
Sample records for barley hordeum vulgare

  1. Lipid and sugar profiles of various barley cultivars (Hordeum vulgare

    Directory of Open Access Journals (Sweden)

    Pastor Kristian A.


    Full Text Available The lipid components and soluble sugars in flour samples of different cultivars of barley (Hordeum vulgare, involving winter malting barley, winter forage barley, spring barley, and hulless barley, were identified. Fatty acids were extracted from flour samples with n-hexane, and derivatized into volatile methyl esters, using TMSH (trimethylsulfonium hydroxide in methanol. Soluble sugars were extracted from defatted and dried samples of barley flour with 96% ethanol, and further derivatized into the corresponding trimethylsilyl (TMS oximes, using hydroxylamine hydrochloride solution and BSTFA (N,O-bis-(trimethylsilyl-trifluoroacetamide. The hexane and alcoholic extracts of barley cultivars were analyzed by GC-MS system. Lipid and sugar compositions were very similar in all barley cultivars. Therefore, multivariate analysis was applied to numerical values of automatically integrated areas of the identified fatty acid methyl esters and TMS oximes of soluble sugars. The application of hierarchical cluster analysis showed a great similarity between the investigated flour samples of barley cultivars, according to their fatty acid content (0.96. Also, significant, but somewhat less similarity was observed regarding the content of soluble sugars (0.70. These preliminary results indicate the possibility of distinguishing flour made of barley, regardless of the variety, from flours made of other cereal species, just by the analysis of the contents of fatty acids and soluble sugars.[Projekat Ministarstva nauke Republike Srbije, br. TR 31066


    Directory of Open Access Journals (Sweden)

    Imre Kádár


    Full Text Available Four levels of N, P and K nutrition (poor, moderate, satisfactory and high and all their possible combinations with 64 treatments in two replications (128 plots were studied in a long term field trial on barley yield and malting quality. A standard East-European spring barley "Opal" (bred in Czechoslovakia was grown in 1986, 13th year of the agricultural experiment, involving various crops in previous years, on a calcareous loamy chernozem soil. The optimum fertility levels for yield enhancement resulted in the poorest malting quality: low modification and extract but long saccharification time and high protein. To solve this problem the brewing industry will have to apply the well-known technological methods available since growers are not likely to give up their fertilizers. Applying soil and plant analysis data, having knowledge about both soil and plant optimum values, the danger of the excessive use of fertilizers can be realized and decreased.

  3. Chemical weed control in barley (hordeum vulgare)

    International Nuclear Information System (INIS)

    Effect of two different pre-emergence herbicides i.e. Terbutryn (lgron-500FW) A, 1.01.25 kg a.t. ha/sup -1/ and Flurochloridone (Racer-25 CS) a 0.31, 0.37, 0.44, 0.50 and 0.56 Kg a.i. ha/sup -1/ on weeds and yield of barley wad studied under field conditions hb/sup -1/. All the herbicides significantly reduce the dry weight of weed Maximum reduction (70%) was observed in terbutryn a 1.0 Kg a.i. ha/sup -1/ Growth and yield parameters like number of spike lets per spike. Number of grams per spike. 1000-grain weight. Biological yield. Grain yield straw yield and harvest index showed significant response to various herbicides doses under study. Application of Flurochloridone (Racer-25 (CS) a 0.44 kg a.i. ha/sup -1/ and Terbutryn (lgran-500 FW) a 1.0 kg a.i). The data further revealed that in general all herbicide application treatments exhibited superior performance in respect of growth and yield over control. (author)

  4. High capacity of plant regeneration from callus of interspecific hybrids with cultivated barley (Hordeum vulgare L.)

    DEFF Research Database (Denmark)

    Bagger Jørgensen, Rikke; Jensen, C. J.; Andersen, B.; Bothmer, R. von


    Callus was induced from hybrids between cultivated barley (Hordeum vulgare L. ssp. vulgare) and ten species of wild barley (Hordeum L.) as well as from one backcross line ((H. lechleri .times. H. vulgare) .times. H. vulgare). Successful callus induction and regeneration of plants were achieved from...... explants of young spikes on the barley medium J 25-8. The capacity for plant regeneration was dependent on the wild parental species. In particular, combinations with four related wild species, viz. H. jubatum, H. roshevitzii, H. lechleri, and H. procerum, regenerated high numbers of plants from calli....

