable for accurate genotyping by using the next-generation sequencing(NGS) technology. Reduced representation libraries(RRLs) of five barley accessions and one mutant were sequenced using NGS technology for SNP discovery. Twenty million short reads were generated and the proportion of repetitive sequences was reduced by more than 56%. A total of 6061 SNPs were identified, and 451 were mapped to the draft sequence of the barley genome with pairing reads. Eleven SNPs were validated using length polymorphic allele-specific PCR markers.

  15. Androgenesis in Anther Culture of Lithuanian Spring Barley (Hordeum vulgare L.) and Potato (Solanum tuberosum L.) Cultivars

    OpenAIRE

    ASAKAVICIUTE, Rita

    2008-01-01

    An anther culture method was used for the production of doubled haploids (DHs) in Lithuanian barley and potato cultivars that were directly regenerated from embryoids (Caredda´s method) were applied to determine androgenic potential according to the green regenerant yield and other morphogenetic factors. Green DH regenerants were obtained in 3 Lithuanian spring barley cultivars (´Aidas´, ´Alsa´, and ´Auksiniai´) out of 10 studied. The highest rate of embryoid formation was determined in cv. ...

  16. Regrowth in Barley (Hordeum vulgare L.) and Rye (Secale cereale L.)

    DEFF Research Database (Denmark)

    Christiansen, J L; Jørgensen, Johannes Ravn; Jørnsgård, B

    1998-01-01

    generally showed stronger regrowth than barley after late cutting, but only the perennial variety 'Soperta' regenerated as many tillers at cutting as formed when harvested at the ripe grain stage. In both species, significant differences were found between varieties. The level of soluble carbohydrates...

  17. Extraction of high-quality RNA from germinating barley (Hordeum vulgare L.) seeds containing high levels of starch.

    Science.gov (United States)

    Comparative evaluation of gene expression levels can lead to improved understanding of the gene networks underlying traits of economic importance. Extraction of high-quality RNA from germinating barley seeds that contain high levels of starch is of vital importance for analysing the expression of ca...

  18. Mutation at the circadian clock gene EARLY MATURITY 8 adapts domesticated barley (Hordeum vulgare) to short growing seasons.

    Science.gov (United States)

    Faure, Sebastien; Turner, Adrian S; Gruszka, Damian; Christodoulou, Vangelis; Davis, Seth J; von Korff, Maria; Laurie, David A

    2012-05-22

    The circadian clock is an autonomous oscillator that produces endogenous biological rhythms with a period of about 24 h. This clock allows organisms to coordinate their metabolism and development with predicted daily and seasonal changes of the environment. In plants, circadian rhythms contribute to both evolutionary fitness and agricultural productivity. Nevertheless, we show that commercial barley varieties bred for short growing seasons by use of early maturity 8 (eam8) mutations, also termed mat-a, are severely compromised in clock gene expression and clock outputs. We identified EAM8 as a barley ortholog of the Arabidopsis thaliana circadian clock regulator EARLY FLOWERING3 (ELF3) and demonstrate that eam8 accelerates the transition from vegetative to reproductive growth and inflorescence development. We propose that eam8 was selected as barley cultivation moved to high-latitude short-season environments in Europe because it allowed rapid flowering in genetic backgrounds that contained a previously selected late-flowering mutation of the photoperiod response gene Ppd-H1. We show that eam8 mutants have increased expression of the floral activator HvFT1, which is independent of allelic variation at Ppd-H1. The selection of independent eam8 mutations shows that this strategy facilitates short growth-season adaptation and expansion of the geographic range of barley, despite the pronounced clock defect.

  19. Overexpression of cytokinin dehydrogenase genes in barley (Hordeum vulgare cv. Golden Promise fundamentally affects morphology and fertility.

    Directory of Open Access Journals (Sweden)

    Katarína Mrízová

    Full Text Available Barley is one of the most important cereal crops grown worldwide. It has numerous applications, but its utility could potentially be extended by genetically manipulating its hormonal balances. To explore some of this potential we identified gene families of cytokinin dehydrogenases (CKX and isopentenyl transferases, enzymes that respectively irreversibly degrade and synthesize cytokinin (CK plant hormones, in the raw sequenced barley genome. We then examined their spatial and temporal expression patterns by immunostaining and qPCR. Two CKX-specific antibodies, anti-HvCKX1 and anti-HvCKX9, predominantly detect proteins in the aleurone layer of maturing grains and leaf vasculature, respectively. In addition, two selected CKX genes were used for stable, Agrobacterium tumefaciens-mediated transformation of the barley cultivar Golden Promise. The results show that constitutive overexpression of CKX causes morphological changes in barley plants and prevents their transition to flowering. In all independent transgenic lines roots proliferated more rapidly and root-to-shoot ratios were higher than in wild-type plants. Only one transgenic line, overexpressing CKX under the control of a promoter from a phosphate transporter gene, which is expressed more strongly in root tissue than in aerial parts, yielded progeny. Analysis of several T1-generation plants indicates that plants tend to compensate for effects of the transgene and restore CK homeostasis later during development. Depleted CK levels during early phases of development are restored by down-regulation of endogenous CKX genes and reinforced de novo biosynthesis of CKs.

  20. Antioxidant activity of 100% and 80% methanol extracts from barley seeds (Hordeum vulgare L.): stabilization of sunflower oil

    Energy Technology Data Exchange (ETDEWEB)

    Anwar, F.; Abdul Qayyum, H. M.; Hussein, A. I.; Iqbal, S.

    2010-07-01

    The antioxidant potential of 100% and 80% methanol extracts from the seeds of three barley varieties (Jou 83, Jou 87 and Haider 93) was assessed. The extract yields from barley seeds ranged from 3.23% (Haider 93,100% methanol) to 5.31% (Jou 83, 80% methanol). The total phenolic contents, DPPH radical scavenging activity (IC50 values) and inhibition of linoleic acid oxidation of barley seed extracts (BSE) were determined to be 88.1-145.7 mg/100g, 90.8-168.6 {mu}g/mL and 62.6-74.6%, respectively. The antioxidant effectiveness of BSE was also assessed by stabilizing sunflower oil (SFO) with BSE at a concentration of 600 ppm (oil weight basis). The stabilized (treated with extract) and the control (without extract addition) SFO samples were subjected to accelerated (oven heating at 60 degree centigrade for 30 days, 8 h heating cycle/day) storage. These were analyzed at regular intervals for the extent of oxidative changes according to the measurements of their contents of peroxide value, para-anisidine value, conjugated dienes and conjugated trienes. Generally, the 80% methanol extract of barely seeds demonstrated better antioxidant action than the 100% methanol extract. The antioxidant activity of BSE was also found to be considerably varied among the varieties tested. The present results suggest that antioxidant extracts from barely seeds might be used to protect vegetable oils from oxidation. (Author) 32 refs.

  1. Antioxidant activity in barley (Hordeum Vulgare L.) grains roasted in a microwave oven under conditions optimized using response surface methodology.

    Science.gov (United States)

    Omwamba, Mary; Hu, Qiuhui

    2010-01-01

    Microwave processing and cooking of foods is a recent development that is gaining momentum in household as well as large-scale food applications. Barley contains phenol compounds which possess antioxidant activity. In this study the microwave oven roasting condition was optimized to obtain grains with high antioxidant activity measured as the ability to scavenge 1,1-diphenyl-2-picrylhydrazyl (DPPH) free radical. Antioxidant activity of grains roasted under optimum conditions was assessed based on DPPH radical scavenging activity, reducing power and inhibition of oxidation in linoleic acid system. The optimum condition for obtaining roasted barley with high antioxidant activity (90.5% DPPH inhibition) was found to be at 600 W microwave power, 8.5 min roasting time, and 61.5 g or 2 layers of grains. The roasting condition influenced antioxidant activity both individually and interactively. Statistical analysis showed that the model was significant (P < 0.0001). The acetone extract had significantly high inhibition of lipid peroxidation and DPPH radical scavenging activity compared to the aqueous extract and alpha-tocopherol. The reducing power of acetone extracts was not significantly different from alpha-tocopherol. The acetone extract had twice the amount of phenol content compared to the aqueous extract indicating its high extraction efficiency. GC-MS analysis revealed the presence of phenol acids, amino phenols, and quinones. The aqueous extract did not contain 3,4-dihydroxybenzaldehyde and 4-hydroxycinnamic acid which are phenol compounds reported to contribute to antioxidant activity in barley grain.

  2. Creation of the first ultra-low gluten barley (Hordeum vulgare L.) for coeliac and gluten-intolerant populations.

    Science.gov (United States)

    Tanner, Gregory J; Blundell, Malcolm J; Colgrave, Michelle L; Howitt, Crispin A

    2016-04-01

    Coeliac disease is a well-defined condition that is estimated to affect approximately 1% of the population worldwide. Noncoeliac gluten sensitivity is a condition that is less well defined, but is estimated to affect up to 10% of the population, and is often self-diagnosed. At present, the only remedy for both conditions is a lifelong gluten-free diet. A gluten-free diet is often expensive, high in fat and low in fibre, which in themselves can lead to adverse health outcomes. Thus, there is an opportunity to use novel plant breeding strategies to develop alternative gluten-free grains. In this work, we describe the breeding and characterization of a novel ultra-low gluten (ULG) barley variety in which the hordein (gluten) content was reduced to below 5 ppm. This was achieved using traditional breeding strategies to combine three recessive alleles, which act independently of each other to lower the hordein content in the parental varieties. The grain of the initial variety was shrunken compared to wild-type barleys. We implemented a breeding strategy to improve the grain size to near wild-type levels and demonstrated that the grains can be malted and brewed successfully. The ULG barley has the potential to provide novel healthy foods and beverages for those who require a gluten-free diet.

  3. The Efficiency of Barley (Hordeum vulgare Bran in Ameliorating Blood and Treating Fatty Heart and Liver of Male Rats

    Directory of Open Access Journals (Sweden)

    Khalid O. Abulnaja

    2015-01-01

    Full Text Available The current study focused on testing the hypolipidemic activity of two doses of barley bran on hypercholesterolemic male rats. Twenty-four male albino rats weighing 180–200 gm were divided into four groups. The first group (G1 was the negative control, the second group (G2 was the positive control group fed 2% cholesterol in the diet, and rats of the third and the fourth groups were fed 2% cholesterol and were cosupplemented with 5% and 10% barley bran, respectively, for 8 weeks. The hypercholesterolemic rats of (G2 showed an increase in lipid profile, liver enzymes, lactate dehydrogenase, creatine kinase-MB, and lipid peroxide and a decrease in antioxidant enzymes, whereas kidney function, fasting blood sugar, glycated hemoglobin total protein, and total bilirubin were not significantly affected compared with the negative control group in G1. Moreover, histology of heart, liver, and kidney of G2 rats showed histopathological changes compared with the negative control. Administration of the two doses of barley bran in G3 and G4 to the hypercholesterolemic rats ameliorated the level of lipids, liver enzymes, lactate dehydrogenase, and creatine kinase-MB. In addition, the histology of heart, liver, and kidney tissues nearly restored the normal state as in G1.

  4. Improving nitrogen use efficiency in barley (Hordeum vulgare L.) through the cisgenic approach

    DEFF Research Database (Denmark)

    Kichey, Thomas; Holme, Inger; Møller, Inge Skrumsager

    2009-01-01

    Barley is one of the major crops cultivated worldwide and constitutes an important basis for animal feed. However, the production is facing a number of challenges that will be accentuated in the years to come, in particular restrictions on the use of nitrogen (N) fertilizer. In order to improve t...... introductions of the gene of interest and the resistance gene for selection, respectively. The transgenic lines (T0), currently growing in greenhouse will be self pollinated and the molecular, physiological and agronomic characterization of subsequent generations will be undertaken....

  5. HvZIP7 mediates zinc accumulation in barley (Hordeum vulgare) at moderately high zinc supply

    DEFF Research Database (Denmark)

    Tiong, Jingwen; Mcdonald, Glenn K.; Genc, Yusuf

    2014-01-01

    were also generated to further understand the functions of HvZIP7 in metal transport. HvZIP7 is strongly induced by Zn deficiency, primarily in vascular tissues of roots and leaves, and its protein was localized in the plasma membrane. These properties are similar to its closely related homologs...... in dicots. Overexpression of HvZIP7 in barley plants increased Zn uptake when moderately high concentrations of Zn were supplied. Significantly, there was a specific enhancement of shoot Zn accumulation, with no measurable increase in iron (Fe), manganese (Mn), copper (Cu) or cadmium (Cd). HvZIP7 displays...

  6. Transformation of different barley (Hordeum vulgare L.) cultivars by Agrobacterium tumefaciens infection of in vitro cultured ovules

    DEFF Research Database (Denmark)

    Holme, Inger Bæksted; Brinch-Pedersen, Henrik; Lange, Mette;

    2008-01-01

    Most cultivars of higher plants display poor regeneration capacity of explants due to yet unknown genotypic determined mechanisms. This implies that technologies such as transformation often are restricted to model cultivars with good tissue characteristics. In the present paper, we add further...... evidence to our previous hypothesis that regeneration from young barley embryos derived from in vitro-cultured ovules is genotype independent. We investigated the ovule culture ability of four cultivars Femina, Salome, Corniche and Alexis, known to have poor response in other types of tissue culture...... vector pVec8-GFP harboring a hygromycin resistance gene and the green fluorescence protein (GFP) gene, was used for transformation. The results strongly indicate that the tissue culture response level in ovule culture is genotype independent. However, we did observe differences between cultivars...

  7. Carbon nanofibers suppress fungal inhibition of seed germination of maize (Zea mays) and barley (Hordeum vulgare L.) crop

    Energy Technology Data Exchange (ETDEWEB)

    Joshi, Anjali, E-mail: joshianjali1982@gmail.com; Sharma, Arti [Centre For Nanoscience and Nanotechnology, Panjab University, Chandigarh (India); Nayyar, Harsh [Department of Botany, Panjab University, Chandigarh (India); Verma, Gaurav [Dr. SS Bhatnagar University Institute of Chemical Engineering and Technology, Panjab University, Chandigarh (India); Dharamvir, Keya [Department of Physics, Panjab University, Chandigarh (India)

    2015-08-28

    Carbon nanofibers (CNFs) are one of allotropes of carbon, consists of graphene layers arrangement in the form of stacked cones or like a cup diameter in nanometer and several millimeters in length. Their extraordinary mechanical, chemical and electronic properties are due to their small size. CNFs have been successfully applied in field of medicine in variety of diagnostic methods. They proven to be an excellent system for drug delivery, tissue regeneration, biosensor etc. This research focuses the applications of CNFs in all fields of Agriculture. In the we treated some fungal disease seed of maize and barley using functionalised CNFs. We find that the tested seeds grow just as well as the healthy seeds whereas the untreated fungal disease seeds, by themselves show very poor germination and seedling growth. This simple experiment shows the extraordinary ability of Carbon nanofibers in carrying effectively inside the germinated seeds.

  8. Analysis of early events in the interaction between Fusarium graminearum and the susceptible barley (Hordeum vulgare) cultivar Scarlett

    DEFF Research Database (Denmark)

    Yang, Fen; Jensen, J.D.; Svensson, Birte;

    2010-01-01

    after inoculation. This coincided with the appearance of discrete F. graminearum-induced proteolytic fragments of beta-amylase. Based on these results, analysis of grain proteome changes prior to extensive proteolysis enabled identification of barley proteins responding early to infection by the fungus...... function was identified. Quantitative real-time RT-PCR analysis of selected genes showed a correlation between high gene expression and detection of the corresponding proteins. Fungal genes encoding alkaline protease and endothiapepsin were expressed during 1-3 days after inoculation, making them...... candidates for generation of the observed beta-amylase fragments. These fragments have potential to be developed as proteome-level markers for fungal infection that are also informative about grain protein quality....

  9. Carbon nanofibers suppress fungal inhibition of seed germination of maize (Zea mays) and barley (Hordeum vulgare L.) crop

    Science.gov (United States)

    Joshi, Anjali; Sharma, Arti; Nayyar, Harsh; Verma, Gaurav; Dharamvir, Keya

    2015-08-01

    Carbon nanofibers (CNFs) are one of allotropes of carbon, consists of graphene layers arrangement in the form of stacked cones or like a cup diameter in nanometer and several millimeters in length. Their extraordinary mechanical, chemical and electronic properties are due to their small size. CNFs have been successfully applied in field of medicine in variety of diagnostic methods. They proven to be an excellent system for drug delivery, tissue regeneration, biosensor etc. This research focuses the applications of CNFs in all fields of Agriculture. In the we treated some fungal disease seed of maize and barley using functionalised CNFs. We find that the tested seeds grow just as well as the healthy seeds whereas the untreated fungal disease seeds, by themselves show very poor germination and seedling growth. This simple experiment shows the extraordinary ability of Carbon nanofibers in carrying effectively inside the germinated seeds.

  10. Drought-related secondary metabolites of barley (Hordeum vulgare L.) leaves and their metabolomic quantitative trait loci.

    Science.gov (United States)

    Piasecka, Anna; Sawikowska, Aneta; Kuczyńska, Anetta; Ogrodowicz, Piotr; Mikołajczak, Krzysztof; Krystkowiak, Karolina; Gudyś, Kornelia; Guzy-Wróbelska, Justyna; Krajewski, Paweł; Kachlicki, Piotr

    2017-03-01

    Determining the role of plant secondary metabolites in stress conditions is problematic due to the diversity of their structures and the complexity of their interdependence with different biological pathways. Correlation of metabolomic data with the genetic background provides essential information about the features of metabolites. LC-MS analysis of leaf metabolites from 100 barley recombinant inbred lines (RILs) revealed that 98 traits among 135 detected phenolic and terpenoid compounds significantly changed their level as a result of drought stress. Metabolites with similar patterns of change were grouped in modules, revealing differences among RILs and parental varieties at early and late stages of drought. The most significant changes in stress were observed for ferulic and sinapic acid derivatives as well as acylated glycosides of flavones. The tendency to accumulate methylated compounds was a major phenomenon in this set of samples. In addition, the polyamine derivatives hordatines as well as terpenoid blumenol C derivatives were observed to be drought related. The correlation of drought-related compounds with molecular marker polymorphisms resulted in the definition of metabolomic quantitative trait loci in the genomic regions of single-nucleotide polymorphism 3101-111 and simple sequence repeat Bmag0692 with multiple linkages to metabolites. The associations pointed to genes related to the defence response and response to cold, heat and oxidative stress, but not to genes related to biosynthesis of the compounds. We postulate that the significant metabolites have a role as antioxidants, regulators of gene expression and modulators of protein function in barley during drought. © 2016 The Authors. The Plant Journal published by John Wiley & Sons Ltd and Society for Experimental Biology.

  11. Antioxidant activity of 100% and 80% methanol extracts from barley seeds (Hordeum vulgare L.: stabilization of sunflower oil

    Directory of Open Access Journals (Sweden)

    Iqbal, Shahid

    2010-09-01

    Full Text Available The antioxidant potential of 100% and 80% methanol extracts from the seeds of three barley varieties (Jou 83, Jou 87 and Haider 93 was assessed. The extract yields from barley seeds ranged from 3.23% (Haider 93,100% methanol to 5.31% (Jou 83, 80% methanol. The total phenolic contents, DPPH radical scavenging activity (IC50 values and inhibition of linoleic acid oxidation of barley seed extracts (BSE were determined to be 88.1-145.7 mg/100g, 90.8-168.6 μg/mL and 62.6-74.6%, respectively. The antioxidant effectiveness of BSE was also assessed by stabilizing sunflower oil (SFO with BSE at a concentration of 600 ppm (oil weight basis. The stabilized (treated with extract and the control (without extract addition SFO samples were subjected to accelerated (oven heating at 60ºC for 30 days, 8 h heating cycle/day storage. These were analyzed at regular intervals for the extent of oxidative changes according to the measurements of their contents of peroxide value, para-anisidine value, conjugated dienes and conjugated trienes. Generally, the 80% methanol extract of barely seeds demonstrated better antioxidant action than the 100% methanol extract. The antioxidant activity of BSE was also found to be considerably varied among the varieties tested. The present results suggest that antioxidant extracts from barely seeds might be used to protect vegetable oils from oxidation.El potencial antioxidante de extractos de metanol al 100% y el 80% de semillas de tres variedades de cebada (Jou 83, Jou 87 y Haider 93 fue evaluada. El rendimiento de los extractos de las semillas de cebada vario desde un 3.23% (Haider, 100% methanol a un 5.31% (Jou 83, 80% metanol. El contenido total de fenoles, la actividad atrapadora del radical DPPH (valores IC50 y la inhibición de la oxidación del ácido linoleico de los extractos de semilla de cebada (BSE fueron 88.1-145.7 mg/100g, 90.8-168.6 μg/mL y 62.6- 74.6%, respectivamente. La efectividad antioxidante de BSE fue tambi

  12. Efficacy of Si fertilization to modulate the heavy metals absorption by barley (Hordeum vulgare L.) and pea (Pisum sativum L.).

    Science.gov (United States)

    Xiao, Wei; Yuqiao, Liu; Qiang, Zhan; Matichenkov, Vladimir; Bocharnikova, Elena; Dåstøl, Magne

    2016-10-01

    Silicon-based fertilizers and soil amendments can have direct and indirect positive influences on cultivated plants. The solid forms of Si-based substances, the most widespread in use, are efficient only at high application rates due to their low level of solubility. Several types of Si-based substances such as fumed silica, slags from the iron and steel industry, modified slags, and a Si-rich product were tested using barley and pea as silicon accumulative and non-accumulative plants, respectively, at two application rates. The plants were grown under toxic concentrations of heavy metals in a greenhouse. Si-rich materials high in water-soluble Si had a positive effect at both the low and high application rates, and for both plant species. This type of substance can be regarded as Si fertilizer, demonstrating greater efficiency at a low application rate and lessened efficiency at a high application rate for protection of the cultivated plants against accumulation of the heavy metals.

  13. Sowing Density: A Neglected Factor Fundamentally Affecting Root Distribution and Biomass Allocation of Field Grown Spring Barley (Hordeum Vulgare L.).

    Science.gov (United States)

    Hecht, Vera L; Temperton, Vicky M; Nagel, Kerstin A; Rascher, Uwe; Postma, Johannes A

    2016-01-01

    Studies on the function of root traits and the genetic variation in these traits are often conducted under controlled conditions using individual potted plants. Little is known about root growth under field conditions and how root traits are affected by agronomic practices in particular sowing density. We hypothesized that with increasing sowing density, root length density (root length per soil volume, cm cm(-3)) increases in the topsoil as well as specific root length (root length per root dry weight, cm g(-1)) due to greater investment in fine roots. Therefore, we studied two spring barley cultivars at ten different sowing densities (24-340 seeds m(-2)) in 2 consecutive years in a clay loam field in Germany and established sowing density dose-response curves for several root and shoot traits. We took soil cores for measuring roots up to a depth of 60 cm in and between plant rows (inter-row distance 21 cm). Root length density increased with increasing sowing density and was greatest in the plant row in the topsoil (0-10 cm). Greater sowing density increased specific root length partly through greater production of fine roots in the topsoil. Rooting depth (D50) of the major root axes (root diameter class 0.4-1.0 mm) was not affected. Root mass fraction decreased, while stem mass fraction increased with sowing density and over time. Leaf mass fraction was constant over sowing density but greater leaf area was realized through increased specific leaf area. Considering fertilization, we assume that light competition caused plants to grow more shoot mass at the cost of investment into roots, which is partly compensated by increased specific root length and shallow rooting. Increased biomass per area with greater densities suggest that density increases the efficiency of the cropping system, however, declines in harvest index at densities over 230 plants m(-2) suggest that this efficiency did not translate into greater yield. We conclude that plant density is a

  14. Effect of pH and Recombinant Barley (Hordeum vulgare L.) Endoprotease B2 on Degradation of Proteins in Soaked Barley

    DEFF Research Database (Denmark)

    Christensen, Jesper Bjerg; Dionisio, Giuseppe; Poulsen, Hanne Damgaard

    2014-01-01

    Nonfermented soaking of barley feedstuff has been established as an in vitro procedure prior to the feeding of pigs as it can increase protein digestibility. In the current study, two feed cultivars of barley (Finlissa and Zephyr) were soaked in vitro either nonbuffered or buffered at pH 3.6 and ...

  15. Localisation of genes for resistance against ¤Blumeria graminis¤ f.sp. ¤hordei¤ and ¤Puccinia graminis¤ in a cross between a barley cultivar and a wild barleyHordeum vulgare¤ ssp. ¤spontaneum¤) line

    DEFF Research Database (Denmark)

    Backes, G.; Madsen, L.H.; Jaiser, H.

    2003-01-01

    for the infection in this experiment. Moreover, powdery mildew disease severity was observed in the field at two different epidemic stages. In addition to other DNA markers, the map included 13 RGA (resistance gene analog) loci. The structure of the data demanded a non-parametric QTL-analysis. For each of the four......The aims of this investigation have been to map new (quantitative) resistance genes against powdery mildew, caused by Blumeria graminis f.sp. hordei L., and leaf rust, caused by Puccinia hordei L., in a cross between the barley (Hordeum vulgare ssp. vulgare) cultivar "Vada" and the wild barley...... the results for the different powdery mildew related traits and the relation between qualitative and quantitative resistance are discussed....

  16. Fine structure of plastids during androgenesis in Hordeum vulgare L.

    Directory of Open Access Journals (Sweden)

    Fortunat Młodzianowski

    2014-01-01

    Full Text Available The fine structure of plastids was studied in the course of androgenesis in in the pollen of Hordeum vulgare L. It was found that these organelles occur in all stages of androgenesis. Their structure was simple and was frequently manifested on the cross section only by the presence of the envelope and matrix of different degree of density. Single thylakoids, nucleoid-like regions and starch grains were, however, also noted. The structure of plastids in embryoids formed from microspores of barley was compared with embryos developed from fertilized egg cell, and we did not found any fundamental differences between them. However, only plastid ribosomes were difficult to identify on ultrathin sections in embryoids and in the embryos.

  17. 大麦(Hordeum vulgare)昼夜节律钟基因CCA1的克隆及表达分析%Cloning and Expression Analysis of Circadian Clock Gene CCA1 in Barley (Hordeum vulgare)

    Institute of Scientific and Technical Information of China (English)

    邢国芳; 宋萌; 姚涵; 韩渊怀

    2012-01-01

    CCA 1 gene plays an important role in circadian clock sensitivity in rice (Oryza sativa L. ) and Arabidopsis thaliana. In this study, CCAl gene in barley was cloned by RT-PCR using homological primers based on the highly conserved region of the multiple alignments of the rice and Arabidopsis. The similarities of this sequence were up to 72% and 69%, respectively, to corresponding mRNA sequences of rice and maize in BLASTx of GenBank database. Using ORF Finder software, a 2157 bp open reading frame was found to code 718 amino acids. Using Compute pI/Mw tool, the amino acid sequence was analyzed, and it revealed that the molecular weight of this protein was about 77 769. 4 Da, and isoelectric point was about 6. 55. We established fluorescence quantitative RT-PCR system with barley inbred lines HUADAMAI 1 and HUADAMAI 2, and studied the expression of CCAl in leaf under 16h/8h (light/ dark) conditions. Expression analysis showed that the gene expression peaked at dawn (ZTO) then gradually declined from ZTO to ZT15, bottomed at ZT15, then increased and returned to the initial level at ZT24. This study will provide information of barley CCAl gene for further studying the function in regulating photoperiod sensitivity in barley, and provide scientific basis for clarifying the mechanism of the circadian synchronization in barley.%昼夜节律钟基因CCA1在调解水稻和拟南芥的光周期反应中起着重要作用.利用BLAST手段以玉米中的CCA1基因序列作为靶序列,调取Genbank数据库信息,并结合RT-PCR方法获得了大麦的cDNA同源序列.BLASTx分析发现其与水稻和玉米的序列相似性分别达到72%和69%.通过ORF Finder软件分析发现,该序列包含一个2157 bp的开放阅读框,编码一个由718个氨基酸残基组成的蛋白序列,其分子量为77769.4 Da,等电点为6.55.采用实时荧光定量PCR分析发现,随光照时间的变化,该基因在大麦叶片中的表达量呈现出白天不断降低而夜晚逐渐

  18. Efeitos de potenciais de água no solo, em diferentes estádios fenológicos da cultura da cevada (Hordeum vulgare L. Effects of soil water potentials at different phenological phases of barley crop (Hordeum vulgare L.

    Directory of Open Access Journals (Sweden)

    M.A. Urchei

    1994-12-01

    Full Text Available Objetivando avaliar os efeitos de défices hídricos, em três estádios fonológicos da cultura da cevada (Hordeum vulgare L., foi conduzido experimento em vasos, com delineamento em blocos ao acaso. Foram utilizados nove tratamentos decorrentes da combinação dos potenciais mínimos de água no solo de -0,05, -0,20 e -1,50 MPa, com os estádios fenológicos de máximo perfilhamento, florescimento e grão leitoso, permanecendo uniformizados durante o restante do ciclo, entre os potenciais de -0,01 a -0,05 MPa. Os resultados de produção, peso e teor de proteína dos grãos, tamanho de espigas, número total e número de espigas chochas, mostraram que os efeitos de défices hídricos variaram com a intensidade, duração e estádio fenológico da cultura, onde o estádio de florescimento mostrou-se mais sensível ao défice de água. A ocorrência de défice hídrico intenso, em cada um dos estádios, bem como ciclos repetidos de défices moderados ou intensos, levaram à diminuições significativas na produção de grãos, além de ocorrer tendência ao aumento do teor de protema dos grãos. O manejo da irrigação na cultura da cevada, quando se busca a máxima eficiência no uso da água, deve levar em conta os diferentes estádios fenológicos.The experiment was carried out under greenhouse conditions, with the objective of evaluating the effects of water deficits in three phenological phases of barley crop (Hordeum vulgare L.. Pots were arranged in a randomized block design with nine treatments. They originated from the combination of minimum soil water potentials of -0,05, -0,20 and -1,50 MPa, with the phenological phases of maximum tillering, flowering and milky grain, having been hold uniformly along the rest of the cycle, between -0,01 and -0,05 MPa potentials. Weight of grain, protein content, spike sizes, spike total number and number of hollow spikes, showed that water deficit effects varied with the intensity, duration and

  19. Powdery Mildew Resistance in 268 Entries of Hordeum vulgare

    DEFF Research Database (Denmark)

    Jiang, W.M.; Jørgensen, Jørgen Helms; Torp, J

    1984-01-01

    A collection of 24 'Spontaneum' barley [H. vulgare ssp. spontaneum] entries and one comprising 244 Ethiopian barleys [H. vulgare ssp. vulgare] were tested for resistance to 4 powdery mildew [used by Erysiphe graminis f. sp. hordei] cultures that carried genes for virulence corresponding to most...... of the known powdery mildew resistance genes. The infection types and spectra of resistance were compared to those of 31 test lines with 35 known resistance genes to find possible new resistance genes and to reveal known resistance genes. The collections may possess some new and some known resistance genes...

  20. Germination and microwave processing of barley (Hordeum vulgare L) changes the structural and physicochemical properties of β-d-glucan & enhances its antioxidant potential.

    Science.gov (United States)

    Ahmad, Mudasir; Gani, Adil; Shah, Asima; Gani, Asir; Masoodi, F A

    2016-11-20

    The nutraceutical potential of β-d-glucan is largely dependent on its structure, size and viscosity. The present study analyzed the effect of germination and microwave processing of barley on the structural, size, antioxidant and thermal characteristics of β-d-glucan. The molecular weight and viscosity of β-d-glucan obtained from germinated barley (GGB) were the lowest (144kDa and 37.33cp) as compared to β-d-glucan from microwave processed barley (GMB) and unprocessed barley (GUB). The GGB exhibited higher antioxidant potential than GMB and GUB. The Structural elucidation by ATR-FTIR revealed scission in polymeric chain and β glycosydic linkage of β-d-glucan obtained from processed barley. The highest peak intensity at glycosydic linkage in GGB confirms more scission in the molecule. The DSC curve of GGB showed the highest transition temperature. It was concluded that germination of barley can be a good approach for enhancing the antioxidant potential of β-d-glucan.

  1. Impact of Pre-Anthesis Water Deficit on Yield and Yield Components in Barley (Hordeum vulgare L. Plants Grown under Controlled Conditions

    Directory of Open Access Journals (Sweden)

    Zakaria I. Al-Ajlouni

    2016-05-01

    Full Text Available Drought at pre-anthesis stages can influence barley growth and results in yield losses. Therefore, it is important to understand how drought at pre-anthesis can affect different traits associated with yield reduction in barley. The objective of this study was to understand the relevance of the genetic background of major flowering time genes in barley plants subjected to pre-anthesis drought and its impact on yield and yield components. A glasshouse experiment using a Randomized Complete Block Design was conducted to investigate the effect of drought and its timing on yield and yield components on eleven barley genotypes, which were selected to represent genetic diversity of major flowering time genes (PPDH1, PPDH2, HvVrn1, HvVrn2 and HvVrn3. Barley plants were exposed to three water regimes, non-stressed and stressed, which was applied at two pre-anthesis growth stages, tillering (SS and stem elongation (SE. Results identified differences among genotypes in all measured traits. Grain yield, grain number and "thousand kernel weight" were reduced in all genotypes due to drought, irrespective of the growth stage. Early flowering genotypes had better performance as reflected in higher yield compared with late flowering genotypes. Results verified the fundamental importance of early flowering to improve productivity in response to pre-anthesis drought. The results of this study can help in selecting barley lines for future breeding purposes with improved resilience to drought conditions in Mediterranean environments.

  2. Barley (Hordeum vulgare) in the Okhotsk culture (5th–10th century AD) of northern Japan and the role of cultivated plants in hunter–gatherer economies

    Science.gov (United States)

    Sergusheva, Elena A.; Müller, Stefanie; Spengler, Robert N.; Goslar, Tomasz; Kato, Hirofumi; Wagner, Mayke; Weber, Andrzej W.; Tarasov, Pavel E.

    2017-01-01

    This paper discusses archaeobotanical remains of naked barley recovered from the Okhotsk cultural layers of the Hamanaka 2 archaeological site on Rebun Island, northern Japan. Calibrated ages (68% confidence interval) of the directly dated barley remains suggest that the crop was used at the site ca. 440–890 cal yr AD. Together with the finds from the Oumu site (north-eastern Hokkaido Island), the recovered seed assemblage marks the oldest well-documented evidence for the use of barley in the Hokkaido Region. The archaeobotanical data together with the results of a detailed pollen analysis of contemporaneous sediment layers from the bottom of nearby Lake Kushu point to low-level food production, including cultivation of barley and possible management of wild plants that complemented a wide range of foods derived from hunting, fishing, and gathering. This qualifies the people of the Okhotsk culture as one element of the long-term and spatially broader Holocene hunter–gatherer cultural complex (including also Jomon, Epi-Jomon, Satsumon, and Ainu cultures) of the Japanese archipelago, which may be placed somewhere between the traditionally accepted boundaries between foraging and agriculture. To our knowledge, the archaeobotanical assemblages from the Hokkaido Okhotsk culture sites highlight the north-eastern limit of prehistoric barley dispersal. Seed morphological characteristics identify two different barley phenotypes in the Hokkaido Region. One compact type (naked barley) associated with the Okhotsk culture and a less compact type (hulled barley) associated with Early–Middle Satsumon culture sites. This supports earlier suggestions that the “Satsumon type” barley was likely propagated by the expansion of the Yayoi culture via south-western Japan, while the “Okhotsk type” spread from the continental Russian Far East region, across the Sea of Japan. After the two phenotypes were independently introduced to Hokkaido, the boundary between both barley

  3. Barley (Hordeum vulgare) in the Okhotsk culture (5th-10th century AD) of northern Japan and the role of cultivated plants in hunter-gatherer economies.

    Science.gov (United States)

    Leipe, Christian; Sergusheva, Elena A; Müller, Stefanie; Spengler, Robert N; Goslar, Tomasz; Kato, Hirofumi; Wagner, Mayke; Weber, Andrzej W; Tarasov, Pavel E

    2017-01-01

    This paper discusses archaeobotanical remains of naked barley recovered from the Okhotsk cultural layers of the Hamanaka 2 archaeological site on Rebun Island, northern Japan. Calibrated ages (68% confidence interval) of the directly dated barley remains suggest that the crop was used at the site ca. 440-890 cal yr AD. Together with the finds from the Oumu site (north-eastern Hokkaido Island), the recovered seed assemblage marks the oldest well-documented evidence for the use of barley in the Hokkaido Region. The archaeobotanical data together with the results of a detailed pollen analysis of contemporaneous sediment layers from the bottom of nearby Lake Kushu point to low-level food production, including cultivation of barley and possible management of wild plants that complemented a wide range of foods derived from hunting, fishing, and gathering. This qualifies the people of the Okhotsk culture as one element of the long-term and spatially broader Holocene hunter-gatherer cultural complex (including also Jomon, Epi-Jomon, Satsumon, and Ainu cultures) of the Japanese archipelago, which may be placed somewhere between the traditionally accepted boundaries between foraging and agriculture. To our knowledge, the archaeobotanical assemblages from the Hokkaido Okhotsk culture sites highlight the north-eastern limit of prehistoric barley dispersal. Seed morphological characteristics identify two different barley phenotypes in the Hokkaido Region. One compact type (naked barley) associated with the Okhotsk culture and a less compact type (hulled barley) associated with Early-Middle Satsumon culture sites. This supports earlier suggestions that the "Satsumon type" barley was likely propagated by the expansion of the Yayoi culture via south-western Japan, while the "Okhotsk type" spread from the continental Russian Far East region, across the Sea of Japan. After the two phenotypes were independently introduced to Hokkaido, the boundary between both barley domains possibly

  4. Lactic acid and thermal treatments trigger the hydrolysis of myo-inositol hexakisphosphate and modify the abundance of lower myo-inositol phosphates in barley (Hordeum vulgare L..

    Directory of Open Access Journals (Sweden)

    Barbara U Metzler-Zebeli

    Full Text Available Barley is an important source of dietary minerals, but it also contains myo-inositol hexakisphosphate (InsP6 that lowers their absorption. This study evaluated the effects of increasing concentrations (0.5, 1, and 5%, vol/vol of lactic acid (LA, without or with an additional thermal treatment at 55°C (LA-H, on InsP6 hydrolysis, formation of lower phosphorylated myo-inositol phosphates, and changes in chemical composition of barley grain. Increasing LA concentrations and thermal treatment linearly reduced (P<0.001 InsP6-phosphate (InsP6-P by 0.5 to 1 g compared to the native barley. In particular, treating barley with 5% LA-H was the most efficient treatment to reduce the concentrations of InsP6-P, and stimulate the formation of lower phosphorylated myo-inositol phosphates such as myo-inositol tetraphosphate (InsP4 and myo-inositol pentaphosphates (InsP5. Also, LA and thermal treatment changed the abundance of InsP4 and InsP5 isomers with Ins(1,2,5,6P4 and Ins(1,2,3,4,5P5 as the dominating isomers with 5% LA, 1% LA-H and 5% LA-H treatment of barley, resembling to profiles found when microbial 6-phytase is applied. Treating barley with LA at room temperature (22°C increased the concentration of resistant starch and dietary fiber but lowered those of total starch and crude ash. Interestingly, total phosphorus (P was only reduced (P<0.05 in barley treated with LA-H but not after processing of barley with LA at room temperature. In conclusion, LA and LA-H treatment may be effective processing techniques to reduce InsP6 in cereals used in animal feeding with the highest degradation of InsP6 at 5% LA-H. Further in vivo studies are warranted to determine the actual intestinal P availability and to assess the impact of changes in nutrient composition of LA treated barley on animal performance.

  5. Effects of extraction solvent mixtures on antioxidant activity evaluation and their extraction capacity and selectivity for free phenolic compounds in barley (Hordeum vulgare L.).

    Science.gov (United States)

    Zhao, Haifeng; Dong, Jianjun; Lu, Jian; Chen, Jian; Li, Yin; Shan, Lianju; Lin, Yan; Fan, Wei; Gu, Guoxian

    2006-09-20

    Four kinds of solvent extracts from three Chinese barley varieties (Ken-3, KA4B, and Gan-3) were used to examine the effects of extraction solvent mixtures on antioxidant activity evaluation and their extraction capacity and selectivity for free phenolic compounds in barley through free radical scavenging activity, reducing power and metal chelating activity, and individual and total phenolic contents. Results showed that extraction solvent mixtures had significant impacts on antioxidant activity estimation, as well as different extraction capacity and selectivity for free phenolic compounds in barley. The highest DPPH* and ABTS*+ scavenging activities and reducing power were found in 80% acetone extracts, whereas the strongest *OH scavenging activity, O2*- scavenging activity, and metal chelating activity were found in 80% ethanol, 80% methanol, and water extracts, respectively. Additionally, 80% acetone showed the highest extraction capacity for (+)-catechin and ferulic, caffeic, vanillic, and p-coumaric acids, 80% methanol for (-)-epicatechin and syringic acid, and water for protocatechuic and gallic acids. Furthermore, correlations analysis revealed that TPC, reducing power, DPPH* and ABTS*+ scavenging activities were well positively correlated with each other (p antioxidant activity, 80% acetone was recommended to extract free phenolic compounds from barley. DPPH* scavenging activity and ABTS*+ scavenging activity or reducing power could be used to assess barley antioxidant activity.

  6. Purification and characterization of three chitinases and one beta-1,3-glucanase accumulating in the medium of cell suspension cultures of barley (Hordeum vulgare L.)

    DEFF Research Database (Denmark)

    Kragh, K.M.; Jacobsen, S.; Dalgaard Mikkelsen, J.;

    1991-01-01

    chromatography. Two of the chitinases were identified as the previously described endochitinases T and C from barley grain. The third and novel chitinase, designated K, was the major basic chitinase in the medium constituting 4% of the soluble protein. Chitinase K was found to be a 33-kDa endochitinase with p...... chitinases from barley aleurone and barley, bean and potato leaves. The purified beta-1,3-glucanase with a molecular weight (MW) of 32 kDa and pI greater-than-or-equal-to 9.8 constituted 1% of the soluble protein in the medium. Based on similar MW, pI and amino acid composition as well as identical N...

  7. Shoot apex development date of anthesis and grain yield of autumn-sown spring and winter barley hordeum-vulgare after different sowing times

    DEFF Research Database (Denmark)

    Knopp, E.

    1985-01-01

    One spring and eight winter barley cultivars were sown at intervals from the middle of September (normal) until the end of October (late). The apical meristem of the spring cultivar had developed furthest until the onset of winter. It had started ear differentiation after normal sowing. Among...

  8. The effect of temperature and rainfall on participation of the pathogens causing root and stem rot in spring barley (Hordeum vulgare L.

    Directory of Open Access Journals (Sweden)

    Barbara Łacicowa

    2013-12-01

    Full Text Available Field experiments conducted in the years 1990-1995 were localized at the Plaiit Cultivation Station, Ulhówek to repeat the cultivation of spring barley cultivars Roland and Lot. In conditions of monoculture, Bipolaris sorokiniana and Fusarium culmorum were of the foremost importance in causing root and stem rot. The proportion of infected plants did not increase with time. Depending on the period of vegetation and the cultivar, the percentage of seedlings with necrosis symptoms ranged from 6% to 53,5% and that of stem base rot from 14% to 59%. In the case of both cultivars. root and stem rot was especially intensive in the third successive season of vegetation, i, e,. in 1992. That season was characterized by warm and wet weather conditions. favourable for the infection of seedlings by B.sorokiniane during the period of six weeks after the sowing of grain. Bipolaris sorokiniana always had the greatest proportion in the infction of spring barley but not in the seasons distinguished by hot and dry weather conditions. On the other hand, during dry and hot weather conditions the only or the dominating fungus obtained from the infcted stem base after the heading of spring barley was F. culmorum. In conditions of monoculture, favourable for root and stem rot of spring barley, the temperature and rainfalls clearly distinguished the proportion of B. sorokiniana and F. culmorum in plant infection.

  9. Shoot apex development date of anthesis and grain yield of autumn-sown spring and winter barley hordeum-vulgare after different sowing times

    DEFF Research Database (Denmark)

    Knopp, E.

    1985-01-01

    One spring and eight winter barley cultivars were sown at intervals from the middle of September (normal) until the end of October (late). The apical meristem of the spring cultivar had developed furthest until the onset of winter. It had started ear differentiation after normal sowing. Among the...

  10. DNA binding sites recognised in vitro by a knotted class 1 homeodomain protein encoded by the hooded gene, k, in barley (Hordeum vulgare)

    DEFF Research Database (Denmark)

    Krusell, L; Rasmussen, I; Gausing, K

    1997-01-01

    of knotted1 from maize was isolated from barley seedlings and expressed as a maltose binding protein fusion in E. coli. The purified HvH21-fusion protein selected DNA fragments with 1-3 copies of the sequence TGAC. Gel shift experiments showed that the TGAC element was required for binding and the results...

  11. Evaluation of the mature grain phytase candidate HvPAPhy_a gene in barley (Hordeum vulgare L.) using CRISPR/Cas9 and TALENs

    DEFF Research Database (Denmark)

    Holme, Inger B; Wendt, Toni; Gil-Humanes, Javier

    2017-01-01

    In the present study, we utilized TALEN- and CRISPR/Cas9-induced mutations to analyze the promoter of the barley phytase gene HvPAPhy_a. The purpose of the study was dual, validation of the PAPhy_a enzyme as the main contributor of the mature grain phytase activity (MGPA), as well as validating...

  12. Remodeling of the major light-harvesting antenna protein of PSII protects the young leaves of barley (Hordeum vulgare L.) from photoinhibition under prolonged iron deficiency.

    Science.gov (United States)

    Saito, Akihiro; Iino, Tomohisa; Sonoike, Kintake; Miwa, Eitaro; Higuchi, Kyoko

    2010-12-01

    Because of the high demand for iron of the photosynthetic apparatus in thylakoid membranes, iron deficiency primarily affects the electron transfer between the two photosystems (PSI and PSII), resulting in photooxidative damage in plants. However, in barley, PSII is protected against photoinhibition, and the plant survives even with a low iron content in its chlorotic leaves. In this study, we report an adaptation mechanism of the photosynthetic apparatus in barley to iron deficiency, which is concomitant with the remodeling of a PSII antenna system. Transcriptome analysis revealed that long-term iron deficiency induced the expression of two genes of the major light-harvesting Chl a/b-binding protein of PSII (LHCII), namely HvLhcb1.11 and HvLhcb1.12. Chl fluorescence analysis of the wild type and Lhcb1-less chlorina mutants clearly showed that non-photochemical quenching (NPQ) of the wild type was increased by approximately 200% by iron deficiency, whereas NPQ of chlorina mutants did not change significantly under iron deficiency. The mutant showed severe photodamage in young leaves under prolonged iron deficiency, suggesting that the HvLhcb1 protein is essential for both thermal dissipation and photoprotection in iron-deficient barley. Analysis of thylakoid protein complexes revealed that the proportion of the monomeric form of Lhcb1 significantly increased in barley grown under iron-deficient conditions. We hypothesize that alteration of the HvLhcb1 subpopulations modifies the organization of LHCII in the thylakoid membranes, which is a key step for thermal dissipation to compensate for excess excitation energy and thereby protect the photosystems from serious damage in iron-deficient barley leaves.

  13. Monosomic and double monosomic substitutions of Hordeum bulbosum L. chromosomes into H. vulgare L.

    Science.gov (United States)

    Pickering, R A

    1992-07-01

    One of the aims of the interspecific crossing programme between Hordeum vulgare L. and H. bulbosum L. has been to introgress desirable genes into barley from the wild species. However, despite their close taxonomic relationship there have been few reports of achieving this objective using amphidiploid hybrids. In order to broaden the range of available hybrids, partially fertile triploids between H. vulgare (2n = 2x = 14) and H. bulbosum (2n = 4x = 28) were developed and crossed with H. vulgare as female parent. From 580 progeny which were screened, eight putative single monosomic chromosome substitution lines and one double monosomic substitution were identified by cytological analysis. These involved the substitution of H. vulgare chromosome 1 (two lines), 6 (four lines), 6L (one line), 7 (one line) and 1 + 4 (one line) by their respective H. bulbosum homoeologues. The H. bulbosum chromosome was frequently eliminated during plant development, but it was observed regularly in pollen mother cells of two lines. However, pairing between the H. bulbosum chromosome and its H. vulgare homoeologue was low. Several of the lines were more resistant than their H. vulgare parents to powdery mildew (Erysiphe graminis DC. f.sp. hordei Em. Marchai), net blotch (Drechslera teres Sacc.) and scald (Rhynchosporium secalis (Oudem.) Davis). Apart from their use in studying genome relationships, their value to plant breeders will depend on the ease of inducing translocations between the parental chromosomes.

  14. Physiological, Biochemical and Molecular Characterization of Barley (Hordeum vulgare L.) and Maize (Zea mays L.) for Improving Manganese Efficiency

    DEFF Research Database (Denmark)

    Long, Lizhi

    and the interaction between latent Mn deficiency and light stress in maize plants. The obtained results showed that latent Mn deficiency decreased the utilization of photosynthetically active light, inhibited the ability to perform photosynthetic state transitions and the response of net photosynthetic CO2......Manganese (Mn) deficiency is a nutritional problem, causing significant reductions in crop yields and in severe cases resulting in complete loss of crops during winter time. Different plant species and genotypes within the same species vary in their tolerance with respect to growth in soils...... with low Mn availability, a phenomenon referred to as Mn efficiency. Iron-regulated transporter 1 (IRT1), known to be correlated with Mn uptake capacity and Mn efficiency in barley, was characterized using barley RNAi lines. The obtained results showed that HvIRT1 was involved in uptake and root...

  15. Wheat (Triticum aestivum L.) and barley (Hordeum vulgare L.) multiple inositol polyphosphate phosphatases (MINPPs) are phytases expressed during grain filling and germination.

    Science.gov (United States)

    Dionisio, Giuseppe; Holm, Preben B; Brinch-Pedersen, Henrik

    2007-03-01

    At present, little is known about the phytases of plant seeds in spite of the fact that this group of enzymes is the primary determinant for the utilization of the major phosphate storage compound in seeds, phytic acid. We report the cloning and characterization of complementary DNAs (cDNAs) encoding one of the groups of enzymes with phytase activity, the multiple inositol phosphate phosphatases (MINPPs). Four wheat cDNAs (TaPhyIIa1, TaPhyIIa2, TaPhyIIb and TaPhyIIc) and three barley cDNAs (HvPhyIIa1, HvPhyIIa2 and HvPhyIIb) were isolated. The open reading frames ranged from 1548 to 1554 bp and the level of homology between the barley and wheat proteins ranged from 90.5% to 91.9%. All cDNAs contained an N-terminal signal peptide encoding sequence, and a KDEL-like sequence, KTEL, was present at the C-terminal, indicating that the enzyme was targeted to and retained within the endoplasmic reticulum. Expression of TaPhyIIa2 and HvPhyIIb in Escherichia coli revealed that the MINPPs possessed a significant phytase activity with narrow substrate specificity for phytate. The pH and temperature optima for both enzymes were pH 4.5 and 65 degrees C, respectively, and the K(m) values for phytate were 246 and 334 microm for the wheat and barley recombinant enzymes, respectively. The enzymes were inhibited by several metal ions, in particular copper and zinc. The cDNAs showed significantly different temporal and tissue-specific expression patterns during seed development and germination. With the exception of TaPhyIIb, the cDNAs were present during late seed development and germination. We conclude that MINPPs constitute a significant part of the endogenous phytase potential of the developing and germinating barley and wheat seeds.

  16. Endophytic colonization of barley (Hordeum vulgare) roots by the nematophagous fungus Pochonia chlamydosporia reveals plant growth promotion and a general defense and stress transcriptomic response.

    Science.gov (United States)

    Larriba, Eduardo; Jaime, María D L A; Nislow, Corey; Martín-Nieto, José; Lopez-Llorca, Luis Vicente

    2015-07-01

    Plant crop yields are negatively conditioned by a large set of biotic and abiotic factors. An alternative to mitigate these adverse effects is the use of fungal biological control agents and endophytes. The egg-parasitic fungus Pochonia chlamydosporia has been traditionally studied because of its potential as a biological control agent of plant-parasitic nematodes. This fungus can also act as an endophyte in monocot and dicot plants, and has been shown to promote plant growth in different agronomic crops. An Affymetrix 22K Barley GeneChip was used in this work to analyze the barley root transcriptomic response to P. chlamydosporia root colonization. Functional gene ontology (GO) and gene set enrichment analyses showed that genes involved in stress response were enriched in the barley transcriptome under endophytism. An 87.5% of the probesets identified within the abiotic stress response group encoded heat shock proteins. Additionally, we found in our transcriptomic analysis an up-regulation of genes implicated in the biosynthesis of plant hormones, such as auxin, ethylene and jasmonic acid. Along with these, we detected induction of brassinosteroid insensitive 1-associated receptor kinase 1 (BR1) and other genes related to effector-triggered immunity (ETI) and pattern-triggered immunity (PTI). Our study supports at the molecular level the growth-promoting effect observed in plants endophytically colonized by P. chlamydosporia, which opens the door to further studies addressing the capacity of this fungus to mitigate the negative effects of biotic and abiotic factors on plant crops.

  17. Mass Spectrometric Imaging of Wheat (Triticum spp.) and Barley (Hordeum vulgare L.) Cultivars: Distribution of Major Cell Wall Polysaccharides According to Their Main Structural Features.

    Science.gov (United States)

    Veličković, Dušan; Saulnier, Luc; Lhomme, Margot; Damond, Aurélie; Guillon, Fabienne; Rogniaux, Hélène

    2016-08-17

    Arabinoxylans (AX) and (1→3),(1→4)-β-glucans (BG) are the main components of cereal cell walls and influence many aspects of their end uses. Important variations in the composition and structure of these polysaccharides have been reported among cereals and cultivars of a given species. In this work, the spatial distribution of AX and BG in the endosperm of mature grains was established for nine wheat varieties and eight barley varieties using enzymatically assisted mass spectrometry imaging (MSI). Important structural features of the AX and BG polymers that were previously shown to influence their physicochemical properties were assessed. Differences in the distribution of AX and BG structures were observed, both within the endosperm of a given cultivar and between wheat and barley cultivars. This study provides a unique picture of the structural heterogeneity of AX and BG polysaccharides at the scale of the whole endosperm in a series of wheat and barley cultivars. Thus, it can participate meaningfully in a strategy aiming at understanding the structure-function relationships of these two polymers.

  18. Dipeptidyl Peptidase IV Inhibitory Peptides Derived from Oat (Avena sativa L.), Buckwheat (Fagopyrum esculentum), and Highland Barley (Hordeum vulgare trifurcatum (L.) Trofim) Proteins.

    Science.gov (United States)

    Wang, Feng; Yu, Guoyong; Zhang, Yanyan; Zhang, Bolin; Fan, Junfeng

    2015-11-01

    Peptides released from oat, buckwheat, and highland barley proteins were examined for their in vitro inhibitory effects on dipeptidyl peptidase IV (DPP4), an enzyme that deactivates incretin hormones involved in insulin secretion. All of the hydrolysates exhibited DPP4 inhibitory activities, with IC50 values ranging from 0.13 mg/mL (oat glutelin alcalase digestion) to 8.15 mg/mL (highland barley albumin tryptic digestion). The lowest IC50 values in gastrointestinal, alcalase, and tryptic digestions were 0.99 mg/mL (oat flour), 0.13 mg/mL (oat glutelin), and 1.83 mg/mL (highland barley glutelin). In all, 35 peptides of more than seven residues were identified in the tryptic hydrolysates of oat globulin using liquid chromatography-mass spectroscopy. Peptides LQAFEPLR and EFLLAGNNK were synthesized and their DPP4 inhibitory activities determined. LQAFEPLR showed high in vitro DPP4 inhibitory activity with an IC50 value of 103.5 μM.

  19. Iron Stress and Pyoverdin Production by a Fluorescent Pseudomonad in the Rhizosphere of White Lupine (Lupinus albus L.) and Barley (Hordeum vulgare L.)

    Science.gov (United States)

    Marschner, P.; Crowley, D. E.

    1997-01-01

    Induction of high-affinity iron transport during root colonization by Pseudomonas fluorescens Pf-5 (pvd-inaZ) was examined in lupine and barley growing in microcosms. P. fluorescens Pf-5 (pvd-inaZ) contains a plasmid carrying pvd-inaZ; thus, in this strain, ice nucleation activity is regulated by pyoverdin production. Lupine or barley plants were grown for 18 or 8 days, respectively, in soil amended with 2% calcium carbonate and inoculated with P. fluorescens Pf-5 (pvd-inaZ) at a density of 4 x 10(sup8) CFU g (dry weight) of soil(sup-1). A filter paper blotting technique was used to sample cells from the rhizosphere in different root zones, and then the cells were resuspended for enumeration and measurement of ice nucleation activity. The population density of P. fluorescens Pf-5 (pvd-inaZ) in the rhizosphere decreased by one order of magnitude in both lupine and barley over time. The ice nucleation activity ranged from -3.4 to -3.0 log ice nuclei CFU(sup-1) for lupine and -3.0 to -2.8 log ice nuclei CFU(sup-1) for barley, was similar in all root zones, and did not change over time. An in vitro experiment was conducted to determine the relationship between ice nucleation activity and pyoverdin production in P. fluorescens Pf-5 (pvd-inaZ). An ice nucleation activity of approximately -3.0 log ice nuclei CFU(sup-1) was measured in the in vitro experiment at 25 to 50 (mu)M FeCl(inf3). By using the regression between ice nucleation activity and pyoverdin production determined in vitro and assuming a P. fluorescens Pf-5 (pvd-inaZ) population density of 10(sup8) CFU g of root(sup-1), the maximum possible pyoverdin accumulation by P. fluorescens Pf-5 (pvd-inaZ) in the rhizosphere was estimated to be 0.5 and 0.8 nmol g of root(sup-1) for lupine and barley, respectively. The low ice nucleation activity measured in the rhizosphere suggests that nutritional competition for iron in the rhizosphere may not be a major factor influencing root colonization by P. fluorescens Pf-5

  20. Quantitative trait loci for yield and grain plumpness relative to maturity in three populations of barley (Hordeum vulgare L.) grown in a low rain-fall environment.

    Science.gov (United States)

    Obsa, Bulti Tesso; Eglinton, Jason; Coventry, Stewart; March, Timothy; Guillaume, Maxime; Le, Thanh Phuoc; Hayden, Matthew; Langridge, Peter; Fleury, Delphine

    2017-01-01

    Identifying yield and grain plumpness QTL that are independent of developmental variation or phenology is of paramount importance for developing widely adapted and stable varieties through the application of marker assisted selection. The current study was designed to dissect the genetic basis of yield performance and grain plumpness in southern Australia using three doubled haploid (DH) populations developed from crosses between adapted parents that are similar in maturity and overall plant development. Three interconnected genetic populations, Commander x Fleet (CF), Commander x WI4304 (CW), and Fleet x WI4304 (FW) developed from crossing of Australian elite barley genotypes, were used to map QTL controlling yield and grain plumpness. QTL for grain plumpness and yield were analysed using genetic linkage maps made of genotyping-by-sequencing markers and major phenology genes, and field trials at three drought prone environments for two growing seasons. Seventeen QTL were detected for grain plumpness. Eighteen yield QTL explaining from 1.2% to 25.0% of the phenotypic variation were found across populations and environments. Significant QTL x environment interaction was observed for all grain plumpness and yield QTL, except QPlum.FW-4H.1 and QYld.FW-2H.1. Unlike previous yield QTL studies in barley, none of the major developmental genes, including Ppd-H1, Vrn-H1, Vrn-H2 and Vrn-H3, that drive barley adaption significantly affected grain plumpness and yield here. Twenty-two QTL controlled yield or grain plumpness independently of known maturity QTL or genes. Adjustment for maturity effects through co-variance analysis had no major effect on these yield QTL indicating that they control yield per se.