  5. Triple Hybridization with Cultivated Barley (Hordeum vulgare L.)

    DEFF Research Database (Denmark)

    Bothmer, R. von; Claesson, L.; Flink, J.; Linde-Laursen, I.


    A crossing programme for trispecific hybridization including cultivated barely (Hordeum vulgare L.) as the third parent was carried out. The primary hybrids comprised 11 interspecific combinations, each of which had either H. jabatum or H. lechleri as one of the parents. The second parent...

  6. Development and Meiosis of Three Interspecific Hybrids with Cultivated Barley (Hordeum vulgare L.)

    DEFF Research Database (Denmark)

    Von Bothmer, R.; Flink, J.; Linde-Laursen, Ib


    The development and meiosis of three interspecific hybrids between cultivated barley (Hordeum vulgare L.) and H. secalinum Schreb., H. tetraploidum Covas, and H. parodii Covas, respectively, were studied. All three hybrid combinations developed very slowly vegetatively. Meiosis of the hybrids was...

  7. NAC Transcription Factors of Barley (Hordeum vulgare L.) and their Involvement in Leaf Senescence

    DEFF Research Database (Denmark)

    Wagner, Michael

    parts of the senescence process. The specific aims of this study were therefore (1) to establish and characterise the NAC transcription factors of the model cereal crop barley (Hordeum vulgare L.) (2) to identify and study putative barley NAC transcription factors involved in the regulation of leaf...

  8. Dataset for transcriptional response of barley (Hordeum vulgare) exposed to drought and subsequent re-watering. (United States)

    Kokáš, Filip; Vojta, Petr; Galuszka, Petr


    Barley (Hordeum vulgare) is an economically important species, which can be cultivated in environmentally adverse conditions due to its higher tolerance in contrast to other cereal crops. The draft of H. vulgare genome is available already for couple of years; however its functional annotation is still incomplete. All available databases were searched to expand current annotation. The improved annotation was used to describe processes and genes regulated in transgenic lines showing higher tolerance to drought in our associated article, doi:10.1016/j.nbt.2016.01.010 (Vojta et al., 2016) [1]. Here we present whole transcriptome response, using extended annotation, to severe drought stress and subsequent re-watering in wild-type barley plants in stem elongation phase of growth. Up- and down-regulated genes fall into distinct GO categories and these enriched by stress and revitalization are highlighted. Transcriptomic data were evaluated separately for root and aerial tissues. PMID:27331111

  9. Identification of a phytase gene in barley (Hordeum vulgare L..

    Directory of Open Access Journals (Sweden)

    Fei Dai

    Full Text Available BACKGROUND: Endogenous phytase plays a crucial role in phytate degradation and is thus closely related to nutrient efficiency in barley products. The understanding of genetic information of phytase in barley can provide a useful tool for breeding new barley varieties with high phytase activity. METHODOLOGY/PRINCIPAL FINDINGS: Quantitative trait loci (QTL analysis for phytase activity was conducted using a doubled haploid population. Phytase protein was purified and identified by the LC-ESI MS/MS Shotgun method. Purple acid phosphatase (PAP gene was sequenced and the position was compared with the QTL controlling phytase activity. A major QTL for phytase activity was mapped to chromosome 5 H in barley. The gene controlling phytase activity in the region was named as mqPhy. The gene HvPAP a was mapped to the same position as mqPhy, supporting the colinearity between HvPAP a and mqPhy. CONCLUSIONS/SIGNIFICANCE: It is the first report on QTLs for phytase activity and the results showed that HvPAP a, which shares a same position with the QTL, is a major phytase gene in barley grains.

  10. Triple Hybridization with Cultivated Barley (Hordeum vulgare L.)

    DEFF Research Database (Denmark)

    Bothmer, R. von; Claesson, L.; Flink, J.;


    represented species closely or distantly related to H. jubatum and H. lechleri. In trispecific crosses with diploid barley, the seed set was 5.7%. Crosses with tetraploid barley were highly unsuccessful (0.2% seed set). Three lines of diploid barley were used in the crosses, i.e. 'Gull', 'Golden Promise' and...... 'Vada'. Generally, cv 'Gull' had high crossability in crosses with related species in the primary hybrid. It is suggested that 'Gull' has a genetic factor for crossability not present in cv 'Vada' and cv 'Golden Promise'. One accession of H. brachyantherum used in the primary hybrid had a very high...... crossability (seed set 54.7%) in combination with cv 'Vada' but no viable offspring was produced. In all, two trispecific hybrids were raised, viz. (H. lechleri .times. H. brevisubulatum) .times. 'Gull' (2n = 27-30) and (H. jubatum .times. H. lechleri) .times. 'Gull' (2n = 20-22). The first combination...

  11. Molecular analysis of genome instability in barley (Hordeum vulgare)

    International Nuclear Information System (INIS)

    A reliable protocol for regenerating barley from seedling explants, including leaf bases with a complete apical meristem, has been developed at the Institute of Genetic Engineering. The system was established with Bulgarian barley cultivars (Ruen, Karnobat, Obzor and Yubilei) and reconstructed genotypes (K. Gecheff IG). Pretreatment of the mature embryos with a high concentration of 2.4D generated valuable and stable genetic deviations in the regenerants. The brewery cultivar Ruen was selected as the model genotype. It has been demonstrated that genetic variations, such as higher yield, earlier maturation and lower protein content, have been induced and maintained for 5 years. Comparative experiments, including treatment of barley mature seeds with 60Co gamma rays (10 and 20 krad) and sodium azide (1.10-3 M and 5 x 10-4 M), were also carried out. The results obtained showed that both treatments stimulated calusogenesis and regeneration of the plants. Molecular markers such as proteins, restriction fragment length polymorphisms (RFLPs) and random amplified polymorphic DNAs (RAPDs) were applied in studies on the mutagenic effects of 2.4D, gamma rays and sodium azide, and a combination threof, on the quality and quantity of the genetic diversification generated in tissue culture of the Bulgarian barley cultivars Ruen, Karnobat, Obzor and Yubilei and the reconstructed genotypes

  12. Characterization of microRNAs and their targets in wild barley (Hordeum vulgare subsp. spontaneum) using deep sequencing. (United States)

    Deng, Pingchuan; Bian, Jianxin; Yue, Hong; Feng, Kewei; Wang, Mengxing; Du, Xianghong; Weining, Song; Nie, Xiaojun


    MicroRNAs (miRNA) are a class of small, endogenous RNAs that play a negative regulatory role in various developmental and metabolic processes of plants. Wild barley (Hordeum vulgare subsp. spontaneum), as the progenitor of cultivated barley (Hordeum vulgare subsp. vulgare), has served as a valuable germplasm resource for barley genetic improvement. To survey miRNAs in wild barley, we sequenced the small RNA library prepared from wild barley using the Illumina deep sequencing technology. A total of 70 known miRNAs and 18 putative novel miRNAs were identified. Sequence analysis revealed that all of the miRNAs identified in wild barley contained the highly conserved hairpin sequences found in barley cultivars. MiRNA target predictions showed that 12 out of 52 miRNA families were predicted to target transcription factors, including 8 highly conserved miRNA families in plants and 4 wheat-barley conserved miRNA families. In addition to transcription factors, other predicted target genes were involved in diverse physiological and metabolic processes and stress defense. Our study for the first time reported the large-scale investigation of small RNAs in wild barley, which will provide essential information for understanding the regulatory role of miRNAs in wild barley and also shed light on future practical utilization of miRNAs for barley improvement. PMID:27100818

  13. Localising QTLs for leaf rust resistance and agronomic traits in barleyHordeum vulgare¤ L.)

    DEFF Research Database (Denmark)

    Kicherer, S.; Backes, G.; Walther, U.; Jahoor, A.


    The Hordeum vulgare accession 'HOR 1063' was crossed with the barley cultivar Krona, and 220 doubled haploid lines were produced based on this cross. A molecular map was constructed based on RFLP markers. Field trials were performed over 2 years and at two locations. In field trials, resistance t...