  1. An Investigation on Physiological Characteristics of Tow Barley (Hordeum vulgare L. Cultivars and Soil Moisture Content as Affected by Straw Management and Nitrogen Rates under Dryland Conditions

    Directory of Open Access Journals (Sweden)

    H. Sadeghi

    2012-04-01

    Full Text Available In most southern parts of Iran, crop residues have been traditionally burned or removed; that is often criticized for soil organic and nutrient losses, reducing soil microbial activity and increasing CO2 emission. A 2-years field study was conducted at the College of Agricultural, Shiraz University, Shiraz, Iran to evaluate the effects of different barley residue and N rates on some physiological indices and soil moisture contents of two dryland barley cultivars. The experiment was conducted as strip split plot with four replications. Vertical plots included two dryland common barley cultivars (Afzal and Reyhan, horizontal plots were three crop residue rates (0, 750 and 1500 kg ha-1 and sub plots were three N rates (0, 40, and 80 kg N ha-1. The results showed that when the crop residues were applied, N rates should be increased accordingly. Increasing N rates (from 0 to 80 kg N ha-1 accompanied by residue application increased leaf area index in both cultivars. When the crop residues were completely applied, but N rates were not appropriated with crop residue application, LAI decreased in both cultivars. The lowest LAI (1.14 was obtained from 1500 kg ha-1crop residue and 0 kg N ha-1 in both cultivars. The highest (1196g/m2 and the lowest (595g/m2 dry matter yield was obtained from 80 kg N ha-1 and % 100 crop residue and from 0 kg N ha-1 and 1500 kg ha-1 crop residue in both cultivars, respectively. Application of 1500 kg ha-1 crop residues and 80 kg N ha-1 significantly increased soil moisture contents and LAI.

  2. Weed Control Efficiency of wild Safflower (Carthamus oxyacanthus M. Bieb in Replacement Series Technique of Barley (Hordeum vulgare L. and Common Vetch (Vicia sativa L.

    Directory of Open Access Journals (Sweden)

    abdolreza ahmadi

    2017-01-01

    Full Text Available Introduction In agronomy, natural outlook has been expressed in different forms which stable agriculture is an example. Stable agriculture is ascribed to the authentic management of agricultural resources, which in addition to fulfilling the ever-changing needs of humans, maintains the health of environment and capacity of water and soil resources. Application of herbicides, besides being costly, resulted in the selection of herbicide resistant weed species and has become an environmental contamination factor. However, reduction of herbicide consumption is one of the goals of modern agriculture, with several methods being suggested, including intercropping. In natural conditions of production, environment conservation of weed existence requires cost. One of the important preparations in weed control from the perspective of sustainable agriculture, is using intercropping system. The aim of this study was to determine the role of crop diversity on weed and crop production based on the beneficial effects of intercropping system than pure. Materials and methods In order to study effects of mixed and sole cropping of barley with common vetch on their biologic yield and utilization indices, an experiment was conducted in Agricultural college of the University of Lorestan, during the growing season of 2013-2014 with 24 treatments using the method of rows replacement series technique by the randomized complete block design in a factorial arrangement with three replications. First factor included 6 levels of intercropping: sole cropping of common vetch (100%, 55-45 (Common vetch-barley, 35-65, 45-55, 65-35 and sole cropping of barley and second factor included 4 levels of weed wild safflower, control, 10, 15 and 20 plants per m2. In this experiment WCE, LER and CR were measured. The data were subjected to analysis of variance (ANOVA using Mstat-C computer software. Mean comparisons were performed using Duncan’s multiple range test at two levels of

  3. Fine structure of plastids during androgenesis in Hordeum vulgare L.

    OpenAIRE

    Fortunat Młodzianowski; Krystyna Idzikowska

    2014-01-01

    The fine structure of plastids was studied in the course of androgenesis in in the pollen of Hordeum vulgare L. It was found that these organelles occur in all stages of androgenesis. Their structure was simple and was frequently manifested on the cross section only by the presence of the envelope and matrix of different degree of density. Single thylakoids, nucleoid-like regions and starch grains were, however, also noted. The structure of plastids in embryoids formed from microspores of bar...

  4. The bioaccumulation of heavy metals in barley (Hordeum vulgare L cultivated on fly ash dump mixed with compost and natural zeolite materials

    Directory of Open Access Journals (Sweden)

    Smaranda Mâșu

    2012-10-01

    Full Text Available The physic-chemical characteristics of the upper layers of fly ash dumps are very important when phytostabilizationplant selection is carried out. Plants with topsoil well developed roots, like cereals are used to stabilize fly ash dumpsin order to eliminate the deflation, erosion, etc. These plant species could be used in thephytostabilization/phytoextraction variant taking into account their metal hyper accumulation capacity, and also inphytostabilization variant by adequate topsoil treatments when a decrease mobility of metals from soil to plants isachieved and thus a less toxic crop is obtained. This study presents a comparative analysis of the metalbioaccumulation degree in plant tissues (grain and straw of barley cultivated on fly ash variants treated withdifferent quantities of compost in the absence/presence of natural zeolite materials, indigenous volcanic tuff. Theaddition of plant debris and sewage sludge compost mixed with natural zeolite materials has lowered thebioaccumulation of Cr with 49%, of Cu with 29%, Fe with more than 77.5%, in grains and straw when compared tountreated fly ash. Barley plants does not allow for Pb and Ni transfer from the fly ash in the aerial part of tissue.

  5. AB-QTL analysis reveals new alleles associated to proline accumulation and leaf wilting under drought stress conditions in barley (Hordeum vulgare L.

    Directory of Open Access Journals (Sweden)

    Sayed Mohammed A

    2012-07-01

    Full Text Available Abstract Background Land plants have evolved several measures to maintain their life against abiotic stresses. The accumulation of proline is the most generalized response of plants under drought, heat or salt stress conditions. It is known as an osmoprotectant which also acts as an instant source of energy during drought recovery process. But, both its role and genetic inheritance are poorly understood in agriculture crops. In the present work, advanced backcross quantitative trait locus (AB-QTL analysis was performed to elucidate genetic mechanisms controlling proline accumulation and leaf wilting in barley under drought stress conditions. Results The analysis revealed eight QTL associated to proline content (PC and leaf wilting (WS. QTL for PC were localized on chromosome 3H, 4H, 5H and 6H. The strongest QTL effect QPC.S42.5H was detected on chromosome 5H where drought inducible exotic allele was associated to increase PC by 54%. QTL effects QPC.S42.3H, QPC.S42.4H and QPC.S42.6H were responsible to heighten PC due to the preeminence of elite alleles over the exotic alleles which ranged from 26% to 43%. For WS, QTL have been localized on chromosome 1H, 2H, 3H and 4H. Among these, QWS.S42.1H and QWS.S42.4H were associated to decrease in WS due to the introgression of exotic alleles. In addition, two digenic epistatic interaction effects were detected for WS where the additive effect of exotic alleles imparted a favorable increase in the trait value. Conclusions The present data represents a first report on whole-genome mapping of proline accumulation and leaf wilting in barley. The detected QTL are linked to new alleles from both cultivated and wild accessions which bring out an initial insight on the genetic inheritance of PC and WS. These QTL alleles are fixed in the isogenic background of Scarlett, which will allow for positional cloning of underlying genes and to develop drought resilient barley cultivars.

  6. AB-QTL analysis reveals new alleles associated to proline accumulation and leaf wilting under drought stress conditions in barley (Hordeum vulgare L.).

    Science.gov (United States)

    Sayed, Mohammed A; Schumann, Henrik; Pillen, Klaus; Naz, Ali A; Léon, Jens

    2012-07-20

    Land plants have evolved several measures to maintain their life against abiotic stresses. The accumulation of proline is the most generalized response of plants under drought, heat or salt stress conditions. It is known as an osmoprotectant which also acts as an instant source of energy during drought recovery process. But, both its role and genetic inheritance are poorly understood in agriculture crops. In the present work, advanced backcross quantitative trait locus (AB-QTL) analysis was performed to elucidate genetic mechanisms controlling proline accumulation and leaf wilting in barley under drought stress conditions. The analysis revealed eight QTL associated to proline content (PC) and leaf wilting (WS). QTL for PC were localized on chromosome 3H, 4H, 5H and 6H. The strongest QTL effect QPC.S42.5H was detected on chromosome 5H where drought inducible exotic allele was associated to increase PC by 54%. QTL effects QPC.S42.3H, QPC.S42.4H and QPC.S42.6H were responsible to heighten PC due to the preeminence of elite alleles over the exotic alleles which ranged from 26% to 43%. For WS, QTL have been localized on chromosome 1H, 2H, 3H and 4H. Among these, QWS.S42.1H and QWS.S42.4H were associated to decrease in WS due to the introgression of exotic alleles. In addition, two digenic epistatic interaction effects were detected for WS where the additive effect of exotic alleles imparted a favorable increase in the trait value. The present data represents a first report on whole-genome mapping of proline accumulation and leaf wilting in barley. The detected QTL are linked to new alleles from both cultivated and wild accessions which bring out an initial insight on the genetic inheritance of PC and WS. These QTL alleles are fixed in the isogenic background of Scarlett, which will allow for positional cloning of underlying genes and to develop drought resilient barley cultivars.

  7. Quantitative Trait Loci for Salinity Tolerance Identified under Drained and Waterlogged Conditions and Their Association with Flowering Time in Barley (Hordeum vulgare. L.

    Directory of Open Access Journals (Sweden)

    Yanling Ma

    Full Text Available Salinity is one of the major abiotic stresses affecting crop production via adverse effects of osmotic stress, specific ion toxicity, and stress-related nutritional disorders. Detrimental effects of salinity are also often exacerbated by low oxygen availability when plants are grown under waterlogged conditions. Developing salinity-tolerant varieties is critical to overcome these problems, and molecular marker assisted selection can make breeding programs more effective.In this study, a double haploid (DH population consisting of 175 lines, derived from a cross between a Chinese barley variety Yangsimai 1 (YSM1 and an Australian malting barley variety Gairdner, was used to construct a high density molecular map which contained more than 8,000 Diversity Arrays Technology (DArT markers and single nucleotide polymorphism (SNP markers. Salinity tolerance of parental and DH lines was evaluated under drained (SalinityD and waterlogged (SalinityW conditions at two different sowing times.Three quantitative trait loci (QTL located on chromosome 1H, single QTL located on chromosomes 1H, 2H, 4H, 5H and 7H, were identified to be responsible for salinity tolerance under different environments. Waterlogging stress, daylight length and temperature showed significant effects on barley salinity tolerance. The QTL for salinity tolerance mapped on chromosomes 4H and 7H, QSlwd.YG.4H, QSlwd.YG.7H and QSlww.YG.7H were only identified in winter trials, while the QTL on chromosome 2H QSlsd.YG.2H and QSlsw.YG.2H were only detected in summer trials. Genes associated with flowering time were found to pose significant effects on the salinity QTL mapped on chromosomes 2H and 5H in summer trials. Given the fact that the QTL for salinity tolerance QSlsd.YG.1H and QSlww.YG.1H-1 reported here have never been considered in the literature, this warrants further investigation and evaluation for suitability to be used in breeding programs.

  8. Genotype-Dependent Effect of Exogenous Nitric Oxide on Cd-induced Changes in Antioxidative Metabolism, Ultrastructure, and Photosynthetic Performance in Barley Seedlings (Hordeum vulgare)

    DEFF Research Database (Denmark)

    Chen, Fei; Wang, Fang; Sun, Hongyan

    2010-01-01

    10- and 15-day treatments. Furthermore, NO significantly increased stromal APX and Mn-SOD activities in both genotypes and upregulated Cd-induced decrease in cAPX activity and gene expression of root/leaf cAPX and leaf CAT1 in the Cd-sensitive genotype. These data suggest that under Cd stress, NO......A greenhouse hydroponic experiment was performed using Cd-sensitive (cv. Dong 17) and Cd-tolerant (Weisuobuzhi) barley seedlings to evaluate how different genotypes responded to cadmium (Cd) toxicity in the presence of sodium nitroprusside (SNP), a nitric oxide (NO) donor. Results showed that 5 μ......M Cd increased the accumulation of O2•-, H2O2, and malondialdehyde (MDA) but reduced plant height, chlorophyll content, net photosynthetic rate (P n), and biomass, with a much more severe response in the Cd-sensitive genotype. Antioxidant enzyme activities increased significantly under Cd stress...

  9. Genetic Study of the Manganese Use Efficiency Trait in Winter Barley (Hordeum vulgare L.) by Genome- Wide Association and Genomic Selection

    DEFF Research Database (Denmark)

    Leplat, Florian Jean Victor

    Manganese (Mn) deficiency remains an unsolved nutritional problem affecting crop production worldwide. The tolerance to Mn limiting conditions, known as Mn efficiency, is a quantitative abiotic stress trait, generally controlled by several genes. However the underlying genetic background of Mn...... efficiency remained elusive. This PhD study aimed to understand better the genetic determination of the trait and propose new insights for plant breeding purposes. Two genome-wide approaches were used in a winter barley collection to characterize the genetic control of the trait. First, a Genome......-wide association study (GWAS) and chlorophyll a fluorescence phenotyping allowed to identify several QTLs involved in the plant response to Mn deficiency. Multiple candidate coding genes were fund, among which, photosystem II PsbP subunit, germin-like proteins or Mn-Superoxide Dismutase. It supports the Mn...

  10. Interactions between ethylene, CO/sub 2/, and ABA on GA/sub 3/-induced amylase synthesis in barley aleurone tissue. [Hordeum vulgare cv Himalaya

    Energy Technology Data Exchange (ETDEWEB)

    Tittle, F.L.; Spencer, M.S.

    1986-04-01

    Gibberellic acid-induced synthesis and release of ..cap alpha..-amylase in barley aleurone tissue was inhibited by abscisic acid. This inhibition was relieved by simultaneous application of ethylene ranging in concentration from 0.1 to 100 microliters per liter. When CO/sub 2/ was applied, it eliminated the effect of 0.1 microliter per liter ethylene and reimposed the abscisic acid inhibition. All concentrations of CO/sub 2/ tested from 400 to 10/sup 5/ microliters per liter counteracted the effect of 0.1 microliter per liter ethylene, but had no observable effect on any higher concentration of ethylene. The results indicate that some processes necessary for embryo growth may be subject to regulation by ethylene and carbon dioxide at naturally occurring concentrations of the gases.

  11. Identification of Barley (Hordeum vulgare L. Autophagy Genes and Their Expression Levels during Leaf Senescence, Chronic Nitrogen Limitation and in Response to Dark Exposure

    Directory of Open Access Journals (Sweden)

    Liliana Avila-Ospina

    2016-02-01

    Full Text Available Barley is a cereal of primary importance for forage and human nutrition, and is a useful model for wheat. Autophagy genes first described in yeast have been subsequently isolated in mammals and Arabidopsis thaliana. In Arabidopsis and maize it was recently shown that autophagy machinery participates in nitrogen remobilization for grain filling. In rice, autophagy is also important for nitrogen recycling at the vegetative stage. In this study, HvATGs, HvNBR1 and HvATI1 sequences were identified from bacterial artificial chromosome (BAC, complementary DNA (cDNA and expressed sequence tag (EST libraries. The gene models were subsequently determined from alignments between genome and transcript sequences. Essential amino acids were identified from the protein sequences in order to estimate their functionality. A total of twenty-four barley HvATG genes, one HvNBR1 gene and one HvATI1 gene were identified. Except for HvATG5, all the genomic sequences found completely matched their cDNA sequences. The HvATG5 gene sequence presents a gap that cannot be sequenced due to its high GC content. The HvATG5 coding DNA sequence (CDS, when over-expressed in the Arabidopsis atg5 mutant, complemented the plant phenotype. The HvATG transcript levels were increased globally by leaf senescence, nitrogen starvation and dark-treatment. The induction of HvATG5 during senescence was mainly observed in the flag leaves, while it remained surprisingly stable in the seedling leaves, irrespective of the leaf age during stress treatment.

  12. Inheritance of the number and thickness of cell layers in barley aleurone tissue (Hordeum vulgare L.): an approach using F2-F3 progeny.

    Science.gov (United States)

    Jestin, Louis; Ravel, Catherine; Auroy, Sylvie; Laubin, Bastien; Perretant, Marie-Reine; Pont, Caroline; Charmet, Gilles

    2008-05-01

    The aleurone tissue of cereal grains, nutritionally rich in minerals and vitamins, is an important target for the improvement of cereals. Inheritance of the thickness and the number of cell layers in barley aleurone was studied on the F2-F3 progeny of an Erhard Frederichen x Criolla Negra cross in which the parental lines have three or two aleurone layers, respectively. F3 grain was sampled from each F2 plant and 96.8% of the entire F3 grain population was classified as being either the 2- or 3-layer type. Using microsatellite, single nucleotide polymorphism (SNP) and morphological markers on 190 F2 plants, a linkage map was built. Three quantitative trait loci (QTLs) affecting aleurone traits were revealed on chromosome 5H (max. LOD = 5.83) and chromosome 7H (max. LOD = 4.45) by interval mapping, and on chromosome 2H by marker analysis with an unmapped marker. These QTLs were consistent with genetic sub-models involving either 2-cell type dominance for 7H and 2H, or putative partial dominance for 5H where 2-cell-layer dominance and additivity gave similar LODs. The number of aleurone cell layers and aleurone thickness were strongly correlated and QTL results for these traits were alike. An SNP marker of sal1, an orthologue of the maize multilayer aleurone gene was mapped to the 7HL chromosome arm. However, the 7H QTL did not co-locate with the barley sal1 SNP, suggesting that an additional gene is involved in determining aleurone traits. These new mapping data allow comparisons to be made with related studies.

  13. EFFECTS OF NITROGEN ON PHENOLIC ACID AND PROTEIN CONTENT IN BARLEY (Hordeum vulgare L. ) GRAIN%氮素对大麦籽粒中酚酸和蛋白质含量的影响

    Institute of Scientific and Technical Information of China (English)

    王祥军; 齐军仓; 贾力群; 王倩; 王琴; 马建峰; 王仙; 曹连莆

    2011-01-01

    Nitrogen is one of the necessary nutrient elements for crop growth. The primary and secondary metabolisms of plant are regulated by nitrogen nutrient levels. As important secondary metabolites, phenolic acids play significant roles in plant resistances, and potentially contribute to barley qualities. However, little is known concerning effects of nitrogen on barley (Hordeum vulgare L. ) phenolic acids. In the present study, two barley cultivars were used, and seven nitrogen concentration treatments (0,412.5, 825.0, 1237.5, 1650, 3300, and 4950mg/L, respectively) under in vitro spike culture were conducted to investigate the effects of nitrogen on phenolic acid and protein contents in barley grain. Results showed that the development of barley grain was inhibited under high nitrogen levels (3300 ~ 4950mg/L), and grain weight decreasing significantly was as the response. Total hydroxybenzoic acid content (THBA), total hydroxycinnamic acid content (THCA), total phenolic acid content (TPA) and THBA/THCA ratio were all significantly affected by nitrogen concentration, cultivar and the interaction between nitrogen concentration and cultivar. Four indexes above were all significantly positively correlated with nitrogen concentration. Except for hordein content ( HC ), the protein indexes of crude protein content (CPC), salt-soluble protein content (SSPC), and glutelin content (GC) were all significantly affected by nitrogen concentration, moreover, SSPC and GC were significantly affected by cultivar and the interaction between nitrogen concentration and cultivar. Excluding HC and GC in the four indexes, CPC and SSPC were significantly positive-correlated with nitrogen concentration. The results also indicated that phenolic acid contents (including THBA, THCA, and TPA) in barley grain increased cooperated with CPC and SSPC when the nitrogen nutrient level went up.%采用穗培养技术在7个氮素(NH4NO3为氮源)浓度水平(N1:0mg/L;N2:412.5 mg/L;N3:825.0mg/L;N4

  14. The identification of new cytosolic glutamine synthetase and asparagine synthetase genes in barley (Hordeum vulgare L.), and their expression during leaf senescence.

    Science.gov (United States)

    Avila-Ospina, Liliana; Marmagne, Anne; Talbotec, Joël; Krupinska, Karin; Masclaux-Daubresse, Céline

    2015-04-01

    Glutamine synthetase and asparagine synthetase are two master enzymes involved in ammonium assimilation in plants. Their roles in nitrogen remobilization and nitrogen use efficiency have been proposed. In this report, the genes coding for the cytosolic glutamine synthetases (HvGS1) and asparagine synthetases (HvASN) in barley were identified. In addition to the three HvGS1 and two HvASN sequences previously reported, two prokaryotic-like HvGS1 and three HvASN cDNA sequences were identified. Gene structures were then characterized, obtaining full genomic sequences. The response of the five HvGS1 and five HvASN genes to leaf senescence was then studied. Developmental senescence was studied using primary and flag leaves. Dark-exposure or low-nitrate conditions were also used to trigger stress-induced senescence. Well-known senescence markers such as the chlorophyll and Rubisco contents were monitored in order to characterize senescence levels in the different leaves. The three eukaryotic-like HvGS1_1, HvGS1_2, and HvGS1_3 sequences showed the typical senescence-induced reduction in gene expression described in many plant species. By contrast, the two prokaryotic-like HvGS1_4 and HvGS1_5 sequences were repressed by leaf senescence, similar to the HvGS2 gene, which encodes the chloroplast glutamine synthetase isoenzyme. There was a greater contrast in the responses of the five HvASN and this suggested that these genes are needed for N remobilization in senescing leaves only when plants are well fertilized with nitrate. Responses of the HvASN sequences to dark-induced senescence showed that there are two categories of asparagine synthetases, one induced in the dark and the other repressed by the same conditions.

  15. Proteomic response of Hordeum vulgare cv. Tadmor and Hordeum marinum to salinity stress: Similarities and differences between a glycophyte and a halophyte

    Directory of Open Access Journals (Sweden)

    Lucie Maršálová

    2016-08-01

    Full Text Available Response to a high salinity treatment of 300 mM NaCl was studied in a cultivated barley Hordeum vulgare Syrian cultivar Tadmor and in a halophytic wild barley Hordeum marinum. Differential salinity tolerance of H. marinum and H. vulgare is underlied by qualitative and quantitative differences in proteins involved in a variety of biological processes. The major aim was to identify proteins underlying differential salinity tolerance between the two barley species. Analyses of plant water content, osmotic potential and accumulation of proline and dehydrin proteins under high salinity revealed a relatively higher water saturation deficit in H. marinum than in H. vulgare while H. vulgare had lower osmotic potential corresponding with high levels of proline and dehydrins. Analysis of proteins soluble upon boiling isolated from control and salt-treated crown tissues revealed similarities as well as differences between H. marinum and H. vulgare. The similar salinity responses of both barley species lie in enhanced levels of stress-protective proteins such as defence-related proteins from late-embryogenesis abundant (LEA family, several chaperones from heat shock protein (HSP family, and others such as GrpE. However, there have also been found significant differences between H. marinum and H. vulgare salinity response indicating an active stress acclimation in H. marinum while stress damage in H. vulgare. An active acclimation to high salinity in H. marinum is underlined by enhanced levels of several stress-responsive transcription factors from basic leucine zipper (bZIP and nascent polypeptide-associated complex (NAC families. In salt-treated H. marinum, enhanced levels of proteins involved in energy metabolism such as glycolysis, ATP metabolism, and photosynthesis-related proteins indicate an active acclimation to enhanced energy requirements during an establishment of novel plant homeostasis. In contrast, changes at proteome level in salt-treated H

  16. Hordeum vulgare cysteine protease heterologous expressed in yeast

    DEFF Research Database (Denmark)

    Rosenkilde, Anne Lind; Dionisio, Giuseppe; Holm, Preben Bach

    , (Hordeum vulgare) endoprotease B2 (HvEPB2) was cloned with and without the 5 amino acid C-terminal sequence into the Pichia pastoris expression vector pPICZ Aα and electrotransformed into Pichia pastoris strain SDM1163. Heterologous protein production was induced with 2% MeOH and the protein expression...... were monitered during induction by collecting 1 ml samples every hr for 24 hrs. After 4 days, the supernatant were harvested and analyzed by SDS-PAGE, activity assay and Western blot. A significant amount of functional, heterologous protein was produced and the protein production was highest after 4...

  17. Characterization of Gene Candidates for Vacuolar Sodium Transport from Hordeum Vulgare

    KAUST Repository

    Scheu, Arne Hagen August

    2017-05-01

    Soil salinity is a major abiotic stress for land plants, and multiple mechanisms of salt tolerance have evolved. Tissue tolerance is one of these mechanisms, which involves the sequestration of sodium into the vacuole to retain low cytosolic sodium concentrations. This enables the plant to maintain cellular functions, and ultimately maintain growth and yield. However, the molecular components involved in tissue tolerance remain elusive. Several candidate genes for vacuolar sodium sequestration have recently been identified by proteome analysis of vacuolar membranes purified from the salt-tolerant cereal Hordeum vulgare (barley). In this study, I aimed to characterize these candidates in more detail. I successfully cloned coding sequences for the majority of candidate genes with primers designed based on the barley reference genome sequence. During the course of this study a newer genome sequence with improved annotations was published, to which I also compared my observations. To study the candidate genes, I used the heterologous expression system Saccharomyces cerevisiae (yeast). I used several salt sensitive yeast strains (deficient in intrinsic sodium transporters) to test whether the candidate genes would affect their salt tolerance by mediating the sequestration of sodium into the yeast vacuole. I observed a reduction in growth upon expression for several of the gene candidate under salt-stress conditions. However, confocal microscopy suggests that most gene products are subject to degradation, and did not localize to the vacuolar membrane (tonoplast). Therefore, growth effects cannot be linked to protein function without further evidence. Various potential causes are discussed, including inaccuracies in the genome resource used as reference for primer design and issues inherent to the model system. Finally, I make suggestions on how to proceed to further characterize the candidate genes and hopefully identify novel sodium transporters from barley.

  18. Enhanced Pb Absorption by Hordeum vulgare L. and Helianthus annuus L. Plants Inoculated with an Arbuscular Mycorrhizal Fungi Consortium.

    Science.gov (United States)

    Arias, Milton Senen Barcos; Peña-Cabriales, Juan José; Alarcón, Alejandro; Maldonado Vega, María

    2015-01-01

    The effect of an arbuscular mycorrhizal fungi (AMF) consortium conformed by (Glomus intraradices, Glomus albidum, Glomus diaphanum, and Glomus claroideum) on plant growth and absorption of Pb, Fe, Na, Ca, and (32)P in barley (Hordeum vulgare L.) and sunflower (Helianthus annuus L.) plants was evaluated. AMF-plants and controls were grown in a substrate amended with powdered Pb slag at proportions of 0, 10, 20, and 30% v/v equivalent to total Pb contents of 117; 5,337; 13,659, and 19,913 mg Pb kg(-1) substrate, respectively. Mycorrhizal root colonization values were 70, 94, 98, and 90%, for barley and 91, 97, 95, and 97%, for sunflower. AMF inoculum had positive repercussions on plant development of both crops. Mycorrhizal barley absorbed more Pb (40.4 mg Pb kg(-1)) shoot dry weight than non-colonized controls (26.5 mg Pb kg(-1)) when treated with a high Pb slag dosage. This increase was higher in roots than shoots (650.0 and 511.5 mg Pb kg(-1) root dry weight, respectively). A similar pattern was found in sunflower. Plants with AMF absorbed equal or lower amounts of Fe, Na and Ca than controls. H. vulgare absorbed more total P (1.0%) than H. annuus (0.9%). The arbuscular mycorrizal consortium enhanced Pb extraction by plants.

  19. SUSTITUCIÓN GRADUAL DE LA ALFALFA (Medicago sativa L.) POR EL GERMINADO DE CEBADA (Hordeum vulgare) EN RACIONES DE CUYES (Cavia porcellus L.) EN LA ETAPA DE CRECIMIENTO/MANIFESTATIONS FADED GRADUALLY REPLACEMENT OF ALFALFA (Medicago sativa L.) BY BARLEY (Hordeum vulgare L.) SPROUT IN PORTIONS OF GUINEA PIGS (Cavia porcellus L.) IN THE STAGE OF GROWTH

    National Research Council Canada - National Science Library

    Freddy C Cayllahua; Daisy U D Condori; Alfonso G F Cordero; Miriam L Veliz; José L P Contreras

    2015-01-01

    ...%) of hydroponic barley (CH) in substitution of alfalfa in the feeding male and female guinea pigs of Peru line, in the growth phase, in number of 72, with 18 days of age and 175 g of initial PV means confined for 42 days...

  20. Separate Location of Parental Chromosomes in Squashed Metaphases of Hybrid between Hordeum vulgare L. and Four Polyploid, Alien Species

    DEFF Research Database (Denmark)

    Jensen, J.; Linde-Laursen, Ib

    1984-01-01

    In 38 squashed, somatic metaphases of four hybrids between diploid Hordeum vulgare and two tetra-and two hexaploid alien species, each of the H. vulgare chromosomes was identifed, and differentiated from the chromosomes of the other parental species, by its Giemsa C-banding pattern. The H. vulgare...

  1. 西藏雅鲁藏布江中部流域发现的古青稞(Hordeum vulgare L.var.nudum)炭化粒%The ancient carbonized barley (Hordeum vulgare L.Var. nudum) kernel discovered in the middle of Yalu Tsanypo river basin in Tibet

    Institute of Scientific and Technical Information of China (English)

    傅大雄; 徐廷文; 冯宗云

    2000-01-01

    This paper deals with the discovery of the ancient carbonized barley kernel in Changguo Gou archaeological traces of the middle Yalu Tsangpo river basin of Tibet.The traces have been dated from the Late Neolithic Age(3500 years ago),and some related problems are discussed.%本文报道了在西藏雅鲁藏布江中部流域昌果沟遗址发现的距今3500年新石器时代晚期的古青稞炭化粒,并对此进行了相关的讨论.

  2. NaCl对大麦硝态氮吸收动力学特征的影响%Kinetics characteristics of NO3absorption of barley (Hordeum vulgare L.) pretreated with different concentrations of NaCl and NO3-N

    Institute of Scientific and Technical Information of China (English)

    丁效东; 张士荣

    2015-01-01

    To learn nitrogen absorption characteristics of plant under salt stress, the NO3--N absorption ability of barley (Hordeum vulgare L.) cultivar ‘Jian 4’ pretreated with NaCl and NO3--N were investigated using culture solution. The pretreatment concentrations of NaCl were 1 mmol×L-1(CK) and 120 mmol×L-1, those of NO3--N were 1 mmol (NO3--N)×L-1 and 10 mmol (NO3--N)×L-1. Barley growth and NO3--N absorption were measured and the kinetics of NO3--N absorption of high- affinity transport system and low-affinity transport system of barley were investigated. The results showed that the uptake of NO3--N of barley pretreated with different concentrations of NaCl and NO3--N was in accordance with Michelis-Menten equation. Also the uptake kinetics parametersVmax andKm were enhanced with increasing pretreatment concentration of NO3--N. For high-affinity system, the uptake of NO3--N of barley was in accordance with Michaelis-Menten equation for all the pretreatments. Under 1 mmol(NO3--N)×L-1 pretreatment, compared with 1 mmol×L-1 NaCl treatment, 120 mmol×L-1 NaCl pretreatment significantly increased barley uptake rate of NO3--N; while under 10 mmol(NO3--N)×L-1, no significant difference in the rate of uptake of NO3--N was observed between 1 mmol×L-1 NaCl and 120 mmol×L-1 NaCl treatments. This indicated that in low nitrogen environment, NaCl restrained uptake of NO3--N of high-affinity system. For low-affinity systems, the uptake rate of NO3--N of barley was in accordance with Michaelis-Menten equation for all pretreatments. Under 1 mmol(NO3--N)×L-1 pretreatment, compared with 1 mmol×L-1 NaCl treatment, 120 mmol×L-1 NaCl treatment significantly increased the rate of uptake of NO3--N. With 10 mmol×L-1 NO3--N pretreatment, the uptake rate of NO3--N under 120 mmol×L-1 NaCl was lower than that of under 1 mmol×L-1 NaCl pretreatment. This showed that under low nitrogen environment, salt stress improved root uptake of NO3--N in low-affinity system. However, under

  3. The activity of some oxidoreductases in Hordeum vulgare L. plants treated with ethylmethanesulfonate and Rosmarinus officinalis L. hydro-alcoholic extracts

    Directory of Open Access Journals (Sweden)

    Gogu Gheorghita

    2011-02-01

    Full Text Available This paper focuses on the activity of some oxidoreductases (catalase, peroxidase, superoxide- dismutase in barley seedlings (Hordeum vulgare L. after 6 hours of seeds treatment with different concentrations (0,01 – 0,50% of ethyl-methane-sulfonate and 12 hours with hydro-alcoholic 0,5% rosemary (Rosmarinus officinalis L. extract (EHR. The EMS treatments led to an obvious increase of the superoxide dismutase, catalase and peroxidase activity in plants, while the application of the hydro-alcoholic rosemary extract, after the EMS treatment, led to a significant decrease of the activities of these enzymes, since the rosemary extract has an obvious antioxidant effect.

  4. 青稞HbSnRK2.4的克隆及其序列特征与表达特性分析%Cloning and Characterization of HbSnRK2.4 in Tibetan Hulless Barley (Hordeum vulgare L. var. nudum HK.f.)

    Institute of Scientific and Technical Information of China (English)

    曾兴权; 王玉林; 徐齐君; 原红军; 韦泽秀; 尼玛扎西

    2015-01-01

    ,about 41.94 kD in molecular weight and with pI=5.96. Results from Prosite Scan indicated that HbSnRK2.4 contains multiple loci of drought stress response cis-element such as casein Kinase II phosphorylation sites,tyrosine kinase phosphorylation sites,protein kinase c-phosphorylation and n-cardamom acylation locus. Expression patterns of HbSnRK2.4 were also investigated by RT-qPCR at serious waterlogging or drought and various time points after recovery. The highest expression level was observed in plants growing in soil absolute moisture 33.4%,which may brought waterlogging to tibet barley. As soil absolute moisture declined,transcripts decreased sharply. But when the soil water content turned to be normal for Hordeum vulgare(15.5%),HbSnRK2.4 restored to a higher level. When plants were drought stressed(<15.5%of absolute moisture),the gene were repressed again. After recovery from draught stress,the plants possessed a normal expression level of HbSnRK2.4.

  5. Hordeum vulgare cysteine protease heterologous expressed in yeast

    DEFF Research Database (Denmark)

    Rosenkilde, Anne Lind; Dionisio, Giuseppe; Holm, Preben Bach

    During germination of barley seeds, the mobilization of protein is essential and Cysteine Proteases accounts for more than 90 % of the total proteolytic activity in the degradation of barley seed storage proteins [1]. Cysteine proteases exist as pro-enzyme until activated through reduction of the...

  6. The influence of strip cropping on the state and degree of weed infestation in dent maize (Zea mays L., common bean (Phaseolus vulgaris L., and spring barley (Hordeum vulgare L.

    Directory of Open Access Journals (Sweden)

    Aleksandra Głowacka

    2013-04-01

    Full Text Available The experiment was conducted in the years 2008–2010 at the Experimental Station of the Faculty of Agricultural Sciences in Zamość, University of Life Sciences in Lublin. The following factors were analysed in the experiment: I. Cultivation method – sole cropping and strip cropping, which consisted in the cultivation of three plants: dent maize, common bean, and spring barley, in adjacent strips with a width of 3.3 m; II. Weed control methods – mechanical and chemical. The subject of the research was weed infestation of the 'Celio' variety of dent maize, the 'Aura' variety of common bean, and the 'Start' variety of spring barley. Weed infestation of the crops was assessed two weeks before harvesting by determining the species composi- tion as well as the number and dry weight of weeds. The dominant weed species in maize, common bean and spring barley were Echinochloa crus-galli, Chenopodium album and Galinsoga parviflora, constituting from 58% to 70% of the total number of weeds. Strip cropping clearly reduced the number of weeds per unit area in all the cultivated species and dry weight of aboveground parts produced by them in common bean and maize crops. The limiting effect of strip cropping on the weed infestation parameters was particularly clear in combination with the mechanical weed control method.

  7. Phylogenetic analysis of the genus Hordeum using repetitive DNA sequences

    DEFF Research Database (Denmark)

    Svitashev, S.; Bryngelsson, T.; Vershinin, A.

    1994-01-01

    A set of six cloned barley (Hordeum vulgare) repetitive DNA sequences was used for the analysis of phylogenetic relationships among 31 species (46 taxa) of the genus Hordeum, using molecular hybridization techniques. In situ hybridization experiments showed dispersed organization of the sequences...... over all chromosomes of H. vulgare and the wild barley species H. bulbosum, H. marinum and H. murinum. Southern blot hybridization revealed different levels of polymorphism among barley species and the RFLP data were used to generate a phylogenetic tree for the genus Hordeum. Our data are in a good...

  8. Physiological and biochemical reactions of Hordeum vulgare seedlings to the action of silver nanoparticles

    Directory of Open Access Journals (Sweden)

    N. O. Khromykh

    2015-07-01

    Full Text Available Morphometrical indexes, and spectrophotometrically measured protein and glutathione (GSH, GSSG contents and activity of peroxidase (POD, EC 1.11.1.7, glutathione-reductase (GR, EC 1.6.4.2 and glutathione S-transferase (GST, EС 2.5.1.18 were examined in Hordeum vulgare L. seedlings after 0.01 and 0.1 mg/l AgNPs treatment during 24 h. We tested the hypothesis that the action of nanoparticles has a stressful effect on the physiological and biochemical processes of seedlings. Growth of roots was inhibited and fresh weight decreased by 29% and 21% under low and high concentrations respectively. Conversely, leaf growth was intensified, and leaf length (16% and 18% and fresh weight (35% and 44% increased at low and high concentrations respectively. POD activity in roots increased by 26% and 7%, and decreased in leaves to 57% and 81% of control at low and high concentrations respectively. GSH content changed insignificantly, but GSSG content increased in roots (2 and 2.5-fold and in leaves (13% and 30% at both AgNPs concentrations. GSH/GSSG-ratio decreased in roots (1.9 and 2.6-fold and in leaves (1.1 and 1.3-fold at low and high concentrations respectively. GR activity decreased at a concentration of 0.01 mg/l (7% in roots and 17% in leaves respectively and increased at 0.1 mg/l (52% in roots and 6% in leaves. GST activity increased in leaves (52% and 78% at low and high concentrations but decreased by 17% in roots under high concentration of nanosilver. Thus, the action of AgNPs on barley seedlings had a dose-dependent and organ-specific character. The various directions of changes in growth, metabolic processes and activity of antioxidant defense systems appear to be a stress response of barley seedlings to the impact of AgNPs, which underlines the necessity of detailed study of plant intracellular processes exposed to the action of nanomaterial.

  9. Engineering of the aspartate family biosynthetic pathway in barley (Hordeum vulgare L.) by transformation with heterologous genes encoding feed-back-insensitive aspartate kinase and dihydrodipicolinate synthase

    DEFF Research Database (Denmark)

    Brinch-Pedersen, Henrik; Galili, G; Knudsen, S

    1996-01-01

    In prokaryotes and plants the synthesis of the essential amino acids lysine and threonine is predominantly regulated by feed-back inhibition of aspartate kinase (AK) and dihydrodipicolinate synthase (DHPS). In order to modify the flux through the aspartate family pathway in barley and enhance the...... as observed in T0 seeds. It is concluded that the aspartate family pathway may be genetically engineered by the introduction of genes coding for feed-back-insensitive enzymes, preferentially giving elevated levels of lysine and methionine....

  10. Screening for spontaneous virulent mutants of erysiphe-graminis-f-sp-hordei on barley hordeum-vulgare lines with resistance genes ml-a-1 ml-a-6 ml-a-12 and ml-g

    DEFF Research Database (Denmark)

    Torp, J.; Jensen, Hans Peter

    1985-01-01

    Seedlings of 4 barley lines with powdery mildew resistance genes Ml-al, Ml-a6, Mla12 or Ml-g were inoculated with powdery mildew culture CR3 which is avirulent to the 4 host lines. Inoculation density was 1.2 infectious conidia/mm2, and in total 50 million conidia were screened for the occurrence...... 2 .times. 10-8. A reconstruction experiment showed that the density of avirulent inoculum did not reduce the survival rate of rare virulent genotypes....

  11. In vitro inhibition of platelet aggregation by peptides derived from oat (Avena sativa L.), highland barley (Hordeum vulgare Linn. var. nudum Hook. f.), and buckwheat (Fagopyrum esculentum Moench) proteins.

    Science.gov (United States)

    Yu, Guoyong; Wang, Feng; Zhang, Bolin; Fan, Junfeng

    2016-03-01

    Bioactive compounds present in foods could have beneficial effects on human health. In this study, we report the capacity of peptides released from oat, highland barley, and buckwheat proteins after enzymatic digestion to inhibit platelet aggregation in vitro. All hydrolysates showed high antiplatelet activity, with IC50 values of 0.282mg/ml (oat flour gastrointestinal hydrolysate, 6h) to 2.496mg/ml (highland barley glutelin tryptic hydrolysate, 14h) in a dose-dependent manner. Thirty-eight peptides with more than seven residues were identified in the tryptic hydrolysates of oat globulin. Results of computational modeling revealed that nine peptides, including ALPIDVLANAYR, EFLLAGNNKR, GEEFGAFTPK, QLAQIPR, LQAFEPLR, ALPVDVLANAYR, GEEFDAFTPK, QKEFLLAGNNK, and TNPNSMVSHIAGK bound the cyclooxygenase-1 active centers with low binding energy (-6.5 to -7.5kcal/mol). This is the first report to identify antiplatelet peptides from grain hydrolysates and the binding modes at the molecular level, leading to their possible use as functional food ingredients to prevent thrombosis.

  12. Five new secondary metabolites from Monascus purpureus-fermented Hordeum vulgare and Sorghum bicolor.

    Science.gov (United States)

    Ansari, Md Pravej; Puri, Alka; Ali, M; Panda, Bibhu Prasad

    2013-10-01

    Long grains of Hordeum vulgare and Sorghum bicolor were individually fermented with Monascus purpureus MTCC 369 under solid state fermentation. The aqueous extract of Monascus which fermented H. vulgare and S. bicolor was found to contain five different new metabolites. Silica gel column chromatography of the aqueous extract with a linear gradient of ethyl acetate, acetonitrile and carbon tetrachloride (v/v) yielded five new metabolites named benzopranyl capriate (9H-1-isoprenyl-benzopyran-5-isopropanoic acid-6-ol-6-n-decanoate), shorghumoic acid (n-octadec-8,11-dien-7α-ol-1-oic acid) and sorghumflavin A (2-n-butyloxo-6-β-hydroxy-7-β-isoprenyl ankaflavin) from Monascus-fermented S. bicolor, while hordeumflavin B (2-n-undecanyloxo-7-β-isoprenyl ankaflavin) and vulgaredilone (2-dodecanyl-7-β isopranyl monoscodilone) from Monascus-fermented H. vulgare.

  13. QTLs for straw quality characteristics identified in recombinant inbred lines of a Hordeum vulgare x H spontaneum cross in a Mediterranean environment

    DEFF Research Database (Denmark)

    Grando, S.; Baum, M.; Ceccarelli, S.;

    2005-01-01

    Barley straw is commonly used as animal feed in many developing countries. Even a small increase in its nutritive value can have a large impact on animal production, and hence, on rural livelihood and human nutrition. Straw quality is strongly affected by environmental factors and is, therefore......, difficult to improve with empirical breeding. The objective of this study was to identify molecular markers to facilitate the improvement of straw quality in barley. For this purpose, we have used the genetic linkage map that was already developed for recombinant inbred lines (RILs) of the cross between...... a Hordeum vulgare cultivar (`Arta') and a H. spontaneum line (H. spontaneum 41-1), covering a total of 890 cM. Straw parameters from RILs grown at Tel Hadya and Breda (ICARDA's research stations) in 2 years (1996/1997 and 1997/1998) were analyzed by NIRS for predicted nutritional characteristics including...

  14. Chromosomal Location and Expression of Green Fluorescent Protein (gfp) Gene in Microspore Derived Transgenic Barley (Hordeum vulgare L.)%转基因大麦中gfp基因的染色体位置及其表达

    Institute of Scientific and Technical Information of China (English)

    陈建民; Carlson A R; 万建民; Kasha K J

    2003-01-01

    通过对大麦小孢子进行基因枪轰击获得4株转绿色荧光蛋白基因(gfp)的植株(A、C、D、E),以gfp基因为探针进行荧光原位杂交(FISH)研究转化植株中转基因插入位置和基因表达.4个株系在染色体7L(5HL)的不同位置都有一个插入点,而E株系在染色体5S(7HS)还有第2个插入点.所有的转基因T0代植株都是半合子并在T1、T2代发生分离.D株系GFP未表达,但FISH和PCR分析表明gfp基因已成功插入其染色体.各株系在根尖和花粉中的GFP表达水平不同:C株系在花粉表达强而在根尖表达中等;A株系在花粉中等表达而在根尖表达较淡;E株系则在根尖高表达,花粉中等表达.A和C株系在根尖和花粉的GFP分离都表现单位点特性,而E株系的根尖分离表现重叠作用(15∶1)特征,但在花粉中表达GFP的频率低.PCR结果和3个分离株系的根尖表达结果一致.D和E株系的GFP表达不正常可能和gfp基因插入位置或基因的结构有关.%Four doubled haploid barley lines (A,C,D,E) derived from gfp (green fluorescent protein) transformation and selection following particle bombardment of microspores were studied for gene expression pattern and the location of genome inserts.The integration sites were detected by fluorescence in situ hybridization (FISH) using the gfp plasmid DNA as a probe.Plants from events A,C,D and E all have a single insert site on chromosome 7L(5HL) at different locations while line E has a second insert site on chromosome 5S(7HS).All original transgenic plants were hemizygous for the transgenes and segregated in the T1 and T2 generations.Although line D had no GFP expression,FISH and PCR could detect gfp gene on its chromosome in transformed plants.Expression levels of GFP varied with lines and tissues examined.Plants from line C showed good expression in pollen and an intermediate level in root tips.Plants from A have intermediate expression of GFP in the pollen and light expression in the

  15. Evaluation of genetic diversity in barley (Hordeum vulgare L.) from ...

    African Journals Online (AJOL)

    User

    2015-06-03

    Jun 3, 2015 ... traits, genotypes in cluster III deserve consideration for directly developing high yielding barely varieties. The result of ... Criteria for the estimation of genetic diversity can be ...... Plant Genetic Resources Institute, Rome, Italy.

  16. Comparison of stability statistics for yield in barley (Hordeum vulgare ...

    African Journals Online (AJOL)

    STORAGESEVER

    2010-03-15

    Mar 15, 2010 ... extremely variable and therefore, suitable cultivars should be released for each ... stability is useful for the selection of crop varieties as well as for breeding .... represents the heterogeneity of linear regression coefficients (bi) whereas the second .... x ), depend only on G X E interaction and error effects.

  17. Genetic Variability in Barley (Hordeum vulgare l.) Landraces from ...

    African Journals Online (AJOL)

    The phenotypic frequencies of morphological characters (qualitative ... of genetic variation among segregating progeny for pure line cultivar development ...... provided discrimination between landraces according to their origin because the .... categories of descriptors evolving along different evolutionary lines (Asfaw, 1989b ...

  18. Biosynthesis of stable iron oxide nanoparticles in aqueous extracts of Hordeum vulgare and Rumex acetosa plants.

    Science.gov (United States)

    Makarov, Valentin V; Makarova, Svetlana S; Love, Andrew J; Sinitsyna, Olga V; Dudnik, Anna O; Yaminsky, Igor V; Taliansky, Michael E; Kalinina, Natalia O

    2014-05-27

    We report the synthesis and characterization of amorphous iron oxide nanoparticles from iron salts in aqueous extracts of monocotyledonous (Hordeum vulgare) and dicotyledonous (Rumex acetosa) plants. The nanoparticles were characterized by TEM, absorbance spectroscopy, SAED, EELS, XPS, and DLS methods and were shown to contain mainly iron oxide and iron oxohydroxide. H. vulgare extracts produced amorphous iron oxide nanoparticles with diameters of up to 30 nm. These iron nanoparticles are intrinsically unstable and prone to aggregation; however, we rendered them stable in the long term by addition of 40 mM citrate buffer pH 3.0. In contrast, amorphous iron oxide nanoparticles (diameters of 10-40 nm) produced using R. acetosa extracts are highly stable. The total protein content and antioxidant capacity are similar for both extracts, but pH values differ (H. vulgare pH 5.8 vs R. acetosa pH 3.7). We suggest that the presence of organic acids (such oxalic or citric acids) plays an important role in the stabilization of iron nanoparticles, and that plants containing such constituents may be more efficacious for the green synthesis of iron nanoparticles.

  19. Some characteristics of segregation in hybrids of Hordeum spontaneum C. Koch emend. Bacht. × H. vulgare (L.) emend. Vav. et Bacht.

    Science.gov (United States)

    Bakhteyev, F K

    1969-01-01

    The analysis of hybrid generations, that had arisen from crosses of various forms of H. spontaneum, as well as comparison of the results of crossing representatives of H. spontaneum with two and six-row forms of H. vulgare warrant the following statements: 1. When various morphological races of H. spontaneum were intercrossed, no morphologically new types arose among the progeny of hybrid generations as a result of these crosses. Various morphological hybrid groups, eight up to F 3, remained strictly within the variability of the system of the species Hordeum spontaneum C. Koch emend. Bacht. 2. When various morphological races of H. spontaneum were hybridized with two- and six-row forms of H. vulgare, marked dominance of characters of the wild parent were observed, nevertheless even in F 3 occasional hybrid individuals with a nonbrittle ear have been obtained. This fact is an evidence that cultivated barley may take part in the formation of such hybrids. In the fourth generation of the above interspecific crosses besides individuals which had inherited the characters of one or the other of the parents new morphological types arise. The latter are characterized by new combinations, inherited from both parents. In studies reported previously such casual hybrid individuals were provisionally named by us "sessiliproskowetzii". At first glance, the latter seemed not to differ from H. spontaneum v. proskowetzii, but more thorough observation showed that such hybrids differ from genuine individuals of v. proskowetzii: their sterile lateral spikelets are sessile, i.e. deprived of pedicels.

  20. The Effect of Homoeologous Meiotic Pairing in Tetraploid Hordeum bulbosum L. × H. vulgare L. Hybrids on Alien Introgressions in Offspring.

    Science.gov (United States)

    Scholz, Margret; Pendinen, Galina

    2016-01-01

    The pairing behaviour of the individual chromosome arms of Hordeum vulgare (Hv) with their homoeologous arms of H. bulbosum (Hb) at metaphase I of meiosis in tetraploid Hb × Hv hybrids and the frequencies of recombined Hv chromosome arms in selfed offspring were studied on differentially visualized chromosomes after fluorescent in situ hybridisation. The frequencies of paired Hv-Hb arms in the F2 and F3 hybrids were correlated with the frequencies of recombined Hv chromosomes in progenies. Self-generation of hybrids, the number of Hv and Hb chromosomes, and the number of recombined Hv chromosomes of the hybrids strongly influenced the Hv-Hb pairing frequency in meiosis. Within the offspring of F2 and F3 hybrids both Hv plants and hybrids were detected. In contrast, all progenies of the F4 hybrid were hybrids which exhibited centromere misdivisions. The highest frequencies of homoeologous pairing in hybrids and most recombinants were obtained for the barley chromosome 1HL. Recombinants for 4HL, 5HS, 6HS, and 7HS were rarely found. Meiotic pairing and recombinants involving chromosome 1HS were never observed. The results of this study demonstrate that fertile tetraploid interspecific hybrids with a high intergenomic pairing at meiosis are valuable basic material for introgression breeding in barley.

  1. The enzymology of alanine aminotransferase (AlaAT) isoforms from Hordeum vulgare and other organisms, and the HvAlaAT crystal structure.

    Science.gov (United States)

    Duff, Stephen M G; Rydel, Timothy J; McClerren, Amanda L; Zhang, Wenlan; Li, Jimmy Y; Sturman, Eric J; Halls, Coralie; Chen, Songyang; Zeng, Jiamin; Peng, Jiexin; Kretzler, Crystal N; Evdokimov, Artem

    2012-12-01

    In this paper we describe the expression, purification, kinetics and biophysical characterization of alanine aminotransferase (AlaAT) from the barley plant (Hordeum vulgare). This dimeric PLP-dependent enzyme is a pivotal element of several key metabolic pathways from nitrogen assimilation to carbon metabolism, and its introduction into transgenic plants results in increased yield. The enzyme exhibits a bi-bi ping-pong reaction mechanism with a K(m) for alanine, 2-oxoglutarate, glutamate and pyruvate of 3.8, 0.3, 0.8 and 0.2 mM, respectively. Barley AlaAT catalyzes the forward (alanine-forming) reaction with a k(cat) of 25.6 s(-1), the reverse (glutamate-forming) reaction with k(cat) of 12.1 s(-1) and an equilibrium constant of ~0.5. The enzyme is also able to utilize aspartate and oxaloacetate with ~10% efficiency as compared to the native substrates, which makes it much more specific than related bacterial/archaeal enzymes (that also have lower K(m) values). We have crystallized barley AlaAT in complex with PLP and l-cycloserine and solved the structure of this complex at 2.7 Å resolution. This is the first example of a plant AlaAT structure, and it reveals a canonical aminotransferase fold similar to structures of the Thermotoga maritima, Pyrococcus furiosus, and human enzymes. This structure bridges our structural understanding of AlaAT mechanism between three kingdoms of life and allows us to shed some light on the specifics of the catalysis performed by these proteins.

  2. Tissue-specific epigenetic modifications in root apical meristem cells of Hordeum vulgare.

    Directory of Open Access Journals (Sweden)

    Agnieszka J Braszewska-Zalewska

    Full Text Available Epigenetic modifications of chromatin structure are essential for many biological processes, including growth and reproduction. Patterns of DNA and histone modifications have recently been widely studied in many plant species, although there is virtually no data on the spatial and temporal distribution of epigenetic markers during plant development. Accordingly, we have used immunostaining techniques to investigate epigenetic modifications in the root apical meristem of Hordeum vulgare. Histone H4 acetylation (H4K5ac, histone H3 dimethylation (H3K4me2, H3K9me2 and DNA methylation (5mC patterns were established for various root meristem tissues. Distinct levels of those modifications were visualised in the root cap, epidermis, cortex and vascular tissues. The lateral root cap cells seem to display the highest level of H3K9me2 and 5mC. In the epidermis, the highest level of 5mC and H3K9me2 was detected in the nuclei from the boundary of the proximal meristem and the elongation zone, while the vascular tissues were characterized by the highest level of H4K5ac. Some of the modified histones were also detectable in the cytoplasm in a highly tissue-specific manner. Immunolocalisation of epigenetic modifications of chromatin carried out in this way, on longitudinal or transverse sections, provides a unique topographic context within the organ, and will provide some answers to the significant biological question of tissue differentiation processes during root development in a monocotyledon plant species.

  3. Tissue-Specific Epigenetic Modifications in Root Apical Meristem Cells of Hordeum vulgare

    Science.gov (United States)

    Braszewska-Zalewska, Agnieszka J.; Wolny, Elzbieta A.; Smialek, Lukasz; Hasterok, Robert

    2013-01-01

    Epigenetic modifications of chromatin structure are essential for many biological processes, including growth and reproduction. Patterns of DNA and histone modifications have recently been widely studied in many plant species, although there is virtually no data on the spatial and temporal distribution of epigenetic markers during plant development. Accordingly, we have used immunostaining techniques to investigate epigenetic modifications in the root apical meristem of Hordeum vulgare. Histone H4 acetylation (H4K5ac), histone H3 dimethylation (H3K4me2, H3K9me2) and DNA methylation (5mC) patterns were established for various root meristem tissues. Distinct levels of those modifications were visualised in the root cap, epidermis, cortex and vascular tissues. The lateral root cap cells seem to display the highest level of H3K9me2 and 5mC. In the epidermis, the highest level of 5mC and H3K9me2 was detected in the nuclei from the boundary of the proximal meristem and the elongation zone, while the vascular tissues were characterized by the highest level of H4K5ac. Some of the modified histones were also detectable in the cytoplasm in a highly tissue-specific manner. Immunolocalisation of epigenetic modifications of chromatin carried out in this way, on longitudinal or transverse sections, provides a unique topographic context within the organ, and will provide some answers to the significant biological question of tissue differentiation processes during root development in a monocotyledon plant species. PMID:23935955

  4. Quantitative trait loci affecting growth-related traits in wild barley (Hordeum spontaneum) grown under different levels of nutrient supply

    NARCIS (Netherlands)

    Elberse, I.A.M.; Vanhala, T.K.; Turin, J.H.B.; Stam, P.; Van Damme, J.M.M.; van Tienderen, P.H.

    2004-01-01

    The genetic basis of phenotypic plasticity of relative growth rate (RGR), its components and associated morphological traits was studied in relation to nutrient limitation. In all, 140 F3 lines from a cross, made between two Hordeum spontaneum (wild barley) accessions sampled in Israel, were subject

  5. Low Phytic Acid Barley Responses to Phosphorus Rates

    Science.gov (United States)

    Low phytic acid (LPA) barley (Hordeum vulgare L.) cultivars partition phosphorus in seed tissue differently than conventional barley cultivars through a reduction in seed phytic acid (myo-inositol-1,2,3,4,5,6-hexkisphosphate) coupled with an increase in inorganic phosphorus. The response of the LPA...

  6. QTLs for straw quality characteristics identified in recombinant inbred lines of a Hordeum vulgare x H. spontaneum cross in a Mediterranean environment.

    Science.gov (United States)

    Grando, S; Baum, M; Ceccarelli, S; Goodchild, A; El-Haramein, F Jaby; Jahoor, A; Backes, G

    2005-02-01

    Barley straw is commonly used as animal feed in many developing countries. Even a small increase in its nutritive value can have a large impact on animal production, and hence, on rural livelihood and human nutrition. Straw quality is strongly affected by environmental factors and is, therefore, difficult to improve with empirical breeding. The objective of this study was to identify molecular markers to facilitate the improvement of straw quality in barley. For this purpose, we have used the genetic linkage map that was already developed for recombinant inbred lines (RILs) of the cross between a Hordeum vulgare cultivar ('Arta') and a H. spontaneum line (H. spontaneum 41-1), covering a total of 890 cM. Straw parameters from RILs grown at Tel Hadya and Breda (ICARDA's research stations) in 2 years (1996/1997 and 1997/1998) were analyzed by NIRS for predicted nutritional characteristics including neutral detergent fiber, acid detergent fiber, lignin, digestible organic matter in dry matter, voluntary intake, crude protein, and straw morphology (the percentage of blades, sheaths, and stems). Localization of QTLs was performed using Windows QTL Cartographer, version 2.0. Seventy-three QTLs were identified, the majority of which (17) in the driest of the four environments. Only six QTLs were identified in two environments; in five cases, one of the two was the wettest environment. This is discussed in relation to the possibility of improving straw quality in favorable environments where yields are higher, rather than in dry environments where straw quality is already relatively good.