  14. Geography of Genetic Structure in Barley Wild Relative Hordeum vulgare subsp. spontaneum in Jordan. (United States)

    Thormann, Imke; Reeves, Patrick; Reilley, Ann; Engels, Johannes M M; Lohwasser, Ulrike; Börner, Andreas; Pillen, Klaus; Richards, Christopher M


    Informed collecting, conservation, monitoring and utilization of genetic diversity requires knowledge of the distribution and structure of the variation occurring in a species. Hordeum vulgare subsp. spontaneum (K. Koch) Thell., a primary wild relative of barley, is an important source of genetic diversity for barley improvement and co-occurs with the domesticate within the center of origin. We studied the current distribution of genetic diversity and population structure in H. vulgare subsp. spontaneum in Jordan and investigated whether it is correlated with either spatial or climatic variation inferred from publically available climate layers commonly used in conservation and ecogeographical studies. The genetic structure of 32 populations collected in 2012 was analyzed with 37 SSRs. Three distinct genetic clusters were identified. Populations were characterized by admixture and high allelic richness, and genetic diversity was concentrated in the northern part of the study area. Genetic structure, spatial location and climate were not correlated. This may point out a limitation in using large scale climatic data layers to predict genetic diversity, especially as it is applied to regional genetic resources collections in H. vulgare subsp. spontaneum. PMID:27513459

  15. Geography of Genetic Structure in Barley Wild Relative Hordeum vulgare subsp. spontaneum in Jordan (United States)

    Reeves, Patrick; Reilley, Ann; Engels, Johannes M. M.; Lohwasser, Ulrike; Börner, Andreas; Pillen, Klaus; Richards, Christopher M.


    Informed collecting, conservation, monitoring and utilization of genetic diversity requires knowledge of the distribution and structure of the variation occurring in a species. Hordeum vulgare subsp. spontaneum (K. Koch) Thell., a primary wild relative of barley, is an important source of genetic diversity for barley improvement and co-occurs with the domesticate within the center of origin. We studied the current distribution of genetic diversity and population structure in H. vulgare subsp. spontaneum in Jordan and investigated whether it is correlated with either spatial or climatic variation inferred from publically available climate layers commonly used in conservation and ecogeographical studies. The genetic structure of 32 populations collected in 2012 was analyzed with 37 SSRs. Three distinct genetic clusters were identified. Populations were characterized by admixture and high allelic richness, and genetic diversity was concentrated in the northern part of the study area. Genetic structure, spatial location and climate were not correlated. This may point out a limitation in using large scale climatic data layers to predict genetic diversity, especially as it is applied to regional genetic resources collections in H. vulgare subsp. spontaneum. PMID:27513459

  16. Hordein variation in Brazilian barley varieties (Hordeum vulgare L. and wild barley (H. euclaston Steud. and H. stenostachys Godr.

    Directory of Open Access Journals (Sweden)

    Echart-Almeida Cinara


    Full Text Available SDS-PAGE was used to analyze the hordein polypeptide patterns of Brazilian barley varieties (Hordeum vulgare L. and of two native species of Hordeum from southern Brazil (H. euclaston Steud. and H. stenostachys Godr.. Forty different hordein polypeptide bands with molecular weights ranging from 30 to 94 kDa were found in the seeds of the three species studied. Twelve of the 14 varieties examined showed intravarietal polymorphism. The number of bands ranged from 10 to 17, depending on the variety, and from 3 to 13 among individual seeds, with a total of 26 bands in H. vulgare. Phenograms using each seed as an operational taxonomic unit (OTU showed that the seeds from most varieties did not form distinct clusters. Seeds from different plants of the native species varied considerably. The molecular weights of the hordein polypeptides of the two native species were quite different from those of H. vulgare. There was a greater similarity between the native species than with H. vulgare, although H. stenostachys was slightly closer to the cultivated species than H. euclaston.

  17. Evaluation of Toxic Effects and Bioaccumulation of Cadmium and Copper in Spring Barley (Hordeum vulgare L.

    Directory of Open Access Journals (Sweden)

    Jūratė Žaltauskaitė


    Full Text Available This paper deals with the analysis of toxic effects of cadmium and copper on the growth of spring barley (Hordeum vulgare L. cultivated in hydroponics. The seedlings of barley were treated with four different concentrations of cadmium and copper, ranging from 0.1 to 10 mg L-1. The aim of the study was to assess toxic effects of cadmium (Cd and copper (Cu on the growth of spring barley, and to determine metal accumulation in above-ground and underground parts of the plant. The impact of Cu and Cd on photosynthetic pigments (chlorophyll a, b, the content of malondialdehyde (MDA, and the essential micronutrients (Mn, Fe were examined. Metal treatment reduced the growth of roots (by 60%, shoots (Cd – 48 %, Cu – 57% and dry weight (Cd – 47 %, Cu – 52% of barley. Exposure to metals altered the content of photosynthetic pigments and caused lipid peroxidation. Regression analysis revealed that there was significant negative relationship between MDA content and biomass of barley treated with Cu (r=-0.99, p=0.01. The examined heavy metals were accumulated mainly in the roots and bioconcentration of Cu there was higher than that of Cd, indicating that roots tended to accumulate higher amounts of Cu than Cd. Though translocation of Cd from roots to above-ground tissues was higher, higher levels of Cd were observed in leaves.DOI:

  18. The Discovery of Resistant Sources of Spring Barley, Hordeum vulgare ssp. spontaneum, and Unique Greenbug Biotypes. (United States)

    Armstrong, J Scott; Mornhinweg, Dolores W; Payton, Mark E; Puterka, Gary J


    The genetic sources for host-plant resistance to the greenbug (Schizaphis graminum Rondani) in barley (Hordeum vulgare ssp. spontaneum) are limited in that only two single dominant genes Rsg1 and Rsg2 are available for the complex of greenbug biotypes. We evaluated four new barley lines from the Wild Barley Diversity Collection (WBDC) that previously showed potential for greenbug resistance. Three of those entries, WBDC 53, WBDC 117, WBDC 336, exhibited very dominant sources of resistance to older known biotypes B, C, E, F, H, I, and TX1, which also add to the host-plant differentials used to separate these greenbug biotypes. We also re-evaluated the earlier known set of greenbug biotypes that have been in culture for several years against the known host-plant differentials, and included seven newer greenbug isolates collected from Wyoming to the full complement of small grain differentials. This resulted in the discovery of five new greenbug biotypes, WY10 MC, WY81, WY10 B, WY12 MC, and WY86. Wyoming isolates WY4 A and WY4 B were identical in their phenotypic profile, and should be combined as a single unique greenbug biotype. These barley trials resulted in finding new sources of host-plant resistance, although more research needs to be conducted on what type of resistance was found, and how it can be used. We also document that the Wheatland, Wyoming area serves as a very conducive environment for the development of new greenbug biotypes. PMID:26527793

  19. Cloning and characterization of four B-hordein genes from Tibetan hull-less barley (Hordeum vulgare subsp. vulgare). (United States)

    Han, Zhao-Xue; Qian, Gang; Pan, Zhi-Fen; Deng, Guang-Bing; Wu, Fang; Tang, Ya-Wei; Qiang, Xiao-Lin; Yu, Mao-Qun


    Four B-hordein genes, designated BH1-BH4, were cloned using PCR amplification from two hull-less barley cultivars, ZQ7239 and ZQ148, collected from Tibet. The results of sequencing indicated that BH1-BH4 contained complete open reading frames (ORFs). Comparison of their predicted polypeptide sequences with the published sequences suggested that they all share the same basic protein structure. Phylogenetic analysis indicated that the deduced amino-acid sequences of BH1-BH4 genes were more closely related to B-hordeins from cultivated barley (Hordeum vulgare L.) than to any other prolamins from wild barley and Aegilops tauschii. Comparison of the coding regions of BH1-BH4 genes showed that BH1 had a lower sequence identity to other previously published B-hordeins than the other three B-hordeins obtained in this study. BH1 was then cloned in a bacterial expression vector based on bacteriophage T7 RNA polymerase. The resulting plasmid produced a 28.15 kDa protein in Escherichia coli. The potential value of B-hordein genes in grain quality improvement of hull-less barley has been discussed. PMID:17046594

  20. Evaluation of barley (hordeum vulgare l.) germplasm for high forage production under salt stress

    International Nuclear Information System (INIS)