  7. An integrated resource for barley linkage map and malting quality QTL alignment

    Science.gov (United States)

    Barley (Hordeum vulgare subsp. vulgare) is an economically important model plant for genetics research that is currently served by a comprehensive set of tools for genetic analysis. High density genetic linkage maps constructed from the inheritance of robust gene-based Single Nucleotide Polymorphism...

  8. Direct selection of expressed sequences on a YAC clone revealed proline-rich-like genes and BARE-1 sequences physically linked to the complex ¤Mla¤ powdery mildew resistance locus of barleyHordeum vulgare¤ L.)

    DEFF Research Database (Denmark)

    Schwarz, G.; Michalek, W.; Jahoor, A.

    2002-01-01

    gene. Of 22 selected cDNA clones, six were re-located on the YAC by southern analysis. Two of these clones are predicted to encode members of the hydroxyproline-rich glycoprotein and proline-rich protein gene families which have been implicated in plant defense response. Four sequences showed high...... homology to the copia-like retroelement BA REI of barley, putatively involved in evolution of disease resistance loci. The high degree of clones representing barley rRNA sequences or false positives is a major disadvantage of direct selection of cDNAs in barley. (C) 2002 Elsevier Science Ireland Ltd. All...

  9. Soil fertility status and nutrients provided to spring barley (Hordeum distichon L. by pig slurry

    Directory of Open Access Journals (Sweden)

    Melisa Gómez-Garrido

    2014-03-01

    Full Text Available Nutrient recycling using pig slurry is a common agricultural practice to manage the ever-increasing amounts of wastes from the pig industry. This study was conducted in the southeast of Spain to quantify the enrichments in major (N, P, K, Mg and minor (Zn, Fe, Cu, and Mn nutrients in soils amended with D1-170 kg N ha-1 (European Union legislated dose or D2-340 kg N ha-1, and understand the influence of pig slurry on yield and nutrient uptake in two crop seasons of spring barley (Hordeum distichon L. Compared to control, D2 increased NO3--N by 11.4X to 109 mg kg-1, Olsen-P by 6.9X to 423 mg kg-1, exchange K (2.5X to 1.6 cmol+ kg-1, Mg (1.7X to 1.8 cmol+ kg-1, diethylene-triamine pentaacetic acid (DTPA-Zn (94X to 18.2 mg kg-1, and Fe (2X to 11.3 mg kg-1. Available NO3--N, Olsen-P, and DTPA-Zn have the best correlations with crop yield and nutrient uptake. These results indicate that the assessment of soil fertility status at 1-mo after pig slurry addition provides a good indicator for potential yield and uptake of barley. However, it is suggested that leachates should be monitored to effectively manage potential releases of nitrate and phosphate into the environment.

  10. Malt barley yield and quality affected by irrigation, tillage, crop rotation, and nitrogen fertilization

    Science.gov (United States)

    Little is known about the comparison of management practices on malt barley (Hordeum vulgare L.) yield and quality in irrigated and non-irrigated cropping systems. We evaluated the effects of irrigation, tillage, cropping system, and N fertilization on malt barley yield and quality in a sandy loam s...

  11. A redox-dependent dimerization switch regulates activity and tolerance for reactive oxygen species of barley seed glutathione peroxidase

    DEFF Research Database (Denmark)

    Navrot, Nicolas; Skjoldager, Nicklas; Bunkenborg, Jakob

    2015-01-01

    Monomeric and dimeric forms of recombinant barley (Hordeum vulgare subsp. vulgare) glutathione peroxidase 2 (HvGpx2) are demonstrated to display distinctly different functional properties in vitro. Monomeric HvGpx2 thus has five fold higher catalytic efficiency than the dimer towards tert-butyl h...... active, but more oxidation-resistant dimer. ...

  12. Reduction in amounts of mitochondrial DNA in the sperm cells as a mechanism for maternal inheritance in Hordeum vulgare.

    Science.gov (United States)

    Sodmergen; Zhang, Quan; Zhang, Yingtao; Sakamoto, Wataru; Kuroiwa, Tsuneyoshi

    2002-12-01

    It is known that extranuclear organelle DNA is inherited maternally in the majority of angiosperms. The mechanisms for maternal inheritance have been well studied in plastids but not in mitochondria. In the present study we examined the mitochondrial DNA in the male reproductive cells of Hordeum vulgare L. by immunoelectron microscopy. Our results show that the number of anti-DNA gold particles on sections of sperm cell mitochondria decreased by 97% during pollen development. The reduction occurred rapidly in the generative cells and subsequently in the sperm cells, concomitant with a remarkable reduction in mitochondrial volume. It seems that the copy numbers of mitochondrial DNA were reduced in the male reproductive cells, which may be a possible mechanism by which paternal transmission is inhibited. Unlike mitochondria, plastids are excluded from the generative cells during the first pollen mitosis. These data suggest a mechanism for maternal inheritance of mitochondria in angiosperms and for independent control of inheritance of mitochondria and plastids in H. vulgare.

  13. Evidence of phytotoxicity and genotoxicity in Hordeum vulgare L. exposed to CeO2 and TiO2 nanoparticles

    Directory of Open Access Journals (Sweden)

    Alessandro eMattiello

    2015-11-01

    Full Text Available Engineered nanoscale materials (ENMs are considered emerging contaminants since they are perceived as a potential threat to the environment and the human health. The reactions of living organisms when exposed to metal nanoparticles (NPs or NPs of different size are not well known. Very few studies on NPs-plant interactions have been published, so far. For this reason there is also great concern regarding the potential NPs impact to food safety. Early genotoxic and phytotoxic effects of cerium oxide nanoparticles (nCeO2 and titanium dioxide nanoparticles (nTiO2 were investigated in seedlings of Hordeum vulgare L.Caryopses were exposed to an aqueous dispersion of nCeO2 and nTiO2 at respectively 0, 500, 1000 and 2000 mg l-1 for 7 days. Genotoxicity was studied by Randomly Amplified Polymorphism DNA (RAPDs and mitotic index on root tip cells. Differences between treated and control plants were observed in RAPD banding patterns as well as at the chromosomal level with a reduction of cell divisions. At cellular level we monitored the oxidative stress of treated plants in terms of reactive oxygen species (ROS generation and ATP content. Again nCeO2 influenced clearly these two physiological parameters, while nTiO2 were ineffective. In particular, the dose 500 mg l-1 showed the highest increase regarding both ROS generation and ATP content; the phenomenon were detectable, at different extent, both at root and shoot level. Total Ce and Ti concentration in seedlings was detected by ICP-OES. TEM EDSX microanalysis demonstrated the presence of aggregates of nCeO2 and nTiO2 within root cells of barley. nCeO2 induced modifications in the chromatin aggregation mode in the nuclei of both root and shoot cells.

  14. Effects of INH, DNP, 2, 4-D and CMU on the sugar content of the barley and maize leaves; Efecto de cuatro inhibidores metabolicos (INH, DNP, 2, 3-D y CMU) sobre el contenido en azucares de hohas de cebada (Hordeum vulgare L.) y Maiz (Zea mais L.)

    Energy Technology Data Exchange (ETDEWEB)

    Fernandez, J.; Sancho, P.

    1979-07-01

    1 ppm of the chemicals in nutritive solution was absorbed by barley and maize roots during 24 and 48 hours in dark or light conditioners in order to determine the best conditions. for the obtention of labelled sugars with high specific activity. Results show that the highest specific activity was obtained In maize plants treated with DNP for 24 hours in dark conditions. (Author) 51 refs.

  15. Sequencing of 15,622 gene-bearing BACs clarifies the gene-dense regions of the barley genome

    Science.gov (United States)

    Barley (Hordeum vulgare L.) possesses a large and highly repetitive genome of 5.1 Gb that has hindered the development of a complete sequence. In 2012, the International Barley Sequencing Consortium released a resource integrating whole-genome shotgun sequences with a physical and genetic framework....

  16. Entwicklung transgener Gerste (Hordeum vulgare L.) mit dem Ziel der Lysin- und Threoninanreicherung im Endosperm

    OpenAIRE

    Ibrahim, Ahmed Shawky Ahmed

    2006-01-01

    An efficient Agrobacterium-mediated barley transformation system was established with a transformation rate of 13.4 % on average. Towards improving the nutritional value of barley, a set of novel transformation vectors was developed including the dapA and lysC genes encoding the feed-back-inhibition insensitive form of the dihydrodipicolinate synthase (DHDPS) and aspartate kinase (AK) respectively. Both genes under the control of the endosperm-specific D-hordein promoter or the constitutive u...

  17. Effects of INH, DNP, 2,4-D and CMU on the photosynthetic activity of barley and maize plants; Efecto de cuatro inhibidores metabolicos (INH, DNP, 2, 4-D y CMU) sobre la actividad fotosintetica de plantular de cebada (Hordeum vulgare L.) y Maiz (Zea mais L.)

    Energy Technology Data Exchange (ETDEWEB)

    Fernandez, J.; Prieto, M. P.

    1979-07-01

    Determinations of the rate of photosynthesis were made in barley and maize leaves treated with INH, DNP, 2,4-D or CMU. 1 ppm of the chemicals in nutritive solutions was absorbed by roots during 24 or 48 hours in both dark and light conditions. After this period, photosynthetic activity, compensation point and 14{sup C}O{sub 2} assimilation were determined. Results show that INH increases the rate of photosynthesis, DNP and 2,4-D do not alter it sensibly and CMU acts as a strong inhibitor of photosynthesis. Some possible applications for ths obtention of labelled compounds by biosynthesis are discussed. (Author) 87 refs.

  18. Lysine-Rich Proteins in High-Lysine Hordeum Vulgare Grain

    DEFF Research Database (Denmark)

    Ingversen, J.; Køie, B.

    1973-01-01

    The salt-soluble proteins in barley grain selected for high-lysine content (Hiproly, CI 7115 and the mutants 29 and 86) and of a control (Carlsberg II) with normal lysine content, contain identical major proteins as determined by MW and electrophoretic mobility. The concentration of a protein group...

  19. Direct measurement of recombination frequency in interspecific hybrids between Hordeum vulgare and H. bulbosum using genomic in situ hybridization.

    Science.gov (United States)

    Zhang, L; Pickering, R; Murray, B

    1999-09-01

    Two different genotypes of diploid Hordeum vulgare x H. bulbosum hybrids, which differ in their pattern of meiotic metaphase pairing behaviour, were investigated at MI and AI by genomic in situ hybridization (GISH). One hybrid, 102C2, showed a high frequency of bivalents at metaphase I whereas the other, 103K5, showed a high frequency of univalents. The GISH analysis of both hybrids established that pairing occurred only between chromosomes of different parental genomes and revealed that pairing frequency greatly exceeded recombination. Hybrid 102C2 had a significantly higher recombination frequency than 103K5, but in both hybrids recombination involved only distal chromosome regions. However, an interesting finding is that the ratio of recombination to pairing frequency in 103K5 (1:8.9) is twice as high compared with 102C2 (1:17). The hybrids also differed in chromosome stability; little chromosome elimination occurred in 102C2 but 103K5 showed extensive chromosome loss. It appears that the high frequency of bound arms at MI favours retention of H. bulbosum chromosomes and maintains stability of chromosome numbers in PMCs. Various ideas are put forward to explain the discrepancy between meiotic pairing frequency and recombination in these hybrids.

  20. Differentially expressed genes between drought-tolerant and drought-sensitive barley genotypes in response to drought stress during the reproductive stage

    OpenAIRE

    Guo, P; Baum, M.; Grando, S.; Ceccarelli, S.; Bai, G.; Li, R; Von Korff, M.; Varshney, R.,; Graner, A.; Valkoun, V.

    2007-01-01

    Drought tolerance is a key trait for increasing and stabilizing barley productivity in dry areas worldwide. Identification of the genes responsible for drought tolerance in barley (Hordeum vulgare L.) will facilitate understanding of the molecular mechanisms of drought tolerance, and also facilitate the genetic improvement of barley through marker-assisted selection or gene transformation. To monitor the changes in gene expression at the transcriptional level in barley leaves during the repro...

  1. Nonhost resistance of barley is successfully manifested against Magnaporthe grisea and a closely related Pennisetum-infecting lineage but is overcome by Magnaporthe oryzae

    NARCIS (Netherlands)

    Zellerhoff, N.; Jarosch, B.; Groenewald, J.Z.; Crous, P.W.; Schaffrath, U.

    2006-01-01

    Magnaporthe oryzae is a major pathogen of rice (Oryza sativa L.) but is also able to infect other grasses, including barley (Hordeum vulgare L.). Here, we report a study using Magnaporthe isolates collected from other host plant species to evaluate their capacity to infect barley. A nonhost type of

  2. Evaluation of a barley core collection for spot form net blotch reaction reveals distinct genotype specific pathogen virulence and host susceptibility

    Science.gov (United States)

    Spot form net blotch (SFNB) caused by Pyrenophora teres Drechs. f. maculata Smedeg., (anamorph Drechslera teres [Sacc.] Shoem.) is a major foliar disease of barley (Hordeum vulgare L.) worldwide. SFNB epidemics have recently been observed in major barley producing countries, suggesting that the loca...

  3. Production of barley endoprotease B2 in Pichia pastoris and its proteolytic activity against native and recombinant hordeins

    DEFF Research Database (Denmark)

    Rosenkilde, Anne Lind; Dionisio, Giuseppe; Holm, Preben Bach

    2014-01-01

    Barley (Hordeum vulgare L.) cysteine proteases are of fundamental biological importance during germination but may also have a large potential as commercial enzyme. Barley cysteine endoprotease B2 (HvEPB2) was expressed in Pichia pastoris from a pPICZαA based construct encoding a HvEPB2 C-termina...

  4. Wheat and barley exposure to nanoceria: Implications for agricultural productivity

    Science.gov (United States)

    The impacts of man-made nanomaterials on agricultural productivity are not yet well understood. A soil microcosm study was performed to assess the physiological, phenological, and yield responses of wheat (Triticum aestivum) and barley (Hordeum vulgare L.) exposed to nanoceria (n...

  5. Classification and salt tolerance analysis of barley varieties

    NARCIS (Netherlands)

    Katerji, N.; Hoorn, van J.W.; Hamdy, A.; Mastrorilli, M.; Fares, C.; Ceccarelli, S.; Grando, S.; Oweis, T.

    2006-01-01

    Six varieties of barley (Hordeum vulgare), five of which were provided by ICARDA, were tested in a green house experiment for their salt tolerance. Afterwards the ICARDA variety Melusine, selected from this experiment for its combination of high yield and salt tolerance, was compared in a lysimeter

  6. Zinc biofortification of cereals: rice differs from wheat and barley

    NARCIS (Netherlands)

    Stomph, T.J.; Jiang, W.; Struik, P.C.

    2009-01-01

    In their review, mainly focused on bread wheat (Triticum aestivum), durum wheat (Triticum durum) and barley (Hordeum vulgare), Palmgren et al. 1 M.G. Palmgren et al., Zinc biofortification of cereals: problems and solutions, Trends Plant Sci. 13 (2008), pp. 464–473. Article | PDF (905 K) | View Reco

  7. Wheat and barley seed systems in Ethiopia and Syria

    NARCIS (Netherlands)

    Bishaw, Z.

    2004-01-01

    Keywords: Wheat,Triticumspp., Barley,Hordeumvulgare L., Seed Systems, Formal Seed Sector, Informal Seed Sector, National Seed Program, Seed Source, Seed Selection, Seed Management, Seed Quality,

  8. Barley coleoptile peroxidases. Purification, molecular cloning, and induction by pathogens

    DEFF Research Database (Denmark)

    Kristensen, B.K.; Bloch, H.; Rasmussen, Søren Kjærsgård

    1999-01-01

    A cDNA clone encoding the Prx7 peroxidase from barley (Hordeum vulgare L.) predicted a 341-amino acid protein with a molecular weight of 36,515. N- and C-terminal putative signal peptides were present, suggesting a vacuolar location of the peroxidase. Immunoblotting and reverse-transcriptase poly...

  9. Wheat and barley seed systems in Ethiopia and Syria

    NARCIS (Netherlands)

    Bishaw, Z.

    2004-01-01

    Keywords: Wheat,Triticumspp., Barley,Hordeumvulgare L., Seed Systems, Formal Seed Sector, Informal Seed Sector, National Seed Program, Seed Source, Seed Selection, Seed Management, Seed Quality,

  10. Zinc biofortification of cereals: rice differs from wheat and barley

    NARCIS (Netherlands)

    Stomph, T.J.; Jiang, W.; Struik, P.C.

    2009-01-01

    In their review, mainly focused on bread wheat (Triticum aestivum), durum wheat (Triticum durum) and barley (Hordeum vulgare), Palmgren et al. 1 M.G. Palmgren et al., Zinc biofortification of cereals: problems and solutions, Trends Plant Sci. 13 (2008), pp. 464–473. Article | PDF (905 K) | View Reco

  11. Synthesis of the major storage protein, hordein, in barley

    DEFF Research Database (Denmark)

    Giese, Nanna Henriette; Andersen, B.; Doll, Hans

    1983-01-01

    A liquid culture system for culturing detached spikes of barley (Hordeum vulgare L.) at different nutritional levels was established. The synthesis of hordein polypeptides was studied by pulse-labeling with [14C]sucrose at different stages of development and nitrogen (N) nutrition. All polypeptid...

  12. Wheat and barley exposure to nanoceria: Implications for agricultural productivity

    Science.gov (United States)

    The impacts of man-made nanomaterials on agricultural productivity are not yet well understood. A soil microcosm study was performed to assess the physiological, phenological, and yield responses of wheat (Triticum aestivum) and barley (Hordeum vulgare L.) exposed to nanoceria (n...

  13. Registration of Harriman low-phytate, hulled spring barley

    Science.gov (United States)

    The Agricultural Research Service, U.S. Department of Agriculture (USDA-ARS), has released 'Harriman', (Hordeum vulgare L.) (Reg. No. xxxxxx, P.I. xxxxxx). Harriman is a hulled, low-phytate barley, the second to be developed and released by the USDA-ARS. Compared to the previously released hulled, l...

  14. Biotic stress in barley: disease problems and solutions

    Science.gov (United States)

    Barley (Hordeum vulgare L.) is cultivated over a wider geographic range than almost any other major crop species. It can be found growing from the tropics to the high latitudes and from the seacoast to the highest arable mountaintops. On marginal lands where alkaline soils, drought, or cold summer t...

  15. Mapping genes in barley for resistance to Puccinia coronata from couch grass and to P. striiformis from brome, wheat and barley

    NARCIS (Netherlands)

    Niks, R.E.; Alemu, Sisay K.; Marcel, T.C.; Heyzen, van Skye

    2015-01-01

    Barley (Hordeum vulgare L.) mapping populations have been developed that are useful to study the inheritance of quantitative resistance to adapted and unadapted rust fungi. In a recent host range study, we found that the parents of those mapping populations also differed in their resistance to th

  16. Growth and yield of barley (Hordeum vulgare L.) as affected by ...

    African Journals Online (AJOL)

    Bheema

    Supplementary irrigation × site interaction had significant effect only on ... of those of the respective non-stressed environments (Cantero-Martínez et al., ..... managements and genotypes response (Boyer, 1982). .... Doctoral Scientiarum Thesis. ... term tillage, crop rotation, and nitrogen fertilizer effects on wheat yield under.

  17. Barley (Hordeum vulgare L.) cysteine proteases: heterologous expression, purification and characterization

    DEFF Research Database (Denmark)

    Rosenkilde, Anne Lind; Dionisio, Giuseppe; Holm, Preben Bach

    2011-01-01

    B2 (HvEPB2) was ligated into the Pichia pastoris expression vector pPICZ Aα and electrotransformed into Pichia pastoris strain KM71H. Heterologous protein production was induced with 2% MeOH and maximum yield were obtained after 4 days where the supernatant was harvested. Purification of HvEPB2 from...

  18. Cell wall polysaccharides hydrolysis of malting barley (Hordeum vulgare L.: a review

    Directory of Open Access Journals (Sweden)

    Jamar, C.

    2011-01-01

    Full Text Available Malting quality results from the different steps of the malting process. Malting uses internal changes of the seed occurring during germination, such as enzymes synthesis, to obtain a good hydrolysis process and the components required. Among the three main hydrolytic events observed, that are namely starch degradation, cell wall breakdown and protein hydrolysis, an efficient cell wall polysaccharides hydrolysis is an essential condition for a final product of quality. Indeed, because of the physical barrier of the cell wall, cell wall polysaccharides hydrolysis is one of the first steps expected from the process to gain access to the cell components. Moreover, viscosity problem and haze formation in malting industry are related to their presence during the process when inefficient degradation occurs, leading to increased production time and cost. Understanding the key elements in cell wall degradation is important for a better control. (1-3,1-4-β-glucans and arabinoxylans are the main constituents of cell wall. (1-3,1-4-β-glucans are unbranched chains of β-D-glucopyranose residues with β-(1,3 linkages and β-(1,4 linkages. Arabinoxylan consists in a backbone of D-xylanopyranosyl units linked by β-(1-4 bonds connected to single L-arabinofuranose by α-(1→2 or α-(1→3-linkages. Degradation of (1-3,1-4-β-glucans is processed by the (1-3,1-4-β-glucanases, the β-glucosidases and the β-glucane exohydrolases. It seems that the (1-3-β-glucanases are also involved. Arabinoxylans are mainly decomposed by (1-4-β-xylan endohydrolase, arabinofuranosidase and β-xylosidase.

  19. Starch and Prolamin Level in Single and Double High-Lysine Barley Mutants

    DEFF Research Database (Denmark)

    Kreis, M.; Doll, Hans

    1980-01-01

    At maturity the high-lysine barley (Hordeum vulgare L.) Ris0 mutants 1508, 527 and 29 kernels contained about 20% less starch and twice as much free sugars as the parent varieties Bomi and Carlsberg II. An enhanched effect on starch reduction and free sugar accumulation was observed during kernel...

  20. Primer Dependent and Independent Forms of Soluble Starch Synthetase from Developing Barley Endosperms

    DEFF Research Database (Denmark)

    Kreis, M.

    1980-01-01

    The activity of soluble starch synthetase (ADP-glucose: agr-1,4-glucan agr-4-glucosyltransferase) in the non-purified extract from 16 day-old Bomi barley endosperms (Hordeum vulgare L.) was low and the reaction was non-linear when plotted against protein concentration. Starch synthetase was purif...

  1. Biochemistry, Structure and Function of Non-Wheat Proteins: Case Study of Barley ß-Amylase

    Science.gov (United States)

    The importance of a protein is not always evident and may be due to its multifunctional nature. ß-Amylase in seeds of barley (Hordeum vulgare L.) constitutes approximately 2% of the total protein in mature seeds and is assumed to be important when storage proteins are mobilized to support protein s...

  2. Genetic mapping of the barley lodging resistance locus Erectoides-k

    DEFF Research Database (Denmark)

    Kristensen, Peter Skov; Dockter, Christoph; Lundqvist, Udda;

    2016-01-01

    The barley (Hordeum vulgare L.) mutant erectoides-k.32 (ert-k.32) was isolated in 1947 from an X-ray-mutant population of cultivar ‘Bonus’. The mutant was released as a cultivar in 1958 with the name ‘Pallas’ – one of the first cereal crop cultivars developed from induced mutants. ‘Pallas’ is a s...

  3. Structural and expressional analysis of the B-hordein genes in Tibetan hull-less barley

    Science.gov (United States)

    The B-hordein gene family was analyzed from two Tibetan hull-less barley cultivars, Z09 and Z26 (Hordeum vulgare subsp. vulgare). Fourteen B-hordein genes, designated BZ09-2 to BZ09-5 (from Z09) and BZ26-1 to BZ26-10 (from Z26), were sequenced. Seven of them similar to a previously reported BZ09-1...

  4. Relationships in the barley genus (Hordeum): An electrophoretic examination of proteins

    DEFF Research Database (Denmark)

    Bagger Jørgensen, Rikke

    1986-01-01

    The relationships between all known Hordeum species except H. guatemalense were inferred from the electrophoresis of the six enzyme systems Got, 6-Pgd, Mdh, Idh, .alpha.- and.beta.- amylases. A total of eleven loci were scored for in these systems. Maximum likelihood clusters and Wagner networks...

  5. Starch and Free Sugars during Kernel Development of Bomi Barley and its High-Lysine Mutant 1508

    DEFF Research Database (Denmark)

    Kreis, Michael

    1978-01-01

    At maturity the high-lysine barley (Hordeum vulgare L.) Ris0 mutants 1508, 527 and 29 kernels contained about 20% less starch and twice as much free sugars as the parent varieties Bomi and Carlsberg II. An enhanched effect on starch reduction and free sugar accumulation was observed during kernel...

  6. Proteome analysis of barley seeds: Identification of major proteins from two-dimensional gels (pl 4-7)

    DEFF Research Database (Denmark)

    Østergaard, O.; Finnie, Christine; Laugesen, S.;

    2004-01-01

    -soluble proteins in extracts of mature barley (Hordeum vulgare) seeds and to follow their fate during germination. About 1200 and 600 spots of p/ 4-7 were detected on 2-D gels by silver staining and colloidal Coomassie Brilliant Blue staining, respectively. About 300 spots were selected for in-gel digestion...

  7. Multi-method research strategy for understanding changes in storage protein composition in developing barley grain to improve nutritional profile

    DEFF Research Database (Denmark)

    Kaczmarczyk, Agnieszka Ewa

    Barley (Hordeum vulgare L.) is cultivated in a range of diverse environments and is widely utilised as feed for animal and as malt in brewing. Nitrogen (N) is a key macronutrient whch directly increases plant growth and is used as a fertiliser to meet the demands for higher yield. However...

  8. Grain Yield Variation in Malting Barley Cultivars in Uruguay and Its Consequences for the Design of a Trials Network

    NARCIS (Netherlands)

    Ceretta, S.S.E.; Eeuwijk, van F.A.

    2008-01-01

    The efficiency of cultivar trial networks is an important subject in official cultivar testing. We investigated this efficiency for malting barley (Hordeum vulgare L.) in Uruguay, using data on 213 cultivars tested across an eight-year period at six locations. The variance-components approach was us

  9. Characterization of a multifunctional inositol phosphate kinase from rice and barley belonging to the ATP-grasp superfamily

    DEFF Research Database (Denmark)

    Josefsen, L.; Bohn, L.; Sørensen, M.B.;

    2007-01-01

    OsIpk and HvIk, inositol phosphate kinases, were cloned from rice (Oryza sativa L. var. indica, IR64) and barley (Hordeum vulgare) respectively.. IP Sequence alignment showed that they belong to the ATP-grasp family, which includes inositol 1,3,4-trisphosphate 5/6-kinase from humans and Arabidops...

  10. Identification of Pyrenophora teres f. maculata, Causal Agent of Spot Type Net Blotch of Barley in North Dakota

    Science.gov (United States)

    Net blotch of barley (Hordeum vulgare L.), caused by the fungus Pyrenophora teres (anamorph: Drechslera teres) can be differentiated into two forms, net form net blotch (NFNB) and spot form net blotch (SFNB). The pathogen forms causing the two different symptoms are P. teres f. teres and P. teres f....

  11. Chemometrics applied to the analysis of induced phytochelatins in Hordeum vulgare plants stressed with various toxic non-essential metals and metalloids.

    Science.gov (United States)

    Dago, Àngela; González, Inmaculada; Ariño, Cristina; Díaz-Cruz, José Manuel; Esteban, Miquel

    2014-01-01

    Hordeum vulgare plants were stressed with Hg, Cd and As and their phytotoxicity was evaluated in terms of growth inhibition and total metal uptake by the plant. The synthesised phytochelatins ((γ-Glu-Cys)n-Gly, n=2-5; PCs) were determined by HPLC with amperometric detection at a glassy carbon electrode. The results indicate that H. vulgare is a good phytostabilisation plant due to its capacity to accumulate heavy metals in roots. Cd and Hg are the most uptake toxic elements, being Cd the most potent inducer of PCs. The data obtained on the different PCs and related peptides induced by each heavy metal were used to perform a Principal Component Analysis (PCA) of the results as a function of the contaminating toxic element or its concentration level. The nature of the stressor element could be predicted from the pattern of PCs and related peptides identified by PCA. PCs were the most strongly induced peptides under Cd and Hg stress, whereas As only tended to synthesise small thiols such as glutathione and γ-glutamylcysteine, both precursors of PCs synthesis. This finding indicates that PCs are induced at different rates depending on the metal stressor used.

  12. Genetic analysis and ecological association of Hina genes based on single nucleotide polymorphisms (SNPs) in wild barley, Hordeum spontaneum.

    Science.gov (United States)

    Li, Wei-Tao; Huang, Xia; Wang, Ji-Rui; Chen, Guo-Yue; Nevo, Eviatar; Zheng, You-Liang; Wei, Yu-Ming

    2010-02-01

    Specific primers were designed to amplify the sequences of Hina genes from 121 wild barley (Hordeum spontaneum) accessions belonging to 18 populations from Iran, Israel and Turkey. Forty-nine single nucleotide polymorphisms (SNPs), nine indels, and 26 haplotypes were determined by sequence analysis. The genetic polymorphism (P), genetic diversity (He), and Shannon's information index (I) in the 18 populations were 0.486, 0.181 and 0.269, respectively. Approximately 2/3 genetic variations of Hina genes were presented within populations, while approximately 1/3 genetic variations were observed between populations. Broad gene flow (Nm= 3.31) and low genetic variation (Gst= 0.0702) were detected. However, the genetic differentiation between populations was independent of geographical distances according to the Mantel test (p = 0.478). The result of Spearman rank correlations (r(s)) showed that the genetic indices (P, He and I) of Hina were not significantly correlated with ecological factors. Only eight SNP positions correlated significantly with ecological factors. Of the eight SNP positions that positively correlated with ecological factors, only one SNP (769, T-C) was located in the coding region; however, it was not responsible for the amino acid change.

  13. Synthesis of Salt Soluble Proteins in Barley. Pulse-Labeling Study of Grain Filling in Liquid-Cultured Detached Spikes

    DEFF Research Database (Denmark)

    Giese, Nanna Henriette; Hejgaard, Jørn

    1984-01-01

    The accumulation of salt-soluble proteins in the endosperm of developing barley (Hordeum vulgare L.) grains was examined. Detached spikes of barley were cultured at different levels of nitrogen nutrition and pulse-labeled with [14C] sucrose at specific times after anthesis. Proteins were extracted...... to increased nitrogen nutrition. Two major components, β-amylase and protein Z in particular, had a synthesis profile almost identical to that of the endosperm storage protein, hordein....

  14. Nitrogen immobilization and mineralization during initial decomposition of 15N-labelled pea and barley residues

    DEFF Research Database (Denmark)

    Jensen, E.S.

    1997-01-01

    The immobilization and mineralization of N following plant residue incorporation were studied in a sandy loam soil using N-15-labelled field pea (Pisum sativum L.) and spring barley (Hordeum vulgare L.) straw. Both crop residues caused a net immobilization of soil-derived inorganic N during...

  15. Root plasma membrane transporters controlling K+/Na+ homeostasis in salt-stressed bBarley1[C][W]

    DEFF Research Database (Denmark)

    Chen, Zhonghua; Pottosin, Igor I.; Cuin, Tracey A.;

    2007-01-01

    Plant salinity tolerance is a polygenic trait with contributions from genetic, developmental, and physiological interactions, in addition to interactions between the plant and its environment. In this study, we show that in salt-tolerant genotypes of barley (Hordeum vulgare), multiple mechanisms ...

  16. Registration of LP1-2581, LP1-2163H, LP3-1159, and LP640-1304 low phytate spring barley germplasm lines

    Science.gov (United States)

    The Agricultural Research Service, U.S. Dept. of Agriculture (USDA-ARS) has developed and released four low-phytate spring barley (Hordeum vulgare L.) germplasm lines: LP1-2581 (Reg. No._____, PI 658245), LP1-2163H (Reg. No._____, PI 658248 ), LP3-1159 (Reg. No._____, PI 658247), and LP640-1304 (...

  17. Integrating statistical and ecophysiological analysis of genotype by environment interaction for grain filling of barley in Mediterranean areas. I. Individual grain weight

    NARCIS (Netherlands)

    Voltas, J.; Eeuwijk, van F.A.; Sombrero, A.; Lafarga, A.; Igartua, E.; Romagosa, I.

    1999-01-01

    In Mediterranean-type environments, grain weight of barley (Hordeum vulgare L.) is influenced by the presence of terminal abiotic stresses such as drought or elevated temperature. The relative importance of these climatic constraints acting together prior to and after anthesis, as well as the specif

  18. Mechanisms involved in control of ¤Blumeria graminis¤ f.sp. ¤hordei¤ in barley treated with mycelial extracts from cultured fungi

    DEFF Research Database (Denmark)

    Haugaard, H.; Collinge, D.B.; Lyngkjær, Michael Foged

    2002-01-01

    Treatment with mycelial extracts, prepared from liquid cultures of Bipolaris oryzae , Pythium ultimum and Rhizopus stolonifer , protected barley (Hordeum vulgare ) against powdery mildew disease caused by the fungus Blumeria graminis f.sp. hordei . The mechanisms of this protection were studied...

  19. NAM-1gene polymorphism and grain protein content in Hordeum.

    Science.gov (United States)

    Jamar, Catherine; Loffet, Francois; Frettinger, Patrick; Ramsay, Luke; Fauconnier, Marie-Laure; du Jardin, Patrick

    2010-04-15

    Grain protein content (GPC) is a key quality factor for malting and brewing process. In wheat, a QTL explaining a large part of GPC variation was identified, which co-localizes with a gene encoding a NAC transcription factor (TtNAM-B1). NAC transcription factors influence GPC by their role in the regulation of senescence and in protein remobilization. An orthologous gene was discovered on barley chromosome 6H where a GPC QTL was mapped. In this study, we identify allelic variation of the NAM-1 gene for three species of Hordeum representing wild and cultivated barley and we investigate the possible link with GPC. Three haplotypes were identified, one corresponds to the sequences of 11 European varieties representing H. vulgare, one corresponds to the sequence found in H. spontaneum and one represents the sequence of H. bulbosum. Three SNPs were identified between H. spontaneum sequence and H. vulgare sequence. One of the H. bulbosum polymorphisms leads to the introduction of a stop codon and a non-functional protein. Differences in GPC between the 11 varieties were found but no polymorphism in the NAM-1 gene was observed, suggesting that differences in expression of the HvNAM-1 gene or other genes should play a role in GPC regulation. Nevertheless based on published values for GPC of H. bulbosum and H. spontaneum compared to GPC measured here in H. vulgare, the non-functional protein is associated with the lower GPC, suggesting that loss of functionality of the NAM-1 gene in Hordeum is related to lower GPC. Moreover H. spontaneum GPC seems to be higher than H. vulgare GPC, suggesting also that allelic variation of the functional NAM-1 gene could be associated with GPC variation within the genus Hordeum. Copyright 2009 Elsevier GmbH. All rights reserved.

  20. Resistance to Barley Leaf Stripe

    DEFF Research Database (Denmark)

    Nørgaard Knudsen, J. C.

    1986-01-01

    in well adapted Northwest European spring cultivars. Virulence matching two hitherto not overcome resistances was demonstrated. Differences in apparent race nonspecific or partial resistance were also present, changing the percentage of infected plants of susceptible genotypes from about 20 to 44 per cent.......Ten barley [Hordeum vulgare] genotypes were inoculated with twelve isolates of Pyrenophora graminea of diverse European and North African origin. Race specific resistance occurred. Four, possibly five, genetically different sources of race-specific resistance were found, three of them occurring...

  1. Uptake and distribution of stable strontium in 26 cultivars of three crop species: oats, wheat, and barley for their potential use in phytoremediation.

    Science.gov (United States)

    Qi, Lin; Qin, Xiaoliang; Li, Feng-Min; Siddique, Kadambot H M; Brandl, Helmut; Xu, Jinzhang; Li, Xiaogang

    2015-01-01

    The main objective of this study was to investigate the accumulation and distribution of strontium (Sr) in 26 cultivars of wheat (Triticum aestivum L.), husk oat (Avena sativa L) and naked oat (Avena nuda), and barley (Hordeum vulgare L.) for their potential use in phytoremediation.Sr levels had no effect on the accumulation of shoot biomass at tillering or at maturity. Mean shoot Sr concentration of naked oat and barley at tillering was significantly (Pphytoremediation to clean up contaminated soil.

  2. The effect of anther orientation on the production of microspore-derived embryoids and plants of Hordeum vulgare cv. Sabarlis.

    Science.gov (United States)

    Hunter, C P

    1985-10-01

    The orientation of barley anthers on culture medium had a marked effect on their response. Embryoids developed only in the upper lobes of anthers cultured on edge, i.e. with a single lobe in contact with the culture medium. Anthers cultured flat, i.e. with both lobes in contact with the medium, did not respond. Careful orientation of anthers at the start of incubation resulted in a mean yield of 20 green plants per 100 anthers cultured.

  3. The 'Green Revolution' dwarfing genes play a role in disease resistance in Triticum aestivum and Hordeum vulgare.

    Science.gov (United States)

    Saville, R J; Gosman, N; Burt, C J; Makepeace, J; Steed, A; Corbitt, M; Chandler, E; Brown, J K M; Boulton, M I; Nicholson, P

    2012-02-01

    The Green Revolution dwarfing genes, Rht-B1b and Rht-D1b, encode mutant forms of DELLA proteins and are present in most modern wheat varieties. DELLA proteins have been implicated in the response to biotic stress in the model plant, Arabidopsis thaliana. Using defined wheat Rht near-isogenic lines and barley Sln1 gain of function (GoF) and loss of function (LoF) lines, the role of DELLA in response to biotic stress was investigated in pathosystems representing contrasting trophic styles (biotrophic, hemibiotrophic, and necrotrophic). GoF mutant alleles in wheat and barley confer a resistance trade-off with increased susceptibility to biotrophic pathogens and increased resistance to necrotrophic pathogens whilst the converse was conferred by a LoF mutant allele. The polyploid nature of the wheat genome buffered the effect of single Rht GoF mutations relative to barley (diploid), particularly in respect of increased susceptibility to biotrophic pathogens. A role for DELLA in controlling cell death responses is proposed. Similar to Arabidopsis, a resistance trade-off to pathogens with contrasting pathogenic lifestyles has been identified in monocotyledonous cereal species. Appreciation of the pleiotropic role of DELLA in biotic stress responses in cereals has implications for plant breeding.

  4. Identification and characterization of barley RNA-directed RNA polymerases

    DEFF Research Database (Denmark)

    Madsen, Christian Toft; Stephens, Jennifer; Hornyik, Csaba

    2009-01-01

    in dicot species. In this report, we identi!ed and characterized HvRDR1, HvRDR2 and HvRDR6 genes in the monocot plant barley (Hordeum vulgare). We analysed their expression under various biotic and abiotic stresses including fungal and viral infections, salicylic acid treatment as well as during plant...... development. The different classes and subclasses of barley RDRs displayed contrasting expression patterns during pathogen challenge and development suggesting their involvement in speci!c regulatory pathways. Their response to heat and salicylic acid treatment suggests a conserved pattern of expression...

  5. Occurrence of barley leaf disease and control strategies in Denmark

    DEFF Research Database (Denmark)

    Jørgensen, Lise Nistrup; Ørum, Jens Erik; Heick, Thies Marten

    Barley (Hordeum vulgare) is one of the major crops in Denmark and of special importance for malting and for pig feed. In 2016, the crop was grown covering a total area of 700,000 ha; approximately 25% of arable area in Denmark. To ensure high yield of around 60 dt ha-1, disease-tolerant cultivars......), mildew of barley (Erysiphe graminis f.sp. hordei) and Ramularia (Ramularia collo-cygni). In recent years, brown rust and net blotch have been the most important disease in terms of yield losses. As most cultivars have mlo resistance, powdery mildew is today seen as a minor problem. Significant attack...

  6. Implementation of biochemical screening to improve baking quality of Barley

    DEFF Research Database (Denmark)

    Aaslo, Per; Langkilde, Ane; Dionisio, Giuseppe

    2011-01-01

    Barley (Hordeum vulgare) is mostly used in feed and malt production but has the ability to provide humans nutritional benefits. The current wheat based “barley” breads can unfortunately not exceed more than 20% barley flour mixed into the dough due to poor leavening properties. Therefore...... the opportunity to give a forecast of the taste of the bread, as the AA composition is known to control certain aspects of the taste. We uses a MSE approach on a time of flight instrument coupled to a UPLC and in gel digestion to identify and characterize the different D-hordeins responsible for baking quality...

  7. High-level expression of the native barley alpha-amylase/subtilisin inhibitor in Pichia pastoris

    DEFF Research Database (Denmark)

    Micheelsen, Pernille Ollendorff; Ostergaard, Peter Rahbek; Lange, Lene

    2008-01-01

    An expression system for high-level expression of the native Hordeum vulgare alpha-amylase/subtilisin inhibitor (BASI) has been developed in Pichia pastoris, using the methanol inducible alcohol oxidase 1 (AOX1) promoter. To optimize expression, two codon-optimized coding regions have been design...... and characterized by Edman degradation, liquid chromatography mass spectrometry and insoluble blue starch assay, and was shown to possess the same characteristics as wild-type protein purified from barley grains....

  8. Intercalation of psoralen into DNA of plastid chromosomes decreases late during barley chloroplast development.

    OpenAIRE

    Davies, J. P.; Thompson, R.J.; Mosig, G

    1991-01-01

    We have used a DNA crosslinking assay to measure intercalation of the psoralen derivative HMT (4'-hydroxymethyl-4,5',8-trimethylpsoralen) into barley (Hordeum vulgare) plastid chromosomal DNA during chloroplast and etioplast development. Intercalation into DNA in intact plastids in vivo and in plastid lysates in vitro shows that chromosomal DNA in the most mature chloroplasts intercalates HMT less efficiently than DNA in younger chloroplasts. In contrast, there is no change in HMT intercalati...

  9. Response of barley seedlings to oxidative stress generated by treatments with growth hormones

    OpenAIRE

    Zenovia Olteanu; Elena Truta; Lacramiora Oprica; Maria Magdalena Zamfirache

    2009-01-01

    The effects induced by growth hormone regulators on soluble protein level and some oxidoreductases in Hordeum vulgare cv. Madalin seedlings were investigated. The study of superoxide dismutase, catalyse and peroxidase behaviour and of protein synthesis was realized in dynamics to evaluate the response of barley seedlings to oxidative stress generated by exposure to hormone factors. During experiments, peroxidase registered smaller limits of variability than superoxide dismutase an...

  10. Giemsa C-banding of Barley Chromosomes. I: Banding Pattern Polymorphism

    DEFF Research Database (Denmark)

    Linde-Laursen, Ib

    1978-01-01

    Twenty barley (Hordeum vulgare) lines studied had a common basic chromosome banding pattern. Most bands ranged from medium to very small in size. The most conspicuous banding occurred at or near the centromeres, in the proximal, intercalary parts of most chromosome arms and beside the secondary c...... 7. Seventeen differently banded karyotypes were found. Some banding pattern polymorphisms can be used in cytological and cytogenetic studies....

  11. A study on zinc distribution in calcareous soils for cowpea (Vigna Unguiculata L.) and barely ( Hordeum Vulgare L.)

    Science.gov (United States)

    Boroomand, Naser; Maleki, Mohammad Reza

    2010-05-01

    Compared to other cereals, such as wheat and barley cultivars which have low sensitivity to Zn deficiency, cowpea is sensitive to zinc (Zn) deficiency, however it extensively grows even in soils with deficient in Zn. A 8-week greenhouse experiment was conducted to study the response of cowpea and barely to Zn in calcareous soils with different DTPA- Zn. The soil samples were taken from soil surface up to 0.3 m in which their DTPA- Zn ranged from 0.5 to 3.5 mg kg-1. Shoot dry matter, concentration and uptake of Zn were found to be significantly correlated with soil DTPA- Zn in cowpea and barely. Critical deficiency level of Zn in cowpea was 1.3 mg kg-1 in soil and 28.5 mg kg-1 in shoot dry matter, however, to barely symptoms of Zn deficiency was not observed and concentration of Zn was higher than the critical level reported in literatures. Organic carbon (OC), calcium carbonate equivalent (CCE), pH and field capacity soil moisture content(FC) were significantly correlated with plant responses to Zn which were the most influenced characteristics to Zn uptake by plants.

  12. Luteibacter rhizovicinus gen. nov., sp nov., a yellow-pigmented gammaproteobacterium isolated from the rhizosphere of barley (Hordeum vulgare L.)

    DEFF Research Database (Denmark)

    Johansen, Jens E.; Binnerup, Svend J.; Kroer, Niels

    2005-01-01

    ) had a DNA G+C content of 64.3 mol% and the major fatty acids were 15:0 iso (23.4%), 17: 1 iso omega 9c (25.5%) and 17 :0 iso (18.1 %). Phylogenetic analysis of the 16S rRNA gene sequences of the three strains showed 96 % sequence similarity to Rhodanobacter lindaniclasticus LMG 18385(T), 95...... % to Frateuria aurantia DSM 6220(T) and 96 % to Fulvimonas soli LMG 19981(T). Using LJ96(T) DNA as probe, DNA-DNA hybridizations documented the relationship of the three strains to a single species (87.4-98.7% relatedness) and showed less than 30% relatedness to Frateuria aurantia DSM 62207 and Fulvimonas soli...... DSM 14263(T). Rhodanobacter lindaniclasticus LMG 183857 is not extant and the strain not available from any public strain collections, thus DNA-DNA hybridization could not include this strain. On the basis of genotypic and phenotypic characteristics, the three yellow-pigmented strains could also...

  13. Can barley (Hordeum vulgare L. s.l.) adapt to fast climate changes? A controlled selection experiment

    DEFF Research Database (Denmark)

    Alemayehu, Fikadu Reta; Frenck, Georg; van der Linden, Leon

    2013-01-01

    The projected future climate will affect the global agricultural production negatively, however, to keep abreast of the expected increase in global population, the agricultural production must increase. Therefore, to safeguard the future crop yield and quality, the adaptive potential of crops...

  14. Characterization and partial purification of beta-1,3-D-glucan (callose) synthase from barley (Hordeum vulgare) leaves

    DEFF Research Database (Denmark)

    Pedersen, L.H.; Jacobsen, S.; Hejgaard, J.

    1993-01-01

    was inhibited by UDP and uridine 5' triphosphate (UTP). Glucanase digestion of the in vitro product showed that it was a beta-1,3-linked polysaccharide. Two different procedures were used for further enrichment of polypeptides involved in callose synthase activity. Sucrose gradient centrifugation...

  15. Transgenic barley: a prospective tool for biotechnology and agriculture.

    Science.gov (United States)

    Mrízová, Katarína; Holasková, Edita; Öz, M Tufan; Jiskrová, Eva; Frébort, Ivo; Galuszka, Petr

    2014-01-01

    Barley (Hordeum vulgare L.) is one of the founder crops of agriculture, and today it is the fourth most important cereal grain worldwide. Barley is used as malt in brewing and distilling industry, as an additive for animal feed, and as a component of various food and bread for human consumption. Progress in stable genetic transformation of barley ensures a potential for improvement of its agronomic performance or use of barley in various biotechnological and industrial applications. Recently, barley grain has been successfully used in molecular farming as a promising bioreactor adapted for production of human therapeutic proteins or animal vaccines. In addition to development of reliable transformation technologies, an extensive amount of various barley genetic resources and tools such as sequence data, microarrays, genetic maps, and databases has been generated. Current status on barley transformation technologies including gene transfer techniques, targets, and progeny stabilization, recent trials for improvement of agricultural traits and performance of barley, especially in relation to increased biotic and abiotic stress tolerance, and potential use of barley grain as a protein production platform have been reviewed in this study. Overall, barley represents a promising tool for both agricultural and biotechnological transgenic approaches, and is considered an ancient but rediscovered crop as a model industrial platform for molecular farming.

  16. Implementation of biochemical screening to improve baking quality of barley

    DEFF Research Database (Denmark)

    Vincze, Éva; Dionisio, Giuseppe; Aaslo, Per;

    2011-01-01

    Barley (Hordeum vulgare) has the potential to offer considerable human nutritional benefits, especially as supplement to wheat-based breads. Under current commercial baking conditions it is not possible to introduce more that 20% barley flour to the wheat bread without negative impact...... proteins. Changing the storage protein composition can lessen this problem. Our working hypothesis was that exploiting the substantial genetic variation within the gene pool for storage proteins could enable improving the baking qualities of barley flour. We characterised forty-nine barley cultivars...... for variations in storage protein and AA composition. These cultivars were selected based on their higher protein contents (11.8–17.6%). The results obtained indicated that substantial variation not only in the distribution of the hordein polypeptides but also in the relative proportions of the storage proteins...

  17. Effect of different doses of post-emergence-applied iodosulfuron on weed control and grain yield of malt barley (Hordeum distichum L., under Mediterranean conditions

    Directory of Open Access Journals (Sweden)

    Barros José Calado

    2016-01-01

    Full Text Available A study was carried out over a two year period (2009/2010 and 2012/2013 on an experimental farm in the Alentejo region (Beja, in southern Portugal where rainfed malt barley (Hordeum distichum L. is sown at the end of autumn or beginning of winter (November- December. The aim of this experiment was to study the efficiency of the herbicide iodosulfuron-methyl-sodium to control post-emergence broadleaved weeds in this cereal crop. The malt barley crop was established using no-till farming. This technology provides the necessary machine bearing capacity of the soil to assure the post-emergence application of herbicides at two different weed development stages. The herbicide iodosulfuron-methyl-sodium was applied at three doses (5.0, 7.5, and 10.0 g a. i. · ha-1 and at two different broadleaved weed development stages (3 to 4 and 6 to 7 pairs of leaves, that also corresponded to two different crop development stages (beginning of tillering and complete tillering. The results indicated that early herbicide application timing provided a significantly higher efficiency for all the applied herbicide doses, but this better weed control was not reflected in a higher crop grain yield. The lack of a higher crop grain yield was probably due to a crop phytotoxicity of the herbicide, when used at an early application timing.

  18. Wild Barley,Hordeum spontaneum,a Genetic Resource for Crop Improvement in Cold and Arid Regions

    Institute of Scientific and Technical Information of China (English)

    Eviatar; Nevo

    2008-01-01

    Food security in cold and arid regions in the world is threatened by stressful and unpredictable environments.The sus-tainable and economically viable solution for increasing stability of food productivity in cold and arid regions is genetic improvement of crops towards high resistance to abiotic stresses,mainly cold and drought resistance.It is often empha-sized that crop genetic improvement lies in exploiting the gene pools of the wild relatives of the crop plant.Wild barley,H.spontaneum,the progenitor of cultivated barley,is a selfing annual grass of predominantly Mediterranean and Irano-Turanian distribution that penetrates into desert environments where it maintains stable populations.Wild barley is also found in cold regions,such as in Tibet.The adaptation of wild barley to the arid region in Israel and Jordan,and the cold region in Tibet has accumulated rich genetic diversities for drought,salt,and cold resistances in wild barley,which is the genetic resource for barley and other crop improvement in arid and cold regions.These genetic diversities are revealed by allozymes,DNA-based molecular markers,and morphological and physiological traits of wild barley plants.Quantita-tive trait loci(QTLs) related to drought resistance were identified in wild barley via the QTL mapping approach.Drought resistance genes such as dehydrins,hsdr4,and eibi1 were identified in wild barley based on the candidate gene approach,gene differential expression approach,and molecular genetic approach,respectively.Genetics and genomics of wild bar-ley cold resistance have not been exploited yet,remaining a huge treasure for future crop improvement of cold resistance.Advanced backcross QTL analysis,the introgression libraries based on wild barley as donors,a QTL approach based on wide crosses using wild barley,and positional cloning of natural QTLs will play prevailing roles to help us understand the molecular control of cold and drought tolerance.Integration of QTL information into a

  19. Enhancing the aluminium tolerance of barley by expressing the citrate transporter genes SbMATE and FRD3

    OpenAIRE

    Zhou, Gaofeng; Pereira, Jorge F.; Delhaize, Emmanuel; Zhou, Meixue; Magalhaes, Jurandir V.; Ryan, Peter R.

    2014-01-01

    Malate and citrate efflux from root apices is a mechanism of Al3+ tolerance in many plant species. Citrate efflux is facilitated by members of the MATE (multidrug and toxic compound exudation) family localized to the plasma membrane of root cells. Barley (Hordeum vulgare) is among the most Al3+-sensitive cereal species but the small genotypic variation in tolerance that is present is correlated with citrate efflux via a MATE transporter named HvAACT1. This study used a biotechnological approa...

  20. Genetic Diversity of SSR Markers in Cultivated Hordeum vulgare L. in Qinghai Province%青海省栽培青稞SSR标记遗传多样性研究

    Institute of Scientific and Technical Information of China (English)

    田海宁; 杨菁; 何桂芳

    2011-01-01

    [ Objective] The aim was to analyze genetic diversity of SSR markers in Hordeum vulgare L. in Qinghai Province and lay a foundation for screening and protecting some excellent H. vulgare cultivars. [ Method] SSR markers were used to evaluate the genetic diversity of 42 cultivated H. vulgare from Qinghai Province. [ Result ] 42 H. vulgare showed polymorphism in 7 SSR markers locus. A total of 24 alleles were identified, and the number of alleles per locus ranged from 1 to 6, with an average of 3.0. According to SSR markers polymorphism, 42 H. vulgare could be divided into 4 groups, namely Ⅰ, Ⅱ, Ⅲ and IV. [ Result] The study indicated that cultivated H. vulgare from Qinghai Province is rich in genetic diversity, which will provide reference for selecting parent of H. vulgare breeding.%[目的]分析我国青海省青稞SSR标记遗传多样性,为具有某些优异特性的青稞品种或资源筛选及青稞资源的保护奠定基础.[方法]利用SSR标记评估42份青海省栽培青稞的遗传多样性.[结果]42份青稞材料在7个SSR标记位点处表现出多态性,各位点扩增的等位基因数为1~6个,共鉴定出24个等位基因,每位点平均3.0个;根据SSR标记多态性可将42份青稞材料分为4组,即Ⅰ、Ⅱ、Ⅲ和Ⅳ.[结论]该研究表明青海省栽培青稞具有丰富的遗传多样性,可为青稞育种亲本选择提供参考.

  1. Influence of Straw Pulp Film Mulching on Water Conservation Effect of Hordeum vulgare Farmland in Tibet%西藏青稞农田草浆地膜覆盖的保水效果研究

    Institute of Scientific and Technical Information of China (English)

    关法春

    2012-01-01

    采用对比方法研究了草浆地膜覆盖对青稞(Hordeum vulgare)农田土壤的保水作用,以期明确草浆地膜的农田保水理论依据和保水效果.结果表明:草浆地膜覆盖下的土壤表面相对湿度、土壤紧实度和土壤含水量等指标均低于塑料地膜覆盖处理,其中土壤含水量指标显著低于后者(n=3,P<0.05);与对照相比,草浆地膜覆盖下0~5 cm土层内土壤紧实度显著降低,但土壤温度与对照相比相差不大,同时土壤表层水分散失明显减少,土壤含水量增加7.59%,达到显著差异水平(n=3,P<0.05).草浆地膜覆盖保水效果十分明显.%In order to offer theoretical basis and clarify practical effect, straw pulp film and plastic film were compared to investigate the effect of film mulches for water conservation of soil in Hordeum vulgare farmland. Plastic film, straw pulp film and CK treatment were administrated; the effect was compared by measuring relative humidity of soil surface, soil temperature, soil compaction and water content. The results showed that all four factors monitored were lower in the treatment of straw pulp film than the plastic film, among which water content of the former was significantly reduced than the latter(n=3, P<0.05). In the treatment of straw pulp film comparing to CK, soil compaction was significantly reduced(n=3, P<0.05), while no significant difference in soil temperature was shown between the two. The evaporation of soil moisture reduced dramatically in the treatment of straw pulp film, resulting in a 7.59% statistically significant increase in the water content of soil (n=3, P<0.05). In conclusion, the straw pulp film mulch has significantly improved the water conservation of the soil in Hordeum vulgare farmland.

  2. Isolation and characterization of the gene encoding the starch debranching enzyme limit dextrinase from germinating barley

    DEFF Research Database (Denmark)

    Kristensen, Michael; Lok, Finn; Planchot, Véronique

    1999-01-01

    The gene encoding the starch debranching enzyme limit dextrinase, LD, from barley (Hordeum vulgare), was isolated from a genomic phage library using a barley cDNA clone as probe. The gene encodes a protein of 904 amino acid residues with a calculated molecular mass of 98.6 kDa. This is in agreement...... fragments coupled with matrix assisted laser desorption mass spectrometry. The sequenced peptide fragments cover 70% of the entire protein sequence, which shows 62% and 77% identity to that of starch debranching enzymes from spinach and rice and 37% identity to Klebsiella pullulanase. Sequence alignment...

  3. Heterogeneity of Powdery Mildew Resistance Revealed in Accessions of the ICARDA Wild Barley Collection

    Science.gov (United States)

    Dreiseitl, Antonin

    2017-01-01

    The primary genepool of barley comprises two subspecies – wild barley (Hordeum vulgare subsp. spontaneum) and cultivated barley H. vulgare. subsp. vulgare. The former originated 5.5 million years ago in southwest Asia and is the immediate ancestor of cultivated barley, which arose around 10,000 years ago. In this study, the specific resistance of a set of 146 wild barley accessions, maintained by the International Center for Agriculture Research in the Dry Areas (ICARDA), to 32 isolates of barley powdery mildew caused by Blumeria graminis f. sp. hordei was evaluated. The set comprised 146 heterogeneous accessions of a previously tested collection. Seed was obtained by single seed descent and each accession was usually represented by five single plant progenies. In total, 687 plant progenies were tested. There were 211 phenotypes of resistance among the accessions, 87 of which were found in single plants, while 202 plants contained the eight most common phenotypes. The most frequent phenotype was found in 56 plants that were susceptible to all pathogen isolates, whereas the second most frequent phenotype, which occurred in 46 plants, was resistant to all isolates. The broad resistance diversity that was revealed is of practical importance and is an aid to determining the extent and role of resistance in natural ecosystems.

  4. Giemsa C-banding in two polyploid, South American Hordeum species, H. tetraploidum and H. lechleri, and their aneuploid hybrids with H. vulgare

    DEFF Research Database (Denmark)

    Linde-Laursen, Ib; Bothmer, R. von

    1986-01-01

    American taxa of the same sections suggest a rather close relationship and support that the biological basis for their classification with different sections is questionable. C-banding patterns identified the chromosomes of parental genomes in interspecific hybrids between the two species and H. vulgare....... The hybrids were stably aneuploid. Both had lost and acquired H. vulgare chromosomes. Thus, somatic elimination of chromosomes was combined with multiplication of chromosomes. The observations of stably aneuploid hybrids have implications for the exploitation of alien germplasm. The activity of non-H. vulgare...

  5. Bioacumulación de arsénico en las etapas de desarrollo de la cebada maltera (Hordeum distichon L. Arsenic bioaccumulation in the stages of development of malt barley (Hordeum distichon L.