    To explore high biomass producing salt tolerant cultivars of a potential forage crop barley (Hordeum vulgare L.), 30-day old plants of 105 different accessions from different origin were subjected to saline and non-saline (control) conditions for 45 days. Salinity stress (150 mM NaCl) markedly suppressed plant growth (shoot and/or root fresh and dry weights), chlorophyll pigments (a and b), internal CO/sub 2/ concentration, stomatal conductance, rate of transpiration and photosynthesis, while a considerable salt-induced increase was observed in all fluorescence related attributes including efficiency of photosystem-II (Fv/Fm), co-efficient of non-photochemical quenching (QN), photochemical quenching (QP), and non-photochemical quenching (NPQ) in all 105 accessions of barley. The response of all 105 barley accessions to salt stress varied significantly for all the morpho-physiological attributes determined in the present study. Overall, on the basis of shoot and root dry weights, accessions, 4050, 4053, 4056, 4163, 4228, 4229, 4244, 4245, 4290, 4414, 4415, 4427, 4452, Mahali, Jesto, 4165, 4229, 4249, 4405, 4409, 4426, 4456, and Giza 123 were found superior while accessions, 4245, 4158, 4166, 4246, 4406, 4423, 4441, 4442 4447, 4453 and 4458 inferior under saline conditions. (author)

  1. Mixed cropping of barley (Hordeum vulgare) and wheat (Triticum aestivum) landraces in the central highlands of Eritrea


    Woldeamlak, A.


    A common cropping system in the central highlands of Eritrea is mixed cropping of barley (Hordeum vulgare) and wheat (Triticum aestivum); it is called hanfetz (Tigrigna word). Mixtures may give higher yield, better yield stability, better food quality and more animal feed. Factors affecting the productivity of mixtures include genotype combination, crop density and component crop ratio.Grain yields differed significantly among genotype combinations in certain years. A combination of Ardu 12/6...

  2. Effects of Dosages and Application Periods of EDTA on Morphological and Cytogenetic Characters of Barley (Hordeum vulgare L.) Seedlings


    İLBAŞ, Ali İrfan; EROĞLU, Yasemin; EROĞLU, Halil Erhan


    Ethylenediaminetetraacetic acid (EDTA) has many applications in plant research in addition to other applications, such as chelation and medical therapy. The morphological and cytogenetic effects of EDTA on barley seedlings were investigated in the present study. Seeds of Hordeum vulgare L. were treated with different doses of EDTA (30, 60, 90, 120 and 150 mmol/l) and 2 different application periods (20 and 22 h). Except mitotic index, all of the measurements for the investigated characters we...

  3. Barley (Hordeum vulgare) and Kiwicha (Amaranthus caudatus) Improvement by Mutation Induction in Peru

    International Nuclear Information System (INIS)

    In order to increase food availability and household incomes of families in the Andean region of Peru, a mutation induction method was applied to improve barley (Hordeum vulgare) and kiwicha (Amaranthus caudatus) cultivars. Barley cultivar Buenavista was treated with 200 and 300Gy inducing different kinds of mutations. Twenty promising mutant lines were selected and have been evaluated at the national trials. From them Mbv-Earlier, from 300Gy dose was selected and released in 2006 as a new cultivar denominated Centenario. This cultivar has a high yield potential (5,552 kg/ha), resistance to stripe rust (P. striiformis f sp hordei) and better food quality than the parental cultivar. Kiwicha traditional cultivar Seleccion Ancash treated with 400Gy , identified a higher yield mutant denominated Centenario Cultivar. At farmer location in the coast the yield has a variation of 3,500 to 5,500 kg/ha and in the highland from 2,500 to 3,700 kg/ha. The better yield potential, tolerance to Sclerotinia sp, color and size of its grains have contributed in the preference of Centenario over other commercial cultivars. (author)

  4. Auxin effects on somaclonal variation and plant regeneration from mature embryo of barley (hordeum vulgare L.)

    International Nuclear Information System (INIS)