    Directory of Open Access Journals (Sweden)

    Francisco Prieto García

    cultivo para estimar niveles de contaminación por arsénico.The contamination by arsenic in water and ground of Zimapán, Hidalgo, Mexico, causes that malt barley (Hordeum distichon L. grown in this region, accumulates this element. The objective was to measure the levels of arsenic accumulated in organs and tissues of barley under controlled conditions, at different stages of development. Malt barley cv. Esmeralda was grown in 25 pots, five pots per differentiated trial. Trials include negative (not contaminated ground and water and positive controls. Five plants by pot were used and the accumulation of arsenic in each one was evaluated in five organs: root, stem, leaf, glean and grain, at each of five stages of development (coleoptiles formation or first leaf, macollo or true leaves from an armpit first knot that becomes present separated from the ground and forms the first spike, formation of spikes and seed filling. A random block design with three treatments was used: with arsenic, positive control and negative control. Malt barley presented high accumulation of arsenic at different stages of development, directly proportional to the time of exposition. Roots presented the highest accumulation of arsenic (100 and 300 mg kg-1, followed by leaves (80 to 180 mg kg-1 and stem (70 to 110 mg kg-1. The level of accumulation of arsenic in grains was between 40-90 mg kg-1, amount that according to Argentinean norms can be considered as highly contaminated. For the bioaccumulation index (BI, the leaves presented the high values, classified as medium values (0.1-1 for green plants. This organ can be indicative of contamination level in the ground. The largest values for the BI were observed in the stem, this organ can be a malt barley specific indicator of the level of arsenic contamination.

  6. Lysine metabolism in antisense C-hordein barley grains

    DEFF Research Database (Denmark)

    Schmidt, Daiana; Rizzi, Vanessa; Gaziola, Salete A

    2015-01-01

    ) and five antisense C-hordein transgenic barley lines. Considering the amounts of soluble and protein-bound aspartate-derived amino acids together with the analysis of key enzymes of aspartate metabolic pathway, we suggest that the C-hordein suppression did not only alter the metabolism of at least one......The grain proteins of barley are deficient in lysine and threonine due to their low concentrations in the major storage protein class, the hordeins, especially in the C-hordein subgroup. Previously produced antisense C-hordein transgenic barley lines have an improved amino acid composition......, with increased lysine, methionine and threonine contents. The objective of the study was to investigate the possible changes in the regulation of key enzymes of the aspartate metabolic pathway and the contents of aspartate-derived amino acids in the nontransgenic line (Hordeum vulgare L. cv. Golden Promise...

  7. Genetic structure and linkage disequilibrium in landrace populations of barley in Sardinia.

    Science.gov (United States)

    Rodriguez, Monica; Rau, Domenico; O'Sullivan, Donal; Brown, Anthony H D; Papa, Roberto; Attene, Giovanna

    2012-06-01

    Multilocus digenic linkage disequilibria (LD) and their population structure were investigated in eleven landrace populations of barley (Hordeum vulgare ssp. vulgare L.) in Sardinia, using 134 dominant simple-sequence amplified polymorphism markers. The analysis of molecular variance for these markers indicated that the populations were partially differentiated (F(ST) = 0.18), and clustered into three geographic areas. Consistent with this population pattern, STRUCTURE analysis allocated individuals from a bulk of all populations into four genetic groups, and these groups also showed geographic patterns. In agreement with other molecular studies in barley, the general level of LD was low (13% of locus pairs, with P landrace populations, but that epistatic homogenising or diversifying selection was also present. Notably, the variance of the disequilibrium component was relatively high, which implies caution in the pooling of barley lines for association studies. Finally, we compared the analyses of multilocus structure in barley landrace populations with parallel analyses in both composite crosses of barley on the one hand and in natural populations of wild barley on the other. Neither of these serves as suitable mimics of landraces in barley, which require their own study. Overall, the results suggest that these populations can be exploited for LD mapping if population structure is controlled.

  8. Barley grain for ruminants: A global treasure or tragedy

    Directory of Open Access Journals (Sweden)

    Nikkhah Akbar

    2012-07-01

    Full Text Available Abstract Barley grain (Hordeum vulgare L. is characterized by a thick fibrous coat, a high level of ß-glucans and simply-arranged starch granules. World production of barley is about 30 % of that of corn. In comparison with corn, barley has more protein, methionine, lysine, cysteine and tryptophan. For ruminants, barley is the third most readily degradable cereal behind oats and wheat. Due to its more rapid starch fermentation rate compared with corn, barley also provides a more synchronous release of energy and nitrogen, thereby improving microbial nutrient assimilation. As a result, feeding barley can reduce the need for feeding protected protein sources. However, this benefit is only realized if rumen acidity is maintained within an optimal range (e.g., > 5.8 to 6.0; below this range, microbial maintenance requirements and wastage increase. With a low pH, microbial endotoxines cause pro-inflammatory responses that can weaken immunity and shorten animal longevity. Thus, mismanagement in barley processing and feeding may make a tragedy from this treasure or pearl of cereal grains. Steam-rolling of barley may improve feed efficiency and post-rumen starch digestion. However, it is doubtful if such processing can improve milk production and feed intake. Due to the need to process barley less extensively than other cereals (as long as the pericarp is broken, consistent and global standards for feeding and processing barley could be feasibly established. In high-starch diets, barley feeding reduces the need for capacious small intestinal starch assimilation, subsequently reducing hindgut starch use and fecal nutrient loss. With its nutritional exclusivities underlined, barley use will be a factual art that can either matchlessly profit or harm rumen microbes, cattle production, farm economics and the environment.

  9. Biochemical and Molecular Characterization of a Barley Seed ß-Glucosidase

    DEFF Research Database (Denmark)

    Leah, R.; Kigel, J.; Svendsen, I.

    1995-01-01

    A 60-kDa ß-glucosidase (BGQ60) was purified and characterized from seeds of barley (Hordeum vulgare L.). BGQ60 catalytic activity was restricted to the cleavage of short-chain oligosaccharides composed of(1, 2) -,(1, 2, 3) -, and/or(1, 2, 3, 4) -ß-linked glucose or mannose units. These oligosacch......A 60-kDa ß-glucosidase (BGQ60) was purified and characterized from seeds of barley (Hordeum vulgare L.). BGQ60 catalytic activity was restricted to the cleavage of short-chain oligosaccharides composed of(1, 2) -,(1, 2, 3) -, and/or(1, 2, 3, 4) -ß-linked glucose or mannose units....... These oligosaccharides are the primary products of endosperm cell wall polysaccharide hydrolysis by other enzymes. In keeping with this, complete hydrolysis of the major polysaccharide of barley starchy endosperm cell wall, (1-3,1-4)-ß-glucan, to free glucose was shown to require the concerted action of endo-(1-3,1-4)-ß...... interrupted by 9 introns. The complete nucleotide sequence of the bgq60 structural gene represents the first characterized plant gene encoding a ß-glucosidase. The barley BGQ60 is a novel plant ß-glucosidase with a hitherto undescribed specific enzymatic activity. The possible biological functions of BGQ60...

  10. Genetic diversity among wild and cultivated barley as revealed by RFLP

    DEFF Research Database (Denmark)

    Petersen, L.; Østergård, H.; Giese, H.

    1994-01-01

    Genetic variability of cultivated and wild barley, Hordeum vulgare ssp. vulgare and spontaneum, respectively, was assessed by RFLP analysis. The material consisted of 13 European varietes, single-plant offspring lines of eight land races from Ethiopia and Nepal, and five accessions of ssp....... spontaneum from Israel, Iran and Turkey. Seventeen out of twenty-one studied cDNA and gDNA probes distributed across all seven barley chromosomes revealed polymorphism when DNA was digested with one of four restriction enzymes. A tree based on genetic distances using frequencies of RFLP banding patterns...... an intermediate level. The proportion of gene diversity residing among,geographical groups (F-ST) varied from 0.19 to 0.94 (average 0.54) per RFLP pattern, indicating large diversification between geographical groups....

  11. Evolutionary changes in defensive specialized metabolism in the genus Hordeum.

    Science.gov (United States)

    Ube, Naoki; Nishizaka, Miho; Ichiyanagi, Tsuyoshi; Ueno, Kotomi; Taketa, Shin; Ishihara, Atsushi

    2017-09-01

    Plants have developed defensive specialized metabolites over the course of evolution. In the genus Hordeum, which includes the important cereal crop barley, specialized metabolites such as hordatines, benzoxazinones, and gramine have been identified. Hordeum species are classified into four clades, H, Xu, Xa, and I. The presence or absence of defensive specialized metabolites was analyzed in representative Hordeum species that included all of the four clades. In the H clade, Hordeum vulgare accumulated hordatines but not benzoxazinones, whereas H. bulbosum accumulated neither compound. Some accessions in the H clade accumulated gramine. Species in the clades I and Xa accumulated benzoxazinones without hordatines. In H. murinum, a Xu clade species, neither hordatines nor benzoxazinones were detected. Two hitherto undescribed compounds were found to commonly accumulate in H. bulbosum in the H clade and H. murinum in the Xu clade. On the basis of spectroscopic analyses, they were identified as dehydrodimers of feruloylagmatine and were designated murinamides A and B. Radical coupling reactions with feruloylagmatine as a substrate by peroxidase afforded murinamides A and B. These compounds showed antifungal activities against Bipolaris sorokiniana and Fusarium asiaticum, indicating their defensive roles. Because hordatines are also dehydrodimers of hydroxycinnamic acid amides (HCAAs) of agmatine, both the H and Xu clade species are considered to accumulate the same class of compounds. Thus, when the H/Xu clades split from the I/Xa clades during evolution, the defensive metabolites shifted from benzoxazinones to dehydrodimers of agmatine HCAAs plus gramine in the H/Xu clades. Copyright © 2017 Elsevier Ltd. All rights reserved.

  12. Yield and yield structure of spring barley (Hodeum vulgare L. grown in monoculture after different stubble crops

    Directory of Open Access Journals (Sweden)

    Dorota Gawęda

    2012-12-01

    Full Text Available A field experiment was conducted in the period 2006- 2008 in the Uhrusk Experimental Farm belonging to the University of Life Sciences in Lublin. The experimental factor was the type of stubble crop ploughed in each year after harvest of spring barley: white mustard, lacy phacelia, winter rape, and a mixture of narrow-leaf lupin with field pea. In the experiment, successive spring barley crops were grown one after the other (in continuous monoculture. The aim of the experiment was to evaluate the effect of stubble crops used on the size and structure of barley yield. The three-year study showed an increasing trend in grain yield of spring barley grown after the mixture of legumes, lacy phacelia, and white mustard compared to its size in the treatment with no cover crop. Straw yield was significantly higher when barley was grown after the mixture of narrowleaf lupin with field pea than in the other treatments of the experiment. The type of ploughed-in stubble crop did not modify significantly plant height, ear length, and grain weight per ear. Growing the mixture of leguminous plants as a cover crop resulted in a significant increase in the density of ears per unit area in barley by an average of 14.7% relative to the treatment with winter rape. The experiment also showed the beneficial effect of the winter rape cover crop on 1000-grain weight of spring barley compared to that obtained in the treatments with white mustard and the mixture of legumes. All the cover crops caused an increase in the number of grains per ear of barley relative to that found in the control treatment. However, this increase was statistically proven only for the barley crops grown after lacy phacelia and the mixture of legumes.

  13. Archaeogenetic evidence of ancient nubian barley evolution from six to two-row indicates local adaptation.

    Directory of Open Access Journals (Sweden)

    Sarah A Palmer

    Full Text Available BACKGROUND: Archaeobotanical samples of barley (Hordeum vulgare L. found at Qasr Ibrim display a two-row phenotype that is unique to the region of archaeological sites upriver of the first cataract of the Nile, characterised by the development of distinctive lateral bracts. The phenotype occurs throughout all strata at Qasr Ibrim, which range in age from 3000 to a few hundred years. METHODOLOGY AND FINDINGS: We extracted ancient DNA from barley samples from the entire range of occupancy of the site, and studied the Vrs1 gene responsible for row number in extant barley. Surprisingly, we found a discord between the genotype and phenotype in all samples; all the barley had a genotype consistent with the six-row condition. These results indicate a six-row ancestry for the Qasr Ibrim barley, followed by a reassertion of the two-row condition. Modelling demonstrates that this sequence of evolutionary events requires a strong selection pressure. CONCLUSIONS: The two-row phenotype at Qasr Ibrim is caused by a different mechanism to that in extant barley. The strength of selection required for this mechanism to prevail indicates that the barley became locally adapted in the region in response to a local selection pressure. The consistency of the genotype/phenotype discord over time supports a scenario of adoption of this barley type by successive cultures, rather than the importation of new barley varieties associated with individual cultures.

  14. The interaction of 2,4-D application and mannitol pretreatment in anther and microspore culture of Hordeum vulgare L. cv. igri

    NARCIS (Netherlands)

    Hoekstra, S.; Bergen, S. van; Brouwershaven, I.R. van; Schilperoort, R.A.; Heidekamp, F.

    1996-01-01

    The influence of 2,4-dichlorophenoxyacetic acid (2,4-D) on embryo-like structures (ELS) and plant development from barley microspores was determined. Microspores cultured on filters enabled simple modification of growth regulator concentrations. Regeneration frequencies obtained with 2,4- D as

  15. Fungitoxicity of some higher plants and synergistic activity of their essential oils against Sclerotium rolfsii sacc. causing foot-rot disease of barley.

    Science.gov (United States)

    Singh, R K

    Twenty five plant species were screened for their volatile components against hyphal growth and sclerotia formation of Sclerotium rolfsii causing foot rot disease of barley (Hordeum vulgare). Leaves of Chenopodium ambrosioides (CA), Lippia alba (LA), Azadirachta indica (AI) and Eucalyptus globulus (EG) were found to be strongly toxic. Their volatile active factors were isolated in the form of essential oils which were tested for toxicity individually and in six combinations (1:1 v/v) viz. CA-LA, LA-AI, CA-AI, CA-EG, and EG-AI. The oil combinations were found to be more fungitoxic than the individual oils. The CA-LA, LA-AI, EG-AI, and CA-EG combinations exhibited a broad fnngitoxic spectrum while CA-AI, LA-EG combinations possessed a narrow range of toxicity. None of the six oil combinations showed phytotoxic behaviour on seed germination, seedling growth and general morphology of Hordeum vulgare.

  16. Constructing the barley model for genetic transformation in Triticeae

    Institute of Scientific and Technical Information of China (English)

    LÜ Bo; WU Jia-jie; FU Dao-lin

    2015-01-01

    Barley (Hordeum vulgare L.) is one of the oldest domesticated crops, showing dramatic adaptation to various climate and environmental conditions. As a major cereal crop, barley ranks the 4th after wheat, maize and rice in terms of planting area and production al over the world. Due to its diploid nature, the cultivated barley is considered as an ideal model to study the polyploid wheat and other Triticeae species. Here, we reviewed the development, optimization, and application of transgenic approaches in barley. The most efifcient and robust genetic transformation has been built on the Agrobacterium-mediated transfer in conjunction with the immature embryo-based regeneration. We then discussed future considerations of using more practical technologies in barley transformation, such as the T-DNA/transposon tagging and the genome editing. As a cereal crop amenable to genetic transformation, barley wil serve as the most valuable carrier for global functional genomics in Triticeae and is becoming the most practical model for generating value-added products.

  17. The Role of alpha-Glucosidase in Germinating Barley Grains

    DEFF Research Database (Denmark)

    Stanley, Duncan; Rejzek, Martin; Næsted, Henrik

    2011-01-01

    The importance of alpha-glucosidase in the endosperm starch metabolism of barley (Hordeum vulgare) seedlings is poorly understood. The enzyme converts maltose to glucose (Glc), but in vitro studies indicate that it can also attack starch granules. To discover its role in vivo, we took complementary...... chemical-genetic and reverse-genetic approaches. We identified iminosugar inhibitors of a recombinant form of an alpha-glucosidase previously discovered in barley endosperm (ALPHA-GLUCOSIDASE97 [HvAGL97]), and applied four of them to germinating grains. All four decreased the Glc-to-maltose ratio...... in the endosperm 10 d after imbibition, implying inhibition of maltase activity. Three of the four inhibitors also reduced starch degradation and seedling growth, but the fourth did not affect these parameters. Inhibition of starch degradation was apparently not due to inhibition of amylases. Inhibition...

  18. Environmental and transgene expression effects on the barley seed proteome

    DEFF Research Database (Denmark)

    Finnie, Christine; Steenholdt, T.; Noguera, O.R.;

    2004-01-01

    The barley (Hordeum vulgare) cultivar Golden Promise is no longer widely used for malting, but is amenable to transformation and is therefore a valuable experimental cultivar. Its characteristics include high salt tolerance, however it is also susceptible to several fungal pathogens. Proteome....... Eleven of these were identified by mass spectrometric peptide mass mapping, including an abundant chitinase implicated in defence against fungal pathogens and a small heat-shock protein. To enable a comparison with transgenic seed protein patterns, differences in spot patterns between field...... with extra nitrogen. Finally, the fate of transgene products in barley seeds was followed. Spots containing two green fluorescent protein constructs and the herbicide resistance marker phosphinothricin acetyltransferase were observed in 2D-gel patterns of transgenic seeds and identified by mass spectrometry...

  19. Quantifying relationships between rooting traits and water uptake under drought in Mediterranean barley and durum wheat

    Institute of Scientific and Technical Information of China (English)

    Pedro Carvalho; Sayed AzamAli; M. John Foulkes

    2014-01-01

    In Mediterranean regions drought is the major factor limiting spring barley and durum wheat grain yields. This study aimed to compare spring barley and durum wheat root and shoot responses to drought and quantify relationships between root traits and water uptake under terminal drought. One spring barley (Hordeum vulgare L. cv. Rum) and two durum wheat Mediterranean cultivars (Triticum turgidum L. var durum cvs Hourani and Karim) were examined in soil-column experi-ments under wel watered and drought conditions. Root system architecture traits, water uptake, and plant growth were measured. Barley aerial biomass and grain yields were higher than for durum wheat cultivars in wel watered conditions. Drought decreased grain yield more for barley (47%) than durum wheat (30%, Hourani). Root-to-shoot dry matter ratio increased for durum wheat under drought but not for barley, and root weight increased for wheat in response to drought but decreased for barley. The critical root length density (RLD) and root volume density (RVD) for 90%available water capture for wheat were similar to (cv. Hourani) or lower than (cv. Karim) for barley depending on wheat cultivar. For both species, RVD accounted for a slightly higher proportion of phenotypic variation in water uptake under drought than RLD.

  20. Transcriptional Activity of rRNA Genes in Barley Cells after Mutagenic Treatment.

    Directory of Open Access Journals (Sweden)

    Jolanta Kwasniewska

    Full Text Available In the present study, the combination of the micronucleus test with analysis of the activity of the rRNA genes in mutagen-treated Hordeum vulgare (barley by maleic hydrazide (MH cells was performed. Simultaneously fluorescence in situ hybridization (FISH with 25S rDNA as probes and an analysis of the transcriptional activity of 35S rRNA genes with silver staining were performed. The results showed that transcriptional activity is always maintained in the micronuclei although they are eliminated during the next cell cycle. The analysis of the transcriptional activity was extended to barley nuclei. MH influenced the fusion of the nucleoli in barley nuclei. The silver staining enabled detection of the nuclear bodies which arose after MH treatment. The results confirmed the usefulness of cytogenetic techniques in the characterization of micronuclei. Similar analyses can be now extended to other abiotic stresses to study the response of plant cells to the environment.

  1. Metabolite Profiling for Leaf Senescence in Barley Reveals Decreases in Amino Acids and Glycolysis Intermediates

    Directory of Open Access Journals (Sweden)

    Liliana Avila-Ospina

    2017-02-01

    Full Text Available Leaf senescence is a long developmental phase important for plant performance and nutrient management. Cell constituents are recycled in old leaves to provide nutrients that are redistributed to the sink organs. Up to now, metabolomic changes during leaf senescence have been mainly studied in Arabidopsis (Arabidopsis thaliana L.. The metabolite profiling conducted in barley (Hordeum vulgare L. during primary leaf senescence under two nitrate regimes and in flag leaf shows that amino acids, hexose, sucrose and glycolysis intermediates decrease during senescence, while minor carbohydrates accumulate. Tricarboxylic acid (TCA compounds changed with senescence only in primary leaves. The senescence-related metabolite changes in the flag leaf were globally similar to those observed in primary leaves. The effect of senescence on the metabolite changes of barley leaves was similar to that previously described in Arabidopsis except for sugars and glycolysis compounds. This suggests a different role of sugars in the control of leaf senescence in Arabidopsis and in barley.

  2. Rhizodeposition of N by pea and barley and its effect on soil N dynamics

    DEFF Research Database (Denmark)

    Jensen, E.S.

    1996-01-01

    Rhizodeposition of N during plant growth influences the microbial activity in the rhizosphere and constitutes a source of labile organic N, but has not been quantified to the same degree as the rhizodeposition of C. The rhizodeposition of N, defined as root-derived N present in the soil after...... removal of visible roots and root fragments, was determined during field pea (Pisum sativum L.) and spring barley (Hordeum vulgare L.) growth in a sandy soil at a low concentration of mineral N using a continuous split-root N-15-labelling technique. The N rhizodeposition constituted 15 and 48...... plant(-1) (20% of total plant N) for barley. Incubation of soils, after removal of roots, showed that the N rhizodeposits were labile; 79% of the pea and 48% of the barley root-derived N present in soil at 7 WAP were mineralizable. The root-derived N present in soil at maturity was less labile, since...

  3. Maize, Sunflower and Barley Sensitivity to the Residual Activity of Clomazone in Soil

    Directory of Open Access Journals (Sweden)

    Jelena Gajić Umiljendić

    2012-01-01

    Full Text Available Sensitivity of maize, sunflower and barley to clomazone residues in loamy soil wasassessed in the study using bioassay. Clomazone was applied at a series of concentrationsfrom 0.12 to 12 mg a.i./kg of soil. After 14 days, morphological (shoot height, fresh and dryweight and physiological (content of carotenoids, chlorophyll a and chlorophyll b parameterswere measured. The results showed that morphological parameters are not valid indicatorsof clomazone sensitivity. Based on the results showing inhibition of the physiologicalparameters, I50 values were calculated and used to estimate the difference in sensitivitybetween the species tested. Sunflower was the most sensitive species, while the differencein sensitivity between maize and barley was not significant.Nomenclature: clomazone (2-(2-chlorbenzyl-4,4-dimethyl-1,2-oxazolidin-3-one, maize(Zea mays L., sunflower (Helianthus annuus L., barley (Hordeum vulgare L.

  4. The comparison of nitrogen use and leaching in sole cropped versus intercropped pea and barley

    DEFF Research Database (Denmark)

    Hauggaard-Nielsen, H.; Ambus, P.; Jensen, E.S.

    2003-01-01

    The effect of sole and intercropping of field pea (Pisum sativum L.) and spring barley (Hordeum vulgare L.) and of crop residue management on crop yield, NO3- leaching and N balance in the cropping system was tested in a 2-year lysimeter experiment on a temperate sandy loam soil. The crop rotation...... was pea and barley sole and intercrops followed by winter-rye and a fallow period. The Land Equivalent Ratio (LER), which is defined as the relative land area under sole crops that is required to produce the yields achieved in intercropping, was used to compare intercropping performance relative to sole...... from the sole cropped pea and barley lysimeters. Soil N balances indicated depletion of N in the soil-plant system during the experimental period, independent of cropping system and residue management. N complementarity in the cropping system and the synchrony between residual N availability and crop N...

  5. Compared cycling in a soil-plant system of pea and barley residue nitrogen

    DEFF Research Database (Denmark)

    Jensen, E.S.

    1996-01-01

    and 35% of the pea residue N were unaccounted for. Since these apparent losses are comparable to almost twice the amounts of pea and barley residue N taken up by the perennial ryegrass crop, there seems to be a potential for improved crop residue management in order to conserve nutrients in the soil......Field experiments were carried out on a temperate soil to determine the decline rate, the stabilization in soil organic matter and the plant uptake of N from N-15-labelled crop residues. The fate of N from field pea (Pisum sativum L.) and spring barley (Hordeum vulgare L.) residues was followed...... in the top 10 cm soil declined rapidly during the initial 86 DAI for all residue types. Leaching of soluble organic materials may have contributed to this decline. At 216 DAI 72, 59 and 45% of the barley, mature pea and green pea residue N, respectively, were present in organic N-forms in the topsoil. During...

  6. Density and relative frequency effects on competitive interactions and resource use in pea–barley intercrops

    DEFF Research Database (Denmark)

    Hauggaard-Nielsen, H.; Andersen, H.K.; Jørnsgaard, B.;

    2006-01-01

    Intercropping advantages may be influenced by both plant density and relative frequency of the intercrop components. In a field study barley (Hordeum vulgare L.) and pea (Pisum sativum L.) were sole cropped and intercropped at three densities and with two relative frequencies when intercropped....... Earlier seedling emergence gave barley an initial growth advantage, assessed using the relative efficiency index (REIc), whereas pea was in general more growth efficient once the initial growth phase had been passed. This reversal in relative growth efficiency along with the observation that early barley...... of the growing period and more so in the pea dominated intercrop. At the final harvest land equivalent ratios (LER) of 0.9-1.2 express resource complementarity in almost all studied intercrops, complementarity that was not directly affected by changes in plant density or relative frequency. Intercropped pea did...

  7. Barley Seed Germination/Root Elongation Toxicity Test For Evaluation Of Sludge Pre-Treatment

    DEFF Research Database (Denmark)

    Eriksson, Eva; Kusk, Kresten Ole; Barrett Sørensen, Mie

    Application of sludge from wastewater treatment plants (WWTPs) on agricultural land is an approach for nutrient recycling that rise challenges due to recalcitrant and harmful pollutants. In this study we assessed the feasibility of a seed germination test to evaluate sludge ecotoxicity and compared...... germination responses from two test parameters, root elongation and seed germination (sprouts elongation) of the barley (Hordeum vulgare). 2nd objective was to evaluate sewage sludge pre-treatments at batch-scale of sludge samples from two WWTPs using anaerobic digestion, and thermal and ozonation pre...

  8. Competition for and utilisation of sulfur in sole and intercrops of pea and barley

    DEFF Research Database (Denmark)

    Andersen, Mette Klindt; Hauggaard-Nielsen, Henrik; Jensen, Henning Høgh;

    2007-01-01

    .) and barley (Hordeum vulgare L.) were grown in a pot experiment as sole crops and intercrops with or without the addition of S in the form of gypsum. At three consecutive harvests total aboveground biomass and corresponding soil samples were taken for analysis. Harvested biomass was analysed for total S and N...... the pea component came to dominate the intercrop both with respect to yield and nutrient accumulation, accounting for 77% of total dry matter production, 90% of N uptake and 85% of S uptake, averaged across S treatments. LER values calculated on the basis of total aboveground dry matter, and N and S...

  9. Phosphoinositides in barley aleurone layers and gibberellic acid-induced changes in metabolism

    Energy Technology Data Exchange (ETDEWEB)

    Murthy, P.P.N.; Renders, J.M.; Keranen, L.M. (Michigan Technological Univ., Houghton (USA))

    1989-12-01

    Phospholipids of barley (Hordeum vulgare L. cv Himalaya) aleurone layers were labeled with myo-(2-{sup 3}H)inositol or ({sup 32}Pi), extracted, and analyzed by physical (chromatography) and chemical (deacylation) techniques. Three phospholipids were found to incorporate both myo-(2-{sup 3}H)inositol and ({sup 32}Pi)-phosphatidylinositol, phosphatidylinositol-monophosphate, and phosphatidylinositol-bisphosphate. Stimulation of ({sup 3}H)inositol prelabeled aleurone layers with GA{sub 3} showed enhanced incorporation of label into phosphatidylinositol within 30 seconds and subsequent rapid breakdown. Stimulation of phosphatidylinositol labeling observed in these studies is the earliest response of aleurone cells to gibberellic acid reported.

  10. Genetic diversity and ecological niche modelling of wild barley: refugia, large-scale post-LGM range expansion and limited mid-future climate threats?

    Directory of Open Access Journals (Sweden)

    Joanne Russell

    Full Text Available Describing genetic diversity in wild barley (Hordeum vulgare ssp. spontaneum in geographic and environmental space in the context of current, past and potential future climates is important for conservation and for breeding the domesticated crop (Hordeum vulgare ssp. vulgare. Spatial genetic diversity in wild barley was revealed by both nuclear- (2,505 SNP, 24 nSSR and chloroplast-derived (5 cpSSR markers in 256 widely-sampled geo-referenced accessions. Results were compared with MaxEnt-modelled geographic distributions under current, past (Last Glacial Maximum, LGM and mid-term future (anthropogenic scenario A2, the 2080s climates. Comparisons suggest large-scale post-LGM range expansion in Central Asia and relatively small, but statistically significant, reductions in range-wide genetic diversity under future climate. Our analyses support the utility of ecological niche modelling for locating genetic diversity hotspots and determine priority geographic areas for wild barley conservation under anthropogenic climate change. Similar research on other cereal crop progenitors could play an important role in tailoring conservation and crop improvement strategies to support future human food security.

  11. The role of root hairs in cadmium acquisition by barley

    Energy Technology Data Exchange (ETDEWEB)

    Zheng Ruilun; Li Huafen [Key Laboratory of Plant-Soil Interactions of the Ministry of Education, College of Resources and Environmental Sciences, China Agricultural University, Beijing 100094 (China); Jiang Rongfeng, E-mail: rfjiang@cau.edu.c [Key Laboratory of Plant-Soil Interactions of the Ministry of Education, College of Resources and Environmental Sciences, China Agricultural University, Beijing 100094 (China); Roemheld, Volker [Institute of Plant Nutrition, University of Hohenheim, D-70593 Stuttgart (Germany); Zhang Fusuo [Key Laboratory of Plant-Soil Interactions of the Ministry of Education, College of Resources and Environmental Sciences, China Agricultural University, Beijing 100094 (China); Zhao Fangjie [Soil Science Department, Rothamsted Research, Harpenden, Hertfordshire AL5 2JQ (United Kingdom)

    2011-02-15

    The role of root hairs in Cd acquisition from soil was investigated in three pot experiments using a root hairless mutant (bald root barley, brb) and its wild-type (WT) cultivar of barley (Hordeum vulgare). brb had significantly lower concentrations and lower total amounts of Cd in shoots than WT. The Cd uptake efficiency based on total root length was 8-45% lower in brb than in WT. The difference between brb and WT increased with increasing extractable Cd in soil under the experimental conditions used. Additions of phosphate to soil decreased Cd extractability. Both soil and foliar additions of phosphate decreased root length, and root hair formation in WT. These effects resulted in decreased Cd uptake with increasing P supply. Cd uptake in WT correlated significantly with root length, root hair length and density, and soil extractable Cd. Root hairs contribute significantly to Cd uptake by barley. - Research highlights: The Cd uptake efficiency was significantly lower in brb than in WT. Additions of phosphate to soil decreased Cd extractability and Cd uptake. Both soil and foliar additions of phosphate decreased root length, and root hair formation in WT. Root hairs contribute significantly to Cd uptake by barley. - The Cd uptake efficiency based on total root length was 8-45% lower in a barley root hairless mutant than in its wild-type, indicating an important role of root hairs in Cd acquisition.

  12. The competitive ability of pea–barley intercrops against weeds and the interactions with crop productivity and soil N availability

    DEFF Research Database (Denmark)

    Corre-Hellou, G.; Dibet, A.; Hauggaard-Nielsen, Henrik

    2011-01-01

    Grain legumes, such as peas (Pisum sativum L.), are known to be weak competitors against weeds when grown as the sole crop. In this study, the weed-suppression effect of pea–barley (Hordeum vulgare L.) intercropping compared to the respective sole crops was examined in organic field experiments...... (2003–2005). The weed biomass was three times higher under the pea sole crops than under both the intercrops and barley sole crops at maturity. The inclusion of joint experiments in several countries and various growing conditions showed that intercrops maintain a highly asymmetric competition over...... weeds, regardless of the particular weed infestation (species and productivity), the crop biomass or the soil nitrogen availability. The intercropping weed suppression was highly resilient, whereas the weed suppression in pea sole crops was lower and more variable. The pea–barley intercrops exhibited...

  13. Insoluble Fiber in Young Barley Leaf Suppresses the Increment of Postprandial Blood Glucose Level by Increasing the Digesta Viscosity

    Directory of Open Access Journals (Sweden)

    Akira Takano

    2013-01-01

    Full Text Available Barley (Hordeum vulgare L. is a well-known cereal plant. Young barley leaf is consumed as a popular green-colored drink, which is named “Aojiru” in Japan. We examined the effects of barley leaf powder (BLP and insoluble fibers derived from BLP on postprandial blood glucose in rats and healthy Japanese volunteers. BLP and insoluble fibers derived from BLP suppressed the increment of postprandial blood glucose levels in rats (, and increased the viscosity of their digesta. The insoluble fibers present in BLP might play a role in controlling blood glucose level by increasing digesta viscosity. In human, BLP suppressed the increment of postprandial blood glucose level only in those which exhibited higher blood glucose levels after meals (. BLP might suppress the increment of postprandial blood glucose level by increasing digesta viscosity in both of rats and humans who require blood glucose monitoring.

  14. [Effect of rye Secale cereale L. chromosomes 1R and 3R on polyembryony expression in hybrid combinations between (Hordeum vulgare L.)-Triticum aestivum L. alloplasmic recombinant lines and wheat T. aestivum L.-rye S. cereale L. substitution lines].

    Science.gov (United States)

    Pershina, L A; Rakovtseva, T S; Belova, L I; Deviatkina, E P; Silkova, O G; Kravtsova, L A; Shchapova, A I

    2007-07-01

    The effect of rye chromosomes on polyembryony was studied for reciprocal hybrid combinations between (Hordeum vulgare L.)-Triticum aestivum L. alloplasmic recombinant lines and five wheat T. aestivum L. (cultivar Saratovskaya 29)-rye Secale cereale L. (cultivar Onokhoiskaya) substitution lines: IR(1D), 2R(2D), 3R(3B), 5R(5A), and 6R(6A), and for direct hybrid combinations between the [H. marinum ssp. gussoneanum (H. geniculatum All.)]-T. aestivum alloplasmic recombinant line and the wheat-rye substitution lines 1R (1A), 1R (1D), and 3R(3B). Chromosomes 1R and 3R of rye cultivar Onokhoiskaya proved to affect the expression of polyembryony in the hybrid combinations that involved the alloplasmic recombinant lines of common wheat as maternal genotypes. Based on this finding, polyembryony was regarded as a phenotypic expression of nuclear-cytoplasmic interactions where an important role is played by rye chromosomes 1R and 3R and the H. vulgare cytoplasm. Consideration is given to the association between the effect of rye chromosomes 1R and 3R on polyembryony in the [(Hordeum)-T. aestivum x wheat-rye substitution lines] hybrid combinations and their stimulating effect on the development on angrogenic embryoids in isolated anther cultures of the wheat-rye substitution lines.

  15. Effects of Pleurotus sapidus (Schulzer Sacc. treatment on nutrient composition and ruminal fermentability of barley straw, barley rootless, and a mixture of the two

    Directory of Open Access Journals (Sweden)

    Alfonso Soto-Sánchez

    2015-09-01

    Full Text Available Barley (Hordeum vulgare L., and its derivatives, ranks fourth in cereal production worldwide, and the Pleurotus species are among the most efficient types of lignocellulolytic white-rot fungi. The objective of this research study was to evaluate the degradation of barley straw and barley rootless with an inoculum of Pleurotus to improve their nutritional availability as a food source for ruminants. Two experiments were conducted; the first was to determine the effects of inoculation of Pleurotus sapidus (Schulzer Sacc. (PS in barley straw (BS, barley rootless (BR, and a 75% BS and 25% BR mixture (M. The second experiment was to evaluate the same substrates in vitro ruminal fermentation. Barley rootless had better organic matter (OM degradability than BS after 24 h incubation with PS. The protein content in BR was higher than in BS (P < 0.01. Enzyme activities had the highest concentration from the start of fermentation, and in vitro dry matter (DM degradability in BS and BR increased after 8 and 24 d fermentation, respectively (P < 0.05. Propionic acid concentration was enhanced after 16 d fermentation in BR (P < 0.5. The use of BS combined with BR exhibited better fermentation; this result provides relevant information for integrating BR with other substrates and improving the use of straw, which can be more nutritionally available for feeding ruminants.

  16. The NAC transcription factors of barley

    DEFF Research Database (Denmark)

    Wagner, Michael; Holm, Preben Bach; Gregersen, Per L.

    2011-01-01

    ). From these data we have identified not only putative regulators of leaf senescence (HvNAC005, HvNAC027 and HvNAC029), but also possible regulators of secondary wall synthesis (HvNAC033, HvNAC034 and HvNAC039), lateral root formation (HvNAC022) and seed development (HvNAC017, HvNAC018, HvNAC019 and Hv...... genes characterized so far have regulatory functions in a broad range of plant developmental processes and tolerances to both biotic and abiotic stresses. This makes the NAC family highly interesting target genes for plant researchers and breeders. As part of a larger project on the identification...... of Hordeum vulgare (barley) leaf senescence regulators, we have attempted to characterize for the first time all presently available barley NAC genes (HvNACs). By searching the NCBI barley EST database using the tBLASTn function, with all known NAC genes from Brachypodium and rice as input, in combination...

  17. Genetic differentiation and geographical Relationship of Asian barley landraces using SSRs

    Directory of Open Access Journals (Sweden)

    Rehan Naeem

    2011-01-01

    Full Text Available Genetic diversity in 403 morphologically distinct landraces of barley (Hordeum vulgare L. subsp. vulgare originating from seven geographical zones of Asia was studied using simple sequence repeat (SSR markers from regions of medium to high recombination in the barley genome. The seven polymorphic SSR markers representing each of the chromosomes chosen for the study revealed a high level of allelic diversity among the landraces. Genetic richness was highest in those from India, followed by Pakistan while it was lowest for Uzbekistan and Turkmenistan. Out of the 50 alleles detected, 15 were unique to a geographic region. Genetic diversity was highest for landraces from Pakistan (0.70 ± 0.06 and lowest for those from Uzbekistan (0.18 ± 0.17. Likewise, polymorphic information content (PIC was highest for Pakistan (0.67 ± 0.06 and lowest for Uzbekistan (0.15 ± 0.17. Diversity among groups was 40% compared to 60% within groups. Principal component analysis clustered the barley landraces into three groups to predict their domestication patterns. In total 51.58% of the variation was explained by the first two principal components of the barley germplasm. Pakistan landraces were clustered separately from those of India, Iran, Nepal and Iraq, whereas those from Turkmenistan and Uzbekistan were clustered together into a separate group.

  18. Physiological, Biochemical and Molecular Characterization of Barley (Hordeum vulgare L.) and Maize (Zea mays L.) for Improving Manganese Efficiency

    DEFF Research Database (Denmark)

    Long, Lizhi

    of a larger number of genes than did the two factors separately. Among the genes up-regulated by Mn deficiency were key genes related to Mnaffected physiological traits such as winter hardiness and disease resistance. GWAS based on chlorophyll a fluorescence measurements on the youngest fully developed leaves...

  19. Chromosome landing at the ¤Mla¤ locus in barleyHordeum vulgare¤ L.) by means of high-resolution mapping with AFLP markers

    DEFF Research Database (Denmark)

    Schwarz, G.; Michalek, W.; Mohler, V.

    1999-01-01

    to construct a high-resolution map of the Mla region. A fluorescence-based AFLP technique and bulked segregant analysis were applied to screen for polymorphic, tightly linked AFLP markers, Three AFLP markers were selected as suitable for a chromosome-landing strategy. One of these AFLP markers and a closely...

  20. Biosynthesis of the leucine derived α-, β- and γ-hydroxynitrile glucosides in barley (Hordeum vulgare L.)

    DEFF Research Database (Denmark)

    Knoch, Eva; Motawie, Mohammed Saddik; Olsen, Carl Erik;

    2016-01-01

    lines including landraces and old and modern cultivars, we demonstrated that the HNG level varies notably between lines whereas the overall ratio between the compounds is constant. Based on sequence similarity to the sorghum (Sorghum bicolor) genes involved in dhurrin biosynthesis, we identified a gene...

  1. A substantial fraction of barley (Hordeum vulgare L.) low phytic acid mutations have little or no effect on yield across diverse production environments

    Science.gov (United States)

    The potential benefits of the low phytic acid (lpa) seed trait for human and animal nutrition, and for phosphorus management in non-ruminant animal production, are well documented. However, in many cases the lpa trait is associated with impaired seed or plant performance, resulting in reduced yield....

  2. 大麦矮秆基因uz的SSR标记%SSR Marker Tagging of the Dwarfing Gene uz in Barley (Hordeum vulgare L.)

    Institute of Scientific and Technical Information of China (English)

    张京

    2003-01-01

    @@ 矮秆是大麦育种的重要目标性状之一.uz和denso分别是亚洲和欧洲大麦育种中利用最为广泛的2个矮秆基因,均位于3H染色体长臂之上.Barua等(1993)利用RAPD和RFLP技术,将denso基因确定在OPH7-H800和WG110所标记的染色体区段之间,距WG110约12.8 cM,可解释80%以上的株高遗传变异[1].系谱分析和等位测验表明,我国大麦育种中主要使用的尺八大麦、萧山立夏黄、沧州裸大麦、矮秆齐、浙皮1号和盐辐矮早3等6个矮源品种,前4个携带相同的矮秆基因uz[2].而且,uz基因作为易突变位点,在我国的原始农家大麦品种中普遍存在[3].本文采用SSR分析技术,对该基因进行分子标记.

  3. Comparison of the Phosphorus and Mineral Concentrations in Bran and Abraded Kernel Fractions of a Normal Barley (Hordeum vulgare) Cultivar versus Four Low Phytic Acid Isolines

    Science.gov (United States)

    Phytic acid consists of 65-80% of the total phosphorus (P) in cereal grains. Its salts are concentrated in the germ and aleurone layers, which are typically removed during milling. We hypothesize that concentrations of different types of P and minerals in milled products will be greatly altered in ...

  4. Unravelling the full complement of phytase encoding enzymes from wheat (Triticum aestivum L.) and barley (Hordeum vulgare L.)

    DEFF Research Database (Denmark)

    Brinch-Pedersen, Henrik; Dionisio, Giuseppe; Holm, Preben Bach

    2007-01-01

    Brinch-Pedersen, H., Dionisio, G. and Holm, PB (2007). . The PSE Congress, Plant for human health in the post-genome era. 26-29 august, 2007, Helsinki. P119.......Brinch-Pedersen, H., Dionisio, G. and Holm, PB (2007). . The PSE Congress, Plant for human health in the post-genome era. 26-29 august, 2007, Helsinki. P119....

  5. Genetic Study of the Manganese Use Efficiency Trait in Winter Barley (Hordeum vulgare L.) by Genome- Wide Association and Genomic Selection

    DEFF Research Database (Denmark)

    Leplat, Florian Jean Victor

    -wide association study (GWAS) and chlorophyll a fluorescence phenotyping allowed to identify several QTLs involved in the plant response to Mn deficiency. Multiple candidate coding genes were fund, among which, photosystem II PsbP subunit, germin-like proteins or Mn-Superoxide Dismutase. It supports the Mn...... functionality in Mn dependent pathways and processes. In a the second step, a genuine statistical method to assist breeding programs in selecting new varieties, named Genomic Selection (GS), was applied. It was demonstrated that GS is an effective tool to be used in breeding programs for selecting more...

  6. Mapping of the Hor-3 locus encoding D hordein in Barley.

    Science.gov (United States)

    Blake, T K; Ullrich, S E; Nilan, R A

    1982-12-01

    The hordein storage proteins of barley (Hordeum vulgare L.) are of intense interest due to their genetic diversity and prominence and impact on the industrial and agricultural uses of the seed. Two major hordein loci have been previously mapped on chromosome 5 (Hor-1 and Hor-2 encoding the C and B hordeins, respectively). A third major locus, Hor-3, which codes for D hordein, has been located in the centromeric region of chromosome 5, probably on the long arm. Two allelic variants with apparent molecular weights of 83,000 and 91,000 and similar isoelectric points of 8.0 comprise the products of this locus in the barley varieties 'Advance' and 'Triple Awned Lemma'. The D hordein examined is similar in molecular weight and isoelectric point to the high molecular weight (HMW) glutenin proteins encoded by the 1B chromosome of wheat (Triticum aestivum L.).

  7. Bipolaris sorokiniana (teleomorph Cochliobolus Sativus: Causer of barley leaf lesions and root rot in Macedonia

    Directory of Open Access Journals (Sweden)

    Karov Ilija K.

    2009-01-01

    Full Text Available Diseased barley plants (Hordeum vulgare, were noticed in the area of Kumanovo, Bitola, Probistip, Skopje and Kocani, at the beginning of March, 2006. Our investigations were carried out in the period from 2006 to 2009. The plants were highly diseased, probably in the stage of germination, dwarfed with necrotic leaves and with poorly developed root. A rotten root collar was noticed notice in some plants, which could be easily pulled out from the soil. Plants infected in a later developing stage became yellow from the top of the leaf, and many brown-olive, oval shape lesions were noticed. Conidia of Bipolaris sorokiniana (Sacc. Shoen., were isolated from symptomatic lesions. Pseudothecia with asci and ascospores from teleomorph Cochliobolus sativus, were found on the barley straw in the same field the previous year.

  8. Simulation of spring barley yield variability in different climatic zones of Northern and Central Europe

    DEFF Research Database (Denmark)

    Rötter, R P; Palosuo, T; Kersebaum, K C;

    2012-01-01

    Europe. The aims of this model comparison were to examine how different process-based crop models perform at multiple sites across Europe when applied with minimal information for model calibration of spring barley at field scale, whether individual models perform better than the multi-model mean...... as indicated by the mean bias error (MBE) (−1159 kg ha−1). While the wide range of simulated yields across all sites and years shows the high uncertainties in model estimates with only restricted calibration, mean predictions from the nine models agreed well with observations. Results of this paper also show......In this study, the performance of nine widely used and accessible crop growth simulation models (APES-ACE, CROPSYST, DAISY, DSSAT-CERES, FASSET, HERMES, MONICA, STICS and WOFOST) was compared during 44 growing seasons of spring barley (Hordeum vulgare L.) at seven sites in Northern and Central...

  9. Genetic and epigenetic effects of salinity on in vitro growth of barley

    Directory of Open Access Journals (Sweden)

    Aykut Demirkiran

    2013-01-01

    Full Text Available Morphological, physiological and molecular changes were investigated in in vitro salt-stressed barley (Hordeum vulgare L. cv. Tokak. Mature embryos were cultured in Murashige and Skoog medium containing 0 (control, 50 and 100 mM NaCl for 20 days. Both concentrations inhibited shoot growth, decreased fresh weight and protein content, and increased SOD (EC 1.15.1.1 activity in a dose-dependent manner. The lower concentration increased root growth. Salinity caused nucleotide variations in roots, but did not affect shoot DNAs. The higher concentration caused methylation changes, mainly hypermethylation in shoots. This is the first study on genetic and epigenetic effects of salinity in barley.

  10. Differences in the diurnal pattern of soil respiration under adjacent Miscanthus x giganteus and barley crops reveal potential flaws in accepted sampling strategies

    Science.gov (United States)

    Keane, James; Ineson, Phil

    2017-04-01

    Soil respiration (Rs) plays an important role in the global carbon cycle and contributes ca. 30% of global ecosystem respiration.However, for convenience, measurements used to compare Rs from different land uses, crops or management practices are often made between 09:00 and 16:00, with an implicit assumption that Rs is largely controlled by temperature. Three months' continuous data presented here show distinctly different diurnal patterns of Rs between barley (Hordeum vulgare) and Miscanthus x giganteus (Miscanthus) grown on adjacent fields. Maximum Rs in barley occurred during the afternoon and correlated with soil temperature, whereas Rs peaked in Miscanthus during the night and was significantly correlated with earlier levels of solar radiation, probably due to delays in translocation of recent photosynthate. Since daily mean Rs in Miscanthus coincided with levels 40% greater than the mean in barley, it is vital to select appropriate times to measure Rs if only single daily measurements are to be made.

  11. Plant small monomeric G-proteins (RAC/ROPs) of barley are common elements of susceptibility to fungal leaf pathogens, cell expansion and stomata development.

    Science.gov (United States)

    Pathuri, Indira Priyadarshini; Eichmann, Ruth; Hückelhoven, Ralph

    2009-02-01

    Small monomeric RAC/ROP GTPases act as molecular switches in signal transduction processes of plant development and stress responses. They emerged as crucial players in plant-pathogen interactions either by supporting susceptibility or resistance. In a recent publication, we showed that constitutively activated (CA) mutants of different barley (Hordeum vulgare) RAC/ROPs regulate susceptibility to barley fungal leaf pathogens of different life style in a contrasting way. This illustrates the distinctive signalling roles of RAC/ROPs for different plant-pathogen combinations. We also reported the involvement of RAC/ROPs in plant epidermis development in a monocotyledonous plant. Here we further discuss a failure of CA HvRAC/ROP-expressing barley to normally develop stomata.

  12. Involvement of Alternative Splicing in Barley Seed Germination.

    Science.gov (United States)

    Zhang, Qisen; Zhang, Xiaoqi; Wang, Songbo; Tan, Cong; Zhou, Gaofeng; Li, Chengdao

    2016-01-01

    Seed germination activates many new biological processes including DNA, membrane and mitochondrial repairs and requires active protein synthesis and sufficient energy supply. Alternative splicing (AS) regulates many cellular processes including cell differentiation and environmental adaptations. However, limited information is available on the regulation of seed germination at post-transcriptional levels. We have conducted RNA-sequencing experiments to dissect AS events in barley seed germination. We identified between 552 and 669 common AS transcripts in germinating barley embryos from four barley varieties (Hordeum vulgare L. Bass, Baudin, Harrington and Stirling). Alternative 3' splicing (34%-45%), intron retention (32%-34%) and alternative 5' splicing (16%-21%) were three major AS events in germinating embryos. The AS transcripts were predominantly mapped onto ribosome, RNA transport machineries, spliceosome, plant hormone signal transduction, glycolysis, sugar and carbon metabolism pathways. Transcripts of these genes were also very abundant in the early stage of seed germination. Correlation analysis of gene expression showed that AS hormone responsive transcripts could also be co-expressed with genes responsible for protein biosynthesis and sugar metabolisms. Our RNA-sequencing data revealed that AS could play important roles in barley seed germination.

  13. Plant-availability to barley of phosphorus in ash from thermally treated animal manure in comparison to other manure based materials and commercial fertilizer

    DEFF Research Database (Denmark)

    Kuligowski, Ksawery; Poulsen, Tjalfe Gorm; Rubæk, Gitte Holton

    2010-01-01

    P 488 mg kg-1 soil DM, pH 6.6). The first-year effect of P application was tested in a spring barley crop (Hordeum vulgare L.) and residual P effects were tested in a perennial ryegrass (Lolium perenne L.) crop the following year. Untreated ash from thermally gasified animal manure biogas residue...... (GA) and a corresponding neutralized acid extract of the ash (ExL) in liquid form were the products in focus. Other products in use were: pelletized pig manure biogas residue (PEL), incinerated PEL (IA), anaerobically digested pig slurry (DS), dried ExL, dried fraction of separated pig slurry (SS...

  14. The effect of adjuvants and reduced rates of crop protection agents on weed infestation, health and lodging of spring barley (Hordeum sativum L.

    Directory of Open Access Journals (Sweden)

    Cezary A. Kwiatkowski

    2012-12-01

    Full Text Available A field experiment in the cultivation of spring barley was carried out in the period 2007-2009 at the Experimental Farm in Czesławice (central Lublin region on grey-brown podzolic soil derived from loess (soil quality class II. The study involved 3 rates of herbicides, growth retardant and fungicides (100%, 75%, 50% as well as different adjuvant types (oil, surface- active, mineral adjuvant. Plots without any adjuvant were the control treatment. Conventional tillage was used, while mineral fertilization was adjusted to high initial soil nutrient availability. A hypothesis was made that the reduction of pesticide rates by 25-50%, with the simultaneous addition of adjuvants, would allow health, weed infestation and lodging of spring barley to be maintained at a level similar to that obtained under the conditions when maximum rates are applied without any adjuvant. It was also assumed that particular adjuvants could show different interactions with the tested groups of crop protection agents. It was proved that the application of full recommended rates of pesticides gave the best values of the indicators relating to weed infestation, health and lodging of spring barley. However, thanks to the addition of adjuvants to the spray solution, the application of pesticide doses reduced by 25% produced similar results. A higher reduction of pesticide rates (by 50% had an adverse effect on the traits in question. In such case, there was noted higher weed infestation of the spring barley crop, compensation of some weed species, and increased stem-base infection by the fungal disease complex. On the other hand, less radical changes were observed in the case of spring barley lodging. The above-mentioned situation occurred in spite of the fact that the action of pesticides was aided by adjuvants. From the group of adjuvants under comparison, the oil adjuvant Atpolan 80 EC showed the best interaction with the crop protection agents under consideration.

  15. The Role of alpha-Glucosidase in Germinating Barley Grains

    DEFF Research Database (Denmark)

    Stanley, Duncan; Rejzek, Martin; Næsted, Henrik;

    2011-01-01

    in the endosperm 10 d after imbibition, implying inhibition of maltase activity. Three of the four inhibitors also reduced starch degradation and seedling growth, but the fourth did not affect these parameters. Inhibition of starch degradation was apparently not due to inhibition of amylases. Inhibition......The importance of alpha-glucosidase in the endosperm starch metabolism of barley (Hordeum vulgare) seedlings is poorly understood. The enzyme converts maltose to glucose (Glc), but in vitro studies indicate that it can also attack starch granules. To discover its role in vivo, we took complementary...... silencing cassette for HvAgl97, alpha-glucosidase activity was reduced by up to 50%. There was a large decrease in the Glc-to-maltose ratio in these lines but no effect on starch degradation or seedling growth. Our results suggest that the alpha-glucosidase HvAGL97 is the major endosperm enzyme catalyzing...

  16. Enzymes associated with protein bodies isolated from ungerminated barley seeds.

    Science.gov (United States)

    Ory, R L; Henningsen, K W

    1969-11-01

    Protein bodies were isolated intact from dormant barley seeds, Hordeum vulgare, var. Kenia, by a combination of buffer extractions and centrifugations over a sucrose gradient. Examination of the protein bodies pellet in the electron microscope shows 2 types of protein bodies in a wide variation of sizes. The majority of them stain evenly with osmium, are contained within a single membrane, and have no other structural components. The other type, mostly the larger particles, has a fine structure of orderly dark and light-stained layers attached to the protein bodies. Two acid hydrolases are associated with these particles: acid phosphatase activity, specific for sodium phytate but inactive on beta-glycerol phosphate, glucose 1-phosphate, fructose 1,6-diphosphate and adenosine triphosphate; and acid protease activity.

  17. Single and combined toxicity of copper and cadmium to H. vulgare growth and heavy metal bioaccumulation

    Directory of Open Access Journals (Sweden)

    Žaltauskaitė J.

    2013-04-01

    Full Text Available The single and combined effects of copper (Cu and cadmium (Cd (0.1-10 mg L−1 in spring barley (Hordeum vulgare L. plants grown in hydroponics are investigated. The aim of the study was to investigate the interactive effect of the binary mixture of Cu and Cd to the growth of H. vulgare and accumulation of these metals by the plants. Single and combined metal treatment led to major effects in the growth of roots and shoots and dry weight of barley. Exposure to metals altered the content of photosynthetic pigments and caused lipid peroxidation. It was observed that combined effects of heavy metals to plants are endpoint and concentration depending. The binary mixture Cu+Cd exhibited additive or less than additive interaction for dry weight, root length and shoot height. Analysis of tissue metal concentrations showed that Cu and Cd were mainly accumulated in the roots and the combination of Cu+Cd had less than additive response of metal bioaccumulation in the leaves and roots.

  18. The use of the ph1b mutant to induce recombination between the chromosomes of wheat and barley

    Science.gov (United States)

    Rey, María-Dolores; Calderón, María C.; Prieto, Pilar

    2015-01-01

    Intensive breeding has led to a narrowing in the genetic base of our major crops. In wheat, access to the extensive gene pool residing in its many and varied relatives (some cultivated, others wild) is hampered by the block on recombination imposed by the Ph1 (Pairing homoeologous 1) gene. Here, the ph1b mutant has been exploited to induced allosyndesis between wheat chromosomes and those of both Hordeum vulgare (cultivated barley) and H. chilense (a wild barley). A number of single chromosome Hordeum sp. substitution and addition lines in wheat were crossed and backcrossed to the ph1b mutant to produce plants in which pairing between the wheat and the non-wheat chromosomes was not suppressed by the presence of Ph1. Genomic in situ hybridization was applied to almost 500 BC1F2 progeny as a screen for allosyndetic recombinants. Chromosome rearrangements were detected affecting H. chilense chromosomes 4Hch, 5Hch, 6Hch, and 7Hch and H. vulgare chromosomes 4Hv, 6Hv, and 7Hv. Two of these were clearly the product of a recombination event involving chromosome 4Hch and a wheat chromosome. PMID:25852713

  19. Constitutively activated barley ROPs modulate epidermal cell size, defense reactions and interactions with fungal leaf pathogens.

    Science.gov (United States)

    Pathuri, Indira Priyadarshini; Zellerhoff, Nina; Schaffrath, Ulrich; Hensel, Götz; Kumlehn, Jochen; Kogel, Karl-Heinz; Eichmann, Ruth; Hückelhoven, Ralph

    2008-12-01

    RHO-like monomeric G-proteins of plants (ROPs, also called RACs), are involved in plant development and interaction with the environment. The barley (Hordeum vulgare) ROP protein HvRACB has been shown to be required for entry of the biotrophic powdery mildew fungus Blumeria graminis f.sp. hordei (Bgh) into living host cells. To get a deeper insight into evolutionarily conserved functions of ROPs in cell polarity and pathogen responses, we stably expressed constitutively activated (CA) mutant variants of different barley ROPs (HvRACB, HvRAC1, HvRAC3) in barley. CA HvROPs induced epidermal cell expansion and/or abolished polarity in tip growing root hairs. All three CA HvROPs enhanced susceptibility of barley to penetration by Bgh whereas only CA HvRAC1 supported whole cell H(2)O(2) production in non-penetrated cells. Despite increasing penetration by Bgh, CA HvRAC1 promoted callose deposition at sites of fungal attack and resistance to penetration by Magnaporthe oryzae. The data show an involvement of ROPs in polar growth processes of the monocot barley and in responses to fungal pathogens with different life style.

  20. Induction of beta-1,3-glucanase in barley in response to infection by fungal pathogens.

    Science.gov (United States)

    Jutidamrongphan, W; Andersen, J B; Mackinnon, G; Manners, J M; Simpson, R S; Scott, K J

    1991-05-01

    The sequence of a partial cDNA clone corresponding to an mRNA induced in leaves of barley (Hordeum vulgare) by infection with fungal pathogens matched almost perfectly with that of a cDNA clone coding for beta-1,-3-glucanase isolated from the scutellum of barley. Western blot analysis of intercellular proteins from near-isogenic barley lines inoculated with the powdery mildew fungus (Erysiphe graminis f. sp. hordei) showed a strong induction of glucanase in all inoculated lines but was most pronounced in two resistant lines. These data were confirmed by beta-1,3-glucanase assays. The barley cDNA was used as a hybridization probe to detect mRNAs in barley, wheat (Triticum aestivum), rice (oryza sativus), and sorghum (Sorghum bicolor), which are induced by infection with the necrotrophic pathogen Bipolaris sorokiniana. These results demonstrate that activation of beta-1,3-glucanase genes may be a general response of cereals to infection by fungal pathogens.

  1. Mathematical Modelling of Allelopathy: IV. Assessment of Contributions of Competition and Allelopathy to Interference by Barley.

    Science.gov (United States)

    Liu, De Li; An, Min; Johnson, I R; Lovett, J V

    2005-04-01

    One of the main challenges to the research on allelopathy is technically the separation of allelopathic effect from competition, and quantitatively, the assessment of the contribution of each component to overall interference. A simple mathematical model is proposed to calculate the contribution of allelopathy and competition to interference. As an example of applying the quantitative model to interference by barley (Hordeum vulgare cv. Triumph), the approach used was an addition of allelopathic effect, by an equivalent amount, to the environment of the test plant (white mustard, Sinapis alba), rather than elimination of competition. Experiments were conducted in glasshouse to determine the magnitude of the contributions of allelopathy and competition to interference by barley. The leachates of living barley roots significantly reduced the total dry weight of white mustard. The model involved the calculation of adjusted densities to an equivalent basis for modelling the contribution of allelopathy and competition to total interference. The results showed that allelopathy contributed 40%, 37% and 43% to interference by barley at 6, 12 and 18 white mustard pot(-1). The consistency in magnitude of the calculated contribution of allelopathic effect by barley across various densities of receiver plant suggested that the adjusted equivalent density is effective and that the model is able to assess the contribution of each component of interference regardless of the density of receiver plant.

  2. Gene Targeting Without DSB Induction Is Inefficient in Barley.

    Science.gov (United States)

    Horvath, Mihaly; Steinbiss, Hans-Henning; Reiss, Bernd

    2016-01-01

    Double strand-break (DSB) induction allowed efficient gene targeting in barley (Hordeum vulgare), but little is known about efficiencies in its absence. To obtain such data, an assay system based on the acetolactate synthase (ALS) gene was established, a target gene which had been used previously in rice and Arabidopsis thaliana. Expression of recombinases RAD51 and RAD54 had been shown to improve gene targeting in A. thaliana and positive-negative (P-N) selection allows the routine production of targeted mutants without DSB induction in rice. We implemented these approaches in barley and analysed gene targeting with the ALS gene in wild type and RAD51 and RAD54 transgenic lines. In addition, P-N selection was tested. In contrast to the high gene targeting efficiencies obtained in the absence of DSB induction in A. thaliana or rice, not one single gene targeting event was obtained in barley. These data suggest that gene targeting efficiencies are very low in barley and can substantially differ between different plants, even at the same target locus. They also suggest that the amount of labour and time would become unreasonably high to use these methods as a tool in routine applications. This is particularly true since DSB induction offers efficient alternatives. Barley, unlike rice and A. thaliana has a large, complex genome, suggesting that genome size or complexity could be the reason for the low efficiencies. We discuss to what extent transformation methods, genome size or genome complexity could contribute to the striking differences in the gene targeting efficiencies between barley, rice and A. thaliana.

  3. The effect of water deficit on the activity of hydrogen peroxide-scavenging enzymes in two barley genotypes

    Directory of Open Access Journals (Sweden)

    Hanna Bandurska

    2014-01-01

    Full Text Available Two barley (Hordeum vulgare L. genotypes, the cv. Aramir and line R567, were subjected to water deficit by immersing their root systems in polyethylene glycol solution of osmotic potential -1.0 MPa. The stress caused a decline in the leaf-relative-water content (RWC and affected membrane damage in both the genotypes. A higher decline in RWC and a higher membrane injury index was observed in R567 in comparison to 'Aramir'. Water deficit induced an increase in the activity of guaiacol peroxidase (GPO and catalse (CAT. A higher increase of CAT than GPO peroxidase activity has been noted in both the genotypes. The results. together with our earlier reports (Bandurska et al. 1997 show that detoxification of hydrogen peroxide under water stress conditions in those two barley genotypes was associated with the action of GPO and CAT, and that the latter was more involved in that process.

  4. Water mobility in the endosperm of high beta-glucan barley mutants as studied by nuclear magnetic resonance imaging

    DEFF Research Database (Denmark)

    Seefeldt, Helene Fast; van den Berg, Frans; Klöckenberger, Walter

    2007-01-01

    1H NMR imaging (MRI) was used as a noninvasive technique to study water distribution and mobility in hydrated barley (Hordeum vulgare L.) seeds of accessions with varying content of beta glucan (BG), a highly hygroscopic cell wall component. High contents of BG in barley are unfavorable in malting...... were related to content and location of BG. Water mobility was investigated by following the rate and mode of desiccation in hydrated single seeds. In order to determine the different water components, a multispin echo experiment was set up to reveal the T2 transverse relaxation rates of water within...... desiccation. The embryo retained water even after 36 h of drying, whereas the endosperm showed low and heterogeneous mobility of the water after drying. The relaxation time constants indicated that the BG mutants had regions of much higher water mobility around the ventral crease compared to the control...

  5. Linkage mapping of putative regulator genes of barley grain development characterized by expression profiling

    Directory of Open Access Journals (Sweden)

    Wobus Ulrich

    2009-01-01

    Full Text Available Abstract Background Barley (Hordeum vulgare L. seed development is a highly regulated process with fine-tuned interaction of various tissues controlling distinct physiological events during prestorage, storage and dessication phase. As potential regulators involved within this process we studied 172 transcription factors and 204 kinases for their expression behaviour and anchored a subset of them to the barley linkage map to promote marker-assisted studies on barley grains. Results By a hierachical clustering of the expression profiles of 376 potential regulatory genes expressed in 37 different tissues, we found 50 regulators preferentially expressed in one of the three grain tissue fractions pericarp, endosperm and embryo during seed development. In addition, 27 regulators found to be expressed during both seed development and germination and 32 additional regulators are characteristically expressed in multiple tissues undergoing cell differentiation events during barley plant ontogeny. Another 96 regulators were, beside in the developing seed, ubiquitously expressed among all tissues of germinating seedlings as well as in reproductive tissues. SNP-marker development for those regulators resulted in anchoring 61 markers on the genetic linkage map of barley and the chromosomal assignment of another 12 loci by using wheat-barley addition lines. The SNP frequency ranged from 0.5 to 1.0 SNP/kb in the parents of the various mapping populations and was 2.3 SNP/kb over all eight lines tested. Exploration of macrosynteny to rice revealed that the chromosomal orders of the mapped putative regulatory factors were predominantly conserved during evolution. Conclusion We identified expression patterns of major transcription factors and signaling related genes expressed during barley ontogeny and further assigned possible functions based on likely orthologs functionally well characterized in model plant species. The combined linkage map and reference

  6. Unique and Conserved Features of the Barley Root Meristem

    Directory of Open Access Journals (Sweden)

    Gwendolyn K. Kirschner

    2017-07-01

    Full Text Available Plant root growth is enabled by root meristems that harbor the stem cell niches as a source of progenitors for the different root tissues. Understanding the root development of diverse plant species is important to be able to control root growth in order to gain better performances of crop plants. In this study, we analyzed the root meristem of the fourth most abundant crop plant, barley (Hordeum vulgare. Cell division studies revealed that the barley stem cell niche comprises a Quiescent Center (QC of around 30 cells with low mitotic activity. The surrounding stem cells contribute to root growth through the production of new cells that are displaced from the meristem, elongate and differentiate into specialized root tissues. The distal stem cells produce the root cap and lateral root cap cells, while cells lateral to the QC generate the epidermis, as it is typical for monocots. Endodermis and inner cortex are derived from one common initial lateral to the QC, while the outer cortex cell layers are derived from a distinct stem cell. In rice and Arabidopsis, meristem homeostasis is achieved through feedback signaling from differentiated cells involving peptides of the CLE family. Application of synthetic CLE40 orthologous peptide from barley promotes meristem cell differentiation, similar to rice and Arabidopsis. However, in contrast to Arabidopsis, the columella stem cells do not respond to the CLE40 peptide, indicating that distinct mechanisms control columella cell fate in monocot and dicot plants.

  7. Unique and Conserved Features of the Barley Root Meristem.

    Science.gov (United States)

    Kirschner, Gwendolyn K; Stahl, Yvonne; Von Korff, Maria; Simon, Rüdiger

    2017-01-01

    Plant root growth is enabled by root meristems that harbor the stem cell niches as a source of progenitors for the different root tissues. Understanding the root development of diverse plant species is important to be able to control root growth in order to gain better performances of crop plants. In this study, we analyzed the root meristem of the fourth most abundant crop plant, barley (Hordeum vulgare). Cell division studies revealed that the barley stem cell niche comprises a Quiescent Center (QC) of around 30 cells with low mitotic activity. The surrounding stem cells contribute to root growth through the production of new cells that are displaced from the meristem, elongate and differentiate into specialized root tissues. The distal stem cells produce the root cap and lateral root cap cells, while cells lateral to the QC generate the epidermis, as it is typical for monocots. Endodermis and inner cortex are derived from one common initial lateral to the QC, while the outer cortex cell layers are derived from a distinct stem cell. In rice and Arabidopsis, meristem homeostasis is achieved through feedback signaling from differentiated cells involving peptides of the CLE family. Application of synthetic CLE40 orthologous peptide from barley promotes meristem cell differentiation, similar to rice and Arabidopsis. However, in contrast to Arabidopsis, the columella stem cells do not respond to the CLE40 peptide, indicating that distinct mechanisms control columella cell fate in monocot and dicot plants.

  8. Competition and Facilitation in Hairy Vetch-Barley Intercrops

    Directory of Open Access Journals (Sweden)

    Giacomo Tosti

    2010-09-01

    Full Text Available Intercrops between legumes and non-legumes are widely used for fodder production and as cover crops, but little quantitative data are available on competition between species in the mixture. The objective of the present study was to assess the interaction between hairy vetch (Vicia villosa Roth. and barley (Hordeum vulgare L. grown as pure crops or intercrops with different proportions of seed rates at sowing. A 4-year field study was conducted using hairy vetch and barley as pure stands at full sowing density and as intercrops at different proportions of their own full seed rate according to the replacement principle. Interaction between species was evaluated on the basis of Land Equivalent Ratio (LER, Relative Neighbour Effect (RNE and Aggressivity (A calculated on biomass and nitrogen (N accumulation. The N accumulation of the mixed crops increased linearly with the legume proportion in the mixture. The mixtures were more efficient than the pure crops in terms of N use (LER > 1. Partial LER values indicated that the barley component benefited from the presence of the legume, while the hairy vetch partial LER decreased with increasing barley proportion in the mixture. The competitive response in terms of biomass accumulation was high for both species when their density in the mixture was high. Concerning N accumulation, barley benefited from an asymmetric interspecific facilitation while the vetch behaviour was similar to that observed for biomass accumulation. Barley dominance progressively increased reaching a maximum just before the last sampling date. At the last sampling date the competitive ability of hairy vetch showed a considerable increase in all mixtures (A ≈ 0. These findings indicate that the use of mixtures between hairy vetch and barley allows an increase in the use efficiency of N resource with respect to pure crops. Barley is the dominant component of the mixture and the hairy vetch is able to cope with the cereal

  9. Sequencing of 15 622 gene-bearing BACs clarifies the gene-dense regions of the barley genome.

    Science.gov (United States)

    Muñoz-Amatriaín, María; Lonardi, Stefano; Luo, MingCheng; Madishetty, Kavitha; Svensson, Jan T; Moscou, Matthew J; Wanamaker, Steve; Jiang, Tao; Kleinhofs, Andris; Muehlbauer, Gary J; Wise, Roger P; Stein, Nils; Ma, Yaqin; Rodriguez, Edmundo; Kudrna, Dave; Bhat, Prasanna R; Chao, Shiaoman; Condamine, Pascal; Heinen, Shane; Resnik, Josh; Wing, Rod; Witt, Heather N; Alpert, Matthew; Beccuti, Marco; Bozdag, Serdar; Cordero, Francesca; Mirebrahim, Hamid; Ounit, Rachid; Wu, Yonghui; You, Frank; Zheng, Jie; Simková, Hana; Dolezel, Jaroslav; Grimwood, Jane; Schmutz, Jeremy; Duma, Denisa; Altschmied, Lothar; Blake, Tom; Bregitzer, Phil; Cooper, Laurel; Dilbirligi, Muharrem; Falk, Anders; Feiz, Leila; Graner, Andreas; Gustafson, Perry; Hayes, Patrick M; Lemaux, Peggy; Mammadov, Jafar; Close, Timothy J

    2015-10-01

    Barley (Hordeum vulgare L.) possesses a large and highly repetitive genome of 5.1 Gb that has hindered the development of a complete sequence. In 2012, the International Barley Sequencing Consortium released a resource integrating whole-genome shotgun sequences with a physical and genetic framework. However, because only 6278 bacterial artificial chromosome (BACs) in the physical map were sequenced, fine structure was limited. To gain access to the gene-containing portion of the barley genome at high resolution, we identified and sequenced 15 622 BACs representing the minimal tiling path of 72 052 physical-mapped gene-bearing BACs. This generated ~1.7 Gb of genomic sequence containing an estimated 2/3 of all Morex barley genes. Exploration of these sequenced BACs revealed that although distal ends of chromosomes contain most of the gene-enriched BACs and are characterized by high recombination rates, there are also gene-dense regions with suppressed recombination. We made use of published map-anchored sequence data from Aegilops tauschii to develop a synteny viewer between barley and the ancestor of the wheat D-genome. Except for some notable inversions, there is a high level of collinearity between the two species. The software HarvEST:Barley provides facile access to BAC sequences and their annotations, along with the barley-Ae. tauschii synteny viewer. These BAC sequences constitute a resource to improve the efficiency of marker development, map-based cloning, and comparative genomics in barley and related crops. Additional knowledge about regions of the barley genome that are gene-dense but low recombination is particularly relevant.

  10. Effect of feeding corn, hull-less or hulled barley on fermentation by mixed cultures of ruminal microorganisms.

    Science.gov (United States)

    Fellner, V; Burns, J C; Marshall, D S

    2008-05-01

    Increased demands for corn grain warrant the evaluation of alternative grain types for ruminant production systems. This study was conducted to determine the effects of hulled and hull-less barley (Hordeum vulgare L.) cultivars compared with corn (Zea mays L.) as an alternative grain type on fermentation in cultures of mixed ruminal microorganisms. Three continuous fermentors were fed 14 g of dry feed per day (divided equally between 2 feedings) consisting of alfalfa (Medicago sativa L.) hay pellets (40% of dry matter) and 1) ground corn, 2) hulled barley, or 3) hull-less barley concentrate (60% of dry matter) in each fermentor. Following an adaptation period of 5 d, culture samples were taken at 2 h after the morning feeding on d 6, 7, and 8 of each period for analysis. A second run of the fermentors followed the same treatment sequence to provide replication. Culture pH was reduced with corn (5.55) and did not differ between barley cultivars (average pH 5.89). Total volatile fatty acid concentration and acetate to propionate ratio were not different across grain type or barley cultivar with the exception of greater total volatile fatty acid concentrations with hull-less barley. Corn produced less methane (14.6 mmol/d) and ammonia-N (7.3 mg/100 mL) compared with barley (33.1 mmol/d and 22 mg/100 mL, respectively); methane was greater with hull-less barley but ammonia-N concentration was similar between the 2 barley cultivars. Hull-less barley had greater digestibility compared with hulled barley, and corn had reduced digestibility compared with barley. Concentrations of C18:0 were greater and those of C18:1 and C18:2 lesser in cultures fed hulled and hull-less barley compared with corn. Our data indicate that grain type and barley cultivar have an impact on ruminal fermentation. The lesser starch concentration of barley minimized the drop in culture pH and improved digestibility.

  11. Colonization of Barley by the Broad-Host Hemibiotrophic Pathogen Phytophthora palmivora Uncovers a Leaf Development-Dependent Involvement of Mlo.

    Science.gov (United States)

    Le Fevre, Ruth; O'Boyle, Bridget; Moscou, Matthew J; Schornack, Sebastian

    2016-05-01

    The discovery of barley Mlo demonstrated that filamentous pathogens rely on plant genes to achieve entry and lifecycle completion in barley leaves. While having a dramatic effect on foliar pathogens, it is unclear whether overlapping or distinct mechanisms affect filamentous pathogen infection of roots. To remove the bias connected with using different pathogens to understand colonization mechanisms in different tissues, we have utilized the aggressive hemibiotrophic oomycete pathogen Phytophthora palmivora. P. palmivora colonizes root as well as leaf tissues of barley (Hordeum vulgare). The infection is characterized by a transient biotrophy phase with formation of haustoria. Barley accessions varied in degree of susceptibility, with some accessions fully resistant to leaf infection. Notably, there was no overall correlation between degree of susceptibility in roots compared with leaves, suggesting that variation in different genes influences host susceptibility above and below ground. In addition, a developmental gradient influenced infection, with more extensive colonization observed in mature leaf sectors. The mlo5 mutation attenuates P. palmivora infection but only in young leaf tissues. The barley-P. palmivora interaction represents a simple system to identify and compare genetic components governing quantitative colonization in diverse barley tissue types.

  12. Structure and function of the bacterial root microbiota in wild and domesticated barley.

    Science.gov (United States)

    Bulgarelli, Davide; Garrido-Oter, Ruben; Münch, Philipp C; Weiman, Aaron; Dröge, Johannes; Pan, Yao; McHardy, Alice C; Schulze-Lefert, Paul

    2015-03-11

    The microbial communities inhabiting the root interior of healthy plants, as well as the rhizosphere, which consists of soil particles firmly attached to roots, engage in symbiotic associations with their host. To investigate the structural and functional diversification among these communities, we employed a combination of 16S rRNA gene profiling and shotgun metagenome analysis of the microbiota associated with wild and domesticated accessions of barley (Hordeum vulgare). Bacterial families Comamonadaceae, Flavobacteriaceae, and Rhizobiaceae dominate the barley root-enriched microbiota. Host genotype has a small, but significant, effect on the diversity of root-associated bacterial communities, possibly representing a footprint of barley domestication. Traits related to pathogenesis, secretion, phage interactions, and nutrient mobilization are enriched in the barley root-associated microbiota. Strikingly, protein families assigned to these same traits showed evidence of positive selection. Our results indicate that the combined action of microbe-microbe and host-microbe interactions drives microbiota differentiation at the root-soil interface.

  13. Structure and Function of the Bacterial Root Microbiota in Wild and Domesticated Barley

    Science.gov (United States)

    Bulgarelli, Davide; Garrido-Oter, Ruben; Münch, Philipp C.; Weiman, Aaron; Dröge, Johannes; Pan, Yao; McHardy, Alice C.; Schulze-Lefert, Paul

    2015-01-01

    Summary The microbial communities inhabiting the root interior of healthy plants, as well as the rhizosphere, which consists of soil particles firmly attached to roots, engage in symbiotic associations with their host. To investigate the structural and functional diversification among these communities, we employed a combination of 16S rRNA gene profiling and shotgun metagenome analysis of the microbiota associated with wild and domesticated accessions of barley (Hordeum vulgare). Bacterial families Comamonadaceae, Flavobacteriaceae, and Rhizobiaceae dominate the barley root-enriched microbiota. Host genotype has a small, but significant, effect on the diversity of root-associated bacterial communities, possibly representing a footprint of barley domestication. Traits related to pathogenesis, secretion, phage interactions, and nutrient mobilization are enriched in the barley root-associated microbiota. Strikingly, protein families assigned to these same traits showed evidence of positive selection. Our results indicate that the combined action of microbe-microbe and host-microbe interactions drives microbiota differentiation at the root-soil interface. PMID:25732064

  14. Phytoremediation of Petroleum-Contaminated Soils around Isfahan Oil Refinery (Iran by Sorghum and Barley

    Directory of Open Access Journals (Sweden)

    Farida Irajy Asiabadi

    2014-04-01

    Full Text Available Petroleum compounds are one of the most frequently encountered pollutants in soils adjacent to oil refineries. Phytoremediation,where feasible, has become a cost-effective alternative to physicochemical methods of soil remediation. In this study, sorghum (Sorghum bicolor and barley (Hordeum vulgare were selected for phytoremediationand the diminution in the concentration of oil-based contaminants was measured during a 90-day period. Contaminated and control treatments were compared in terms of root and shoot dry weight. Comparisons revealed reductions of about 22% and 30% in root dry matter and 51% and 42% in shoot dry matter of sorghum and barley in contaminated soil, respectively. The control and planted soils were significantly different in total and oil-degrading bacterial counts. Moreover, the concentration of total petroleum hydrocarbons decreased by 52%-64% in 90 days. Since planting the contaminated soil with sorghum and barley resulted in an improvement of 30% compared to unplanted contaminated soil, the two plants were highly efficient in removing petroleum from oil-contaminated soils. Therefore, despite the necessity of further studies to enhance the efficacy of phytoremediation by assessing the appropriateness of various plant species, some genotypes like sorghum and barley were found suitable choices for phytoremediation of the investigated petroleum-contaminated soil.

  15. Root border cell development is a temperature-insensitive and Al-sensitive process in barley.

    Science.gov (United States)

    Pan, Jian-Wei; Ye, Dan; Wang, Li-Ling; Hua, Jing; Zhao, Gu-Feng; Pan, Wei-Huai; Han, Ning; Zhu, Mu-Yuan

    2004-06-01

    In vivo and in vitro experiments showed that border cell (BC) survival was dependent on root tip mucigel in barley (Hordeum vulgare L. cv. Hang 981). In aeroponic culture, BC development was an induced process in barley, whereas in hydroponic culture, it was a kinetic equilibrium process during which 300-400 BCs were released into water daily. The response of root elongation to temperatures (10-35 degrees C) was very sensitive but temperature changes had no great effect on barley BC development. At 35 degrees C, the root elongation ceased whereas BC production still continued, indicating that the two processes might be regulated independently under high temperature (35 degrees C) stress. Fifty microM Al could inhibit significantly BC development by inhibiting pectin methylesterase activity in the root cap of cv. 2000-2 (Al-sensitive) and cv. Humai 16 (Al-tolerant), but 20 microM Al could not block BC development in cv. Humai 16. BCs and their mucigel of barley had a limited role in the protection of Al-induced inhibition of root elongation, but played a significant role in the prevention of Al from diffusing into the meristems of the root tip and the root cap. Together, these results suggested that BC development was a temperature-insensitive but Al-sensitive process, and that BCs and their mucigel played an important role in the protection of root tip and root cap meristems from Al toxicity.

  16. Barley Leaf Area and Leaf Growth Rates Are Maximized during the Pre-Anthesis Phase

    Directory of Open Access Journals (Sweden)

    Ahmad M. Alqudah

    2015-04-01

    Full Text Available Leaf developmental traits are an important component of crop breeding in small-grain cereals. Surprisingly, little is known about the genetic basis for the differences in barley (Hordeum vulgare L. leaf development. The two barley row-type classes, i.e., two- and six-rowed, show clear-cut differences in leaf development. To quantify these differences and to measure the genetic component of the phenotypic variance for the leaf developmental differences in both row-type classes we investigated 32 representative spring barley accessions (14 two- and 18 six-rowed accessions under three independent growth conditions. Leaf mass area is lower in plants grown under greenhouse (GH conditions due to fewer, smaller, and lighter leaf blades per main culm compared to pot- and soil-grown field plants. Larger and heavier leaf blades of six-rowed barley correlate with higher main culm spike grain yield, spike dry weight, and harvest index; however, smaller leaf area (LA in two-rowed barley can be attributed to more spikes, tillers, and biological yield (aboveground parts. In general, leaf growth rate was significantly higher between awn primordium and tipping stages. Moderate to very high broad-sense heritabilities (0.67–0.90 were found under all growth conditions, indicating that these traits are predominantly genetically controlled. In addition, our data suggests that GH conditions are suitable for studying leaf developmental traits. Our results also demonstrated that LA impacts single plant yield and can be reconsidered in future breeding programs. Six-rowed spike 1 (Vrs1 is the major determinate of barley row-types, the differences in leaf development between two- and six-rowed barleys may be attributed to the regulation of Vrs1 in these two classes, which needs further testing.

  17. Molecular characterization of two lipoxygenases from barley

    NARCIS (Netherlands)

    Mechelen, J.R. van; Schuurink, R.C.; Smits, M.; Graner, A.; Douma, A.C.; Sedee, N.J.A.; Schmitt, N.F.; Valk, B.E.

    1999-01-01

    Two full-length lipoxygenase cDNA sequences (LoxB and LoxC) from barley (Hordeum distichum cv. L. Triumph) are described. The cDNAs share high homology with the barley LoxA cDNA. Southern blotting experiments indicate single copy numbers of the three lipoxygenase genes. RFLP mapping revealed the pre

  18. Intercalation of psoralen into DNA of plastid chromosomes decreases late during barley chloroplast development.

    Science.gov (United States)

    Davies, J P; Thompson, R J; Mosig, G

    1991-01-01

    We have used a DNA crosslinking assay to measure intercalation of the psoralen derivative HMT (4'-hydroxymethyl-4,5',8-trimethylpsoralen) into barley (Hordeum vulgare) plastid chromosomal DNA during chloroplast and etioplast development. Intercalation into DNA in intact plastids in vivo and in plastid lysates in vitro shows that chromosomal DNA in the most mature chloroplasts intercalates HMT less efficiently than DNA in younger chloroplasts. In contrast, there is no change in HMT intercalation during etioplast differentiation in the dark. Our results also show that DNA in higher plant plastid chromosomes is under superhelical tension in vivo. The lower susceptibility to HMT intercalation of DNA in the most mature chloroplasts indicates that late during chloroplast development the superhelical tension or the binding of proteins to the DNA or both change. Images PMID:1923805

  19. Concerted suppression of all starch branching enzyme genes in barley produces amylose-only starch granules

    DEFF Research Database (Denmark)

    Carciofi, Massimiliano; Blennow, Per Gunnar Andreas; Jensen, Susanne Langgård;

    2012-01-01

    Background Starch is stored in higher plants as granules composed of semi-crystalline amylopectin and amorphous amylose. Starch granules provide energy for the plant during dark periods and for germination of seeds and tubers. Dietary starch is also a highly glycemic carbohydrate being degraded...... is preferentially derived from amylose, which can be increased by suppressing amylopectin synthesis by silencing of starch branching enzymes (SBEs). However all the previous works attempting the production of high RS crops resulted in only partly increased amylose-content and/or significant yield loss. Results...... In this study we invented a new method for silencing of multiple genes. Using a chimeric RNAi hairpin we simultaneously suppressed all genes coding for starch branching enzymes (SBE I, SBE IIa, SBE IIb) in barley (Hordeum vulgare L.), resulting in production of amylose-only starch granules in the endosperm...

  20. Concerted suppression of all starch branching enzyme genes in barley produces amylose-only starch granules

    DEFF Research Database (Denmark)

    Carciofi, Massimiliano; Blennow, Per Gunnar Andreas; Jensen, Susanne Langgård

    2012-01-01

    In this study we invented a new method for silencing of multiple genes. Using a chimeric RNAi hairpin we simultaneously suppressed all genes coding for starch branching enzymes (SBE I, SBE IIa, SBE IIb) in barley (Hordeum vulgare L.), resulting in production of amylose-only starch granules in the endosperm....... This trait was segregating 3:1. Amylose-only starch granules were irregularly shaped and showed peculiar thermal properties and crystallinity. Transgenic lines retained high-yield possibly due to a pleiotropic upregualtion of other starch biosynthetic genes compensating the SBEs loss. For gelatinized starch...... yield in a living organism. This was achieved by a new method of simultaneous suppression of the entire complement of genes encoding starch branching enzymes. We demonstrate that amylopectin is not essential for starch granule crystallinity and integrity. However the slower initial growth of shoots from...

  1. A Barley ROP GTPase ACTIVATING PROTEIN Associates with Microtubules and Regulates Entry of the Barley Powdery Mildew Fungus into Leaf Epidermal Cells[C][W

    Science.gov (United States)

    Hoefle, Caroline; Huesmann, Christina; Schultheiss, Holger; Börnke, Frederik; Hensel, Götz; Kumlehn, Jochen; Hückelhoven, Ralph

    2011-01-01

    Little is known about the function of host factors involved in disease susceptibility. The barley (Hordeum vulgare) ROP (RHO of plants) G-protein RACB is required for full susceptibility of the leaf epidermis to invasion by the biotrophic fungus Blumeria graminis f. sp hordei. Stable transgenic knockdown of RACB reduced the ability of barley to accommodate haustoria of B. graminis in intact epidermal leaf cells and to form hairs on the root epidermis, suggesting that RACB is a common element of root hair outgrowth and ingrowth of haustoria in leaf epidermal cells. We further identified a barley MICROTUBULE-ASSOCIATED ROP-GTPASE ACTIVATING PROTEIN (MAGAP1) interacting with RACB in yeast and in planta. Fluorescent MAGAP1 decorated cortical microtubules and was recruited by activated RACB to the cell periphery. Under fungal attack, MAGAP1-labeled microtubules built a polarized network at sites of successful defense. By contrast, microtubules loosened where the fungus succeeded in penetration. Genetic evidence suggests a function of MAGAP1 in limiting susceptibility to penetration by B. graminis. Additionally, MAGAP1 influenced the polar organization of cortical microtubules. These results add to our understanding of how intact plant cells accommodate fungal infection structures and suggest that RACB and MAGAP1 might be antagonistic players in cytoskeleton organization for fungal entry. PMID:21685259

  2. Drivers of phosphorus uptake by barley following secondary resource application

    Directory of Open Access Journals (Sweden)

    Eva eBrod

    2016-05-01

    Full Text Available Minable rock phosphate is a finite resource. Replacing mineral phosphorus (P fertilizer with P-rich secondary resources is one way to manage P more efficiently, but the importance of physicochemical and microbial soil processes induced by secondary resources for plant P uptake are still poorly understood. Using radioactive labelling techniques, the fertilization effects of dairy manure, fish sludge, meat bone meal and wood ash were studied as P uptake by barley after 44 days and compared with those of water-soluble mineral P (MinP and an unfertilized control (NoP in a pot experiment with an agricultural soil containing little available P at two soil pH levels, approximately pH 5.3 (unlimed soil and pH 6.2 (limed soil. In a parallel incubation experiment, the effects of the secondary resources on physicochemical and microbial soil processes were studied. The results showed that the relative agronomic efficiency compared with MinP decreased in the order: manure ≥ fish sludge ≥ wood ash ≥ meat bone meal. The solubility of inorganic P in secondary resources was the main driver for P uptake by barley (Hordeum vulgare. The effects of secondary resources on physicochemical and microbial soil processes were of little overall importance. Application of organic carbon with manure resulted in microbial P immobilisation and decreased uptake by barley of P derived from the soil. On both soils, P uptake by barley was best explained by a positive linear relationship with the H2O + NaHCO3-soluble inorganic P fraction in fertilizers, or by a linear negative relationship with the HCl-soluble inorganic P fraction in fertilizers.

  3. Golgi localized barley MTP8 proteins facilitate Mn transport.

    Science.gov (United States)

    Pedas, Pai; Schiller Stokholm, Michaela; Hegelund, Josefine Nymark; Ladegård, Anne Hald; Schjoerring, Jan Kofod; Husted, Søren

    2014-01-01

    Many metabolic processes in plants are regulated by manganese (Mn) but limited information is available on the molecular mechanisms controlling cellular Mn homeostasis. In this study, a yeast assay was used to isolate and characterize two genes, MTP8.1 and MTP8.2, which encode membrane-bound proteins belonging to the cation diffusion facilitator (CDF) family in the cereal species barley (Hordeum vulgare). Transient expression in onion epidermal cells showed that MTP8.1 and MTP8.2 proteins fused to the green fluorescent protein (GFP) are localized to Golgi. When heterologously expressed in yeast, MTP8.1 and MTP8.2 were found to be Mn transporters catalysing Mn efflux in a similar manner as the Golgi localized endogenous yeast protein Pmr1p. The level of MTP8.1 transcripts in barley roots increased with external Mn supply ranging from deficiency to toxicity, while MTP8.2 transcripts decreased under the same conditions, indicating non-overlapping functions for the two genes. In barley leaves, the expression of both MTP8 genes declined in response to toxic Mn additions to the roots suggesting a role in ensuring proper delivery of Mn to Golgi. Based on the above we suggest that barley MTP8 proteins are involved in Mn loading to the Golgi apparatus and play a role in Mn homeostasis by delivering Mn to Mn-dependent enzymes and/or by facilitating Mn efflux via secretory vesicles. This study highlights the importance of MTP transporters in Mn homeostasis and is the first report of Golgi localized Mn2+ transport proteins in a monocot plant species.

  4. Golgi localized barley MTP8 proteins facilitate Mn transport.

    Directory of Open Access Journals (Sweden)

    Pai Pedas

    Full Text Available Many metabolic processes in plants are regulated by manganese (Mn but limited information is available on the molecular mechanisms controlling cellular Mn homeostasis. In this study, a yeast assay was used to isolate and characterize two genes, MTP8.1 and MTP8.2, which encode membrane-bound proteins belonging to the cation diffusion facilitator (CDF family in the cereal species barley (Hordeum vulgare. Transient expression in onion epidermal cells showed that MTP8.1 and MTP8.2 proteins fused to the green fluorescent protein (GFP are localized to Golgi. When heterologously expressed in yeast, MTP8.1 and MTP8.2 were found to be Mn transporters catalysing Mn efflux in a similar manner as the Golgi localized endogenous yeast protein Pmr1p. The level of MTP8.1 transcripts in barley roots increased with external Mn supply ranging from deficiency to toxicity, while MTP8.2 transcripts decreased under the same conditions, indicating non-overlapping functions for the two genes. In barley leaves, the expression of both MTP8 genes declined in response to toxic Mn additions to the roots suggesting a role in ensuring proper delivery of Mn to Golgi. Based on the above we suggest that barley MTP8 proteins are involved in Mn loading to the Golgi apparatus and play a role in Mn homeostasis by delivering Mn to Mn-dependent enzymes and/or by facilitating Mn efflux via secretory vesicles. This study highlights the importance of MTP transporters in Mn homeostasis and is the first report of Golgi localized Mn2+ transport proteins in a monocot plant species.

  5. HvLUX1 is a candidate gene underlying the early maturity 10 locus in barley: phylogeny, diversity, and interactions with the circadian clock and photoperiodic pathways.

    Science.gov (United States)

    Campoli, Chiara; Pankin, Artem; Drosse, Benedikt; Casao, Cristina M; Davis, Seth J; von Korff, Maria

    2013-09-01

    Photoperiodic flowering is a major factor determining crop performance and is controlled by interactions between environmental signals and the circadian clock. We proposed Hvlux1, an ortholog of the Arabidopsis circadian gene LUX ARRHYTHMO, as a candidate underlying the early maturity 10 (eam10) locus in barley (Hordeum vulgare L.). The link between eam10 and Hvlux1 was discovered using high-throughput sequencing of enriched libraries and segregation analysis. We conducted functional, phylogenetic, and diversity studies of eam10 and HvLUX1 to understand the genetic control of photoperiod response in barley and to characterize the evolution of LUX-like genes within barley and across monocots and eudicots. We demonstrate that eam10 causes circadian defects and interacts with the photoperiod response gene Ppd-H1 to accelerate flowering under long and short days. The results of phylogenetic and diversity analyses indicate that HvLUX1 was under purifying selection, duplicated at the base of the grass clade, and diverged independently of LUX-like genes in other plant lineages. Taken together, these findings contribute to improved understanding of the barley circadian clock, its interaction with the photoperiod pathway, and evolution of circadian systems in barley and across monocots and eudicots.

  6. The genetics and mechanism of avoidance of rust infection in Hordeum chilense

    NARCIS (Netherlands)

    Vaz Patto, M.C.

    2001-01-01

    Hordeum chilense is a perennial species occurring in Chile and Argentina. This wild barley species shows a very wide range of variation of morphological and agronomic characters and crosses easily with other members of the Triticeae tribe.H. chilense is one of the five wild barley species in which a

  7. Response of barley aleurone layers to abscisic acid

    Energy Technology Data Exchange (ETDEWEB)

    Ho, D.T.H.; Varner, J.E.

    1976-02-01

    Cordycepin, an inhibitor of RNA synthesis in barley (Hordeum vulgare L.) aleurone cells, does not inhibit the gibberellic acid-enhanced ..cap alpha..-amylase (EC 3.2.1.1.) synthesis in barley aleurone layers if it is added 12 hours or more after the addition of the hormone. However, the accumulation of ..cap alpha..-amylase activity after 12 hours of gibberellic acid can be decreased by abscisic acid. The accumulation of ..cap alpha..-amylase activity is sustained or quickly restored when cordycepin is added simultaneously or some time after abscisic acid, indicating that the response of aleurone layers to abscisic acid depends on the continuous synthesis of a short lived RNA. By analysis of the newly synthesized proteins by gel electrophoresis with sodium dodecylsulfate, it was observed that the synthesis of ..cap alpha..-amylase is decreased in the presence of abscisic acid while the synthesis of most of the other proteins remains unchanged. From the rate of resumption of ..cap alpha..-amylase production in the presence of cordycepin and abscisic acid, it appears that abscisic acid does not have a measurable effect on the stability of ..cap alpha..-amylase mRNA.

  8. Homeopathically prepared gibberellic acid and barley seed germination.

    Science.gov (United States)

    Hamman, B; Koning, G; Lok, K Him

    2003-07-01

    The potentisation process by which homeopathic preparations are produced raises the concern that these medicines have placebo effects only, since they theoretically no longer contain active molecules of the diluted substance. Plant models offer a method of examining the efficacy of homeopathically prepared solutions. This study examined the effects of homeopathically prepared gibberellic acid (HGA3) on the germination performance of barley (Hordeum vulgare L.) seeds. The effect of HGA3 (4-200 cH) on seed germination rate and seedling development was compared to that of the most commonly used form of gibberellic acid (GA3), 0.5 g l(-1), and control (distilled water). The extent and type of response was dependent on the vigour level of the seedlot. Treating seeds from three vigour groups in HGA3 consistently resulted in larger seedlings. High-vigour seeds treated with HGA3 4, 30 and 200 cH germinated faster, and roots of medium-vigour seedlots treated in HGA3 15 cH were longer. Biphasic effects of HGA3 were also demonstrated. As a plant model, germinating barley seeds successfully demonstrated the ability of HGA3 to produce a biological response.

  9. Organization and expression of two tandemly oriented genes encoding ribulosebisphosphate carboxylase/oxygenase activase in barley.

    Science.gov (United States)

    Rundle, S J; Zielinski, R E

    1991-03-15

    We have isolated and structurally characterized genomic DNA and cDNA sequences encoding ribulose-1,5-bisphosphate carboxylase/oxygenase (Rbu-P2 carboxylase) activase from barley (Hordeum vulgare L.). Three Rbu-P2 carboxylase activase (Rca) polypeptides are encoded in the barley genome by two closely linked, tandemly oriented nuclear genes (RcaA and RcaB); cDNAs encoding each of the three Rbu-P2 carboxylase activase polypeptides were isolated from cDNA libraries of barley leaf mRNA. RcaA produces two mRNAs, which encode polypeptides of 42 and 46 kDa, by an alternative splicing mechanism identical to that previously reported for spinach and Arabidopsis Rca genes (Werneke, J.M., Chatfield, J.M., and Ogren, W. L. (1989) Plant Cell 1, 815-825). RcaB is transcribed to produce a single mRNA, which encodes a mature peptide of 42 kDa. Genomic Southern blots indicate that RcaA and RcaB represent the entire Rbu-P2 carboxylase activase gene family in barley. The genes share 80% nucleotide sequence identity, and the 42-kDa polypeptides encoded by RcaA and RcaB share 87% amino acid sequence identity. Coding regions of the two barley Rca genes are separated by 1 kilobase pair of flanking DNA. DNA sequence motifs similar to those thought to control light-regulated gene expression in other nuclear-encoded plastid polypeptide genes are found at the 5' end of both barley Rca genes. Probes specific to three mRNAs were used to determine the relative contribution each species makes to the total Rca mRNA pool.

  10. Enhancing the aluminium tolerance of barley by expressing the citrate transporter genes SbMATE and FRD3.

    Science.gov (United States)

    Zhou, Gaofeng; Pereira, Jorge F; Delhaize, Emmanuel; Zhou, Meixue; Magalhaes, Jurandir V; Ryan, Peter R

    2014-06-01

    Malate and citrate efflux from root apices is a mechanism of Al(3+) tolerance in many plant species. Citrate efflux is facilitated by members of the MATE (multidrug and toxic compound exudation) family localized to the plasma membrane of root cells. Barley (Hordeum vulgare) is among the most Al(3+)-sensitive cereal species but the small genotypic variation in tolerance that is present is correlated with citrate efflux via a MATE transporter named HvAACT1. This study used a biotechnological approach to increase the Al(3+) tolerance of barley by transforming it with two MATE genes that encode citrate transporters: SbMATE is the major Al(3+)-tolerance gene from sorghum whereas FRD3 is involved with Fe nutrition in Arabidopsis. Independent transgenic and null T3 lines were generated for both transgenes. Lines expressing SbMATE showed Al(3+)-activated citrate efflux from root apices and greater tolerance to Al(3+) toxicity than nulls in hydroponic and short-term soil trials. Transgenic lines expressing FRD3 exhibited similar phenotypes except citrate release from roots occurred constitutively. The Al(3+) tolerance of these lines was compared with previously generated transgenic barley lines overexpressing the endogenous HvAACT1 gene and the TaALMT1 gene from wheat. Barley lines expressing TaALMT1 showed significantly greater Al(3+) tolerance than all lines expressing MATE genes. This study highlights the relative efficacy of different organic anion transport proteins for increasing the Al(3+) tolerance of an important crop species.

  11. Transcriptome Analysis of High-Temperature Stress in Developing Barley Caryopses :Early Stress Responses and Effects on Storage Compound Biosynthesis

    Institute of Scientific and Technical Information of China (English)

    Elke Mangelsen; Joachim Kilian; Klaus Harter; Christer Jansson; Dierk Wanke; Eva Sundberg

    2011-01-01

    High-temperature stress,like any abiotic stress,impairs the physiology and development of plants,including the stages of seed setting and ripening.We used the Aflymetrix 22K Barley1 GeneChip microarray to investigate the response of developing barley(Hordeum vulgare)seeds,termed caryopses,after 0.5,3,and 6 h of heat stress exposure;958 induced and 1122 repressed genes exhibited spatial and temporal expression patterns that provide a detailed insight into the caryopses'early heat stress responses.Down-regulation of genes related to storage compound biosynthesis and cell growth provides evidence for a rapid impairment of the caryopsis' development.Increased levels of sugars and amino acids were indicative for both production of compatible solutes and feedback-induced accumulation of substrates for storage compound biosynthesis.Metadata analysis identified embryo and endosperm as primary locations of heat stress responses,indicating a strong impact of short-term heat stress on central developmental functions of the caryopsis.A comparison with heat stress responses in Arabidopsis shoots and drought stress responses in barley caryopses identified both conserved and presumably heat-and caryopsis-specific stress-responsive genes.Summarized,our data provide an important basis for further investigation of gene functions in order to aid an improved heat tolerance and reduced losses of yield in barley as a model for cereal crops.

  12. Combined mass spectrometric and chromatographic methods for in-depth analysis of phenolic secondary metabolites in barley leaves.

    Science.gov (United States)

    Piasecka, Anna; Sawikowska, Aneta; Krajewski, Paweł; Kachlicki, Piotr

    2015-03-01

    Structural analysis via HPLC-ESI-MSn, UPLC-HESI-MS/MS and NMR reported 152 phenolic secondary metabolites in spring barley seedlings (Hordeum vulgare L.). Flavonoids with various patterns of glycosylation and acylation, as well as hydroxycinnamic acid glycosides, esters and amides, were identified in methanolic extracts from leaves of nine varieties of barley originating from different regions of the world. Hordatines derivatives, flavones acylated directly on the aglycone, and hydroxyferulic acid derivatives deserve special attention. Preparative chromatography enabled characterization of a number of compounds at trace levels with the 6-C-[6″-O-glycosyl]-glycosides and the 6-C-[2″,6″-di-O-glycosides]-glucoside structure of flavones. Derivatives of flavonols, quercetin and isorhamnetin were observed only in Syrian varieties. The ultra performance liquid chromatography profiles of UV-absorbing secondary metabolites were used for chemotaxonomic comparison between nine varieties of barley from different climatic conditions. The hierarchical clustering of bred lines from the Fertile Crescent and European and American varieties indicates a great diversity of chemical phenotypes within barley species.

  13. Developing a Molecular Identification Assay of Old Landraces for the Genetic Authentication of Typical Agro-Food Products: The Case Study of the Barley 'Agordino'.

    Science.gov (United States)

    Palumbo, Fabio; Galla, Giulio; Barcaccia, Gianni

    2017-03-01

    The orzo Agordino is a very old local variety of domesticated barley (Hordeum vulgare ssp. distichum L.) that is native to the Agordo District, Province of Belluno, and is widespread in the Veneto Region, Italy. Seeds of this landrace are widely used for the preparation of very famous dishes of the dolomitic culinary tradition such as barley soup, bakery products and local beer. Understanding the genetic diversity and identity of the Agordino barley landrace is a key step to establish conservation and valorisation strategies of this local variety and also to provide molecular traceability tools useful to ascertain the authenticity of its derivatives. The gene pool of the Agordino barley landrace was reconstructed using 60 phenotypically representative individual plants and its genotypic relationships with commercial varieties were investigated using 21 pure lines widely cultivated in the Veneto Region. For genomic DNA analysis, following an initial screening of 14 mapped microsatellite (SSR) loci, seven discriminant markers were selected on the basis of their genomic position across linkage groups and polymorphic marker alleles per locus. The genetic identity of the local barley landrace was determined by analysing all SSR markers in a single multi-locus PCR assay. Extent of genotypic variation within the Agordino barley landrace and the genotypic differentiation between the landrace individuals and the commercial varieties was determined. Then, as few as four highly informative SSR loci were selected and used to develop a molecular traceability system exploitable to verify the genetic authenticity of food products deriving from the Agordino landrace. This genetic authentication assay was validated using both DNA pools from individual Agordino barley plants and DNA samples from Agordino barley food products. On the whole, our data support the usefulness and robustness of this DNA-based diagnostic tool for the orzo Agordino identification, which could be rapidly and

  14. The effect of application of micromycetes on plant growth, as well as soybean and barley yields.

    Science.gov (United States)

    Ignatova, Lyudmila; Brazhnikova, Yelena; Berzhanova, Ramza; Mukasheva, Togzhan

    2015-01-01

    The possibility of application of micromycetes (strains Penicillium bilaiae Pb14, Aureobasidium pullulans YA05 and Rhodotorula mucilaginosa YR07) to increase yields of soybean (Glycine max cv Almaty) and barley (Hordeum vulgare cv Arna) was estimated. It was shown that the most positive effect on germination energy and seed germination after seed treatment with liquid culture, supernatant and filtrate, is achieved at 1:5 dilution. In studying the influence of cell-associated and extracellular biologically active compounds of micromycetes (liquid culture and supernatant) on biometric parameters of seedlings, the maximum stimulating effect was observed in the variants with liquid culture. These strains of micromycetes were used as a bases for various compositions of preparations - application of each strain separately and application of micromycetes mixes. In microfield experiments, the increase of soybean yield ranged from 4.5 to 9.4 quintal/ha, barley - from 2.9 to 5.9 quintal/ha. A significant increase in various parameters of structure of the yield was shown in all experimental variants when compared to the control. It was found that an increase in soybean and barley yields and yield components was higher in the variant with a mix of micromycetes when compared to the separate application of each strain. The most efficient mixture was based on the mix of fungal strains (culture filtrate of P. bilaiae Pb14 diluted 1:5 + liquid cultures of A. pullulans YA05 and Rh. mucilaginosa YR07 in a 1:5 dilution).

  15. Stable gene replacement in barley by targeted double-strand break induction.

    Science.gov (United States)

    Watanabe, Koichi; Breier, Ulrike; Hensel, Götz; Kumlehn, Jochen; Schubert, Ingo; Reiss, Bernd

    2016-03-01

    Gene targeting is becoming an important tool for precision genome engineering in plants. During gene replacement, a variant of gene targeting, transformed DNA integrates into the genome by homologous recombination (HR) to replace resident sequences. We have analysed gene targeting in barley (Hordeum vulgare) using a model system based on double-strand break (DSB) induction by the meganuclease I-SceI and a transgenic, artificial target locus. In the plants we obtained, the donor construct was inserted at the target locus by homology-directed DNA integration in at least two transformants obtained in a single experiment and was stably inherited as a single Mendelian trait. Both events were produced by one-sided integration. Our data suggest that gene replacement can be achieved in barley with a frequency suitable for routine application. The use of a codon-optimized nuclease and co-transfer of the nuclease gene together with the donor construct are probably the components important for efficient gene targeting. Such an approach, employing the recently developed synthetic nucleases/nickases that allow DSB induction at almost any sequence of a genome of interest, sets the stage for precision genome engineering as a routine tool even for important crops such as barley.

  16. Grain yield, net blotch and scald of barley in Finnish official variety trials

    Directory of Open Access Journals (Sweden)

    J. ROBINSON

    2008-12-01

    Full Text Available Data on grain yield, and terminal severity of net blotch (Pyrenophora teres f. teres and scald (Rhynchosporium secalis from Finnish official barley (Hordeum vulgare variety trials were analysed to indicate the pattern of disease incidence over six years and five sites for nineteen barley genotypes, and the effect of the diseases on yield and the genotype by environment interaction for yield. The effect of climatic factors on net blotch severity were also investigated. The genotype by site interaction for net blotch severity was not statistically significant, but that for yield was. Net blotch severity differed between years, but was similar across sites and there were statistically significant first order interactions between year, site and genotype. 'Saana' and 'Thule' had relatively low mean terminal net blotch scores and their reaction to the disease was less sensitive to the environment than was that of 'Tyra' for example. Analysis of yield data adjusted for net blotch severity indicated that the magnitude of the genotype by environment interaction terms were not accounted for to any significant degree by differences in relative net blotch resistances among the barley genotypes. Overall, mean scores for scald severity were lower than those for net blotch. Terminal net blotch severity was correlated with May rainfall and growing degree days.;

  17. Jekyll Encodes a Novel Protein Involved in the Sexual Reproduction of Barley[W][OA

    Science.gov (United States)

    Radchuk, Volodymyr; Borisjuk, Ljudmilla; Radchuk, Ruslana; Steinbiss, Hans-Henning; Rolletschek, Hardy; Broeders, Sylvia; Wobus, Ulrich

    2006-01-01

    Cereal seed development depends on the intimate interaction of filial and maternal tissues, ensuring nourishment of the new generation. The gene jekyll, which was identified in barley (Hordeum vulgare), is preferentially expressed in the nurse tissues. JEKYLL shares partial similarity with the scorpion Cn4 toxin and is toxic when ectopically expressed in Escherichia coli and tobacco (Nicotiana tabacum). In barley, jekyll is upregulated in cells destined for autolysis. The gene generates a gradient of expression in the nucellar projection, which mediates the maternal–filial interaction during seed filling. Downregulation of jekyll by the RNA interference technique in barley decelerates autolysis and cell differentiation within the nurse tissues. Flower development and seed filling are thereby extended, and the nucellar projection no longer functions as the main transport route for assimilates. A slowing down in the proliferation of endosperm nuclei and a severely impaired ability to accumulate starch in the endosperm leads to the formation of irregular and small-sized seeds at maturity. Overall, JEKYLL plays a decisive role in the differentiation of the nucellar projection and drives the programmed cell death necessary for its proper function. We further suggest that cell autolysis during the differentiation of the nucellar projection allows the optimal provision of basic nutrients for biosynthesis in endosperm and embryo. PMID:16766690

  18. Fertility in barley flowers depends on Jekyll functions in male and female sporophytes.

    Science.gov (United States)

    Radchuk, Volodymyr; Kumlehn, Jochen; Rutten, Twan; Sreenivasulu, Nese; Radchuk, Ruslana; Rolletschek, Hardy; Herrfurth, Cornelia; Feussner, Ivo; Borisjuk, Ljudmilla

    2012-04-01

    • Owing to its evolutional plasticity and adaptability, barley (Hordeum vulgare) is one of the most widespread crops in the world. Despite this evolutionary success, sexual reproduction of small grain cereals is poorly investigated, making discovery of novel genes and functions a challenging priority. Barley gene Jekyll appears to be a key player in grain development; however, its role in flowers has remained unknown. • Here, we studied RNAi lines of barley, where Jekyll expression was repressed to different extents. The impact of Jekyll on flower development was evaluated based on differential gene expression analysis applied to anthers and gynoecia of wildtype and transgenic plants, as well as using isotope labeling experiments, hormone analysis, immunogold- and TUNEL-assays and in situ hybridization. • Jekyll is expressed in nurse tissues mediating gametophyte-sporophyte interaction in anthers and gynoecia, where JEKYLL was found within the intracellular membranes. The repression of Jekyll impaired pollen maturation, anther dehiscence and induced a significant loss of fertility. The presence of JEKYLL on the pollen surface also hints at possible involvement in the fertilization process. • We conclude that the role of Jekyll in cereal sexual reproduction is clearly much broader than has been hitherto realized. © 2012 The Authors. New Phytologist © 2012 New Phytologist Trust.

  19. Jekyll encodes a novel protein involved in the sexual reproduction of barley.

    Science.gov (United States)

    Radchuk, Volodymyr; Borisjuk, Ljudmilla; Radchuk, Ruslana; Steinbiss, Hans-Henning; Rolletschek, Hardy; Broeders, Sylvia; Wobus, Ulrich

    2006-07-01

    Cereal seed development depends on the intimate interaction of filial and maternal tissues, ensuring nourishment of the new generation. The gene jekyll, which was identified in barley (Hordeum vulgare), is preferentially expressed in the nurse tissues. JEKYLL shares partial similarity with the scorpion Cn4 toxin and is toxic when ectopically expressed in Escherichia coli and tobacco (Nicotiana tabacum). In barley, jekyll is upregulated in cells destined for autolysis. The gene generates a gradient of expression in the nucellar projection, which mediates the maternal-filial interaction during seed filling. Downregulation of jekyll by the RNA interference technique in barley decelerates autolysis and cell differentiation within the nurse tissues. Flower development and seed filling are thereby extended, and the nucellar projection no longer functions as the main transport route for assimilates. A slowing down in the proliferation of endosperm nuclei and a severely impaired ability to accumulate starch in the endosperm leads to the formation of irregular and small-sized seeds at maturity. Overall, JEKYLL plays a decisive role in the differentiation of the nucellar projection and drives the programmed cell death necessary for its proper function. We further suggest that cell autolysis during the differentiation of the nucellar projection allows the optimal provision of basic nutrients for biosynthesis in endosperm and embryo.

  20. Imidiazolium based ionic liquids: effects of different anions and alkyl chains lengths on the barley seedlings.

    Science.gov (United States)

    Cvjetko Bubalo, Marina; Hanousek, Karla; Radošević, Kristina; Gaurina Srček, Višnja; Jakovljević, Tamara; Radojčić Redovniković, Ivana

    2014-03-01

    We studied the effects of five imidiazolium based ionic liquids with different anions and length of alkyl chains linked to imidazolium ring on the early development of barley (Hordeum vulgare). The inhibitory effect depends on the ionic liquids concentration and chemical structure, whereby the most toxic one was [C10mim][Br], followed by [C7mim][Br], [C4mim][Br], [C4mim][CH3CO2] and [C4mim][BF4]. Both anion and cation structures affected the toxicity of ionic liquid indicating that selection of more biocompatible anions such as [CH3CO2] does not necessarily indicate lower toxicity. Alternation in the extent of oxidative stress and antioxidant enzymes activities were found in barley plants due to ionic liquid treatments. When seedlings were exposed to higher concentrations of ionic liquids, antioxidant system could not effectively remove reactive oxidative species, leading to lipid peroxidation and damage of the photosynthetic system. However, overall data indicated that the performance of barley seedling was improved when all measured enzymes involved in scavenging of reactive oxygen species (ROS) were increased with special emphasis on GPX activities. Since there are no studies about ionic liquid (IL) toxicity in plants, that simultaneously evaluates the antioxidative enzyme system in response to different ILs, this work is valuable for gaining knowledge about the protection mechanism of plants from oxidative stress caused by IL exposure.

  1. Real-time weed detection, decision making and patch spraying in maize, sugarbeet, winter wheat and winter barley

    DEFF Research Database (Denmark)

    Gerhards, R; Christensen, Svend

    2003-01-01

    online weed detection using digital image analysis, computer-based decision making and global positioning systems (GPS)-controlled patch spraying. In a 4-year study, herbicide use with this map-based approach was reduced in winter cereals by 60% for herbicides against broad-leaved weeds and 90% for grass......Information on temporal and spatial variation in weed seedling populations within agricultural fields is very important for weed population assessment and management. Most of all, it allows a potential reduction in herbicide use, when post-emergence herbicides are only applied to field sections...... with weed infestation levels higher than the economic weed threshold; a review of such work is provided. This paper presents a system for site-specific weed control in sugarbeet (Beta vulgaris L.), maize (Zea mays L.), winter wheat (Triticum aestivum L.) and winter barley (Hordeum vulgare L.), including...

  2. Cloning and characterization of purple acid phosphatase phytases from wheat, barley, maize, and rice.

    Science.gov (United States)

    Dionisio, Giuseppe; Madsen, Claus K; Holm, Preben B; Welinder, Karen G; Jørgensen, Malene; Stoger, Eva; Arcalis, Elsa; Brinch-Pedersen, Henrik

    2011-07-01

    Barley (Hordeum vulgare) and wheat (Triticum aestivum) possess significant phytase activity in the mature grains. Maize (Zea mays) and rice (Oryza sativa) possess little or virtually no preformed phytase activity in the mature grain and depend fully on de novo synthesis during germination. Here, it is demonstrated that wheat, barley, maize, and rice all possess purple acid phosphatase (PAP) genes that, expressed in Pichia pastoris, give fully functional phytases (PAPhys) with very similar enzyme kinetics. Preformed wheat PAPhy was localized to the protein crystalloid of the aleurone vacuole. Phylogenetic analyses indicated that PAPhys possess four conserved domains unique to the PAPhys. In barley and wheat, the PAPhy genes can be grouped as PAPhy_a or PAPhy_b isogenes (barley, HvPAPhy_a, HvPAPhy_b1, and HvPAPhy_b2; wheat, TaPAPhy_a1, TaPAPhy_a2, TaPAPhy_b1, and TaPAPhy_b2). In rice and maize, only the b type (OsPAPhy_b and ZmPAPhy_b, respectively) were identified. HvPAPhy_a and HvPAPhy_b1/b2 share 86% and TaPAPhya1/a2 and TaPAPhyb1/b2 share up to 90% (TaPAPhy_a2 and TaPAPhy_b2) identical amino acid sequences. despite of this, PAPhy_a and PAPhy_b isogenes are differentially expressed during grain development and germination. In wheat, it was demonstrated that a and b isogene expression is driven by different promoters (approximately 31% identity). TaPAPhy_a/b promoter reporter gene expression in transgenic grains and peptide mapping of TaPAPhy purified from wheat bran and germinating grains confirmed that the PAPhy_a isogene set present in wheat/barley but not in rice/maize is the origin of high phytase activity in mature grains.

  3. Effects of chromium(III and VI) on spring barley and maize biomass yield and content of nitrogenous compounds.

    Science.gov (United States)

    Wyszkowski, Mirosław; Radziemska, Maja

    2010-01-01

    The aim of this study was to (1) determine the effects of trivalent Cr(III) or hexavalent chromium Cr(VI) soil contamination on biomass yield and nitrogenous compound content of spring barley (Hordeum vulgare L.) as the main crop and subsequently maize (Zea mays L.) grown successively, and (2) examine whether the neutralizing additives applied (compost, zeolite, and calcium oxide) may be effective in reducing adverse impact of chromium (Cr) on crops. Spring barley yield was markedly decreased by Cr compounds, particularly Cr(VI). In contrast, maize yield was significantly increased by Cr(VI). Hexavalent Cr exerted a greater effect than the Cr(III) form on nitrogen levels in spring barley. Chromium significantly increased ammonia nitrogen content in maize. The accumulation of NO(3)(-)-N in plants treated with Cr(VI) was lower than in controls. The application of compost, zeolite, and calcium oxide onto the soil increased yield of maize only in pots containing Cr(III). Neutralizing additives exerted a positive, increased effect on the N-total content of maize but not spring barley, which was apparent with calcium oxide. Accumulation of NH(4)(+)-N in maize in pots with Cr(VI) was increased by all additives applied. The content of nitrate nitrogen in spring barley was predominantly affected by addition of compost and calcium oxide into the soil, producing a significant rise in NO(3)(-)-N content. Chromium, especially Cr(VI), used at doses of 100 and 150 mg/kg soil exerted adverse effects in treated plants, particularly spring barley.

  4. A semidwarf phenotype of barley uzu results from a nucleotide substitution in the gene encoding a putative brassinosteroid receptor.

    Science.gov (United States)

    Chono, Makiko; Honda, Ichiro; Zeniya, Haruko; Yoneyama, Koichi; Saisho, Daisuke; Takeda, Kazuyoshi; Takatsuto, Suguru; Hoshino, Tsuguhiro; Watanabe, Yoshiaki

    2003-11-01

    Brassinosteroids (BRs) play important roles throughout plant growth and development. Despite the importance of clarifying the mechanism of BR-related growth regulation in cereal crops, BR-related cereal mutants have been identified only in rice (Oryza sativa). We previously found that semidwarf barley (Hordeum vulgare) accessions carrying the "uzu" gene, called "uzu" barley in Japan, are non-responding for brassinolide (BL). We then performed chemical and molecular analyses to clarify the mechanisms of uzu dwarfism using isogenic line pairs of uzu gene. The response of the uzu line to BL was significantly lower than that of its corresponding normal line. Measurement of BRs showed that the uzu line accumulates BRs, similar to known BR-insensitive mutants. The marker synteny of rice and barley chromosomes suggests that the uzu gene may be homologous to rice D61, a rice homolog of Arabidopsis BR-insensitive 1 (BRI1), encoding a BR-receptor protein. A barley homolog of BRI1, HvBRI1, was isolated by using degenerate primers. A comparison of HvBRI1 sequences in uzu and normal barley varieties showed that the uzu phenotype is correlated with a single nucleotide substitution. This substitution results in an amino acid change at a highly conserved residue in the kinase domain of the BR-receptor protein. These results may indicate that uzu dwarfism is caused by the missense mutation in HvBRI1. The uzu gene is being introduced into all hull-less barley cultivars in Japan as an effective dwarf gene for practical use, and this is the first report about an agronomically important mutation related to BRs.

  5. Temporal and spatial distribution of roots and competition for nitrogen in pea-barley intercrops - a field study employing P-32 technique

    DEFF Research Database (Denmark)

    Hauggaard-Nielsen, H.; Ambus, P.; Jensen, E.S.

    2001-01-01

    Root system dynamics, productivity and N use were studied in inter- and sole crops of field pea (Pisum sativum L.) and spring barley (Hordeum vulgare L.) on a temperate sandy loam. A P-32 tracer placed at a depth of 12.5, 37.5, 62.5 or 87.5 cm was employed to determine root system dynamics...... by sampling crop leaves at 0, 15, 30 and 45 cm lateral distance. N-15 addition was used to estimate N-2 fixation by pea, using sole cropped barley as reference crop. The Land Equivalent Ratio (LER), which is defined as the relative land area under sole crops that is required to produce the yields achieved...... in intercropping, were used to compare the crop growth in intercrops relative to the respective sole crops. The P-32 appearance in leaves revealed that the barley root system grows faster than that of pea. P uptake by the barley root system during early growth stages was approximately 10 days ahead...

  6. PTK1, a mitogen-activated-protein kinase gene, is required for conidiation, appressorium formation, and pathogenicity of Pyrenophora teres on barley.

    Science.gov (United States)

    Ruiz-Roldán, M C; Maier, F J; Schäfer, W

    2001-02-01

    Mitogen-activated protein kinases (MAPKs) are a group of protein kinases that execute a wide variety of roles in cellular signal transduction pathways such as osmoregulation, cell wall biosynthesis, growth, and differentiation. A polymerase chain reaction (PCR) with degenerate primers based on conserved regions of known MAPKs was used to clone the MAPK gene PTK1 from the leaf pathogen Pyrenophora teres (anamorph Drechslera teres), the causal agent of net blotch of barley (Hordeum vulgare L.). The predicted amino acid sequence shows high homology with MAPKs from other phytopathogenic fungi. The gene is present in the genome as a single copy. PTK1 is expressed during in vitro growth on complete medium, under conidiation-inducing conditions and during infection of barley leaves, as shown by reverse transcription-PCR studies. In order to assess the role of PTK1 in the life cycle of P. teres, targeted gene disruption was conducted. Mutants carrying an interrupted copy of the gene were deficient in conidiation, did not form appressoria on glass surfaces or on barley leaves, lost their ability to infect barley leaves, and could not colonize host tissues following artificial wounding.

  7. Isolation and purification of a papain inhibitor from Egyptian genotypes of barley seeds and its in vitro and in vivo effects on the cowpea bruchid, Callosobruchus maculatus (F.).

    Science.gov (United States)

    Abd El-Latif, Ashraf Oukasha

    2015-02-01

    The cysteine inhibitors that are known as cystatin have been identified and characterized from several plant species. In the current study, 44 barley (Hordeum vulgare) genotypes including 3 varieties and 41 promising lines were screened for their potential as protease inhibitors. The barley genotypes showed low inhibitory activity against trypsin and chymotrypsin enzymes with a mean of 4.15 TIU/mg protein and 4.40 CIU/mg protein. The barley variety, Giza 123, showed strong papain inhibitory activity of 97.09 PIU/mg proteins and was subjected for further purification studies using ammonium sulfate fractionation and DEAE-Sephadex A-25 column. Barley purified proteins showed two bands on SDS-PAGE corresponding to a molecular mass of 12.4-54.8 kDa. The purified barley PI was found to be stable at a temperature below 80 °C and at a wide range of pH from 2 to 12. Barley PI was found to have higher potential inhibitory activity against papain enzyme compared to the standard papain inhibitor, E-64 with an IC50 value of 21.04 µg/ml and 25.62 µg/ml for barley PI and E-64, respectively. The kinetic analysis revealed a non-competitive type of inhibition with a Ki value of 1.95 × 10(-3 )µM. The antimetabolic effect of barley PI was evaluated against C. maculatus by incorporating the F30-60 protein of the purified inhibitor into the artificial diet using artificial seeds. Barley PI significantly prolonged the development of C. maculatus in proportion to PI concentration. Barley PI significantly increased the mortality of C. maculatus and caused a significant reduction in its fecundity. On the other hand, barley PI seemed to have non-significant effects on the adult longevity and the adult dry weight. The in vitro and in vivo results proved the efficiency of the papain inhibitory protein isolated from barley as a tool for managing the cowpea bruchid, C. maculatus.

  8. Transfer of N and P from intact or decomposing roots of pea to barley interconnected by an arbuscular mycorrhizal fungus

    DEFF Research Database (Denmark)

    Johansen, A.; Jensen, E.S.

    1996-01-01

    The role of arbuscular mycorrhizas in the transfer of N and P between pea (Pisum sativum L.) and barley (Hordeum vulgare L.) plants was studied in a controlled environment. The plants were grown together in PVC containers, either in symbiosis with Glomus intraradices Schenck and Smith or as non......-mycorrhizal controls, and with their root systems separated by an intermediate buffer zone (2 cm), confined by fine nylon mesh. The pea donor plants were supplied simultaneously with N-15 and P-32, using a split-root labelling technique, in order to follow the flow of N and P to the barley receiver plants during 60 d...... of growth. In half of the containers, the donor-plant shoot was removed 42 d after the start of labelling and the roots were left in the soil to decompose. The reverse transfer of N and P, from barley donor to pea receiver plants was also measured to allow calculation of the net transfer through hyphae...

  9. Purification, enzymatic characterization, and nucleotide sequence of a high-isoelectric-point alpha-glucosidase from barley malt

    DEFF Research Database (Denmark)

    Frandsen, T P; Lok, F; Mirgorodskaya, E;

    2000-01-01

    High-isoelectric-point (pI) alpha-glucosidase was purified 7, 300-fold from an extract of barley (Hordeum vulgare) malt by ammonium sulfate fractionation, ion-exchange, and butyl-Sepharose chromatography. The enzyme had high activity toward maltose (k(cat) = 25 s(-1)), with an optimum at pH 4...... in the transition state complex. Mass spectrometry of tryptic fragments assigned the 92-kD protein to a barley cDNA (GenBank accession no. U22450) that appears to encode an alpha-glucosidase. A corresponding sequence (HvAgl97; GenBank accession no. AF118226) was isolated from a genomic phage library using a c......DNA fragment from a barley cDNA library. HvAgl97 encodes a putative 96.6-kD protein of 879 amino acids with 93.8% identity to the protein deduced from U22450. The sequence contains two active site motifs of glycoside hydrolase family 31. Three introns of 86 to 4,286 bp interrupt the coding region. The four...

  10. Cell layer-specific distribution of transiently expressed barley ESCRT-III component HvVPS60 in developing barley endosperm.

    Science.gov (United States)

    Hilscher, Julia; Kapusi, Eszter; Stoger, Eva; Ibl, Verena

    2016-01-01

    The significance of the endosomal sorting complexes required for transport (ESCRT)-III in cereal endosperm has been shown by the identification of the recessive mutant supernumerary aleurone layer1 (SAL1) in maize. ESCRT-III is indispensable in the final membrane fission step during biogenesis of multivesicular bodies (MVBs), responsible for protein sorting to vacuoles and to the cell surface. Here, we annotated barley ESCRT-III members in the (model) crop Hordeum vulgare and show that all identified members are expressed in developing barley endosperm. We used fluorescently tagged core ESCRT-III members HvSNF7a/CHMP4 and HvVPS24/CHMP3 and the associated ESCRT-III component HvVPS60a/CHMP5 for transient localization studies in barley endosperm. In vivo confocal microscopic analyses show that the localization of recombinantly expressed HvSNF7a, HvVPS24 and HvVPS60a differs within barley endosperm. Whereas HvSNF7a induces large agglomerations, HvVPS24 shows mainly cytosolic localization in aleurone and subaleurone. In contrast, HvVPS60a localizes strongly at the plasma membrane in aleurone. In subaleurone, HvVPS60a was found to a lesser extent at the plasma membrane and at vacuolar membranes. These results indicate that the steady-state association of ESCRT-III may be influenced by cell layer-specific protein deposition or trafficking and remodelling of the endomembrane system in endosperm. We show that sorting of an artificially mono-ubiquitinated Arabidopsis plasma membrane protein is inhibited by HvVPS60a in aleurone. The involvement of HvVPS60a in different cell layer-specific trafficking pathways, reflected by localization of HvVPS60a at the plasma membrane in aleurone and at the PSV membrane in subaleurone, is discussed.

  11. Differentially expressed genes between drought-tolerant and drought-sensitive barley genotypes in response to drought stress during the reproductive stage

    Science.gov (United States)

    Guo, Peiguo; Baum, Michael; Grando, Stefania; Ceccarelli, Salvatore; Bai, Guihua; Li, Ronghua; von Korff, Maria; Varshney, Rajeev K.; Graner, Andreas; Valkoun, Jan

    2009-01-01

    Drought tolerance is a key trait for increasing and stabilizing barley productivity in dry areas worldwide. Identification of the genes responsible for drought tolerance in barley (Hordeum vulgare L.) will facilitate understanding of the molecular mechanisms of drought tolerance, and also facilitate the genetic improvement of barley through marker-assisted selection or gene transformation. To monitor the changes in gene expression at the transcriptional level in barley leaves during the reproductive stage under drought conditions, the 22K Affymetrix Barley 1 microarray was used to screen two drought-tolerant barley genotypes, Martin and Hordeum spontaneum 41-1 (HS41-1), and one drought-sensitive genotype Moroc9-75. Seventeen genes were expressed exclusively in the two drought-tolerant genotypes under drought stress, and their encoded proteins may play significant roles in enhancing drought tolerance through controlling stomatal closure via carbon metabolism (NADP malic enzyme, NADP-ME, and pyruvate dehydrogenase, PDH), synthesizing the osmoprotectant glycine-betaine (C-4 sterol methyl oxidase, CSMO), generating protectants against reactive-oxygen-species scavenging (aldehyde dehydrogenase,ALDH, ascorbate-dependent oxidoreductase, ADOR), and stabilizing membranes and proteins (heat-shock protein 17.8, HSP17.8, and dehydrin 3, DHN3). Moreover, 17 genes were abundantly expressed in Martin and HS41-1 compared with Moroc9-75 under both drought and control conditions. These genes were possibly constitutively expressed in drought-tolerant genotypes. Among them, seven known annotated genes might enhance drought tolerance through signalling [such as calcium-dependent protein kinase (CDPK) and membrane steroid binding protein (MSBP)], anti-senescence (G2 pea dark accumulated protein, GDA2), and detoxification (glutathione S-transferase, GST) pathways. In addition, 18 genes, including those encoding Δl-pyrroline-5-carboxylate synthetase (P5CS), protein phosphatase 2C

  12. Glutathione S-transferase (GST) family in barley: identification of members, enzyme activity, and gene expression pattern.

    Science.gov (United States)

    Rezaei, Mohammad Kazem; Shobbar, Zahra-Sadat; Shahbazi, Maryam; Abedini, Raha; Zare, Sajjad

    2013-09-15

    Barley (Hordeum vulgare) is one of the most important cereals in many developing countries where drought stress considerably diminishes agricultural production. Glutathione S-transferases (GSTs EC 2.5.1.18) are multifunctional enzymes which play a crucial role in cellular detoxification and oxidative stress tolerance. In this study, 84 GST genes were identified in barley by a comprehensive in silico approach. Sequence alignment and phylogenetic analysis grouped these HvGST proteins in eight classes. The largest numbers of the HvGST genes (50) were included in the Tau class followed by 21 genes in Phi, five in Zeta, two in DHAR, two in EF1G, two in Lambda, and one each in TCHQD and Theta classes. Phylogenetic analysis of the putative GSTs from Arabidopsis, rice, and barley indicated that major functional diversification within the GST family predated the monocot/dicot divergence. However, intra-specious duplication seems to be common. Expression patterns of five GST genes from Phi and Tau classes were investigated in three barley genotypes (Yusof [drought-tolerant], Moroc9-75 [drought-sensitive], and HS1 [wild ecotype]) under control and drought-stressed conditions, during the vegetative stage. All investigated genes were up-regulated significantly under drought stress and/or showed a higher level of transcripts in the tolerant cultivar. Additionally, GST enzyme activity was superior in Yusof and induced in the extreme-drought-treated leaves, while it was not changed in Moroc9-75 under drought conditions. Moreover, the lowest and highest levels of lipid peroxidation were observed in the Yusof and Moroc9-75 cultivars, respectively. Based on the achieved results, detoxification and antioxidant activity of GSTs might be considered an important factor in the drought tolerance of barley genotypes for further investigations.

  13. The barley anion channel, HvALMT1, has multiple roles in guard cell physiology and grain metabolism.

    Science.gov (United States)

    Xu, Muyun; Gruber, Benjamin D; Delhaize, Emmanuel; White, Rosemary G; James, Richard A; You, Jiangfeng; Yang, Zhenming; Ryan, Peter R

    2015-01-01

    The barley (Hordeum vulgare) gene HvALMT1 encodes an anion channel in guard cells and in certain root tissues indicating that it may perform multiple roles. The protein localizes to the plasma membrane and facilitates malate efflux from cells when constitutively expressed in barley plants and Xenopus oocytes. This study investigated the function of HvALMT1 further by identifying its tissue-specific expression and by generating and characterizing RNAi lines with reduced HvALMT1 expression. We show that transgenic plants with 18-30% of wild-type HvALMT1 expression had impaired guard cell function. They maintained higher stomatal conductance in low light intensity and lost water more rapidly from excised leaves than the null segregant control plants. Tissue-specific expression of HvALMT1 was investigated in developing grain and during germination using transgenic barley lines expressing the green fluorescent protein (GFP) with the HvALMT1 promoter. We found that HvALMT1 is expressed in the nucellar projection, the aleurone layer and the scutellum of developing barley grain. Malate release measured from isolated aleurone layers prepared from imbibed grain was significantly lower in the RNAi barley plants compared with control plants. These data provide molecular and physiological evidence that HvALMT1 functions in guard cells, in grain development and during germination. We propose that HvALMT1 releases malate and perhaps other anions from guard cells to promote stomatal closure. The likely roles of HvALMT1 during seed development and grain germination are also discussed.

  14. Improving drought and salinity tolerance in barley by application of salicylic acid and potassium nitrate

    Directory of Open Access Journals (Sweden)

    Khalaf Ali Fayez

    2014-01-01

    Full Text Available Growth and physiological activities of barley (Hordeum vulgare L. cv. Gustoe grown in soil cultures were evaluated to recognize the ameliorative role of salicylic acid (SA and KNO3 against the negative effects of salt and water deficit stresses. Barley plants were subjected to three levels of NaCl (50, 100 and 150 mM, three levels of water stress (80%, 70% and 50% of the soil water content (SWC and the combination of 150 mM NaCl + 50 μM SA, 150 mM NaCl + 10 mM KNO3, 50% SWC + 50 μM SA and 50% SWC + 10 mM KNO3 for two weeks. Salt and water deficit stresses reduced the shoot growth, leaf photosynthetic pigments, K+ contents and provoked oxidative stress in leaves confirmed by considerable changes in soluble carbohydrate, proline, malondialdehyde (MDA, total phenolic compounds, antioxidant activity and Na+ contents. Leaf soluble protein of salt and water deficit treated plants was unaffected. The Na+/K+ ratio increased with increasing salt and water deficit treated plants. Application of 50 μM SA or 10 mM KNO3 to150 mM NaCl and/or 50% SWC treated plants improved these attributes under salt and water stresses. Soluble carbohydrates in stressed plants may have a significant role in osmotic adjustment. It can be concluded that the addition of SA or KNO3 can ameliorate the oxidative stress in barley stressed plants. This ameliorative effect might be maintained through low MDA contents and decreased Na+/K+ ratio in leaves. This study also provided evidence for the ability of barley cultivation in salt and water deficit soils due to its capacity for osmotic adjustment.

  15. Molecular identification based on coat protein sequences of the Barley yellow dwarf virus from Brazil

    Directory of Open Access Journals (Sweden)

    Talita Bernardon Mar

    2013-12-01

    Full Text Available Yellow dwarf disease, one of the most important diseases of cereal crops worldwide, is caused by virus species belonging to the Luteoviridae family. Forty-two virus isolates obtained from oat (Avena sativa L., wheat (Triticum aestivum L., barley (Hordeum vulgare L., corn (Zea mays L., and ryegrass (Lolium multiflorum Lam. collected between 2007 and 2008 from winter cereal crop regions in southern Brazil were screened by polymerase chain reaction (PCR with primers designed on ORF 3 (coat protein - CP for the presence of Barley yellow dwarf virus and Cereal yellow dwarf virus (B/CYDV. PCR products of expected size (~357 bp for subgroup II and (~831 bp for subgroup I were obtained for three and 39 samples, respectively. These products were cloned and sequenced. The subgroup II 3' partial CP amino acid deduced sequences were identified as BYDV-RMV (92 - 93 % of identity with "Illinois" Z14123 isolate. The complete CP amino acid deduced sequences of subgroup I isolates were confirmed as BYDV-PAV (94 - 99 % of identity and established a very homogeneous group (identity higher than 99 %. These results support the prevalence of BYDV-PAV in southern Brazil as previously diagnosed by Enzyme-Linked Immunosorbent Assay (ELISA and suggest that this population is very homogeneous. To our knowledge, this is the first report of BYDV-RMV in Brazil and the first genetic diversity study on B/CYDV in South America.

  16. Evaluation of Chlorophyll Content and Fluorescence Parameters as Indicators of Drought Tolerance in Barley

    Institute of Scientific and Technical Information of China (English)

    LI Rong-hua; GUO Pei-guo; Michael Baum; Stefania Grando; Salvatore Ceccarelli

    2006-01-01

    Drought is a major abiotic stress that severely affects food production worldwide. Agronomic and physiological traits associated with drought tolerance are suitable indicators for selection of drought tolerance genotypes to reduce the impact of water deficit on crop yield in breeding program. The objective of this study was to identify indicators related to drought tolerance through analysis of photosynthetic traits in barley (Hordeum vulgare L.). These traits included chlorophyll content, initial fluorescence (Fo), maximum primary yield of photochemistry of pho tosystem Ⅱ (Fv / Fo) and maximum quantum yield of photosystem Ⅱ (Fv/Fm). Four genotypes (Tadmor, Arta, Morocco9-75 and WI2291) variable in drought tolerance were used to investigate the correlation between these traits and drought tolerance. The results reflected that all of these traits were affected negatively in the four genotypes at different levels of post-anthesis drought stress, but the decrease in drought tolerant genotypes was much less than that of drought sensitive genotypes. The results further revealed that the components of the photosynthetic apparatus could be damaged significantly in drought sensitive genotypes, while drought tolerant genotypes were relatively less affected. On the other hand, the values of chlorophyll content, Fo, Fv/Fo and Fv/Fm in drought tolerance genotypes were significantly higher than those in drought sensitive genotypes under drought stress. It was concluded that chlorophyll content, Fo, Fv / Fo and Fv / Fm could be considered as reliable indicators in screening barley germplasm for drought tolerance.

  17. Cloning and characterization of a gibberellin-induced RNase expressed in barley aleurone cells

    Energy Technology Data Exchange (ETDEWEB)

    Rogers, S.W.; Rogers, J.C. (Washington State Univ., Pullman, WA (United States). Inst. of Biological Chemistry)

    1999-04-01

    The authors cloned a cDNA for a gibberellin-induced ribonuclease (RNase) expressed in barley (Hordeum vulgare) aleurone and the gene for a second barley RNase expressed in leaf tissue. The protein encoded by the cDNA is unique among RNases described to date in that it contains a novel 23-amino acid insert between the C2 and C3 conserved sequences. Expression of the recombinant protein in tobacco (Ncotiana tabacum) suspension-cultured protoplasts gave an active RNase of the expected size, confirming the enzymatic activity of the protein. Analyses of hormone regulation of re-expression of mRNA for the aleurone RNase revealed that, like the pattern for [alpha]-amylase, mRNA levels increased in the presence of gibberellic acid, and its antagonist abscisic acid prevented this effect. Quantitative studies at early times demonstrated that cycloheximide treatment of aleurone layers increased mRNA levels 4-fold, whereas a combination of gibberellin plus cycloheximide treatment was required to increase [alpha]-amylase mRNA levels to the same extent. These results are consistent with loss of repression as an initial effect of gibberellic acid on transcription of those genes, although the regulatory pathways for the two genes may differ.

  18. Temperature-Induced Protein Conformational Changes in Barley Root Plasma Membrane-Enriched Microsomes

    Science.gov (United States)

    Caldwell, Charles R.

    1987-01-01

    The membrane-bound proteins of barley (Hordeum vulgare L. cv Conquest) root plasma membrane-enriched microsomes displayed fluorescence typical of protein-associated trytophan residues. The protein fluorescence intensity was sensitive to variations in sample temperature. The temperature-induced decline in protein fluorescence intensity was nonlinear with slope discontinuities at about 12 and 32°C. Detergents at levels above their critical micelle concentration enhanced protein fluorescence. Glutaraldehyde reduced protein fluorescence. Protein fluorescence polarization increased at temperatures above 30°C. Both the rate of tryptophan photoionization and the fluorescence intensity of the photoionization products suggested alterations in membrane protein conformation between 12 and 32°C. The quenching of the intrinsic protein fluorescence by acrylamide and potassium iodide indicated changes in accessibility of the extrinsic agents to the protein tryptophan residues beginning at about 14°C. The results indicate thermally induced changes in the dynamics of the membrane proteins over the temperature range of 12 to 32°C which could account for the complex temperature dependence of the barley root plasma membrane ATPase. PMID:16665545

  19. Biochemical similarities between soluble and membrane-bound calcium-dependent protein kinases of barley

    Energy Technology Data Exchange (ETDEWEB)

    Klimczak, L.J.; Hind, G. (Brookhaven National Laboratory, Upton, NY (USA))

    1990-04-01

    The soluble and membrane-bound forms of the calcium-dependent protein kinase from barley leaves (Hordeum vulgare L. cv. Borsoy) have been partially purified and compared. Both forms showed an active polypeptide of 37 kilodaltons on activity gels with incorporated histone as substrate. They eluted from chromatofocusing columns at an identical isoelectric point of pH 4.25 {plus minus} 0.2, and also comigrated on several other chromatographic affinity media including Matrex Gel Blue A, histone-agarose, phenyl-Sepharose, and heparin-agarose. Both activities comigrated with chicken ovalbumin during gel filtration through Sephacryl S-200, indicating a native molecular mass of 45 kilodaltons. The activities share a number of enzymatic properties including salt and pH dependence, free calcium stimulation profile, substrate specificity, and Km values. The soluble activity was shown to bind to artificial lipid vesicles. These data suggest strongly that the soluble and membrane-bound calcium-dependent protein kinases from barley are very closely related or even identical.

  20. Carbon and nitrogen metabolism in barley plants exposed to UV-B radiation

    Energy Technology Data Exchange (ETDEWEB)

    Ghisi, R.; Trentin, A.R.; Masi, A.; Ferretti, M. [Dipartimento di Biotecnologie Agrarie, Legnaro, Padova (Italy)

    2002-10-01

    The effect of UV-B radiation on FW, leaf and stem length, photosynthetic O{sub 2} evolution, levels of carbohydrates and nitrates, and extractable activities of some of the enzymes involved in C and N metabolism was evaluated in barley (Hordeum vulgare L. cv. Express) seedlings during the 9 days following transfer to an UV-B enriched environment. The results show that under our experimental conditions UV-B radiation scarcely affects the photosynthetic competence of barley leaves, expressed as RuBP carboxylase (EC 4.1.1.39) activity, O{sub 2} evolution rate and chlorophyll content. Nevertheless, this treatment induced significant alterations of the enzyme activity of nitrate reductase (EC 1.6.6.1) and glutamine synthetase (EC 6.3.1.2), although only after a few days of treatment. The effects were not confined to the exposed tissue, but were detectable also at the root level. In fact, nitrate reductase decreased in response to UV-B in both leaf and root tissue, whereas glutamine synthetase was affected only in the root. In contrast, nitrate content was not influenced by the treatment, neither in root nor in leaf tissue, whilst leaf sucrose diminished in exposed plants only on the last day of treatment. (au)

  1. Molecular and phenotypic characterization of transgenic wheat and sorghum events expressing the barley alanine aminotransferase.

    Science.gov (United States)

    Peña, Pamela A; Quach, Truyen; Sato, Shirley; Ge, Zhengxiang; Nersesian, Natalya; Dweikat, Ismail M; Soundararajan, Madhavan; Clemente, Tom

    2017-08-11

    The expression of a barley alanine aminotransferase gene impacts agronomic outcomes in a C3 crop, wheat. The use of nitrogen-based fertilizers has become one of the major agronomic inputs in crop production systems. Strategies to enhance nitrogen assimilation and flux in planta are being pursued through the introduction of novel genetic alleles. Here an Agrobacterium-mediated approach was employed to introduce the alanine aminotransferase from barley (Hordeum vulgare), HvAlaAT, into wheat (Triticum aestivum) and sorghum (Sorghum bicolor), regulated by either constitutive or root preferred promoter elements. Plants harboring the transgenic HvAlaAT alleles displayed increased alanine aminotransferase (alt) activity. The enhanced alt activity impacted height, tillering and significantly boosted vegetative biomass relative to controls in wheat evaluated under hydroponic conditions, where the phenotypic outcome across these parameters varied relative to time of year study was conducted. Constitutive expression of HvAlaAT translated to elevation in wheat grain yield under field conditions. In sorghum, expression of HvAlaAT enhanced enzymatic activity, but no changes in phenotypic outcomes were observed. Taken together these results suggest that positive agronomic outcomes can be achieved through enhanced alt activity in a C3 crop, wheat. However, the variability observed across experiments under greenhouse conditions implies the phenotypic outcomes imparted by the HvAlaAT allele in wheat may be impacted by environment.

  2. Evidence for osmotic regulation of hydrolytic enzyme production in germinating barley seeds.

    Science.gov (United States)

    Jones, R L; Armstrong, J E

    1971-08-01

    alpha-Amylase levels in intact seeds of barley (Hordeum vulgare L. cv. Himalaya) reach a maximum at 3 to 4 days of germination while gibberellin levels continue to increase beyond 6 days of germination. In contrast to its effect on half seeds, gibberellic acid does not increase the total amount of alpha-amylase produced in germinating seeds. The inability of gibberellic acid to stimulate alpha-amylase production is not related to its availability; rather, evidence suggests that a factor(s) in whole seeds prevents further enhancement of alpha-amylase formation and accumulation. Hydrolysis products accumulate in the subaleurone space of the endosperm of germinating seeds up to concentrations of 570 milliosmolar. Chromatography of these hydrolysis products indicate the presence of maltose and glucose. Calculations based on reducing sugar determinations show that glucose accounts for as much as 57% of the solutes present in the endosperm fluid. Both maltose and glucose in the range of 0.2 to 0.4 M effectively inhibit the production of alpha-amylase by isolated barley aleurone layers. This inhibition is quantitatively similar to that brought about by solutions of polyethylene glycol and mannitol. On the basis of these data we propose that hydrolysis products which accumulate in the starchy endosperm of germinating seeds function to regulate the production of hydrolytic enzymes by the aleurone layer.

  3. Proteome analysis of grain filling and seed maturation in barley.

    Science.gov (United States)

    Finnie, Christine; Melchior, Sabrina; Roepstorff, Peter; Svensson, Birte

    2002-07-01

    In monocotyledonous plants, the process of seed development involves the deposition of reserves in the starchy endosperm and development of the embryo and aleurone layer. The final stages of seed development are accompanied by an increase in desiccation tolerance and drying out of the mature seed. We have used two-dimensional gel electrophoresis for a time-resolved study of the changes in proteins that occur during seed development in barley (Hordeum vulgare). About 1,000 low-salt extractable protein spots could be resolved on the two-dimensional gels. Protein spots were divided into six categories according to the timing of appearance or disappearance during the 5-week period of comparison. Nineteen different proteins or protein fragments in 36 selected spots were identified by matrix-assisted laser-desorption ionization time of flight mass spectrometry (MS) or nano-electrospray tandem MS/MS. Some proteins were present throughout development (for example, cytosolic malate dehydrogenase), whereas others were associated with the early grain filling (ascorbate peroxidase) or desiccation (Cor14b) stages. Most noticeably, the development process is characterized by an accumulation of low-M(r) alpha-amylase/trypsin inhibitors, serine protease inhibitors, and enzymes involved in protection against oxidative stress. We present examples of proteins not previously experimentally observed, differential extractability of thiol-bound proteins, and possible allele-specific spot variation. Our results both confirm and expand on knowledge gained from previous analyses of individual proteins involved in grain filling and maturation.

  4. Effectiveness of rabbit manure biofertilizer in barley crop yield.

    Science.gov (United States)

    Islas-Valdez, Samira; Lucho-Constantino, Carlos A; Beltrán-Hernández, Rosa I; Gómez-Mercado, René; Vázquez-Rodríguez, Gabriela A; Herrera, Juan M; Jiménez-González, Angélica

    2015-11-07

    The quality of biofertilizers is usually assessed only in terms of the amount of nutrients that they supply to the crops and their lack of viable pathogens and phytotoxicity. The goal of this study was to determine the effectiveness of a liquid biofertilizer obtained from rabbit manure in terms of presence of pathogens, phytotoxicity, and its effect on the grain yield and other agronomic traits of barley (Hordeum vulgare L.). Environmental effects of the biofertilizer were also evaluated by following its influence on selected soil parameters. We applied the biofertilizer at five combinations of doses and timings each and in two application modes (foliar or direct soil application) within a randomized complete block design with three replicates and using a chemical fertilizer as control. The agronomic traits evaluated were plant height, root length, dry weight, and number of leaves and stems at three growth stages: tillering, jointing, and flowering. The effectiveness of the biofertilizer was significantly modified by the mode of application, the growth stage of the crop, and the dose of biofertilizer applied. The results showed that the foliar application of the biofertilizer at the tillering stage produced the highest increase in grain yield (59.7 %, p biofertilizer caused significant changes in soil, particularly concerning pH, EC, Ca, Zn, Mg, and Mn. It is our view that the production and use of biofertilizers are a reliable alternative to deal with a solid waste problem while food security is increased.

  5. A chemometric approach to determine the phenolic compounds in different barley samples by two different stationary phases: a comparison between C18 and pentafluorophenyl core shell columns.

    Science.gov (United States)

    Gómez-Caravaca, Ana María; Verardo, Vito; Berardinelli, Annachiara; Marconi, Emanuele; Caboni, Maria Fiorenza

    2014-08-15

    Barley (Hordeum vulgare L.) is a cereal crop that has been cultivated since ancient times. However, its interest as nutritional food and as food ingredient is relatively new. Thus, in this study, the phenolic compounds of eighteen different varieties of barley (4 waxy and 14 non-waxy) grown under the same agronomic conditions in the same experimental field have been determined by HPLC-DAD-MS. Two new methodologies were developed using new generation superficially porous HPLC columns with different stationary phases: C18 and pentafluorophenyl (PFP). Twelve free phenolic compounds and eight bound phenolic compounds could be identified in barley samples in less than 22min. The study of different method parameters showed that C18 column was more suitable for the analysis of phenolic compounds of barley. Hierarchical cluster analysis (HCA) was conducted in order to assess the different ability of the two different core shell HPLC columns in the discrimination between "waxy" and "non-waxy" varieties, and only HCA of C18 column could separate waxy and non-waxy genotypes. Significant differences in the content of phenolic compounds between waxy and non-waxy samples were found, being waxy barley samples the ones which presented higher content of free and bound phenolic compounds. Once the best discriminant HPLC column was established, principal component analysis (PCA) was applied and it was able to discriminate between "waxy" and "non-waxy" varieties; however it discriminated the barley samples based only in free phenolic compounds. Because of that, partial least squares discriminant analysis (PLS-DA) and Artificial Neural Networks (ANN) were carried out. PLS-DA and ANN permitted the classification of waxy and non-waxy genotypes from both free and bound phenolic compounds.

  6. Genetic similarity of Brazilian hull-less and malting barley varieties evaluated by RAPD markers Similaridade genética de variedades brasileiras de cevada nua e cevada cervejeira avaliada por marcadores RAPD

    Directory of Open Access Journals (Sweden)

    Mariela Aparecida Kroth

    2005-01-01

    Full Text Available Barley (Hordeum vulgare L. is widely used for brewing and animal feed. Recently, it has become desirable for human consumption due to its high nutritional significance, specially hull-less or naked barley. There are differences in nutritional and malting characteristics among barley varieties. RAPD procedure is able to separate barley varieties at various similarity levels. The aim of this work was the RAPD analysis of six Brazilian hull-less varieties and seven malting varieties. PCR reactions were performed with eleven random primers. A total of 34 RAPD fragments was obtained with five primers. A dendrogram was constructed based on the Jaccard similarity coefficient. Barley varieties displayed an average similarity coefficient of 0.53. Intravarietal monomorphic fragments allowed differentiation among varieties. The averages of intravarietal similarity coefficients ranged from 0.53 to 0.85. RAPD markers, detected in this work, were suitable for differentiation among Brazilian barley varieties.A cevada (Hordeum vulgare L. é amplamente empregada na produção de cerveja e na ração animal. Recentemente, este cereal tornou-se desejável na alimentação humana devido ao seu alto valor nutricional, principalmente da cevada nua ou sem casca. Existem diferenças nas características nutricionais e para malteação entre as diversas variedades de cevada. O procedimento RAPD é capaz de separar as variedades de cevada em vários níveis de similaridade. O objetivo desse trabalho foi analisar por RAPD seis variedades brasileiras de cevada nua e sete variedades de cevada cervejeira. Reações de PCR foram realizadas com onze iniciadores aleatórios. Um total de 34 fragmentos de amplificação foi obtido com cinco destes iniciadores. Baseado no coeficiente de similaridade de Jaccard, um dendrograma foi construído. As variedades de cevada apresentaram índice médio de similaridade de 0,53. Fragmentos monomórficos intravariedades permitiram a

  7. 锌肥对不同基因型大麦吸收积累镉的影响%Effect of zinc fertilization on cadmium uptake and accumulation in two barley (Hordeum vulgare) cultivars

    Institute of Scientific and Technical Information of China (English)

    朱永官

    2003-01-01

    对土壤添加不同Zn、Cd条件下两种基因型(Sahara和 Clipper)大麦对Zn、Cd的吸收积累研究表明,在本实验条件下土壤添加Zn、Cd对植物地上部生物量没有显著影响,但土壤添加Zn抑制植物根系生长.在土壤不缺Zn情况下添加Zn<20 mg*kg-1时并没有对大麦体内Cd浓度产生显著影响;当土壤Zn添加量达到40 mg*kg-1时,植物体内Cd浓度明显降低.植物吸收Cd的总量随着土壤添加Zn的增加而显著下降,这主要是由于根系生物量的下降所致.两个基因型大麦品种Zn效率存在显著差异,但这一差异对植物吸收Cd的总量没有影响.Zn高效品种Sahara根部Cd浓度显著低于Clipper.

  8. Assessment of CH4 and N2O fluxes in a Danish Beech (Fagus sylvatica) forest and an adjacent N-fertilised barley (Hordeum vulgare)

    DEFF Research Database (Denmark)

    Ambus, P.; Jensen, J.M.; Prieme, A.

    2001-01-01

    emissions immediately following soil applications of digested sewage sludge. Cumulated values for CH4 emissions over the course of 328 days after sludge applications indicated a small net source in sludge treated plots (7.6 mg C m(-2)) whereas sludge-free soil constituted a small sink (-0.9 mg C m(-2...... and independent of drainage status. Methane oxidation was observed all-year round in the forest cumulating to -225 mg C m(-2) and -84 mg C m(-2) in dry and wet areas. In a model experiment with incubated soil cores, nitrogen amendment (NH4Cl) and perturbation significantly reduced CH4 oxidation in the forest soil......, presumably as a result of increased nitrification activity. Sludge also induced net CH4 production in the otherwise strong CH4 oxidising forest soil. This emphasises the potential for CH4 emissions from sewage sludge applications onto land. The study shows, however, that emissions of N2O and CH4 induced...

  9. Influence of NaCl-Induced Salinity and Cd Toxicity on Respiration Activity and Cd Availability to Barley Plants in Farmyard Manure-Amended Soil

    Directory of Open Access Journals (Sweden)

    Adel R. A. Usman

    2015-01-01

    Full Text Available The objective of this study was to evaluate the Cd availability and toxicity as affected by NaCl-induced salinity and farmyard manure addition. The Cd availability and toxicity were investigated in greenhouse pot and incubation experiments were conducted on a calcareous loamy sand soil contaminated with Cd (0.5, 1.5, 3, 6, 12, and 24 mg kg−1 of soil and amended with two rates of 0.0 and 30 g farmyard manure (FYM kg−1. Barley seeds (Hordeum vulgare L. were sown in pots and irrigated with water containing different levels of salinity (0, 30, 60, and 120 mM NaCl. The results revealed that the DTPA-extractable Cd and its content in barley plant shoots tended to increase in line as Cd was applied and salt levels increased. Elevated decreases in the soil basal respiration with increased Cd applied and NaCl-induced salinity were found. However, applying FYM significantly reduced Cd availability and increased plant growth and soil respiration activity. The results clearly showed that adding farmyard manure as soil organic amendment decreased the availability of Cd to barley plants and mitigated the toxicity of both Cd and salinity to soil microbial activity.

  10. Technical note: Differences in the diurnal pattern of soil respiration under adjacent Miscanthus × giganteus and barley crops reveal potential flaws in accepted sampling strategies

    Science.gov (United States)

    Ben Keane, J.; Ineson, Phil

    2017-03-01

    For convenience, measurements used to compare soil respiration (Rs) from different land uses, crops or management practices are often made between 09:00 and 16:00 UTC, convenience which is justified by an implicit assumption that Rs is largely controlled by temperature. Three months of continuous data presented here show distinctly different diurnal patterns of Rs between barley (Hordeum vulgare) and Miscanthus × giganteus (Miscanthus) grown on adjacent fields. Maximum Rs in barley occurred during the afternoon and correlated with soil temperature, whereas in Miscanthus after an initial early evening decline, Rs increased above the daily average during the night and in July maximum daily rates of Rs were seen at 22:00 and was significantly correlated with earlier levels of solar radiation, probably due to delays in translocation of recent photosynthate. Since the time of the daily mean Rs in Miscanthus occurred when Rs in the barley was 40 % greater than the daily mean, it is vital to select appropriate times to measure Rs especially if only single daily measurements are to be made.

  11. De novo 454 sequencing of barcoded BAC pools for comprehensive gene survey and genome analysis in the complex genome of barley

    Directory of Open Access Journals (Sweden)

    Scholz Uwe

    2009-11-01

    Full Text Available Abstract Background De novo sequencing the entire genome of a large complex plant genome like the one of barley (Hordeum vulgare L. is a major challenge both in terms of experimental feasibility and costs. The emergence and breathtaking progress of next generation sequencing technologies has put this goal into focus and a clone based strategy combined with the 454/Roche technology is conceivable. Results To test the feasibility, we sequenced 91 barcoded, pooled, gene containing barley BACs using the GS FLX platform and assembled the sequences under iterative change of parameters. The BAC assemblies were characterized by N50 of ~50 kb (N80 ~31 kb, N90 ~21 kb and a Q40 of 94%. For ~80% of the clones, the best assemblies consisted of less than 10 contigs at 24-fold mean sequence coverage. Moreover we show that gene containing regions seem to assemble completely and uninterrupted thus making the approach suitable for detecting complete and positionally anchored genes. By comparing the assemblies of four clones to their complete reference sequences generated by the Sanger method, we evaluated the distribution, quality and representativeness of the 454 sequences as well as the consistency and reliability of the assemblies. Conclusion The described multiplex 454 sequencing of barcoded BACs leads to sequence consensi highly representative for the clones. Assemblies are correct for the majority of contigs. Though the resolution of complex repetitive structures requires additional experimental efforts, our approach paves the way for a clone based strategy of sequencing the barley genome.

  12. Development of a monoclonal antibody-based enzyme-linked immunosorbent assay to quantify soluble beta-glucans in oats and barley.

    Science.gov (United States)

    Rampitsch, Christof; Ames, Nancy; Storsley, Joanne; Marien, Lindsay

    2003-09-24

    A set of 31 murine monoclonal antibodies was produced against (1-->3,1-->4)beta-d-glucan from oats (Avena sativa L.) chemically cross-linked to keyhole limpet hemocyanin. Monoclonal antibodies were tested for their cross-reactivity to related and unrelated polysaccharides. The antibodies reacted strongly to unmodified beta-glucan from oats and barley (Hordeum vulgare L.) and to lichenan from Icelandic moss, a polysaccharide with a structure similar to that of beta-glucan but which is not encountered in cereals. Cross-reaction to other polysaccharides tested was minimal at physiological levels. An enzyme-linked immunosorbent assay (ELISA) that could routinely detect and quantify nanogram levels of soluble beta-glucan extracted from the flour of oats or barley was designed with one of these monoclonal antibodies. The beta-glucan extraction procedure from ground oat and barley samples and the ELISA were both optimized for reproducibility, accuracy, and throughput, and results were compared to values obtained from an established, commercially available enzyme-based assay. Correlations between the two assays were consistently high (r (2) > 0.9), indicating that the ELISA presented in this paper is a valuable alternative for assaying beta-glucan levels in cereals and cereal products, both routinely and in preparations in which beta-glucans are present in nanogram amounts. Development of the extraction procedure for ELISA is discussed.

  13. Meat bone meal as fertiliser for barley and oat

    Directory of Open Access Journals (Sweden)

    L. CHEN

    2008-12-01

    Full Text Available The traditional production of mineral N and P fertilisers is unsustainable due its reliance on fossil fuels in the case of N, and on limited mineral resource stocks in the case of P. The use of alternative or complementary fertilisers that originate from organic waste materials is gaining interest. Organic farms, especially arable organic farms without livestock, need usable sources of plant nutrients. Meat bone meal (MBM, a potential organic fertiliser for agricultural crops, contains considerable amounts of nutrients (on average 8% N, 5% P, 1% K and 10% Ca. In EU countries, Commission regulation (EC No 181/2006 authorised the use of MBM as an organic fertiliser. In this study, MBM was compared to conventional mineral NPK fertiliser. Two randomised complete block split-plot field experiments were conducted: one with spring barley (Hordeum vulgare in two years; and another with oat (Avena sativa for three years, including a fourth year of testing for residual effect. Compared to mineral fertiliser (20% N, 3% P and 9% K, MBM was applied at three N levels: 60, 90 and 120 kg N ha-1. The grain yield of both cereal species supported by MBM, did not differ from the yield obtained with the mineral fertiliser at any N level. At 120 kg N ha-1, the grain yield level with either type was ca. 4500 kg ha-1 of barley and 5000 kg ha-1 of oat, representing fair averages for Finnish conditions. Moreover, MBM and mineral fertilisation showed no differences in quality in terms of 1000-grain weight, test-weight, protein content and protein yield. Since MBM has a low N/P ratio, P was applied in surplus to attain comparable N levels. Therefore MBM fertilisation should be fitted for crop rotation and for meeting environmental requirements.;

  14. The role of alpha-glucosidase in germinating barley grains.

    Science.gov (United States)

    Stanley, Duncan; Rejzek, Martin; Naested, Henrik; Smedley, Mark; Otero, Sofía; Fahy, Brendan; Thorpe, Frazer; Nash, Robert J; Harwood, Wendy; Svensson, Birte; Denyer, Kay; Field, Robert A; Smith, Alison M

    2011-02-01

    The importance of α-glucosidase in the endosperm starch metabolism of barley (Hordeum vulgare) seedlings is poorly understood. The enzyme converts maltose to glucose (Glc), but in vitro studies indicate that it can also attack starch granules. To discover its role in vivo, we took complementary chemical-genetic and reverse-genetic approaches. We identified iminosugar inhibitors of a recombinant form of an α-glucosidase previously discovered in barley endosperm (ALPHA-GLUCOSIDASE97 [HvAGL97]), and applied four of them to germinating grains. All four decreased the Glc-to-maltose ratio in the endosperm 10 d after imbibition, implying inhibition of maltase activity. Three of the four inhibitors also reduced starch degradation and seedling growth, but the fourth did not affect these parameters. Inhibition of starch degradation was apparently not due to inhibition of amylases. Inhibition of seedling growth was primarily a direct effect of the inhibitors on roots and coleoptiles rather than an indirect effect of the inhibition of endosperm metabolism. It may reflect inhibition of glycoprotein-processing glucosidases in these organs. In transgenic seedlings carrying an RNA interference silencing cassette for HvAgl97, α-glucosidase activity was reduced by up to 50%. There was a large decrease in the Glc-to-maltose ratio in these lines but no effect on starch degradation or seedling growth. Our results suggest that the α-glucosidase HvAGL97 is the major endosperm enzyme catalyzing the conversion of maltose to Glc but is not required for starch degradation. However, the effects of three glucosidase inhibitors on starch degradation in the endosperm indicate the existence of unidentified glucosidase(s) required for this process.

  15. Two loci on chromosome 5H determine low-temperature tolerance in a 'Nure' (winter) x 'Tremois' (spring) barley map.

    Science.gov (United States)

    Francia, E; Rizza, F; Cattivelli, L; Stanca, A M; Galiba, G; Tóth, B; Hayes, P M; Skinner, J S; Pecchioni, N

    2004-02-01

    Barley ( Hordeum vulgare subsp. vulgare) is an economically important diploid model for the Triticeae; and a better understanding of low-temperature tolerance mechanisms could significantly improve the yield of fall-sown cereals. We developed a new resource for genetic analysis of winter hardiness-related traits, the 'Nure' x 'Tremois' linkage map, based on a doubled-haploid population that is segregating for low-temperature tolerance and vernalization requirement. Three measures of low-temperature tolerance and one measure of vernalization requirement were used and, for all traits, QTLs were mapped on chromosome 5H. The vernalization response QTL coincides with previous reports at the Vrn-1/Fr1 region of the Triticeae. We also found coincident QTLs at this position for all measures of low-temperature tolerance. Using Composite Interval Mapping, a second proximal set, of coincident QTLs for low-temperature tolerance, and the accumulation of two different COR proteins (COR14b and TMC-Ap3) was identified. The HvCBF4 locus, or another member of the CBF loci clustered in this region, is the candidate gene underlying this QTL. There is a CRT/DRE recognition site in the promoter of cor14b with which a CBF protein could interact. These results support the hypothesis that highly conserved regulatory factors, such as members of the CBF gene family, may regulate the stress responses of a wide range of plant species.

  16. Morphology and AFLP markers suggest three Hordeum chilense ecotypes that differ in avoidance to rust fungi

    NARCIS (Netherlands)

    Vaz Patto, M.C.; Aardse, A.; Buntjer, J.; Rubiales, D.; Martin, A.; Niks, R.E.

    2001-01-01

    In Hordeum chilense Roem. & Schult., a high variation in the level of avoidance to infection of barley leaf rust (Puccinia hordei Otth) occurs. Probably resulting from the properties of the stomata, the rust germ tube overgrows stomata, and the infection process fails in an early stage. In the prese

  17. Abscisic acid flux alterations result in differential abscisic acid signaling responses and impact assimilation efficiency in barley under terminal drought stress.

    Science.gov (United States)

    Seiler, Christiane; Harshavardhan, Vokkaliga T; Reddy, Palakolanu S; Hensel, Götz; Kumlehn, Jochen; Eschen-Lippold, Lennart; Rajesh, Kalladan; Korzun, Viktor; Wobus, Ulrich; Lee, Justin; Selvaraj, Gopalan; Sreenivasulu, Nese

    2014-04-01

    Abscisic acid (ABA) is a central player in plant responses to drought stress. How variable levels of ABA under short-term versus long-term drought stress impact assimilation and growth in crops is unclear. We addressed this through comparative analysis, using two elite breeding lines of barley (Hordeum vulgare) that show senescence or stay-green phenotype under terminal drought stress and by making use of transgenic barley lines that express Arabidopsis (Arabidopsis thaliana) 9-cis-epoxycarotenoid dioxygenase (AtNCED6) coding sequence or an RNA interference (RNAi) sequence of ABA 8'-hydroxylase under the control of a drought-inducible barley promoter. The high levels of ABA and its catabolites in the senescing breeding line under long-term stress were detrimental for assimilate productivity, whereas these levels were not perturbed in the stay-green type that performed better. In transgenic barley, drought-inducible AtNCED expression afforded temporal control in ABA levels such that the ABA levels rose sooner than in wild-type plants but also subsided, unlike as in the wild type , to near-basal levels upon prolonged stress treatment due to down-regulation of endogenous HvNCED genes. Suppressing of ABA catabolism with the RNA interference approach of ABA 8'-hydroxylase caused ABA flux during the entire period of stress. These transgenic plants performed better than the wild type under stress to maintain a favorable instantaneous water use efficiency and better assimilation. Gene expression analysis, protein structural modeling, and protein-protein interaction analyses of the members of the PYRABACTIN RESISTANCE1/PYRABACTIN RESISTANCE1-LIKE/REGULATORY COMPONENT OF ABA RECEPTORS, TYPE 2C PROTEIN PHOSPHATASE Sucrose non-fermenting1-related protein kinase2, and ABA-INSENSITIVE5/ABA-responsive element binding factor family identified specific members that could potentially impact ABA metabolism and stress adaptation in barley.

  18. The CELLULOSE-SYNTHASE LIKE C (CSLC) Family of Barley Includes Members that Are Integral Membrane Proteins Targeted to the Plasma Membrane

    Institute of Scientific and Technical Information of China (English)

    Fenny M. Dwivany; Dina Yuli; Rachel A. Burton; Neil J. Shirley; Sarah M. Wilson; Geoffrey B. Fincher; Antony Bacic; Ed Newbigin; Monika S. Doblin

    2009-01-01

    The CELLULOSESYNTHASE-LIKE C(CSLC) family is an ancient lineage within the CELLULOSE SYNTHASE/CEL-LULOSE SYNTHASE-LIKE (CESA/CSL) polysaccharide synthase superfamily that is thought to have arisen before the diver-gence of mosses and vascular plants. As studies in the flowering plant Arabidopsis have suggested synthesis of the (1,4)-β-glucan backbone of xyloglucan (XyG), a wall polysaccharide that tethers adjacent cellulose microfibrils to each other, as a probable function for the CSLCs, CSLC function was investigated in barley (Hordeum vulgare L.), a species with low amounts of XyG in its walls. Four barley CSLC genes were identified (designated HvCSLC1-4). Phylogenetic analysis reveals three well supported clades of CSLCs in flowering plants, with barley having representatives in two of these clades. The four barley CSLCs were expressed in various tissues, with in situ PCR detecting transcripts in all cell types of the coleoptile and root, including cells with primary and secondary cell walls. Co-expression analysis showed that HvCSLC3 was coor-dinately expressed with putative XyG xylosyltransferase genes. Both immuno-EM and membrane fractionation showed that HvCSLC2 was located in the plasma membrane of barley suspension-cultured cells and was not in internal membranes such as endoplasmic reticulum or Golgi apparatus. Based on our current knowledge of the sub-cellular locations of poly-saccharide synthesis, we conclude that the CSLC family probably contains more than one type of polysaccharide synthase.

  19. Characterization of the entire cystatin gene family in barley and their target cathepsin L-like cysteine-proteases, partners in the hordein mobilization during seed germination.

    Science.gov (United States)

    Martinez, Manuel; Cambra, Ines; Carrillo, Laura; Diaz-Mendoza, Mercedes; Diaz, Isabel

    2009-11-01

    Plant cystatins are inhibitors of cysteine-proteases of the papain C1A and legumain C13 families. Cystatin data from multiple plant species have suggested that these inhibitors act as defense proteins against pests and pathogens and as regulators of protein turnover. In this study, we characterize the entire cystatin gene family from barley (Hordeum vulgare), which contain 13 nonredundant genes, and identify and characterize their target enzymes, the barley cathepsin L-like proteases. Cystatins and proteases were expressed and purified from Escherichia coli cultures. Each cystatin was found to have different inhibitory capability against barley cysteine-proteases in in vitro inhibitory assays using specific substrates. Real-time reverse transcription-polymerase chain reaction revealed that inhibitors and enzymes present a wide variation in their messenger RNA expression patterns. Their transcripts were mainly detected in developing and germinating seeds, and some of them were also expressed in leaves and roots. Subcellular localization of cystatins and cathepsin L-like proteases fused to green fluorescent protein demonstrated the presence of both protein families throughout the endoplasmic reticulum and the Golgi complex. Proteases and cystatins not only colocalized but also interacted in vivo in the plant cell, as revealed by bimolecular fluorescence complementation. The functional relationship between cystatins and cathepsin L-like proteases was inferred from their common implication as counterparts of mobilization of storage proteins upon barley seed germination. The opposite pattern of transcription expression in gibberellin-treated aleurones presented by inhibitors and enzymes allowed proteases to specifically degrade B, C, and D hordeins stored in the endosperm of barley seeds.

  20. The Hydrogen Sulfide Donor NaHS Delays Programmed Cell Death in Barley Aleurone Layers by Acting as an Antioxidant.

    Science.gov (United States)

    Zhang, Ying-Xin; Hu, Kang-Di; Lv, Kai; Li, Yan-Hong; Hu, Lan-Ying; Zhang, Xi-Qi; Ruan, Long; Liu, Yong-Sheng; Zhang, Hua

    2015-01-01

    H2S is a signaling molecule in plants and animals. Here we investigated the effects of H2S on programmed cell death (PCD) in barley (Hordeum vulgare L.) aleurone layers. The H2S donor NaHS significantly delayed PCD in aleurone layers isolated from imbibed embryoless barley grain. NaHS at 0.25 mM effectively reduced the accumulation of superoxide anion (·O2 (-)), hydrogen peroxide (H2O2), and malondialdehyde (MDA), promoted the activity of superoxide dismutase (SOD), guaiacol peroxidase (POD), catalase (CAT), and ascorbate peroxidase (APX), and decreased those of lipoxygenase (LOX) in isolated aleurone layers. Quantitative-PCR showed that NaHS treatment of aleurone tissue led to enhanced transcript levels of the antioxidant genes HvSOD1, HvAPX, HvCAT1, and HvCAT2 and repressed transcript levels of HvLOX (lipoxygenase gene) and of two cysteine protease genes HvEPA and HvCP3-31. NaHS treatment in gibberellic acid- (GA-) treated aleurone layers also delayed the PCD process, reduced the content of ·O2 (-), and increased POD activity while decreasing LOX activity. Furthermore, α-amylase secretion in barley aleurone layers was enhanced by NaHS treatment regardless of the presence or absence of GA. These data imply that H2S acted as an antioxidant in delaying PCD and enhances α-amylase secretion regardless of the presence of GA in barley aleurone layers.

  1. The Hydrogen Sulfide Donor NaHS Delays Programmed Cell Death in Barley Aleurone Layers by Acting as an Antioxidant

    Directory of Open Access Journals (Sweden)

    Ying-Xin Zhang

    2015-01-01

    Full Text Available H2S is a signaling molecule in plants and animals. Here we investigated the effects of H2S on programmed cell death (PCD in barley (Hordeum vulgare L. aleurone layers. The H2S donor NaHS significantly delayed PCD in aleurone layers isolated from imbibed embryoless barley grain. NaHS at 0.25 mM effectively reduced the accumulation of superoxide anion (·O2-, hydrogen peroxide (H2O2, and malondialdehyde (MDA, promoted the activity of superoxide dismutase (SOD, guaiacol peroxidase (POD, catalase (CAT, and ascorbate peroxidase (APX, and decreased those of lipoxygenase (LOX in isolated aleurone layers. Quantitative-PCR showed that NaHS treatment of aleurone tissue led to enhanced transcript levels of the antioxidant genes HvSOD1, HvAPX, HvCAT1, and HvCAT2 and repressed transcript levels of HvLOX (lipoxygenase gene and of two cysteine protease genes HvEPA and HvCP3-31. NaHS treatment in gibberellic acid- (GA- treated aleurone layers also delayed the PCD process, reduced the content of ·O2-, and increased POD activity while decreasing LOX activity. Furthermore, α-amylase secretion in barley aleurone layers was enhanced by NaHS treatment regardless of the presence or absence of GA. These data imply that H2S acted as an antioxidant in delaying PCD and enhances α-amylase secretion regardless of the presence of GA in barley aleurone layers.

  2. Increased Abundance of Proteins Involved in Phytosiderophore Production in Boron-Tolerant Barley1[C][W

    Science.gov (United States)

    Patterson, John; Ford, Kris; Cassin, Andrew; Natera, Siria; Bacic, Antony

    2007-01-01

    Boron (B) phytotoxicity affects cereal-growing regions worldwide. Although B-tolerant barley (Hordeum vulgare) germplasm is available, molecules responsible for this tolerance mechanism have not been defined. We describe and use a new comparative proteomic technique, iTRAQ peptide tagging (iTRAQ), to compare the abundances of proteins from B-tolerant and -intolerant barley plants from a ‘Clipper’ × ‘Sahara’ doubled-haploid population selected on the basis of a presence or absence of two B-tolerance quantitative trait loci. iTRAQ was used to identify three enzymes involved in siderophore production (Iron Deficiency Sensitive2 [IDS2], IDS3, and a methylthio-ribose kinase) as being elevated in abundance in the B-tolerant plants. Following from this result, we report a potential link between iron, B, and the siderophore hydroxymugineic acid. We believe that this study highlights the potency of the iTRAQ approach to better understand mechanisms of abiotic stress tolerance in cereals, particularly when applied in conjunction with bulked segregant analysis. PMID:17478636

  3. Temperature-Induced Protein Conformational Changes in Barley Root Plasma Membrane-Enriched Microsomes: II. Intrinsic Protein Fluorescence.

    Science.gov (United States)

    Caldwell, C R

    1987-07-01

    The membrane-bound proteins of barley (Hordeum vulgare L. cv Conquest) root plasma membrane-enriched microsomes displayed fluorescence typical of protein-associated trytophan residues. The protein fluorescence intensity was sensitive to variations in sample temperature. The temperature-induced decline in protein fluorescence intensity was nonlinear with slope discontinuities at about 12 and 32 degrees C. Detergents at levels above their critical micelle concentration enhanced protein fluorescence. Glutaraldehyde reduced protein fluorescence. Protein fluorescence polarization increased at temperatures above 30 degrees C. Both the rate of tryptophan photoionization and the fluorescence intensity of the photoionization products suggested alterations in membrane protein conformation between 12 and 32 degrees C. The quenching of the intrinsic protein fluorescence by acrylamide and potassium iodide indicated changes in accessibility of the extrinsic agents to the protein tryptophan residues beginning at about 14 degrees C. The results indicate thermally induced changes in the dynamics of the membrane proteins over the temperature range of 12 to 32 degrees C which could account for the complex temperature dependence of the barley root plasma membrane ATPase.

  4. Kþ retention in leaf mesophyll, an overlooked component of salinity tolerance mechanism:A case study for barley

    Institute of Scientific and Technical Information of China (English)

    Sergey Shabala

    2015-01-01

    Plant salinity tolerance is a physiological y complex trait, with numerous mechanisms contributing to it. In this work, we show that the ability of leaf mesophyl to retain Kþ represents an important and essential y overlooked component of a salinity tolerance mechanism. The strong positive correlation between mesophyl Kþ retention ability under saline conditions (quantified by the magnitude of NaCl‐induced Kþ efflux from mesophyl ) and the overal salinity tolerance (relative fresh weight and/or survival or damage under salinity stress) was found while screening 46 barley (Hordeum vulgare L.) genotypes contrasting in their salinity tolerance. Genotypes with intrinsical y higher leaf Kþ content under control conditions were found to possess better Kþ retention ability under salinity and, hence, overal higher tolerance. Contrary to previous reports for barley roots, Kþ retention in mesophyl was not associated with an increased Hþ‐pumping in tolerant varieties but instead correlated negatively with this trait. These findings are explained by the fact that increased Hþ extrusion may be needed to charge balance the activity and provide the driving force for the high affinity HAK/KUP Kþ transporters required to restore cytosolic Kþ homeostasis in salt‐sensitive genotypes.

  5. Differential Compartmentation of Gibberellin A1 and Its Metabolites in Vacuoles of Cowpea and Barley Leaves 1

    Science.gov (United States)

    Garcia-Martinez, Jose L.; Ohlrogge, John B.; Rappaport, Lawrence

    1981-01-01

    The metabolism and efflux of gibberellin A1 (GA1) taken up by leaves of cowpea (Vigna sinensis cv. Blackeye pea No. 5), as well as the distribution of GA1 metabolites in the protoplasts and vacuoles of cowpea and barley (Hordeum vulgare L. cv. Numar), were studied. GA1 is metabolized rapidly in cowpea leaf discs to products tentatively identified as gibberellin A8 (GA8) and gibberellin A8 glucoside (GA8-glu). After labeling leaf discs with [3H]GA1 for 1 hour, the release of radioactivity from the leaf was followed. Over a 12-hour period, the level of radioisotope in the tissue declined to about 35% of the original, after which no further release was observed. At this time, almost all of the radioactivity remaining in the leaf was GA8-glu, while most of the radioactivity which had been released was unmetabolized GA1. Mesophyll protoplasts and vacuoles were isolated from cowpea and barley leaves previously fed [3H]GA1. These protoplasts retain the ability to metabolize GA1, indicating that neither the leaf structure nor the cell wall is necessary for this metabolism. A higher proportion of GA8-glu was found in the vacuoles relative to the entire protoplasts. The results obtained suggest that GA1 metabolites are preferentially compartmentalized in the vacuoles relative to GA1. PMID:16662014

  6. Mixture toxicity and interactions of copper, nickel, cadmium, and zinc to barley at low effect levels: Something from nothing?

    Science.gov (United States)

    Versieren, Liske; Evers, Steffie; De Schamphelaere, Karel; Blust, Ronny; Smolders, Erik

    2016-10-01

    Metal contamination is mostly a mixture of different metals, and these multicomponent mixtures can produce significant mixture effects. The present study was set up to investigate the toxicity of multiple metal mixtures of Cu, Ni, Cd, and Zn to plants at metal doses individually causing low-level phytotoxic effects. Barley (Hordeum vulgare L.) root elongation toxicity tests were performed in resin-buffered nutrient solutions to control metal speciation. Treatments included single-metal concentrations and binary, ternary, and quaternary mixtures. Mixtures of different metals at free ion concentrations, each causing <10% inhibition of root elongation, yielded significant mixture effects, with inhibition reaching up to 50%. The independent action (IA) model predicted mixture toxicity statistically better than the concentration addition (CA) model, but some synergisms relative to the IA model were observed. These synergisms relative to IA were most pronounced in quaternary mixtures and when the dose-response curves had steep slopes. Generally, antagonistic interactions relative to the CA model were observed. Increasing solution Zn concentrations shifted metal interactions (CA based) from additive or slightly synergistic at background Zn concentrations to antagonistic at higher Zn concentrations, suggesting a protective effect of Zn. Overall, the present study shows that the CA model can be used as a conservative model to predict metal mixture toxicity to barley. Environ Toxicol Chem 2016;35:2483-2492. © 2016 SETAC.

  7. Suppression of the barley uroporphyrinogen III synthase gene by a Ds activation tagging element generates developmental photosensitivity.

    Science.gov (United States)

    Ayliffe, Michael A; Agostino, Anthony; Clarke, Bryan C; Furbank, Robert; von Caemmerer, Susanne; Pryor, Anthony J

    2009-03-01

    Chlorophyll production involves the synthesis of photoreactive intermediates that, when in excess, are toxic due to the production of reactive oxygen species (ROS). A novel, activation-tagged barley (Hordeum vulgare) mutant is described that results from antisense suppression of a uroporphyrinogen III synthase (Uros) gene, the product of which catalyzes the sixth step in the synthesis of chlorophyll and heme. In homozygous mutant plants, uroporphyrin(ogen) I accumulates by spontaneous cyclization of hydroxyl methylbilane, the substrate of Uros. Accumulation of this tetrapyrrole intermediate results in photosensitive cell death due to the production of ROS. The efficiency of Uros gene suppression is developmentally regulated, being most effective in mature seedling leaves compared with newly emergent leaves. Reduced transcript accumulation of a number of nuclear-encoded photosynthesis genes occurs in the mutant, even under 3% light conditions, consistent with a retrograde plastid-nuclear signaling mechanism arising from Uros gene suppression. A similar set of nuclear genes was repressed in wild-type barley following treatment with a singlet oxygen-generating herbicide, but not by a superoxide generating herbicide, suggesting that the retrograde signaling apparent in the mutant is specific to singlet oxygen.

  8. Short communication. Plant density effect on the individual plant to plant yield variability expressed as coefficient of variation in barley

    Energy Technology Data Exchange (ETDEWEB)

    Kotzamanidis, S. T.; Lithourgidis, A. S.; Roupakias, D. G.

    2009-07-01

    The effect of plant density on the coefficient of variation (CV) for individual plant yield was studied in barley (Hordeum vulgare L.). An F2 population originating from the cross Niki x Carina was planted in three densities: high (51.32 plants m{sup -}2), intermediate (4.61 plants m{sup -}2), and low (1.15 plants m-2) using the honeycomb design. In each of the experiments, the most promising 15 plants were selected based on the individual plant yield. Progeny (F3) of the 30 plants selected from the intermediate and the low plant density were grown the following year in two experiments under an intermediate and low density. It was observed that in the F2 population the CV was reduced from 71 to 55% when the density reduced from 51.32 to 4.61 plants m{sup -}2, whereas the CV value was increased when the density was further reduced to 1.15 plants m{sup -}2. Similarly, the following year the CV was increased from 39 to 56% when the density was decreased from 4.61 to 1.15 plants m{sup -}2 in the F3 generation, and from 22 to 58% in the control. It was concluded that for barley an optimum plant density might exist under which the CV for individual plant yield is minimized and therefore the effectiveness of selection might be optimized. (Author)18 refs.

  9. ABA pretreatment can alter the distribution of polysomes in salt-stressed barley sprouts

    Directory of Open Access Journals (Sweden)

    Szypulska Ewa

    2016-12-01

    Full Text Available The study analyzed caryopses of barley (Hordeum vulgare cv. Stratus. Caryopses were germinated in darkness at 20°C in three experimental setups: (a in distilled water for 24 hours, followed by 100 mM NaCl for another 24 hours (salinity stress, SS, (b in 100 μM of abscisic acid for the first 24 hours, followed by rinsing with distilled water to remove residual ABA, and in 100 mM NaCl for another 24 hours (ABA pretreatment + salinity stress, ABAS, (c in distilled water only (control, C. Changes in the content of free polysomes (FP, membrane-bound polysomes (MBP, cytoskeleton-bound polysomes (CBP and cytomatrix-bound polysomes (CMBP were examined in barley sprouts germinated in SS and ABAS treatments for 48 hours. In salt-stressed barley sprouts, the concentrations of membrane-bound and cytoskeleton-bound polysomes (MBP, CBP and CMBP decreased significantly, whereas an increase was noted only in the free polysome (FP fraction. ABA pretreatment altered the distribution of polysomes in stressed plants. The content of cytoskeletonbound polysomes (CBP and CMBP increased, FP levels decreased, whereas no changes in MBP content were observed in response to ABA treatment. Our results suggest that plants respond to salt stress by increasing the concentrations of free polysomes that are probably released from damaged cell structures, mainly membranes. Our present and previous findings indicate that ABA could inhibit the release of FP in stressed plants by enhancing polysome binding to the cytoskeleton.

  10. Vulgar Music and Technology

    Science.gov (United States)

    Stivers, Richard

    2007-01-01

    Rock music, rap, and heavy metal are all forms of vulgar music. Vulgarity refers to actions and communication that are "common, noisy, and gross," and are "untranscendent." A technological society is a vulgar society in its base of materialism and exclusive concern with power. Its excessive rationality produces a need for escape, for ecstasy, for…

  11. Dryland malt barley yield and quality affected by tillage, cropping sequence, and nitrogen fertilization

    Science.gov (United States)

    Information is needed on the effects of management practices on dryland malt barley (Hordeum vulgaris L.) and pea (Pisum sativum L.) yields and quality. We evaluated the effects of tillage and cropping sequence combination and N fertilization on dryland malt barley and pea yields, grain characterist...

  12. Caryopsis Dormancy Patterns of Wild Barley(Hordeum spontaneum)and Its Association with Agronomic Traits and Ecogeographical Parameters%野生二棱大麦种子休眠型态与农艺性状及生态地理因素相关性研究

    Institute of Scientific and Technical Information of China (English)

    严俊; 王莹; NEVO Eviatar; GUTTERMAN Yitzchak; 程剑平

    2011-01-01

    对来自以色列不同地区16个生态型野生二棱大麦种子的休眠型态与其农艺性状及起源地生态地里因素的相关性进行了研究.结果表明:高温(40℃)储藏可以打破种子的休眠;16个生态型种子在高温处理下的萌发率表现出显著差异,其休眠打破过程显示出不同型态的对数生长曲线:8个旱生生态型为S型,而8个湿生生态型为倒L型.休眠深度用实际达到最大萌发率的时间度量,最低休眠深度(15.6 d)是来自湿润地区"进化峡谷"的生态型 37-N,而最深休眠深度(103.1 d)是来自干旱地区Ein-Zukim(死海附近)的生态型32-6.此外,对11个物候及农艺性状指标与休眠深度做斯皮尔曼秩相关分析,结果有9个显示出显著相关,尤其是粒重与休眠深度有极显著相关性.同时,休眠深度与起源地15个生态地理因素中的9个有显著相关,种子休眠主要受其起源地的地理位置、温度和水分条件等影响.可见,野生二棱大麦自然选择进化了休眠特性去应对干热环境而繁衍生息.本研究结果可用于进一步遗传研究和现代栽培大麦品种的改良.%Patterns in caryopsis dormancy and its agronomic and ecogeographical associations were investigated in 16 wild barley (Hordeum spontaneum) ecotypes from different habitats in Israel.The results showed that heat treatment (40℃) could break dormancy of caryopses.Germination percentages under breaking dormancy treatments were significantly different among the 16 ecotypes.Dormancy-break patterns were fitted by logistic growth curves: all eight xeric ecotypes showed an S-shaped curve,whereas all eight mesic ecotypes displayed a reverse L-shaped curve.For depth of dormancy,as reflected by the time to maximum germination percentage,the lowest (15.6 days) was for the ecotype 37-N from the north slop of Evolution Canyon (mesic),whereas it was the highest (103.1 days) for 32-6 from Ein-Zukim (near Dead Sea) (xeric).In addition,nine of 11

  13. [Nuclear-cytoplasmic compatibility and the state of mitochondrial and chloroplast DNA regions in alloplasmic recombinant and introgressive lines (H. vulgare)-T. aestivum].

    Science.gov (United States)

    Pershina, L A; Trubacheva, N V; Sinyavskaya, M G; Devyatkina, E P; Kravtsova, L A

    2014-10-01

    Alloplasmic lines combining alien nuclear and cytoplasmic genomes are convenient models for studying the mechanisms of nuclear-cytoplasmic compatibility/incompatibility. In the.present study, we have investigated the correlation between the characters and state of mitochondrial (mt) and chloroplast (cp) DNA regions in alloplasmic recombinant common wheat lines with barley cytoplasm characterized by partial or total fertility. Fertility restoration in the studied lines (Hordeum vulgare)-Triticum aestivum is determined by different ratios of the genetic material of common wheat variety Pyrotrix 28, which is a fertility restorer in the cytoplasm of barley, and varietySaratovskaya 29, which is a fixer of sterility. In partially fertile lines with nuclear genomes dominated by the genetic material of Saratovskaya 29, plant growth and development are suppressed. In these lines we have identified the barley homoplasmy of cpDNA regions infA and rpoB and the heteroplasmy of the 18S/5S mt repeat and the cpDNA ycf5 region. Nuclear-cytoplasmic compatibility in lines with reduced fertility (the genetic material of Pyrotrix 28 predominates in their nuclear genomes) is associated with restoration of normal plant growth and development and the changes in thestate of the studied cpDNA and mtDNA regions towards the wheat type. Thus, in fertile lines, the cpDNA regions (infA, rpoB) and the 18S/5S mt repeat were identified in the homoplasmic wheat state; though the cpDNAycf5 region was in the heteroplasmic state, it was dominated by the wheat type of the copies. The nuclearicytoplasmic compatibility is not broken as a result of introgression of the alien genetic material into the nuclear genome of one of the fertile lines; the plants of introgressive lines are fertile and normally developed, and the states of the cpDNA and mtDNA regions correspond to their states in fertile recombinant lines.

  14. (52)Fe translocation in barley as monitored by a positron-emitting tracer imaging system (PETIS): evidence for the direct translocation of Fe from roots to young leaves via phloem.

    Science.gov (United States)

    Tsukamoto, Takashi; Nakanishi, Hiromi; Uchida, Hiroshi; Watanabe, Satoshi; Matsuhashi, Shinpei; Mori, Satoshi; Nishizawa, Naoko K

    2009-01-01

    The real-time translocation of iron (Fe) in barley (Hordeum vulgare L. cv. Ehimehadaka no. 1) was visualized using the positron-emitting tracer (52)Fe and a positron-emitting tracer imaging system (PETIS). PETIS allowed us to monitor Fe translocation in barley non-destructively under various conditions. In all cases, (52)Fe first accumulated at the basal part of the shoot, suggesting that this region may play an important role in Fe distribution in graminaceous plants. Fe-deficient barley showed greater translocation of (52)Fe from roots to shoots than did Fe-sufficient barley, demonstrating that Fe deficiency causes enhanced (52)Fe uptake and translocation to shoots. In the dark, translocation of (52)Fe to the youngest leaf was equivalent to or higher than that under the light condition, while the translocation of (52)Fe to the older leaves was decreased, in both Fe-deficient and Fe-sufficient barley. This suggests the possibility that the mechanism and/or pathway of Fe translocation to the youngest leaf may be different from that to the older leaves. When phloem transport in the leaf was blocked by steam treatment, (52)Fe translocation from the roots to older leaves was not affected, while (52)Fe translocation to the youngest leaf was reduced, indicating that Fe is translocated to the youngest leaf via phloem in addition to xylem. We propose a novel model in which root-absorbed Fe is translocated from the basal part of the shoots and/or roots to the youngest leaf via phloem in graminaceous plants.

  15. Characterization of the Entire Cystatin Gene Family in Barley and Their Target Cathepsin L-Like Cysteine-Proteases, Partners in the Hordein Mobilization during Seed Germination1[W

    Science.gov (United States)

    Martinez, Manuel; Cambra, Ines; Carrillo, Laura; Diaz-Mendoza, Mercedes; Diaz, Isabel

    2009-01-01

    Plant cystatins are inhibitors of cysteine-proteases of the papain C1A and legumain C13 families. Cystatin data from multiple plant species have suggested that these inhibitors act as defense proteins against pests and pathogens and as regulators of protein turnover. In this study, we characterize the entire cystatin gene family from barley (Hordeum vulgare), which contain 13 nonredundant genes, and identify and characterize their target enzymes, the barley cathepsin L-like proteases. Cystatins and proteases were expressed and purified from Escherichia coli cultures. Each cystatin was found to have different inhibitory capability against barley cysteine-proteases in in vitro inhibitory assays using specific substrates. Real-time reverse transcription-polymerase chain reaction revealed that inhibitors and enzymes present a wide variation in their messenger RNA expression patterns. Their transcripts were mainly detected in developing and germinating seeds, and some of them were also expressed in leaves and roots. Subcellular localization of cystatins and cathepsin L-like proteases fused to green fluorescent protein demonstrated the presence of both protein families throughout the endoplasmic reticulum and the Golgi complex. Proteases and cystatins not only colocalized but also interacted in vivo in the plant cell, as revealed by bimolecular fluorescence complementation. The functional relationship between cystatins and cathepsin L-like proteases was inferred from their common implication as counterparts of mobilization of storage proteins upon barley seed germination. The opposite pattern of transcription expression in gibberellin-treated aleurones presented by inhibitors and enzymes allowed proteases to specifically degrade B, C, and D hordeins stored in the endosperm of barley seeds. PMID:19759340

  16. Influence of silicon on microdistribution of mineral ions in roots of salt-stressed barley as associated with salt tolerance in plants

    Institute of Scientific and Technical Information of China (English)

    LIANG; Yongchao(梁永超); DING; Ruixing(丁瑞兴)

    2002-01-01

    Two contrasting barley (Hordeum vulgare L.) cultivars: Kepin No.7 (salt sensitive), and Jian 4 (salt tolerant) were grown hydroponically to investigate the microdistribution of mineral ions in roots as affected by silicon (Si) with respect to salt tolerance. The experiment was undertaken consisting of two treatments with 3 replicates: (i) 120 mmol@L?1 NaCl alone (referred to as Si(NaCl+), (ii) 120 mmol@L?1 NaCl + 1.0 mmol@L?1 Si (as potassium silicate) (referred to as Si+NaCl+). Plant root tips were harvested for microanalysis using an energy dispersive X-ray microanalyzer (EDX) 30 d after transplanting. Higher Cl and Na X-ray peaks were recorded in the root epidermal, cortical and stelar cells of roots for the treatment Si(NaCl+ with the majorities of Na and Cl being accumulated in epidermal and cortical cells, while relatively low K peaks were observed regardless of the barley cultivars used. By contrast, considerably higher K peaks were detected in the epidermal, cortical and stelar cells of the roots for the treatment Si+NaCl+, but lower Cl and Na peaks were also observed for this treatment with both Na and Cl ions being evenly distributed in the epidermal, cortical and stelar cells. These findings directly support our previous finding, which showed that Si depressed the uptake of sodium but enhanced the uptake of potassium by salt-stressed barley. We believe that one of the possible mechanisms involved in Si-enhancement of salt tolerance in barley is attributed to the Si-induced changes in the uptake and microdistribution of mineral ions in plants.

  17. Expression levels of barley Cbf genes at the Frost resistance-H2 locus are dependent upon alleles at Fr-H1 and Fr-H2.

    Science.gov (United States)

    Stockinger, Eric J; Skinner, Jeffrey S; Gardner, Kip G; Francia, Enrico; Pecchioni, Nicola

    2007-07-01

    Genetic analyses have identified two loci in wheat and barley that mediate the capacity to overwinter in temperate climates. One locus co-segregates with VRN-1, which affects the vernalization requirement. This locus is known as Frost resistance-1 (Fr-1). The second locus, Fr-2, is coincident with a cluster of more than 12 Cbf genes. Cbf homologs in Arabidopsis thaliana play a key regulatory role in cold acclimatization and the acquisition of freezing tolerance. Here we report that the Hordeum vulgare (barley) locus VRN-H1/Fr-H1 affects expression of multiple barley Cbf genes at Fr-H2. RNA blot analyses, conducted on a 'Nure'x'Tremois' barley mapping population segregating for VRN-H1/Fr-H1 and Fr-H2, revealed that transcript levels of all cold-induced Cbf genes at Fr-H2 were significantly higher in recombinants harboring the vrn-H1 winter allele than in recombinants harboring the Vrn-H1 spring allele. Steady-state Cbf2 and Cbf4 levels were also significantly higher in recombinants harboring the Nure allele at Fr-H2. Additional experiments indicated that, in vrn-H1 genotypes requiring vernalization, Cbf expression levels were dampened after plants were vernalized, and dampened Cbf expression was accompanied by robust expression of Vrn-1. Cbf levels were also significantly higher in plants grown under short days than under long days. Experiments in wheat and rye indicated that similar regulatory mechanisms occurred in these plants. These results suggest that VRN-H1/Fr-H1 acts in part to repress or attenuate expression of the Cbf at Fr-H2; and that the greater level of low temperature tolerance attributable to the Nure Fr-H2 allele may be due to the greater accumulation of Cbf2 and Cbf4 transcripts during normal growth and development.

  18. Conversion of deoxynivalenol to 3-acetyldeoxynivalenol in barley-derived fuel ethanol co-products with yeast expressing trichothecene 3-O-acetyltransferases

    Directory of Open Access Journals (Sweden)

    Brooks Wynse S

    2011-09-01

    Full Text Available Abstract Background The trichothecene mycotoxin deoxynivalenol (DON may be concentrated in distillers dried grains with solubles (DDGS; a co-product of fuel ethanol fermentation when grain containing DON is used to produce fuel ethanol. Even low levels of DON (≤ 5 ppm in DDGS sold as feed pose a significant threat to the health of monogastric animals. New and improved strategies to reduce DON in DDGS need to be developed and implemented to address this problem. Enzymes known as trichothecene 3-O-acetyltransferases convert DON to 3-acetyldeoxynivalenol (3ADON, and may reduce its toxicity in plants and animals. Results Two Fusarium trichothecene 3-O-acetyltransferases (FgTRI101 and FfTRI201 were cloned and expressed in yeast (Saccharomyces cerevisiae during a series of small-scale ethanol fermentations using barley (Hordeum vulgare. DON was concentrated 1.6 to 8.2 times in DDGS compared with the starting ground grain. During the fermentation process, FgTRI101 converted 9.2% to 55.3% of the DON to 3ADON, resulting in DDGS with reductions in DON and increases in 3ADON in the Virginia winter barley cultivars Eve, Thoroughbred and Price, and the experimental line VA06H-25. Analysis of barley mashes prepared from the barley line VA04B-125 showed that yeast expressing FfTRI201 were more effective at acetylating DON than those expressing FgTRI101; DON conversion for FfTRI201 ranged from 26.1% to 28.3%, whereas DON conversion for FgTRI101 ranged from 18.3% to 21.8% in VA04B-125 mashes. Ethanol yields were highest with the industrial yeast strain Ethanol Red®, which also consumed galactose when present in the mash. Conclusions This study demonstrates the potential of using yeast expressing a trichothecene 3-O-acetyltransferase to modify DON during commercial fuel ethanol fermentation.

  19. UNcleProt (Universal Nuclear Protein database of barley): The first nuclear protein database that distinguishes proteins from different phases of the cell cycle.

    Science.gov (United States)

    Blavet, Nicolas; Uřinovská, Jana; Jeřábková, Hana; Chamrád, Ivo; Vrána, Jan; Lenobel, René; Beinhauer, Jana; Šebela, Marek; Doležel, Jaroslav; Petrovská, Beáta

    2017-01-02

    Proteins are the most abundant component of the cell nucleus, where they perform a plethora of functions, including the assembly of long DNA molecules into condensed chromatin, DNA replication and repair, regulation of gene expression, synthesis of RNA molecules and their modification. Proteins are important components of nuclear bodies and are involved in the maintenance of the nuclear architecture, transport across the nuclear envelope and cell division. Given their importance, the current poor knowledge of plant nuclear proteins and their dynamics during the cell's life and division is striking. Several factors hamper the analysis of the plant nuclear proteome, but the most critical seems to be the contamination of nuclei by cytosolic material during their isolation. With the availability of an efficient protocol for the purification of plant nuclei, based on flow cytometric sorting, contamination by cytoplasmic remnants can be minimized. Moreover, flow cytometry allows the separation of nuclei in different stages of the cell cycle (G1, S, and G2). This strategy has led to the identification of large number of nuclear proteins from barley (Hordeum vulgare), thus triggering the creation of a dedicated database called UNcleProt, http://barley.gambrinus.ueb.cas.cz/ .

  20. Heterologous expression of surface-active proteins from barley and filamentous fungi in Pichia pastoris and characterization of their contribution to beer gushing.

    Science.gov (United States)

    Lutterschmid, Georg; Muranyi, Monika; Stübner, Matthias; Vogel, Rudi F; Niessen, Ludwig

    2011-05-14

    The spontaneous over-foaming of beer upon opening, i.e. beer gushing, is an unwanted phenomenon for the brewing industry. Currently, surface-active proteins from filamentous fungi and non-specific lipid transfer proteins (nsLTP1) from barley are discussed as gushing inducers. In our study the class I hydrophobin FcHyd3p from Fusarium culmorum, the class II hydrophobin Hfb2 from Trichoderma reesei, the alkaline foam protein A (AfpA) from F. graminearum and nsLTP1 from Hordeum vulgare cv. Marnie (barley) were heterologously expressed in Pichia pastoris and used in gushing tests. The class I hydrophobin FcHyd3p was unable to induce gushing in beer. The class II hydrophobin Hfb2 was able to induce gushing in beer, but proved to be inhibited by heat treatment as well as by the presence of enriched hop compounds. Both resulted in a reduced gushing potential. AfpA and nsLTP1 exhibited no gushing-inducing potential at the amounts added to beer. Addition of these proteins to beer or carbonated water previously treated with class II hydrophobins revealed a gushing reducing character.

  1. Microwave irradiation induced changes in protein molecular structures of barley grains: relationship to changes in protein chemical profile, protein subfractions, and digestion in dairy cows.

    Science.gov (United States)

    Yan, Xiaogang; Khan, Nazir A; Zhang, Fangyu; Yang, Ling; Yu, Peiqiang

    2014-07-16

    The objectives of this study were to evaluate microwave irradiation (MIR) induced changes in crude protein (CP) subfraction profiles, ruminal CP degradation characteristics and intestinal digestibility of rumen undegraded protein (RUP), and protein molecular structures in barley (Hordeum vulgare) grains. Samples from hulled (n = 1) and hulless cultivars (n = 2) of barley, harvested from four replicate plots in two consecutive years, were evaluated. The samples were either kept as raw or irradiated in a microwave for 3 min (MIR3) or 5 min (MIR5). Compared to raw grains, MIR5 decreased the contents of rapidly degradable CP subfraction (from 45.22 to 6.36% CP) and the ruminal degradation rate (from 8.16 to 3.53%/h) of potentially degradable subfraction. As a consequence, the effective ruminal degradability of CP decreased (from 55.70 to 34.08% CP) and RUP supply (from 43.31 to 65.92% CP) to the postruminal tract increased. The MIR decreased the spectral intensities of amide 1, amide II, α-helix, and β-sheet and increased their ratios. The changes in protein spectral intensities were strongly correlated with the changes in CP subfractions and digestive kinetics. These results show that MIR for a short period (5 min) with a lower energy input can improve the nutritive value and utilization of CP in barely grains.

  2. Effect of Barley β-Glucan on the Gluten Polymerization Process in Dough during Heat Treatment.

    Science.gov (United States)

    Huang, Ze-Hua; Zhao, Yang; Zhu, Ke-Xue; Guo, Xiao-Na; Peng, Wei; Zhou, Hui-Ming

    2017-07-26

    Barley (Hordeum vulgare L.) β-glucan (BBG) is of interest as a result of its health benefits, but BBG presents significant disruptions on the gluten network, with a negative impact on food texture. To clarify the interaction between BBG and gluten in dough, the dynamic rheological, thermochemical process of gluten and microstructure of dough with BBG during heating were detected. The results showed that BBG delayed the gluten thermopolymerization reaction during heating and affected polymerization of specific molecular weight protein subunits. These impacts depended upon the heating temperature and time. When heating under 25-65 °C, tan δ of the dough reached the highest level at the BBG concentration of 1%. However, under the temperature of 65-95 °C, tan δ was positively correlated with the BBG content (0-3%). The differential scanning calorimetry curves revealed that the peak temperature (TP) of the two endothermic peaks increased by 3.86 and 3.10 °C. Size-exclusion high-performance liquid chromatography analysis showed that BBG mainly affected the peak area of gliadin and glutenin. Furthermore, after 3% BBG was added, the bands of 59.8 and 64.9 kDa in sodium dodecyl sulfate-polyacrylamide gel electrophoresis patterns delayed, vanishing for 120 s when heating at 95 °C. Therefore, BBG delayed the polymerization reaction of specific molecular weight protein subunits rather than all of the proteins.

  3. Tempered mlo broad-spectrum resistance to barley powdery mildew in an Ethiopian landrace.

    Science.gov (United States)

    Ge, Xintian; Deng, Weiwei; Lee, Zheng Zhou; Lopez-Ruiz, Francisco J; Schweizer, Patrick; Ellwood, Simon R

    2016-07-12

    Recessive mutations in the Mlo gene confer broad spectrum resistance in barley (Hordeum vulgare) to powdery mildew (Blumeria graminis f. sp. hordei), a widespread and damaging disease. However, all alleles discovered to date also display deleterious pleiotropic effects, including the naturally occurring mlo-11 mutant which is widely deployed in Europe. Recessive resistance was discovered in Eth295, an Ethiopian landrace, which was developmentally controlled and quantitative without spontaneous cell wall appositions or extensive necrosis and loss of photosynthetic tissue. This resistance is determined by two copies of the mlo-11 repeat units, that occur upstream to the wild-type Mlo gene, compared to 11-12 in commonly grown cultivars and was designated mlo-11 (cnv2). mlo-11 repeat unit copy number-dependent DNA methylation corresponded with cytological and macroscopic phenotypic differences between copy number variants. Sequence data indicated mlo-11 (cnv2) formed via recombination between progenitor mlo-11 repeat units and the 3' end of an adjacent stowaway MITE containing region. mlo-11 (cnv2) is the only example of a moderated mlo variant discovered to date and may have arisen by natural selection against the deleterious effects of the progenitor mlo-11 repeat unit configuration.

  4. Transport of Arginine and Aspartic Acid into Isolated Barley Mesophyll Vacuoles 1

    Science.gov (United States)

    Martinoia, Enrico; Thume, Monika; Vogt, Esther; Rentsch, Doris; Dietz, Karl-Josef

    1991-01-01

    The transport of arginine into isolated barley (Hordeum vulgare L.) mesophyll vacuoles was investigated. In the absence of ATP, arginine uptake was saturable with a Km of 0.3 to 0.4 millimolar. Positively charged amino acids inhibited arginine uptake, lysine being most potent with a Ki of 1.2 millimolar. In the presence of free ATP, but not of its Mg-complex, uptake of arginine was drastically enhanced and a linear function of its concentration up to 16 millimolar. The nonhydrolyzable adenylyl imidodiphosphate, but no other nucleotide tested, could substitute for ATP. Therefore, it is suggested that this process does not require energy and does not involve the tonoplast ATPase. The ATP-dependent arginine uptake was strongly inhibited by p-chloromercuriphenylsulfonic acid. Furthermore, hydrophobic amino acids were inhibitory (I50 phenylalanine 1 millimolar). Similar characteristics were observed for the uptake of aspartic acid. However, rates of ATP-stimulated aspartic acid transport were 10-fold lower as compared to arginine transport. Uptake of aspartate in the absence of ATP was negligible. PMID:16668447

  5. Glyoxylate cycle and metabolism of organic acids in the scutellum of barley seeds during germination.

    Science.gov (United States)

    Ma, Zhenguo; Marsolais, Frédéric; Bernards, Mark A; Sumarah, Mark W; Bykova, Natalia V; Igamberdiev, Abir U

    2016-07-01

    During the developmental processes from dry seeds to seedling establishment, the glyoxylate cycle becomes active in the mobilization of stored oils in the scutellum of barley (Hordeum vulgare L.) seeds, as indicated by the activities of isocitrate lyase and malate synthase. The succinate produced is converted to carbohydrates via phosphoenolpyruvate carboxykinase and to amino acids via aminotransferases, while free organic acids may participate in acidifying the endosperm tissue, releasing stored starch into metabolism. The abundant organic acid in the scutellum was citrate, while malate concentration declined during the first three days of germination, and succinate concentration was low both in scutellum and endosperm. Malate was more abundant in endosperm tissue during the first three days of germination; before citrate became predominant, indicating that malate may be the main acid acidifying the endosperm. The operation of the glyoxylate cycle coincided with an increase in the ATP/ADP ratio, a buildup of H2O2 and changes in the redox state of ascorbate and glutathione. It is concluded that operation of the glyoxylate cycle in the scutellum of cereals may be important not only for conversion of fatty acids to carbohydrates, but also for the acidification of endosperm and amino acid synthesis. Copyright © 2016 Elsevier Ireland Ltd. All rights reserved.

  6. Comparative phytohormone profiles, lipid kinase and lipid phosphatase activities in barley aleurone, coleoptile, and root tissues.

    Science.gov (United States)

    Meringer, Maria V; Villasuso, Ana L; Pasquaré, Susana J; Giusto, Norma M; Machado, Estela E; Racagni, Graciela E

    2012-09-01

    We analyzed lipid kinase and lipid phosphatase activities and determined endogenous phytohormone levels by liquid chromatography-tandem mass spectrometry in root and coleoptile tissues following germination of barley (Hordeum vulgare) seeds. The enzymes showing highest activity in aleurone cells were diacylglycerol kinase (DAG-k, EC 2.7.1.107) and phosphatidate kinase (PA-k). The ratio of gibberellins (GAs) to abscisic acid (ABA) was 2-fold higher in aleurone than in coleoptile or root tissues. In coleoptiles, phosphatidylinositol 4-kinase (PI4-k, EC 2.7.1.67) showed the highest enzyme activity, and jasmonic acid (JA) level was higher than in aleurone. In roots, activities of PI4-k, DAG-k, and PA-k were similar, and salicylic acid (SA) showed the highest concentration. In the assays to evaluate the hydrolysis of DGPP (diacylglycerol pyrophosphate) and PA (phosphatidic acid) we observed that PA hydrolysis by LPPs (lipid phosphate phosphatases) was not modified; however, the diacylglycerol pyrophosphate phosphatase (DGPPase) was strikingly higher in coleoptile and root tissues than to aleurone. Relevance of these findings in terms of signaling responses and seedling growth is discussed.

  7. Heat-stable proteins and abscisic acid action in barley aleurone cells

    Energy Technology Data Exchange (ETDEWEB)

    Jacobsen, J.V. (CSIRO, Canberra (Australia)); Shaw, D.C. (Australian National Univ., Canberra (Australia))

    1989-12-01

    ({sup 35}S)Methionine labeling experiments showed that abscisic acid (ABA) induced the synthesis of at least 25 polypeptides in mature barley (Hordeum vulgare) aleurone cells. The polypeptides were not secreted. Whereas most of the proteins extracted from aleurone cells were coagulated by heating to 100{degree}C for 10 minutes, most of the ABA-induced polypeptides remained in solution (heat-stable). ABA had little effect on the spectrum of polypeptides that were synthesized and secreted by aleurone cells, and most of these secreted polypeptides were also heat-stable. Coomassie blue staining of sodium dodecyl sulfate polyacrylamide gels indicated that ABA-induced polypeptides already occurred in high amounts in mature aleurone layers having accumulated during grain development. About 60% of the total protein extracted from mature aleurone was heat stable. Amino acid analyses of total preparations of heat-stable and heat-labile proteins showed that, compared to heat-labile proteins, heat-stable intracellular proteins were characterized by higher glutamic acid/glutamine (Glx) and glycine levels and lower levels of neutral amino acids. Secreted heat-stable proteins were rich in Glx and proline. The possibilities that the accumulation of the heat-stable polypeptides during grain development is controlled by ABA and that the function of these polypeptides is related to their abundance and extraordinary heat stability are considered.

  8. Monitoring intra- and extracellular redox capacity of intact barley aleurone layers responding to phytohormones.

    Science.gov (United States)

    Mark, Christina; Zór, Kinga; Heiskanen, Arto; Dufva, Martin; Emnéus, Jenny; Finnie, Christine

    2016-12-15

    Redox regulation is important for numerous processes in plant cells including abiotic stress, pathogen defence, tissue development, seed germination and programmed cell death. However, there are few methods allowing redox homeostasis to be addressed in whole plant cells, providing insight into the intact in vivo environment. An electrochemical redox assay that applies the menadione-ferricyanide double mediator is used to assess changes in the intracellular and extracellular redox environment in living aleurone layers of barley (Hordeum vulgare cv. Himalaya) grains, which respond to the phytohormones gibberellic acid and abscisic acid. Gibberellic acid is shown to elicit a mobilisation of electrons as detected by an increase in the reducing capacity of the aleurone layers. By taking advantage of the membrane-permeable menadione/menadiol redox pair to probe the membrane-impermeable ferricyanide/ferrocyanide redox pair, the mobilisation of electrons was dissected into an intracellular and an extracellular, plasma membrane-associated component. The intracellular and extracellular increases in reducing capacity were both suppressed when the aleurone layers were incubated with abscisic acid. By probing redox levels in intact plant tissue, the method provides a complementary approach to assays of reactive oxygen species and redox-related enzyme activities in tissue extracts.

  9. Dormant barley aleurone shows heterogeneity and a specific cytodifferentiation

    NARCIS (Netherlands)

    Schuurink, R.C.; Bakhuizen, R.; Libbenga, K.R.; Boulanger, F.; Sinjorgo, K.M.C.

    1997-01-01

    In response to gibberellic acid, aleurone layers isolated from dormant barley (Hordeum distichum L. cv. Triumph) kernels produced significantly less alpha-amylase than aleurones from non-dormant kernels. Light microscopical investigations using the dye acridine orange as well as electron microscopic

  10. Over-expression of microRNA171 affects phase transitions and floral meristem determinancy in barley

    Directory of Open Access Journals (Sweden)

    Curaba Julien

    2013-01-01

    Full Text Available Abstract Background The transitions from juvenile to adult and adult to reproductive phases of growth are important stages in the life cycle of plants. The regulators of these transitions include miRNAs, in particular miR156 and miR172 which are part of a regulatory module conserved across the angiosperms. In Arabidopsis miR171 represses differentiation of axillary meristems by repressing expression of SCARECROW-LIKE(SCL transcription factors, however the role of miR171 has not been examined in other plants. Results To investigate the roles of mir171 and its target genes in a monocot, the Hvu pri-miR171a was over-expressed in barley (Hordeum vulgare L. cv. Golden promise leading to reduced expression of at least one HvSCL gene. The resulting transgenic plants displayed a pleiotropic phenotype which included branching defects, an increased number of short vegetative phytomers and late flowering. These phenotypes appear to be the consequence of changes in the organisation of the shoot meristem. In addition, the data show that miR171 over-expression alters the vegetative to reproductive phase transition by activating the miR156 pathway and repressing the expression of the TRD (THIRD OUTER GLUME and HvPLA1 (Plastochron1 genes. Conclusions Our data suggest that some of the roles of miR171 and its target genes that have been determined in Arabidopsis are conserved in barley and that they have additional functions in barley including activation of the miR156 pathway.

  11. Simulation of geospatial production changes of barley due to the impacts of climate change in South Korea

    Science.gov (United States)

    Ko, J.; Seungtaek, J.

    2016-12-01

    Determining effective measures to alleviate or adjust the changing climate for crops is a prominent issue to be delivered in the upcoming years. Impacts of global change on crops are considered to appear geographically different aspects from region to region and area to area. The objectives of this study are to apply a grid crop simulation modeling (GCSM) system for geospatial projection of the climate change impacts on barley (Hordeum vulgare) in order to determine likely current and future remedial measures using the developed simulation design for South Korea. The barley GCSM scheme was formulated using the Decision Support System for Agricultural Technology (DSSAT) crop model package version 4.6, in which crop models can be used to conduct grid data runs based on shell scripting in a Linux operating system. We used twelve years (1999-2011) climate data with a 3 km pixel resolution as the baseline climate and projected data of the specific future climate changes for the climate change scenarios of RCP4.5 and RCP8.5 according to the IPCC's fifth assessment report. Four soil layers containing different soil physical and chemical properties for the corresponding region were aggregated in order to use as the model input data as well. We will further report the current projection outcomes and discuss potential remedial measures that can be used to adjust the future impacts of climate change on barley production of South Korea. We assume that the current GCSM system could be used as a promising tool to simulate geospatial production changes of crops due to the climate change impacts and to search for likely solutions to the forthcoming food insecurity.

  12. Phosphate utilization efficiency correlates with expression of low-affinity phosphate transporters and noncoding RNA, IPS1, in barley.

    Science.gov (United States)

    Huang, Chun Y; Shirley, Neil; Genc, Yusuf; Shi, Bujun; Langridge, Peter

    2011-07-01

    Genetic variation in phosphorus (P) efficiency exists among wheat (Triticum aestivum) and barley (Hordeum vulgare) genotypes, but the underlying mechanisms for the variation remain elusive. High- and low-affinity phosphate (Pi) PHT1 transporters play an indispensable role in P acquisition and remobilization. However, little is known about genetic variation in PHT1 gene expression and association with P acquisition efficiency (PAE) and P utilization efficiency (PUE). Here, we present quantitative analyses of transcript levels of high- and low-affinity PHT1 Pi transporters in four barley genotypes differing in PAE. The results showed that there was no clear pattern in the expression of four paralogs of the high-affinity Pi transporter HvPHT1;1 among the four barley genotypes, but the expression of a low-affinity Pi transporter, HvPHT1;6, and its close homolog HvHPT1;3 was correlated with the genotypes differing in PUE. Interestingly, the expression of HvPHT1;6 and HvPHT1;3 was correlated with the expression of HvIPS1 (for P starvation inducible; noncoding RNA) but not with HvIPS2, suggesting that HvIPS1 plays a distinct role in the regulation of the low-affinity Pi transporters. In addition, high PUE was found to be associated with high root-shoot ratios in low-P conditions, indicating that high carbohydrate partitioning into roots occurs simultaneously with high PUE. However, high PUE accompanying high carbon partitioning into roots could result in low PAE. Therefore, the optimization of PUE through the modification of low-affinity Pi transporter expression may assist further improvement of PAE for low-input agriculture systems.

  13. Radioprotective effects of ascorbic acid in barley seeds

    Energy Technology Data Exchange (ETDEWEB)

    Conger, B.V.

    1975-01-01

    Experiments were conducted to test the radioprotective effects of a naturally occurring reducing agent, ascorbic acid, on seeds (caryopses) of barley, Hordeum vulgare L. emend Lam. Seeds were soaked either before or after ..gamma.. or fission neutron irradiation in distilled water or ascorbic acid solutions ranging in concentration from 0.01 to 1.00 M. Results are reported as percentage germination, seedling height, seedling growth reduction, and (in one experiment) percent of cells with chromosome aberrations. As evidenced by both reduced germination and seedling growth, ascorbic acid was toxic when seeds were soaked for 1 hr at ambient temperature prior to irradiation and then planted immediately. When seeds were soaked in ascorbic acid before irradiation and soaked after irradiation in air-bubbled water at 0/sup 0/C for 18 hr, the toxicity disappeared, and a protective effect (which increased with increasing ascorbic acid concentration) was observed for ..gamma.. and, to a lesser extent, for neutron irradiation. Additional studies suggested that the protective effect was related to reduced hydration of the embryos of seeds soaked in ascorbic acid. Also, no radioprotective effect was observed when seeds were presoaked for 2 or 16 hr in 0.01 M ascorbic acid solutions buffered at pH 3 or pH 7. A protective effect was observed for seeds of 1.5 percent water content soaked after irradiation in an oxygen-bubbled ascorbic acid solution of 0.5 M but was not observed for seeds soaked in nitrogen-bubbled ascorbic acid. The protective effect against oxygen-dependent damage may be a result of interaction of ascorbic acid with radiation-induced free radicals.

  14. Gibberellic Acid enhancement of DNA turnover in barley aleurone cells.

    Science.gov (United States)

    Taiz, L; Starks, J E

    1977-08-01

    When imbibed, deembryonated halfseeds from barley (Hordeum vulgare L., var. Himalaya) are incubated in buffer, the DNA content of the aleurone layer increases 25 to 40% over a 24-hour period. In contrast, the DNA of isolated aleurone layers declines by 20% over the same time period. Gibberellic acid (GA) causes a reduction in DNA levels in both halfseed aleurone layers and isolated aleurone layers. GA also increases the specific radioactivity of [(3)H]thymidine-labeled halfseed aleurone layer DNA during the first 12 hours of treatment. Pulse-chase studies demonstrated that the newly synthesized DNA is metabolically labile.The buoyant density on CsCl density gradients of hormone-treated aleurone DNA is identical with that of DNA extracted from whole seedlings. After density-labeling halfseed DNA with 5-bromodeoxyuridine, a bimodal absorption profile is obtained in neutral CsCl. The light band (1.70 g/ml) corresponds to unsubstituted DNA, while the heavy band (1.725-1.74 g/ml) corresponds to a hybrid density-labeled species. GA increases the relative amount of the heavy (hybrid) peak in halfseed aleurone layer DNA, further suggesting that the hormone enhances semiconservative replication in halfseeds.DNA methylation was also demonstrated. Over 60% of the radioactivity from [(3)H-Me]methionine is incorporated into 5-methylcytosine. GA has no effect on the percentage distribution of label among the bases.It was concluded that GA enhances the rate of DNA degradation and DNA synthesis (turnover) in halfseeds, but primarily DNA degradation in isolated aleurone layers. Incorporation by isolated aleurone layers is due to DNA repair. Semiconservative replication apparently plays no physiological role in the hormone response, since both isolated aleurone layers and gamma-irradiated halfseeds respond normally. The hypothesis was advanced that endoreduplication and DNA degradation are means by which the seed stores and mobilizes deoxyribonucleotides for the embryo during

  15. Functional characterisation of an intron retaining K+ transporter of barley reveals intron-mediated alternate splicing

    KAUST Repository

    Shahzad, K.

    2015-01-01

    Intron retention in transcripts and the presence of 5 and 3 splice sites within these introns mediate alternate splicing, which is widely observed in animals and plants. Here, functional characterisation of the K+ transporter, HvHKT2;1, with stably retained introns from barley (Hordeum vulgare) in yeast (Saccharomyces cerevisiae), and transcript profiling in yeast and transgenic tobacco (Nicotiana tabacum) is presented. Expression of intron-retaining HvHKT2;1 cDNA (HvHKT2;1-i) in trk1, trk2 yeast strain defective in K+ uptake restored growth in medium containing hygromycin in the presence of different concentrations of K+ and mediated hypersensitivity to Na+. HvHKT2;1-i produces multiple transcripts via alternate splicing of two regular introns and three exons in different compositions. HKT isoforms with retained introns and exon skipping variants were detected in relative expression analysis of (i) HvHKT2;1-i in barley under native conditions, (ii) in transgenic tobacco plants constitutively expressing HvHKT2;1-i, and (iii) in trk1, trk2 yeast expressing HvHKT2;1-i under control of an inducible promoter. Mixed proportions of three HKT transcripts: HvHKT2;1-e (first exon region), HvHKT2;1-i1 (first intron) and HvHKT2;1-i2 (second intron) were observed. The variation in transcript accumulation in response to changing K+ and Na+ concentrations was observed in both heterologous and plant systems. These findings suggest a link between intron-retaining transcripts and different splice variants to ion homeostasis, and their possible role in salt stress.

  16. Dispersed gold nanoparticles potentially ruin gold barley yellow dwarf virus and eliminate virus infectivity hazards

    Science.gov (United States)

    Alkubaisi, Noorah A.; Aref, Nagwa M. A.

    2017-02-01

    Gold nanoparticles (AuNPs) application melted barley yellow dwarf virus-PAV (BYDV-PAV) spherical nanoparticle capsids. Synergistic therapeutic effects for plant virus resistance were induced by interaction with binding units of prepared AuNPs in a water solution which was characterized and evaluated by zeta sizer, zeta potential and transmission electron microscopy (TEM). The yield of purified nanoparticles of BYDV-PAV was obtained from Hordeum vulgare (Barley) cultivars, local and Giza 121/Justo. It was 0.62 mg/ml from 27.30 g of infected leaves at an A260/A280 ratio. Virus nanoparticle has a spherical shape 30 nm in size by TEM. BYDV-PAV combined with AuNPs to challenge virus function in vivo and in vitro. Dual AuNPs existence in vivo and in vitro affected compacted configuration of viral capsid protein in the interior surface of capsomers, the outer surface, or between the interface of coat protein subunits for 24 and 48 h incubation period in vitro at room temperature. The sizes of AuNPs that had a potentially dramatic deteriorated effect are 3.151 and 31.67 nm with a different intensity of 75.3% for the former and 24.7% for the latter, which enhances optical sensing applications to eliminate virus infectivity. Damages of capsid protein due to AuNPs on the surface of virus subunits caused variable performance in four different types of TEM named puffed, deteriorated and decorated, ruined and vanished. Viral yield showed remarkably high-intensity degree of particle symmetry and uniformity in the local cultivar greater than in Giza 121/Justo cultivar. A high yield of ruined VLPs in the local cultivar than Justo cultivar was noticed. AuNPs indicated complete lysed VLPs and some deteriorated VLPs at 48 h.

  17. Dispersed gold nanoparticles potentially ruin gold barley yellow dwarf virus and eliminate virus infectivity hazards

    Science.gov (United States)

    Alkubaisi, Noorah A.; Aref, Nagwa M. A.

    2016-10-01

    Gold nanoparticles (AuNPs) application melted barley yellow dwarf virus-PAV (BYDV-PAV) spherical nanoparticle capsids. Synergistic therapeutic effects for plant virus resistance were induced by interaction with binding units of prepared AuNPs in a water solution which was characterized and evaluated by zeta sizer, zeta potential and transmission electron microscopy (TEM). The yield of purified nanoparticles of BYDV-PAV was obtained from Hordeum vulgare (Barley) cultivars, local and Giza 121/Justo. It was 0.62 mg/ml from 27.30 g of infected leaves at an A260/A280 ratio. Virus nanoparticle has a spherical shape 30 nm in size by TEM. BYDV-PAV combined with AuNPs to challenge virus function in vivo and in vitro. Dual AuNPs existence in vivo and in vitro affected compacted configuration of viral capsid protein in the interior surface of capsomers, the outer surface, or between the interface of coat protein subunits for 24 and 48 h incubation period in vitro at room temperature. The sizes of AuNPs that had a potentially dramatic deteriorated effect are 3.151 and 31.67 nm with a different intensity of 75.3% for the former and 24.7% for the latter, which enhances optical sensing applications to eliminate virus infectivity. Damages of capsid protein due to AuNPs on the surface of virus subunits caused variable performance in four different types of TEM named puffed, deteriorated and decorated, ruined and vanished. Viral yield showed remarkably high-intensity degree of particle symmetry and uniformity in the local cultivar greater than in Giza 121/Justo cultivar. A high yield of ruined VLPs in the local cultivar than Justo cultivar was noticed. AuNPs indicated complete lysed VLPs and some deteriorated VLPs at 48 h.

  18. Diacylglycerol pyrophosphate binds and inhibits the glyceraldehyde-3-phosphate dehydrogenase in barley aleurone.

    Science.gov (United States)

    Astorquiza, Paula Luján; Usorach, Javier; Racagni, Graciela; Villasuso, Ana Laura

    2016-04-01

    The aleurona cell is a model that allows the study of the antagonistic effect of gibberellic acid (GA) and abscisic acid (ABA). Previous results of our laboratory demonstrated the involvement of phospholipids during the response to ABA and GA. ABA modulates the levels of diacylglycerol, phosphatidic acid and diacylglycerol pyrophosphate (DAG, PA, DGPP) through the activities of phosphatidate phosphatases, phospholipase D, diacylglycerol kinase and phosphatidate kinase (PAP, PLD, DGK and PAK). PA and DGPP are key phospholipids in the response to ABA, since both are capable of modifying the hydrolitic activity of the aleurona. Nevertheless, little is known about the mechanism of action of these phospholipids during the ABA signal. DGPP is an anionic phospholipid with a pyrophosphate group attached to diacylglycerol. The ionization of the pyrophosphate group may be important to allow electrostatic interactions between DGPP and proteins. To understand how DGPP mediates cell functions in barley aleurone, we used a DGPP affinity membrane assay to isolate DGPP-binding proteins from Hordeum vulgare, followed by mass spectrometric sequencing. A cytosolic glyceraldehyde-3-phosphate dehydrogenase (GAPDH, EC 1.2.1.12) was identified for being bound to DGPP. To validate our method, the relatively abundant GAPDH was characterized with respect to its lipid-binding properties, by fat western blot. GAPDH antibody interacts with proteins that only bind to DGPP and PA. We also observed that ABA treatment increased GAPDH abundance and enzyme activity. The presence of phospholipids during GAPDH reaction modulated the GAPDH activity in ABA treated aleurone. These data suggest that DGPP binds to GAPDH and this DGPP and GAPDH interaction provides new evidences in the study of DGPP-mediated ABA responses in barley aleurone.

  19. Genetic Variation of Functional Components in Grains of Improved Barley Lines from Four Continents

    Institute of Scientific and Technical Information of China (English)

    Yawen ZENG; Xiaoying PU; Jing ZHANG; Juan DU; Ganggang GUO; Tao YANG; ChunyanZHAO; Shuming YANG; Dawei ZHAO; Junjie TANG; Ping JIA

    2012-01-01

    [Objective] The study was to analyze functional components in improved barley grains. [Method] Genetic variations of functional components in grains among 629 barley improved lines from four continents were determined with DU640-type ul- traviolet spectrophotometry (BECKMAN). [Result] The contents (mg/100 g) of total flavones and GABA in grains of Asian barley lines (123.09_+29.56, 9.49_+4.34) were significantly higher than that of American barley lines (103.85_22.33, 7.38_+3.59), while no significant difference was observed between Asia/Americas and Europe (115.47_+11.41, 9.66-+3.98) and Australia (104.20-+4.76, 8.83-+3.41); furthermore, there was no significant difference of resistant starch content (%) in barley grains among four continents [Asia (1.63_+1.44), America (1.54_+1.13), Europe (1.20+0.85) and Aus- tralia (0.27_+0.26)]. The contents (%) of resistant starch in grains of two-rowed barley (ssp. Hordeurn distichon Koern., 1.45_+1.20) was significantly lower than that of poly- rowed barley (ssp. Hordeum vulgare Orlov., 1.95_+1.24). On the contrary, the content of total flavones in two-rowed lines (111.43_+27.79 mg/100 g) wa, s significantly higher than that of poly-rowed lines (102.15_+14.95 mg/100 g), and the content of GABA in two-rowed lines (8.55+_3.73 mg/100 g) was also significantly higher than that of poly-rowed lines (5.96_+3.95 mg/100 g). There was the most significant correlation between GABA content and resistant starch (-0.21)/total flavones content (0.12 , P〈0.01, n=-629). There were great genotype differences among the functional compo- nents in barley grains. The coefficient of variation (78.60%) and range (0-9.29%) of resistant starch (1.56_+1.22%) were relatively large, including 11 high-resistant starch lines above 5%; the coefficient of variation (49.00%) and range (0-30.67 mg/100g) of GABA (8.00-

  20. Main: 1GPT [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1GPT 大麦 Barley Hordeum vulgare l. Gamma Hordothionin. Hordeum Vulgare Gamma-1-H Thi...r: A Structural Motif Common To Toxic Arthropod Proteins Biochemistry V. 32 715 1993 PIR; S13849; S13849.|PDB; 1GP... AA, Molecular weight: 5250 Da RICRRRSAGFKGPCVSNKNCAQVCMQEGWGGGNCDGPLRRCKCMRRC barley_1GPT.jpg ...

  1. Main: 1FI2 [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1FI2 大麦 Barley Hordeum vulgare l. Oxalate Oxidase 1 Hordeum Vulgare Molecule: Oxala...59.1; -.|PIR; A45980; A45980.|PDB; 1FI2; X-ray; A=1-201.|InterPro; IPR006045; Cupin.|InterPro; IPR007113; Cu...KGELLVGILGSLDSGNKLYSRVVRAGETFVIPRGLMHFQFNVGKTEAYMVVSFNSQNPGIVFVPLTLFGSDPPIPTPVLTKALRVEAGVVELLKSKFAGGS barley_1FI2.jpg ...

  2. Variability of barley aleurone layer induced by X-rays

    Directory of Open Access Journals (Sweden)

    Romuald Kosina

    2015-05-01

    Full Text Available A series of Hordeum vulgare cultivars was irradiated by X-rays to induce mutations in endosperm. Many structural defects of endosperm were revealed in plants irradiated 8 DAF. Change of a cell cycle was especially frequent and this was visible in the form of clones of small or large cells in the aleurone layer. X-irradiation appeared as a successful tool in the study of development.

  3. Response of Several Spring Barley Cultivars to UV-B Radiation and Ozone Treatment

    Directory of Open Access Journals (Sweden)

    Kristina DĖDELIENĖ

    2011-01-01

    Full Text Available Normal 0 false false false EN-US X-NONE X-NONE MicrosoftInternetExplorer4 /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Table Normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-priority:99; mso-style-qformat:yes; mso-style-parent:""; mso-padding-alt:0cm 5.4pt 0cm 5.4pt; mso-para-margin:0cm; mso-para-margin-bottom:.0001pt; mso-pagination:widow-orphan; font-size:11.0pt; font-family:"Calibri","sans-serif"; mso-ascii-font-family:Calibri; mso-ascii-theme-font:minor-latin; mso-fareast-font-family:"Times New Roman"; mso-fareast-theme-font:minor-fareast; mso-hansi-font-family:Calibri; mso-hansi-theme-font:minor-latin; mso-bidi-font-family:"Times New Roman"; mso-bidi-theme-font:minor-bidi;} Experiments were conducted under controlled environmental conditions to assess the impact of UV-B radiation (8 kJ m-2 d-1 and ozone (240 μg m-3 on seven spring barley (Hordeum vulgare L. cultivars. It has been established that the impact of UV-B and ozone on various spring barley cultivars differs greatly and in most cases the cultivars which are tolerant to an impact of ozone are sensitive to UV-B and vice versa. The impact of both investigated stressors resulted in a more pronounced decrease in chlorophyll a than chlorophyll b content while the chlorophyll a/b ratio in the leaves of different spring barley cultivars has also decreased. The reaction of carotenoids differs greatly depending on a stressor. UV-B radiation causes a significant increase in the content of carotenoids which is most likely a defence reaction against high energy short-wave radiation. The impact of ozone, in contrast, resulted in a decrease in carotenoids in the leaves of different spring barley cultivars.

  4. Controle de azevém (Lolium multiflorum L., e gorga (Spergula arvensis L. e seletividade de herbicidas as culturas de trigo, cevada e centeio Control of rye grass (Lolium multiforum L. and corn spurry (Spergula arvensis L., and selectivity of herbicides to wheat, barley, and rye crops

    Directory of Open Access Journals (Sweden)

    J. A. R. O. Velloso

    1982-12-01

    Full Text Available Foram realizados três experimentos a campo em 1980, no Centro Nacional de Pesquisa de Trigo/EMBRAPA, Passo Fundo, RS, visando conhecer o comportamento dos herbicidas diclofop, dicamba, a associação 2,4 D com dicamba e a mistura diclofop + (2,4 D + dicamba, no controle de azevém (Lolium multiflorum L. e gorga (Spergula arvensis L.. Ao mesmo tempo foi avaliada a seletividade que estes herbicidas apresentam às culturas de trigo (Triticum aestivum L., cevada (Hordeum vulgare L. e centeio (Secale cereale L.. Os resultados da avaliação visual de fitotoxicidade mostra ram que o dicamba causou o maior grau de injúria para as três culturas. Cevada mostrou ser a cultura mais sensível ao dicamba na fase inicial. Trigo, cevada e centeio foram tolerantes ao diclofop. A mistura diclofop + (2,4 D + dicamba não controlou o azevém nas três culturas. Esta mistura apresentou ainda redução no controle de gorga, nas culturas de cevada e centeio. Dicamba ocasionou redução no rendimento de grãos das culturas, mostrando ser pouco seletivo na dose testada. Centeio sofreu uma redução no rendimento de grãos causada por diclofop, enquanto que a mistura diclofop + (2,4 D + dicamba foi seletiva para todas as culturas.Three field experiments were carried out, in 1980, at the National Wheat Research Center/ EMBRAPA, Passo Fundo, RS. They aimed at testnig the responses of herbicides diclofop, dicamba, the association 2,4 D with dicamba, and the mixture diclofop + (2,4 D + dicamba in the control of rye grass (Lolium multiflorum L. and corn spurry (Spergula arvensis L.. Simultaneously, the selectivity of these herbicides to wheat (Triticum aestivum L., barley (Hordeum vulgare L., and rye (Secale cereale L. was evaluated. The results of visual evaluation of phytotoxicity showed that dicamba caused the greatest degree of injury to the three crops studied. Barley was the most sensitive crop to dicamba in the initial growth stage. Wheat, barley, and rye were

  5. Determination of mortality of different life stages of Tribolium castaneum (Coleoptera: Tenebrionidae) in stored barley using microwaves.

    Science.gov (United States)

    Vadivambal, R; Jayas, D S; White, N D G

    2008-06-01

    Barley, Hordeum vulgare L., one of the important crops in Canada, is used in malting, feed, and food industries. Disinfestation of barley using microwaves can be an alternative to chemical methods used to kill insects. A pilot-scale industrial microwave system operating at 2.45 MHz was used in this study to determine the mortality of life stages (egg, larva, pupa, and adult) of Tribolium castaneum (Herbst) (Coleoptera: Tenebrionidae). Barley samples of 50 g each at 14, 16, and 18% moisture content (MC; wet basis) were infested with various life stages of T. castaneum and exposed to microwave energy at different power levels and exposure times, and the mortality of the insects was determined. The average temperature of the 14% MC sample exposed to 28 s at 0, 200, 300, 400, and 500 W were 27.4, 42.6, 53.7, 66.9, and 73.0 degrees C, respectively, and those exposed to 56 s at 0, 200, 300, and 400 W were 27.4, 57.3, 75.5, and 91.2 degrees C, respectively. A similar range of temperature was observed for 16 and 18% MC barley. Complete mortality of all life stages of T. castaneum can be achieved at a power level of 400 W and an exposure time of 56 s or at 500 W for 28 s. Among the life stages of T. castaneum, eggs were the most susceptible to microwave energy and adults were the least susceptible. There was no significant difference in the mortality of larvae and adults at 14, 16, and 18% MC, but the mortality was significantly different for eggs and pupae at different MCs. There was a significant increase in the mortality with an increase in power level or exposure time or both. Germination capacity of the seeds was decreased with an increase in power level or exposure time or both. Quality characteristics such as alpha-amylase, diastatic power, soluble protein, viscosity, and density of the barley malt treated at 500 W for 28 s were same as the control sample, whereas the samples treated at 400 W for 56 s were significantly lower.

  6. Effects of sulfur nutritional level on cadmium toxicity in barley

    Energy Technology Data Exchange (ETDEWEB)

    Chen, Yichang; Huerta, A.J. (Miami Univ., Oxford, OH (United States))

    1993-05-01

    The effects of S levels on Cd toxicity were studied in barley (Hordeum vulgare L.cv.UC 476). Barley was grown hydroponically in half-strength Hoagland's solution containing either 100% or 10% S in a growth chamber at constant 20 C, 290 umole M[sup [minus]2] s[sup [minus]1] light intensity, and a 16/18 hour light/dark period. Five days after the first true leaf appeared, 15 uM Cd was added to the nutrient solutions where appropriate. At 14 days after beginning of Cd treatment, plants were analyzed for photosynthetic characteristics. The photosynthetic characteristics measured were CO[sub 2] response curves (measured with a LICOR 6200 portable photosynthesis system), and fluorescence measurement system. At 21 days they were analyzed for morphological and biomass measurements. The CO[sub 2] response curves for leaves of plants treated with 10% S did not significantly differ from those of plants treated with 100% S. Treatment with Cd significantly reduced the CO[sup 2] saturated rates of photosynthesis and the reduction was more significant in the 10% S than in the 100% S plants. Photochemical efficiency of PSII (FV/FM) and fluorescence quenching capacity (FQ) were not affected by 10% S as compared to 100% S treatment. Interestingly, treatment with Cd significantly increased both FV/FM and FQ as compared to control., However, S level had no effect on the fluorescence parameters of Cd-treated plants. Leaf and root length, leaf area, root and shoot dry weight were only slightly affected (increased or decreased) by 10% S as compared to 100% S but very significantly reduced by treatment with Cd. Our results agree with the previous reports which show that S (an important component of glutathione and phytochelatins which are low molecular weight Cd binding proteins), is important in regulating Cd detoxification in plants. However, we are continuing to conduct experiments as even lower S concentrations and different Cd concentrations.

  7. Root Hair Mutations Displace the Barley Rhizosphere Microbiota

    Directory of Open Access Journals (Sweden)

    Robertson-Albertyn Senga

    2017-06-01

    Full Text Available The rhizosphere, the thin layer of soil surrounding and influenced by plant roots, defines a distinct and selective microbial habitat compared to unplanted soil. The microbial communities inhabiting the rhizosphere, the rhizosphere microbiota, engage in interactions with their host plants which span from parasitism to mutualism. Therefore, the rhizosphere microbiota emerges as one of the determinants of yield potential in crops. Studies conducted with different plant species have unequivocally pointed to the host plant as a driver of the microbiota thriving at the root–soil interface. Thus far, the host genetic traits shaping the rhizosphere microbiota are not completely understood. As root hairs play a critical role in resource exchanges between plants and the rhizosphere, we hypothesized that they can act as a determinant of the microbiota thriving at the root–soil interface. To test this hypothesis, we took advantage of barley (Hordeum vulgare mutant lines contrasting for their root hair characteristics. Plants were grown in two agricultural soils, differentiating in their organic matter contents, under controlled environmental conditions. At early stem elongation rhizosphere specimens were collected and subjected to high-resolution 16S rRNA gene profiling. Our data revealed that the barley rhizosphere microbiota is largely dominated by members of the phyla Bacteroidetes and Proteobacteria, regardless of the soil type and the root hair characteristics of the host plant. Conversely, ecological indices calculated using operational taxonomic units (OTUs presence, abundance, and phylogeny revealed a significant impact of root hair mutations on the composition of the rhizosphere microbiota. In particular, our data indicate that mutant plants host a reduced-complexity community compared to wild-type genotypes and unplanted soil controls. Congruently, the host genotype explained up to 18% of the variation in ecological distances computed for the

  8. Root Hair Mutations Displace the Barley Rhizosphere Microbiota.

    Science.gov (United States)

    Senga, Robertson-Albertyn; Alegria Terrazas, Senga; Balbirnie, Katharin; Blank, Manuel; Janiak, Agnieszka; Szarejko, Iwona; Chmielewska, Beata; Karcz, Jagna; Morris, Jenny; Hedley, Pete E; George, Timothy S; Bulgarelli, Davide

    2017-01-01

    The rhizosphere, the thin layer of soil surrounding and influenced by plant roots, defines a distinct and selective microbial habitat compared to unplanted soil. The microbial communities inhabiting the rhizosphere, the rhizosphere microbiota, engage in interactions with their host plants which span from parasitism to mutualism. Therefore, the rhizosphere microbiota emerges as one of the determinants of yield potential in crops. Studies conducted with different plant species have unequivocally pointed to the host plant as a driver of the microbiota thriving at the root-soil interface. Thus far, the host genetic traits shaping the rhizosphere microbiota are not completely understood. As root hairs play a critical role in resource exchanges between plants and the rhizosphere, we hypothesized that they can act as a determinant of the microbiota thriving at the root-soil interface. To test this hypothesis, we took advantage of barley (Hordeum vulgare) mutant lines contrasting for their root hair characteristics. Plants were grown in two agricultural soils, differentiating in their organic matter contents, under controlled environmental conditions. At early stem elongation rhizosphere specimens were collected and subjected to high-resolution 16S rRNA gene profiling. Our data revealed that the barley rhizosphere microbiota is largely dominated by members of the phyla Bacteroidetes and Proteobacteria, regardless of the soil type and the root hair characteristics of the host plant. Conversely, ecological indices calculated using operational taxonomic units (OTUs) presence, abundance, and phylogeny revealed a significant impact of root hair mutations on the composition of the rhizosphere microbiota. In particular, our data indicate that mutant plants host a reduced-complexity community compared to wild-type genotypes and unplanted soil controls. Congruently, the host genotype explained up to 18% of the variation in ecological distances computed for the rhizosphere samples

  9. Crystal structure of an essential enzyme in seed starch degradation - barley limit dextrinase in complex with cyclodextrins

    DEFF Research Database (Denmark)

    Vester-Christensen, Malene Bech; Abou Hachem, Maher; Svensson, Birte

    2010-01-01

    Barley limit dextrinase [Hordeum vulgare limit dextrinase (HvLD)] catalyzes the hydrolysis of α-1,6 glucosidic linkages in limit dextrins. This activity plays a role in starch degradation during germination and presumably in starch biosynthesis during grain filling. The crystal structures of Hv......LD in complex with the competitive inhibitors α-cyclodextrin (CD) and β-CD are solved and refined to 2.5 Å and 2.1 Å, respectively, and are the first structures of a limit dextrinase. HvLD belongs to glycoside hydrolase 13 family and is composed of four domains: an immunoglobulin-like N-terminal eight......-stranded β-sandwich domain, a six-stranded β-sandwich domain belonging to the carbohydrate binding module 48 family, a catalytic (β/α)8-like barrel domain that lacks α-helix 5, and a C-terminal eight-stranded β-sandwich domain of unknown function. The CDs are bound at the active site occupying carbohydrate...

  10. Effects of sulphur dioxide on the development of fungal diseases of winter barley in an open-air fumigation system

    Energy Technology Data Exchange (ETDEWEB)

    Mansfield, P.J.; Bell, J.N.B.; Wheeler, B.E.J. (Imperial Coll., Ascot (UK)); McLeod, A.R. (National Power Technology and Environmental Centre, Leatherhead (UK))

    1991-01-01

    The development of fungal diseases was monitored through three consecutive growing seasons (1984-1985, 1985-1986 and 1986-1987) on field plots of winter barley (Hordeum vulgare L.) cv. 'Igri' exposed to sulfur dioxide (SO{sub 2}) concentrations in the range 0.005-0.048 microliter l{sup {minus}1} using an open-air fumigation system. In each season the incidence and severity of powdery mildew (Erysiphe graminis D.C. ex Merat f.sp. hordei Em. Marchal) increased and leaf blotch (Rhynchosporium secalis Oudem J.J. Davis) decreased in plots exposed to elevated levels of SO{sub 2} (0.014-0.048 microliter l{sup {minus}1} SO{sub 2}) compared with control plots exposed to background levels of 0.005-0.009 microliter l{sup {minus}1} SO{sub 2}. The apparent infection rate of powdery mildew was also greater in SO{sub 2}-treated plots. The effects of SO{sub 2} exposure on eyespot (Pseudocercosporella herpotrichoides (Fron) Deighton) and black ear moulds (Cladosporium and Alternaria spp.) were variable. Sharp eyespot (Rhizoctonia cerealis van der Hoeven), Fusarium foot rot, brown rust (Puccinia hordei Otth.), Septoria nodorum Berk., net blotch (Pyrenophora teres Sacc.) and Botrytis spp. infection on the ear were all apparently unaffected by SO{sub 2}. 3 figs., 36 refs., 4 tabs.

  11. Reduced glutamine synthetase activity plays a role in control of photosynthetic responses to high light in barley leaves.

    Science.gov (United States)

    Brestic, Marian; Zivcak, Marek; Olsovska, Katarina; Shao, Hong-Bo; Kalaji, Hazem M; Allakhverdiev, Suleyman I

    2014-08-01

    The chloroplastic glutamine synthetase (GS, EC 6.3.1.2) activity was previously shown to be the limiting step of photorespiratory pathway. In our experiment, we examined the photosynthetic high-light responses of the GS2-mutant of barley (Hordeum vulgare L.) with reduced GS activity, in comparison to wild type (WT). The biophysical methods based on slow and fast chlorophyll fluorescence induction, P700 absorbance, and gas exchange measurements were employed. Despite the GS2 plants had high basal fluorescence (F0) and low maximum quantum yield (Fv/Fm), the CO2 assimilation rate, the PSII and PSI actual quantum yields were normal. On the other hand, in high light conditions the GS2 had much higher non-photochemical quenching (NPQ), caused both by enhanced capacity of energy-dependent quenching and disconnection of PSII antennae from reaction centers (RC). GS2 leaves also maintained the PSII redox poise (QA(-)/QA total) at very low level; probably this was reason why the observed photoinhibitory damage was not significantly above WT. The analysis of fast chlorophyll fluorescence induction uncovered in GS2 leaves substantially lower RC to antenna ratio (RC/ABS), low PSII/PSI ratio (confirmed by P700 records) as well as low PSII excitonic connectivity.

  12. Control of. cap alpha. -amylase mRNA accumulation by gibberellic acid and calcium in barley aleurone layers

    Energy Technology Data Exchange (ETDEWEB)

    Deikman, J.; Jones, R.L.

    1985-01-01

    Pulse-labeling of barley (Hordeum vulgare L. cv Himalaya) aleurone layers incubated for 13 hours in 2.5 micromolar gibberellic acid (GA/sub 3/) with or without 5 millimolar CaCl/sub 2/ shows that ..cap alpha..-amylase isozymes 3 and 4 are not synthesized in vivo in the absence of Ca/sup 2 +/. No difference was observed in ..cap alpha..-amylase mRNA levels between layers incubated for 12 hours in 2.5 micromolar GA/sub 3/ with 5 millimolar CaCl/sub 2/ and layers incubated in GA/sub 3/ alone. RNA isolated from layers incubated for 12 hours in GA/sub 3/ with and without CA/sup 2 +/. A cDNA clone for ..cap alpha..-amylase was isolated and used to measure ..cap alpha..-amylase mRNA levels in aleurone layers incubated in the presence and absence of Ca/sup 2 +/ was translated in vitro and was found to produce the same complement of translation products regardless of the presence of Ca/sup 2 +/ in the incubation medium. Immunoprecipitation of translation products showed that the RNA for ..cap alpha..-amylase synthesized in Ca/sup 2 +/-deprived aleurone layers was translatable. Ca/sup 2 +/ is required for the synthesis of ..cap alpha..-amylase isozymes 3 and 4 at a step after mRNA accumulation and processing.

  13. Primer extension studies on alpha-amylase mRNAs in barley aleurone. II. Hormonal regulation of expression.

    Science.gov (United States)

    Chandler, P M; Jacobsen, J V

    1991-04-01

    Relative levels of different alpha-amylase mRNAs were assessed by primer extension experiments using RNA prepared from aleurone of barley (Hordeum vulgare L. cv. Himalaya). Three different aleurone systems were studied: protoplasts prepared from aleurone layers, isolated aleurone layers, and aleurone from germinated grain. Oligonucleotide primers specific for the low-pI and high-pI alpha-amylase groups allowed the levels of different alpha-amylase mRNAs to be assessed both within and between the two groups. In all aleurone systems the same set of alpha-amylase mRNAs was produced in response to either applied gibberellic acid (aleurone protoplasts, isolated aleurone layers) or, presumably, native gibberellin(s) (germinated grain). This result indicates that the same set of genes is being expressed in each case. Differences were observed between the different aleurone systems in regulation of levels of alpha-amylase mRNAs. In particular, the regulation of alpha-amylase mRNA levels in aleurone of germinated grain has unique features which are not adequately explained by the response of isolated aleurone layers to gibberellic acid.

  14. Gibberellic-acid-induced synthesis and release of cell-wall-degrading endoxylanase by isolated aleurone layers of barley

    Energy Technology Data Exchange (ETDEWEB)

    Dashek, W.V.; Chrispeels, M.J.

    1977-01-01

    When aleurone layers of barley (Hordeum vulgare L.) are incubated with gibberellic acid (GA/sub 3/), xylose and arabinose, both as free sugars and bound to larger molecules, are released into the medium. Release begins 10 to 12 h after the start of incubation and continues for at least 60 h. At the same time there is a GA/sub 3/-induced breakdown of the cell wall resulting in a loss of /sup 2///sub 3/ of the cell-wall pentose during 60 h of incubation. GA/sub 3/ causes the appearance in the medium of an enzyme (or enzymes) which hydrolyze larchwood xylan and aleurone-layer arabinoxylan. Release of the enzyme(s) into the medium begins 28 to 32 h after the start of incubation. Enzyme activity does not accumulate to any large extent in the tissue prior to release into the medium, and is present in very low levels only in the absence of GA/sub 3/. Xylanase activity is associated with a protein (or proteins) with a molecular weight of 29,000. The hydrolysis of the xylans is largely caused by endoxylanase activity, indicating the importance of endoglycosidases in the GA/sub 3/-induced breakdown of the aleurone cell wall.

  15. Untangling nucleotide diversity and evolution of the H genome in polyploid Hordeum and Elymus species based on the single copy of nuclear gene DMC1.

    Directory of Open Access Journals (Sweden)

    Dongfa Sun

    Full Text Available Numerous hybrid and polypoid species are found within the Triticeae. It has been suggested that the H subgenome of allopolyploid Elymus (wheatgrass species originated from diploid Hordeum (barley species, but the role of hybridization between polyploid Elymus and Hordeum has not been studied. It is not clear whether gene flow across polyploid Hordeum and Elymus species has occurred following polyploid speciation. Answering these questions will provide new insights into the formation of these polyploid species, and the potential role of gene flow among polyploid species during polyploid evolution. In order to address these questions, disrupted meiotic cDNA1 (DMC1 data from the allopolyploid StH Elymus are analyzed together with diploid and polyploid Hordeum species. Phylogenetic analysis revealed that the H copies of DMC1 sequence in some Elymus are very close to the H copies of DMC1 sequence in some polyploid Hordeum species, indicating either that the H genome in theses Elymus and polyploid Hordeum species originated from same diploid donor or that gene flow has occurred among them. Our analysis also suggested that the H genomes in Elymus species originated from limited gene pool, while H genomes in Hordeum polyploids have originated from broad gene pools. Nucleotide diversity (π of the DMC1 sequences on H genome from polyploid species (π = 0.02083 in Elymus, π = 0.01680 in polyploid Hordeum is higher than that in diploid Hordeum (π = 0.01488. The estimates of Tajima's D were significantly departure from the equilibrium neutral model at this locus in diploid Hordeum species (P<0.05, suggesting an excess of rare variants in diploid species which may not contribute to the origination of polyploids. Nucleotide diversity (π of the DMC1 sequences in Elymus polyploid species (π = 0.02083 is higher than that in polyploid Hordeum (π = 0.01680, suggesting that the degree of relationships between two parents of a polyploid might be a factor

  16. Influence of bacterial N-acyl-homoserinelactones on growth parameters, pigments, antioxidative capacities and the xenobiotic phase II detoxification enzymes in barley and yam bean

    Directory of Open Access Journals (Sweden)

    Christine eGoetz-Roesch

    2015-04-01

    Full Text Available Bacteria are able to communicate with each other and sense their environment in a population density dependent mechanism known as quorum sensing (QS. N-acyl-homoserine lactones (AHLs are the QS signalling compounds of Gram-negative bacteria which are frequent colonizers of rhizospheres. While cross-kingdom signalling and AHL-dependent gene expression in plants has been confirmed, the responses of enzyme activities in the eukaryotic host upon AHLs are unknown. Since AHL are thought to be used as so-called plant boosters or strengthening agents, which might change their resistance towards radiation and/or xenobiotic stress, we have examined the plants’ pigment status and their antioxidative and detoxifying capacities upon AHL treatment. Because the yield of a crop plant should not be negatively influenced, we have also checked for growth and root parameters.We investigated the influence of three different AHLs, namely N-hexanoyl- (C6-HSL, N-octanoyl- (C8-HSL and N-decanoyl- homoserine lactone (C10-HSL on two agricultural crop plants. The AHL-effects on Hordeum vulgare (L. as an example of a monocotyledonous crop and on the tropical leguminous crop plant Pachyrhizus erosus (L were compared. While plant growth and pigment contents in both plants showed only small responses to the applied AHLs, AHL treatment triggered tissue- and compound-specific changes in the activity of important detoxification enzymes. The activity of dehydroascorbate reductase (DHAR in barley shoots after C10-HSL treatment for instance increased up to 384% of control plant levels, whereas superoxide dismutase (SOD activity in barley roots was decreased down to 23% of control levels upon C6-HSL treatment. Other detoxification enzymes reacted similarly within this range, with interesting clusters of positive or negative answers towards AHL treatment. In general the changes on the enzyme level were more severe in barley than in yam bean which might be due to the different

  17. The non-touching method of the malting barley quality evaluation

    Science.gov (United States)

    Raba, B.; Nowakowski, K.; Lewicki, A.; Przybył, K.; Zaborowicz, M.; Koszela, K.; Boniecki, P.; Mueller, W.

    2014-04-01

    The first important stage of the malt production processes is the malting barley quality evaluation. Presented project was focused on the visual features of malting barley grains. The principal aim was to elaborate complete methodology to determine the level of grains contamination. The article describes the mechanisms of choosing parameters which can distinguish useful for the malt production grains from defects and impurities. Original computer system 'Hordeum v 3.1' helped obtain graphical data from images of contaminated barley samples. Research carried out in this area can improve the quality evaluation process of malting barley.

  18. Durum wheat and barley productivity in saline-drought environments

    NARCIS (Netherlands)

    Katerji, N.; Mastrorilli, M.; Hoorn, van J.W.; Lahmer, F.Z.; Hamdy, A.; Oweis, T.

    2009-01-01

    In two Successive years, durum wheat (Triticum turgidum Desf.) and barley (Hodeum vulgare L.) were tested in a factorial salinity-drought experiment, combining three levels of salinity and two levels of drought. The two drought treatments were obtained by applying irrigation water when the pre-dawn

  19. The Sublime and the Vulgar.

    Science.gov (United States)

    Swann, Karen

    1990-01-01

    Explores how Edmund Burke's discourse on the sublime helps illuminate attacks on the vulgarization of culture (as typified by Allan Bloom), both for the presumedly "vulgar" reader and for the champions of high culture. (MG)

  20. Effect of Silicon on Leaf Ultrastructure,Chlorophyll Content and Photosynthetic Activity of Barley Under Salt Stress

    Institute of Scientific and Technical Information of China (English)

    LIANGYONGCHAO

    1998-01-01

    Two contrasting cultivars of barley(Hordeum vulgare L.):Kepin No.7(salt sensitive),and Jian 4(salt tolerant)were grown in a hydropon ics system with 2 NaCl levels:60 mmol NaCl L-1 and 120 mmol NaCl L-1 ,and 3 Si levels:0 mmol Si L-1 ,0.5 mmol Si L-1 and 1.0 mmol Si L-1 (as silicic acid).Compared with the plants treated with 60 mmol NaCl L-1 alone,the leaf chlorophyll contents of plants rreated with salt and Si increased significantly ofr salt-sensitive cultivar at tillering stage,but for alt-tolerant cultivar,the addition of Si resulted in an obivous increase in the leaf chlorophyll content of plants exposed to 120 mmol NaCl L-1 ,However,this Si-enhancement of leaf chlorophyll content was also observed in the salttolerant plants at joninting stage,but not in the salt-sensitive plants.Moreover,leaf chlorophyll content was consistently higher for the salt-tolerant cultivar than for the salt-sensitive cultivar irrespective of salt and/or Si treatment .Compared with the plants treated with sal alont ,net CO2 assimilation rate in plant leaves increased significantly for both cultivars when treated with salt and Si, Teh addition of Si to the salt teatment was found to improve the cell ultrastructure of leaves.Under salt stress condition,the double membranes of chloroplasts disappeared,but membrane integrity was markedly improved in the salt treatment supplemented with Si.Silicon was also found to ameliorate the damage to the ultrasturcture of chloroplast granae which appeared to be disintegrated and vague in salt treatments without added Si.The results support previous work which showed that Si decreases the permeability of plasma membranes of salt-stressed barley,thus mitigating salt damage.

  1. Low-temperature acclimation of barley cultivars used as parents in mapping populations: response to photoperiod, vernalization and phenological development.

    Science.gov (United States)

    Limin, Allen; Corey, Ann; Hayes, Patrick; Fowler, D Brian

    2007-06-01

    Six barley (Hordeum vulgare L.) accessions, previously used as parents of mapping populations, were evaluated for characters potentially affecting the location of low-temperature (LT) tolerance QTLs. Three were of winter growth habit (Kompolti Korai, Nure, and Strider), one was facultative (Dicktoo) and two were spring (Morex and Tremois). Final leaf number (FLN) and LT(50 )were determined at weekly intervals from 0 to 98 days of LT acclimation/vernalization under both long day (LD) and short day (SD) photoperiods. The point of vegetative/reproductive transition was determined from measurements of double ridge (DR) formation and FLN. With the exception of Nure, SD delayed development by increasing leaf production. Dicktoo was extremely SD sensitive lengthening its vegetative phase by more than 63 days relative to the LD photoperiod. SD had the opposite effect on Nure, causing an accelerating of flowering exhibiting the characteristic of 'short day vernalization'. All accessions except Dicktoo and Kompolti Korai acclimated rapidly in the first 7 days of LT exposure, approaching their maximum LT tolerance in 14-21 days. Dicktoo and Kompolti Korai continued to slowly acclimate until reproductive transition. The results emphasize two important points: (1) the location of QTLs for LT tolerance, and as a consequence the identification of putative candidate genes, will be a function of the genotypes sampled, the experimental conditions used, and the quality of the phenotypic data and (2) the barley LT tolerance pathway reaches an early impediment relative to closely related more hardy members of the Triticeae such as wheat and rye.

  2. Lipoic acid and redox status in barley plants subjected to salinity and elevated CO{sub 2}

    Energy Technology Data Exchange (ETDEWEB)

    Perez-Lopez, U.; Robredo, A.; Mena-Petite, A.; Munoz-Rueda, A. (Univ. del Pais Vasco/EHU, Dept. de Biologia Vegetal y Ecologia, Bilbao (Spain)); Lacuesta, M. (Univ. del Pais Vasco/EHU, Dept. de Biologia Vegetal y Ecologia, Vitoria-Gasteiz (Spain)); Sgherri, C.; Navari-Izzo, F. (Univ. di Pisa, Dipartimento di Chimica e Biotecnologie Agrarie, Pisa (Italy))

    2010-02-15

    Future environmental conditions will include elevated concentrations of salt in the soil and an elevated concentration of CO{sub 2}in the atmosphere. Because these environmental changes will likely affect reactive oxygen species (ROS) formation and cellular antioxidant metabolism in opposite ways, we analyzed changes in cellular H{sub 2}O{sub 2} and non-enzymatic antioxidant metabolite [lipoic acid (LA), ascorbate (ASA), glutathione (GSH)] content induced by salt stress (0, 80, 160 or 240 mM NaCl) under ambient (350 mumol mol-1) or elevated (700 mumol mol-1) CO{sub 2}concentrations in two barley cultivars (Hordeum vulgare L.) that differ in sensitivity to salinity (cv. Alpha is more sensitive than cv. Iranis). Under non-salinized conditions, elevated CO{sub 2}increased LA content, while ASA and GSH content decreased. Under salinized conditions and ambient CO{sub 2}, ASA increased, while GSH and LA decreased. At 240 mM NaCl, H{sub 2}O{sub 2} increased in Alpha and decreased in Iranis. When salt stress was imposed at elevated CO{sub 2}, less oxidative stress and lower increases in ASA were detected, while LA was constitutively higher. The decrease in oxidative stress could have been because of less ROS formation or to a higher constitutive LA level, which might have improved regulation of ASA and GSH reductions. Iranis had a greater capacity to synthesize ASA de novo and had higher constitutive LA content than did Alpha. Therefore, we conclude that elevated CO{sub 2}protects barley cultivars against oxidative damage. However, the magnitude of the positive effect is cultivar specific. (author)

  3. Heat shock inhibits. alpha. -amylase synthesis in barley aleurone without inhibiting the activity of endoplasmic reticulum marker enzymes

    Energy Technology Data Exchange (ETDEWEB)

    Sticher, L.; Biswas, A.K.; Bush, D.S.; Jones, R.L. (Univ. of California, Berkeley (USA))

    1990-02-01

    The effects of heat shock on the synthesis of {alpha}-amylase and on the membranes of the endoplasmic reticulum (ER) of barley (Hordeum vulgare) aleurone were studied. Heat shock, imposed by raising the temperature of incubation from 25{degree}C to 40{degree}C for 3 hours, inhibits the accumulation of {alpha}-amylase and other proteins in the incubation medium of barley aleurone layers treated with gibberellic acid and Ca{sup 2+}. When ER is isolated from heat-shocked aleurone layers, less newly synthesized {alpha}-amylase is found associated with this membrane system. ER membranes, as indicated by the activities of NADH cytochrome c reductase and ATP-dependent Ca{sup 2+} transport, are not destroyed by heat stress, however. Although heat shock did not reduce the activity of ER membrane marker enzymes, it altered the buoyant density of these membranes. Whereas ER from control tissue showed a peak of marker enzyme activity at 27% to 28% sucrose (1.113-1.120 grams per cubic centimeter), ER from heat-shocked tissue peaked at 30% to 32% sucrose (1.127-1.137 grams per cubic centimeter). The synthesis of a group of proteins designated as heat-shock proteins (HSPs) was stimulated by heat shock. These HSPs were localized to different compartments of the aleurone cell. Several proteins ranging from 15 to 30 kilodaltons were found in the ER and the mitochondrial/plasma membrane fractions of heat-shocked cells, but none of the HSPs accumulated in the incubation medium of heat-shocked aleurone layers.

  4. Barley metallothioneins: MT3 and MT4 are localized in the grain aleurone layer and show differential zinc binding.

    Science.gov (United States)

    Hegelund, Josefine Nymark; Schiller, Michaela; Kichey, Thomas; Hansen, Thomas Hesselhøj; Pedas, Pai; Husted, Søren; Schjoerring, Jan Kofod

    2012-07-01

    Metallothioneins (MTs) are low-molecular-weight, cysteine-rich proteins believed to play a role in cytosolic zinc (Zn) and copper (Cu) homeostasis. However, evidence for the functional properties of MTs has been hampered by methodological problems in the isolation and characterization of the proteins. Here, we document that barley (Hordeum vulgare) MT3 and MT4 proteins exist in planta and that they differ in tissue localization as well as in metal coordination chemistry. Combined transcriptional and histological analyses showed temporal and spatial correlations between transcript levels and protein abundance during grain development. MT3 was present in tissues of both maternal and filial origin throughout grain filling. In contrast, MT4 was confined to the embryo and aleurone layer, where it appeared during tissue specialization and remained until maturity. Using state-of-the-art speciation analysis by size-exclusion chromatography inductively coupled plasma mass spectrometry and electrospray ionization time-of-flight mass spectrometry on recombinant MT3 and MT4, their specificity and capacity for metal ion binding were quantified, showing a strong preferential Zn binding relative to Cu and cadmium (Cd) in MT4, which was not the case for MT3. When complementary DNAs from barley MTs were expressed in Cu- or Cd-sensitive yeast mutants, MT3 provided a much stronger complementation than did MT4. We conclude that MT3 may play a housekeeping role in metal homeostasis, while MT4 may function in Zn storage in developing and mature grains. The localization of MT4 and its discrimination against Cd make it an ideal candidate for future biofortification strategies directed toward increasing food and feed Zn concentrations.

  5. [Determination of nine mineral elements in hulless barley by ultraviolet spectrophotometry and flame atomic absorption spectrometry].

    Science.gov (United States)

    Liu, Jin; Zhang, Huai-Gang

    2010-04-01

    The contents of nine mineral elements, including sulphur, zinc, calcium, magnesium, potassium, sodium, iron, copper and manganese in five hulless barley (Hordeum vulgare L. var. nudum Hook. f.) lines were determined by ultraviolet spectrophotometry and flames atomic absorption spectrometry (FAAS). For the determination of sulphur, the samples were dissolved by magnesia and anhydrous sodium carbonate at 250 degrees C for 0. 5 h and at 550 degrees C for 3 h in the muffle furnace, and then a certain amount of barium chloride was put into the sample solution for colorimetry of the UV-Vs spectrophotometer. For the determination of other eight mineral elements, all of the samples were dissolved by a kind of incinerating method: first, the sample was put into the muffle furnace at 250 degrees C for 0. 5 h and at 550 degrees C for 2.5 h, then two droplets of 50%HNO3 were distributed into each sample, and the last step was putting the sample into the muffle furnace at 550 degrees C for 0.5 h. And then all of the ash was dissolved by 50%HNO3 to 50 milliliter and determined by flames atomic absorption spectrometry. The precision, accuracy, repeatability and stability of the method were discussed too. The results showed that the relative standard deviations (RSD) were between 1.2% and 3.7%; The average recoveries were 97.44%-101.52% and the relative standard deviations (RSD) of sample determination were 1.3%-3.8%. The repeatability experiment showed that the relative standard deviations (RSD) were 2.6%-6.1%. And the content of each mineral element was the same after 24 hours; All these showed that the method has a good precision, accuracy, repeatability and stability. In all the hulless barley samples, the average contents were in the order of K > S > Mg > Ca > Fe > Na > Zn > Mn > Cu, and the contents of zinc, iron and manganese closely related to people's health were relatively higher than other crops. The data of the experiment could provide an accurate and credible evidence

  6. How Specific is Non-Hypersensitive Host and Nonhost Resistance of Barley to Rust and Mildew Fungi?

    Institute of Scientific and Technical Information of China (English)

    Niks R. E.

    2014-01-01

    Full nonhost resistance can be deifned as immunity, displayed by an entire plant species against all genotypes of a plant pathogen. Interesting biological questions are, whether the genes responsible for the nonhost status of a plant species have a general or a specific effectiveness to heterologous (“nonhost”) pathogens? Is the nonhost resistance to pathogens of plant species that are related to the nonhost based onR-genes or on other types of genes?We study this question in barley (Hordeum vulgareL.), which is a near-nonhost to several rusts (Puccinia) of cereals and grasses. By crosses and selection we accumulated susceptibility and developed an experimental line, SusPtrit, with high susceptibility to at least nine different heterologous rust taxa such as the wheat andAgropyron leaf rusts (P. triticina andP. persistens, respectively). At the microscopic level there is also some variation among barley accessions in the degree that the heterologous wheat powdery mildew (Blumeria graminisf.sp.tritici) is able to form haustoria in epidermal cells. So, also the genetics of the variation in level of nonhost resistance to heterologous mildew fungi can be studied in barley. Our data obtained on mapping populations involving three regular nonhost-immune accessions (Vada, Cebada Capa and Golden Promise) suggest that nonhost resistance is the joined effect of multiple, quantitative genes (QTLs) and very occasionally a major gene (R-gene?) is involved. Most QTLs have effect to only one or two heterologous rusts, but some have a wider spectrum. This was conifrmed in a set of QTL-NILs. Those QTL-NILs are used to ifne-map the effective genes. In some cases, a QTL region with effectiveness to several heterologous rusts might be a cluster of genes with a more narrow spectrum of effectiveness. Our evidence suggests that nonhost resistance in barley to rust and powdery mildew fungi of related Gramineae is not due toR-genes, but to pathogen species-speciifc quantitative

  7. Lipid signalling mediated by PLD/PA modulates proline and H2O2 levels in barley seedlings exposed to short- and long-term chilling stress.

    Science.gov (United States)

    Peppino Margutti, Micaela; Reyna, Matias; Meringer, María Verónica; Racagni, Graciela E; Villasuso, Ana Laura

    2017-04-01

    Phospholipase D (PLD) hydrolyses phospholipids to yield phosphatidic acid (PA) and a head group, and is involved in responses to a variety of environmental stresses, including chilling and freezing stress. Barley responses to chilling stress (induced by incubating seedlings at 4 °C) are dynamic and the duration of stress, either short (0-180 min) or long-term (24-36 h) had a significant impact on the response. We investigated the roles of PLD/PA in responses of barley (Hordeum vulgare) seedlings to short and long-term chilling stress, based on regulation of proline and reactive oxygen species (ROS) levels. Short-term chilling stress caused rapid and transient increases in PLD activity, proline level, and ROS levels in young leaves. PLD has the ability to catalyse the transphosphatidylation reaction leading to formation of phosphatidylalcohol (preferentially, to PA). Pre-treatment of seedlings with 1-butanol significantly increased proline synthesis but decreased ROS (H2O2) formation. These observations suggest that PLD is a negative regulator of proline synthesis, whereas PA/PLD promote ROS signals. Exogenous PA pre-treatment reduced the proline synthesis but enhanced H2O2 formation. Effects of long-term chilling stress on barley seedlings differed from those of short-term chilling stress. E.g., PLD activity was significantly reduced in young leaves and roots, whereas proline synthesis and ROS signals were increased in roots. Exogenous ROS application enhanced proline level while exogenous proline application reduced ROS level and modulated some effects of long-term chilling stress. Our findings suggest that PLD contributes to signalling pathways in responses to short-term chilling stress in barley seedling, through regulation of the balance between proline and ROS levels. In contrast, reduced PLD activity in the response to long-term chilling stress did not affect proline level. Increased ROS levels may reflect an antioxidant system that is affected by

  8. Genome-wide association mapping and biochemical markers reveal that seed ageing and longevity are intricately affected by genetic background and developmental and environmental conditions in barley.

    Science.gov (United States)

    Nagel, Manuela; Kranner, Ilse; Neumann, Kerstin; Rolletschek, Hardy; Seal, Charlotte E; Colville, Louise; Fernández-Marín, Beatriz; Börner, Andreas

    2015-06-01

    Globally, over 7.4 million accessions of crop seeds are stored in gene banks, and conservation of genotypic variation is pivotal for breeding. We combined genetic and biochemical approaches to obtain a broad overview of factors that influence seed storability and ageing in barley (Hordeum vulgare). Seeds from a germplasm collection of 175 genotypes from four continents grown in field plots with different nutrient supply were subjected to two artificial ageing regimes. Genome-wide association mapping revealed 107 marker trait associations, and hence, genotypic effects on seed ageing. Abiotic and biotic stresses were found to affect seed longevity. To address aspects of abiotic, including oxidative, stress, two major antioxidant groups were analysed. No correlation was found between seed deterioration and the lipid-soluble tocochromanols, nor with oil, starch and protein contents. Conversely, the water-soluble glutathione and related thiols were converted to disulphides, indicating a strong shift towards more oxidizing intracellular conditions, in seeds subjected to long-term dry storage at two temperatures or to two artificial ageing treatments. The data suggest that intracellular pH and (bio)chemical processes leading to seed deterioration were influenced by the type of ageing or storage. Moreover, seed response to ageing or storage treatment appears to be significantly influenced by both maternal environment and genetic background. © 2014 John Wiley & Sons Ltd.

  9. Characterization and genetic mapping of eceriferum-ym (cer-ym), a cutin deficient barley mutant with impaired leaf water retention capacity.

    Science.gov (United States)

    Li, Chao; Liu, Cheng; Ma, Xiaoying; Wang, Aidong; Duan, Ruijun; Nawrath, Christiane; Komatsuda, Takao; Chen, Guoxiong

    2015-09-01

    The cuticle covers the aerial parts of land plants, where it serves many important functions, including water retention. Here, a recessive cuticle mutant, eceriferum-ym (cer-ym), of Hordeum vulgare L. (barley) showed abnormally glossy spikes, sheaths, and leaves. The cer-ym mutant plant detached from its root system was hypersensitive to desiccation treatment compared with wild type plants, and detached leaves of mutant lost 41.8% of their initial weight after 1 h of dehydration under laboratory conditions, while that of the wild type plants lost only 7.1%. Stomata function was not affected by the mutation, but the mutant leaves showed increased cuticular permeability to water, suggesting a defective leaf cuticle, which was confirmed by toluidine blue staining. The mutant leaves showed a substantial reduction in the amounts of the major cutin monomers and a slight increase in the main wax component, suggesting that the enhanced cuticle permeability was a consequence of cutin deficiency. cer-ym was mapped within a 0.8 cM interval between EST marker AK370363 and AK251484, a pericentromeric region on chromosome 4H. The results indicate that the desiccation sensitivity of cer-ym is caused by a defect in leaf cutin, and that cer-ym is located in a chromosome 4H pericentromeric region.

  10. Effectiveness of urease inhibition on the abatement of ammonia, nitrous oxide and nitric oxide emissions in a non-irrigated Mediterranean barley field.

    Science.gov (United States)

    Abalos, Diego; Sanz-Cobena, Alberto; Misselbrook, Thomas; Vallejo, Antonio

    2012-09-01

    Urea is considered the cheapest and most commonly used form of inorganic N fertilizer worldwide. However, its use is associated with emissions of ammonia (NH(3)), nitrous oxide (N(2)O) and nitric oxide (NO), which have both economic and environmental impact. Urease activity inhibitors have been proposed as a means to reduce NH(3) emissions, although limited information exists about their effect on N(2)O and NO emissions. In this context, a field experiment was carried out with a barley crop (Hordeum vulgare L.) under Mediterranean conditions to test the effectiveness of the urease inhibitor N-(n-butyl) thiophosphoric triamide (NBPT) on reducing these gaseous N losses from surface applied urea. Crop yield, soil mineral N concentrations, dissolved organic carbon (DOC), denitrification potential, NH(3), N(2)O and NO fluxes were measured during the growing season. The inclusion of the inhibitor reduced NH(3) emissions in the 30 d following urea application by 58% and net N(2)O and NO emissions in the 95 d following urea application by 86% and 88%, respectively. NBPT addition also increased grain yield by 5% and N uptake by 6%, although neither increase was statistically significant. Under the experimental conditions presented here, these results demonstrate the potential of the urease inhibitor NBPT in abating NH(3), N(2)O and NO emissions from arable soils fertilized with urea, slowing urea hydrolysis and releasing lower concentrations of NH(4)(+) to the upper soil layer.

  11. Glutamate synthase activities and protein changes in relation to nitrogen nutrition in barley: the dependence on different plastidic glucose-6P dehydrogenase isoforms.

    Science.gov (United States)

    Esposito, Sergio; Guerriero, Gea; Vona, Vincenza; Di Martino Rigano, Vittoria; Carfagna, Simona; Rigano, Carmelo

    2005-01-01

    In barley (Hordeum vulgare L. var. Nure), glutamate synthesis and the production of reducing power by the oxidative pentose phosphate pathway (OPPP) are strictly correlated biochemical processes. NADH-GOGAT was the major root isoform, whose activity increased on a medium supplied with NH4+ or NO3-; by contrast, no noticeable variations could be observed in the leaves of plants supplied with nitrogen. In the leaves, the major isoform is Fd-GOGAT, whose activity increased under nitrogen feeding. G6PDH activity increased in the roots supplied with nitrogen; no variations were observed in the leaves. Moreover, an increase of the P2 isoform in the roots was measured, giving 13.6% G6PDH activity localized in the plastids under ammonium, and 25.2% under nitrate feeding conditions. Western blots confirmed that P2-G6PDH protein was induced in the roots by nitrogen. P1-G6PDH protein was absent in the roots and increased in the leaves by nitrogen supply to the plants. The changes measured in cytosolic G6PDH seem correlated to more general cell growth processes, and do not appear to be directly involved in glutamate synthesis. The effects of light on Fd-GOGAT is discussed, together with the possibility for P2-G6PDH to sustain nitrogen assimilation upon illumination.

  12. Genome comparison of barley and maize smut fungi reveals targeted loss of RNA silencing components and species-specific presence of transposable elements.

    Science.gov (United States)

    Laurie, John D; Ali, Shawkat; Linning, Rob; Mannhaupt, Gertrud; Wong, Philip; Güldener, Ulrich; Münsterkötter, Martin; Moore, Richard; Kahmann, Regine; Bakkeren, Guus; Schirawski, Jan

    2012-05-01

    Ustilago hordei is a biotrophic parasite of barley (Hordeum vulgare). After seedling infection, the fungus persists in the plant until head emergence when fungal spores develop and are released from sori formed at kernel positions. The 26.1-Mb U. hordei genome contains 7113 protein encoding genes with high synteny to the smaller genomes of the related, maize-infecting smut fungi Ustilago maydis and Sporisorium reilianum but has a larger repeat content that affected genome evolution at important loci, including mating-type and effector loci. The U. hordei genome encodes components involved in RNA interference and heterochromatin formation, normally involved in genome defense, that are lacking in the U. maydis genome due to clean excision events. These excision events were possibly a result of former presence of repetitive DNA and of an efficient homologous recombination system in U. maydis. We found evidence of repeat-induced point mutations in the genome of U. hordei, indicating that smut fungi use different strategies to counteract the deleterious effects of repetitive DNA. The complement of U. hordei effector genes is comparable to the other two smuts but reveals differences in family expansion and clustering. The availability of the genome sequence will facilitate the identification of genes responsible for virulence and evolution of smut fungi on their respective hosts.

  13. Genome Comparison of Barley and Maize Smut Fungi Reveals Targeted Loss of RNA Silencing Components and Species-Specific Presence of Transposable Elements[W

    Science.gov (United States)

    Laurie, John D.; Ali, Shawkat; Linning, Rob; Mannhaupt, Gertrud; Wong, Philip; Güldener, Ulrich; Münsterkötter, Martin; Moore, Richard; Kahmann, Regine; Bakkeren, Guus; Schirawski, Jan

    2012-01-01

    Ustilago hordei is a biotrophic parasite of barley (Hordeum vulgare). After seedling infection, the fungus persists in the plant until head emergence when fungal spores develop and are released from sori formed at kernel positions. The 26.1-Mb U. hordei genome contains 7113 protein encoding genes with high synteny to the smaller genomes of the related, maize-infecting smut fungi Ustilago maydis and Sporisorium reilianum but has a larger repeat content that affected genome evolution at important loci, including mating-type and effector loci. The U. hordei genome encodes components involved in RNA interference and heterochromatin formation, normally involved in genome defense, that are lacking in the U. maydis genome due to clean excision events. These excision events were possibly a result of former presence of repetitive DNA and of an efficient homologous recombination system in U. maydis. We found evidence of repeat-induced point mutations in the genome of U. hordei, indicating that smut fungi use different strategies to counteract the deleterious effects of repetitive DNA. The complement of U. hordei effector genes is comparable to the other two smuts but reveals differences in family expansion and clustering. The availability of the genome sequence will facilitate the identification of genes responsible for virulence and evolution of smut fungi on their respective hosts. PMID:22623492

  14. Comparative Studies on Callose Formation in Powdery Mildew Compatible and Incompatible Barley

    DEFF Research Database (Denmark)

    Skou, Jens-Peder; Jørgensen, Jørgen Helms; Lilholt, Ulla

    1984-01-01

    . This is the 1st case where the effect of callose refers to the action of a specific gene. Six susceptible Japanese varieties formed large appositions but they were initiated as late as in other susceptible varieties, and their color was paler than in other barleys. Nine Hordeum spp. [H. capense, H. chilense, H...

  15. Two New American Species of Hordeum (Poaceae)

    DEFF Research Database (Denmark)

    Bothmer, Roland Von; Jacobsen, Niels; Bagger Jørgensen, Rikke

    1985-01-01

    Two new species of Hordeum are described, viz. the diploid H. erectifolium, native to Argentina, and H. guatemalense, native to Guatemala.......Two new species of Hordeum are described, viz. the diploid H. erectifolium, native to Argentina, and H. guatemalense, native to Guatemala....

  16. Mechanisms of Salt Tolerance in Transgenic Arabidopsis thaliana Carrying a Peroxisomal Ascorbate Peroxidase Gene from Barley

    Institute of Scientific and Technical Information of China (English)

    XU Wei-Feng; SHI Wei-Ming; A. UEDA; T. TAKABE

    2008-01-01

    Ascorbate peroxidases (APX), localized in the cytosol, peroxisome, mitochondria, and chloroplasts of plant cells,catalyze the reduction of H2O2 to water by using ascorbic acid as the specific electron donor. To determine the role of peroxisomal type ascorbate peroxidasc (pAPX), an antioxidant enzyme, in protection against salt-induced oxidative stress, transgenic Arabidopsis thaliana plant carrying a pAPX gene (HvAPX1) from barley (Hordeum vulgare L.) was analyzed. The transgenic line pAPX3 was found to be more tolerant to salt stress than the wild type. Irrespective of salt stress, there were no significant differences in Na+, K+, Ca2+, and Mg2+ contents and the ratio of K+ to Na+ between pAPX3 and the wild type. Clearly, the salt tolerance in pAPX3 was not due to the maintenance and reestablishment of cellular ion homeostasis. However, the degree of H2O2 and lipid peroxidation (measured as the levels of malondialdehyde)accumulation under salt stress was higher in the wild type than in pAPX3. The mechanism of salt tolerance in transgenic pAPX3 can thus be explained by reduction of oxidative stress injury. Under all conditions tested, activities of superoxide,glutathionc reductase, and catalase were not significantly different between pAPX3 and the wild type. In contrast, the activity of APX was significantly higher in the transgcnic plant than in wild type under salt stress. These results suggested that in higher plants, HvAPX1 played an important role in salt tolerance and was a candidate gene for developing salt-tolerant crop plants.

  17. Yield response of Bere, a Scottish barley landrace, to cultural practices and agricultural inputs

    Directory of Open Access Journals (Sweden)

    Peter J. Martin

    2011-11-01

    Full Text Available There is very little documented about the response of cereal landraces to modern agricultural practices. Bere is a Scottish barley (Hordeum vulgare L. landrace which is grown in Orkney to supply meal for baking. A recent research programme has improved yields and the security of the Bere harvest, making it possible to supply a new market for grain to produce specialist whiskies. At the start of this research, a survey of Orkney farmers who had grown Bere since the 1980s showed that most had planted it at the traditional time in mid-May, used few inputs and considered the main constraints of the crop to be low yield (2.8 to 3.8 t/ha and susceptibility to lodging. Three years of trials in Orkney between 2003 and 2005 showed very significant increases in grain yield (17-76% and thousand grain weight from planting Bere earlier, in the second half of April. This also had the advantage of an earlier and more secure harvest. Yields showed smaller, but often significant, increases (5-11% from applying mineral fertiliser, growth regulator or fungicide, while combinations of growth regulator and fungicide increased yields from 10- 22%. In spite of usually increasing grain yield, growth regulator did not always control lodging. Although the use of inputs often increased the gross margins of growing Bere, a trial in 2005 showed that early planting was a more cost effective single intervention than either the use of fungicide or growth regulator. By increasing grower profits and reducing harvesting risks, these results have made it viable for more farmers to grow Bere in its region of origin, providing growers and end-users with additional income and contributing to the in situ conservation of this landrace.

  18. Reactive oxygen species are involved in gibberellin/abscisic acid signaling in barley aleurone cells.

    Science.gov (United States)

    Ishibashi, Yushi; Tawaratsumida, Tomoya; Kondo, Koji; Kasa, Shinsuke; Sakamoto, Masatsugu; Aoki, Nozomi; Zheng, Shao-Hui; Yuasa, Takashi; Iwaya-Inoue, Mari

    2012-04-01

    Reactive oxygen species (ROS) act as signal molecules for a variety of processes in plants. However, many questions about the roles of ROS in plants remain to be clarified. Here, we report the role of ROS in gibberellin (GA) and abscisic acid (ABA) signaling in barley (Hordeum vulgare) aleurone cells. The production of hydrogen peroxide (H2O2), a type of ROS, was induced by GA in aleurone cells but suppressed by ABA. Furthermore, exogenous H2O2 appeared to promote the induction of α-amylases by GA. In contrast, antioxidants suppressed the induction of α-amylases. Therefore, H2O2 seems to function in GA and ABA signaling, and in regulation of α-amylase production, in aleurone cells. To identify the target of H2O2 in GA and ABA signaling, we analyzed the interrelationships between H2O2 and DELLA proteins Slender1 (SLN1), GA-regulated Myb transcription factor (GAmyb), and ABA-responsive protein kinase (PKABA) and their roles in GA and ABA signaling in aleurone cells. In the presence of GA, exogenous H2O2 had little effect on the degradation of SLN1, the primary transcriptional repressor mediating GA signaling, but it promoted the production of the mRNA encoding GAMyb, which acts downstream of SLN1 and involves induction of α-amylase mRNA. Additionally, H2O2 suppressed the production of PKABA mRNA, which is induced by ABA:PKABA represses the production of GAMyb mRNA. From these observations, we concluded that H2O2 released the repression of GAMyb mRNA by PKABA and consequently promoted the production of α-amylase mRNA, thus suggesting that the H2O2 generated by GA in aleurone cells is a signal molecule that antagonizes ABA signaling.

  19. Nitric oxide and reactive oxygen species mediate metabolic changes in barley seed embryo during germination

    Directory of Open Access Journals (Sweden)

    Zhenguo eMa

    2016-02-01

    Full Text Available The levels of nitric oxide (NO and reactive oxygen species (ROS, ATP/ADP ratios, reduction levels of ascorbate and glutathione, expression of the genes encoding proteins involved in metabolism of NO and activities of the enzymes involved in fermentation and in metabolism of NO and ROS were studied in the embryos of germinating seeds of two barley (Hordeum vulgare L. cultivars differing in dormancy level. The level of NO production continuously increased after imbibition while the level of nitrosylated SH-groups in proteins increased. This corresponded to the decrease of free SH-groups in proteins. At early stage of germination (0-48 h postimbibition the genes encoding class 1 phytoglobin (the protein scavenging NO and S-nitrosoglutathione reductase (scavenging S-nitrosoglutathione were markedly expressed. More dormant cultivar exhibited lower ATP/ADP and ascorbate/dehydroascorbate ratios and lower lactate and alcohol dehydrogenase activities, while the production of NO and nitrosylation of proteins was higher as compared to the non-dormant cultivar. The obtained data indicate that at the onset of germination NO is actively generated causing nitrosylation of SH-groups and a switch from respiration to fermentation. After radicle protrusion the metabolism changes in a more reducing type as recorded by ratio of reduced and oxidized glutathione and ascorbate. The turnover of NO by the scavenging systems (phytoglobin, S-nitrosoglutathione reductase and interaction with ROS might contribute to the maintenance of redox and energy balance of germinating seeds and lead to alleviation of dormancy.

  20. Field studies on the regulation of abscisic acid content and germinability during grain development of barley: molecular and chemical analysis of pre-harvest sprouting.

    Science.gov (United States)

    Chono, Makiko; Honda, Ichiro; Shinoda, Shoko; Kushiro, Tetsuo; Kamiya, Yuji; Nambara, Eiji; Kawakami, Naoto; Kaneko, Shigenobu; Watanabe, Yoshiaki

    2006-01-01

    To investigate whether the regulation of abscisic acid (ABA) content was related to germinability during grain development, two cDNAs for 9-cis-epoxycarotenoid dioxygenase (HvNCED1 and HvNCED2) and one cDNA for ABA 8'-hydroxylase (HvCYP707A1), which are enzymes thought to catalyse key regulatory steps in ABA biosynthesis and catabolism, respectively, were cloned from barley (Hordeum vulgare L.). Expression and ABA-quantification analysis in embryo revealed that HvNCED2 is responsible for a significant increase in ABA levels during the early to middle stages of grain development, and HvCYP707A1 is responsible for a rapid decrease in ABA level thereafter. The change in the embryonic ABA content of imbibing grains following dormancy release is likely to reflect changes in the expression patterns of HvNCEDs and HvCYP707A1. A major change between dormant and after-ripened grains occurred in HvCYP707A1; the increased expression of HvCYP707A1 in response to imbibition, followed by a rapid ABA decrease and a high germination percentage, was observed in the after-ripened grains, but not in the dormant grains. Under field conditions, HvNCED2 showed the same expression level and pattern during grain development in 2002, 2003, and 2004, indicating that HvNCED2 expression is regulated in a growth-dependent manner in the grains. By contrast, HvNCED1 and HvCYP707A1 showed a different expression pattern in each year, indicating that the expression of these genes is affected by environmental conditions during grain development. The varied expression levels of these genes during grain development and imbibition, which would have effects on the activity of ABA biosynthesis and catabolism, might be reflected, in part, in the germinability in field-grown barley.