    Crop improvement through genetic engineering depends on effective and reproducible plant regeneration systems. In barley (Hordeum vulgare L.), immature embryos are the most commonly used as explant source for In vitro regeneration and genetic transformation but, mature embryos are alternative to immature embryo due to the fact that they have advantages such as easy storage and ready availability throughout the year. The effects of different concentrations (2, 4, 6, 8, 10 and 12 mg/l) of three auxins (2,4-D, dicamba and picloram) were evaluated in mature embryo culture of barley. Calli, embryogenic calli and regenerated plants were observed in all of the studied auxins. The MS (Murashige and Skoog basal medium) containing 12 mg/l dicamba was found to be the most effective for embryogenic callus, responded embryogenic callus and regeneration efficiency. Plant tissue culture can bring about genetic changes that are known as somaclonal variation. Genetic and epigenetic changes were examined by RAPD (Randomly Amplified Polymorphic DNA) and CRED-RA (Coupled Restriction Enzyme Digestion-Random Amplification) techniques, respectively. Increased auxin concentration led to the decrease in the GTS (Genomic Template Stability) value. DNA hypermethylation occurred in higher concentrations of 2,4-D and picloram, while DNA hypomethylation was observed in dicamba. (author)

  5. Genetic Diversity Assessment in Several Barley (Hordeum vulgare L. Cultivars Using Microsatellite Markers

    Directory of Open Access Journals (Sweden)

    Mohammad Reza BLORI-MOGHADAM


    Full Text Available In the present study, genetic diversity in seven cultivars of cultivated barley (Hordeum vulgare populations was evaluated using 10 microsatellite markers. Genomic DNA was extracted from fresh leaves and amplification reactions were done by PCR. The amplification products were separated on 6% denaturing polyacrylamide gels containing 7M urea and visualized via silver staining method. High level of polymorphism was observed among populations. Polymorphic bands ranged from 100 to 300 bp. Altogether 65 alleles were observed among all genotypes, with an average of 9.2 alleles per locus for all loci. Polymorphic information content (PIC ranged from 0.80 to 0.88 with an average of 0.84. �Sahand� populations showed the lowest mean of gene diversity whereas the highest mean of heterozygosity observed in Rayhan populations that can prepare a powerful resource of genetic diversity for breeding programs. The genotypes were clustered using unweight pair-group method on arithmetic average by POPGEN32 software. The dendrogram discriminated all the genotypes in several groups. The results showed that SSR markers have a high ability to reveal most of the information in a single locus and can be used for genetic analysis in molecular levels determination of genetic similarity and clustering barley cultivars.

  6. The Influence of Processing by Impulse Pressure on the Productivity of the Don Barley (Hordeum vulgare L.

    Directory of Open Access Journals (Sweden)

    Pavlova Violetta Aleksandrovna


    Full Text Available Plant productivity is the important indicator, which determines the amount of yield. The productivity of plants depends on the number of bruchids per plant and on the weight of 1000 bruchids. The article studies the influence of impulse pressure of various magnitudes on plant productivity of Don barley (Hordeum vulgare L.. It was found that the pressure of 17 MPa was the most effective for increasing the productivity. Impulse pressure of other magnitudes also had influence on the productivity of Don barley.

  7. Changes in Physiological and Agronomical Parameters of Barley (Hordeum vulgare) Exposed to Cerium and Titanium Dioxide Nanoparticles


    Luca Marchiol; Alessandro Mattiello; Filip Pošćić; Guido Fellet; Costanza Zavalloni; Elvio Carlino; Rita Musetti


    The aims of our experiment were to evaluate the uptake and translocation of cerium and titanium oxide nanoparticles and to verify their effects on the growth cycle of barley (Hordeum vulgare L.). Barley plants were grown to physiological maturity in soil enriched with either 0, 500 or 1000 mg·kg−1 cerium oxide nanoparticles (nCeO2) or titanium oxide nanoparticles (nTiO2) and their combination. The growth cycle of nCeO2 and nTiO2 treated plants was about 10 days longer than the controls. In nC...

  8. Further molecular evidence for the Hordeum vulgare ssp. spontaneum in Tibet as ultimate progenitor of Chinese cultivated barley

    Institute of Scientific and Technical Information of China (English)


    106 accessions of Tibetan wild barley, including 50 accessions of the two-rowed wild barley Hordeum vulgare ssp. spontaneum(HS), 27 accessions of the six-rowed bottle-shaped wild barley H. lagunculiforme(HL) and 29 accessions of the six-rowed wild barley H. agriocrithon(HA) that separately represent different agrigeographical regions of Tibet, were used to study the genetic diversity and genetic differentiation using SSR markers selected from seven barley linkage groups. 229 allelic variants were identified with an average of 7.6 alleles/locus. The average of total number of alleles per locus in HA(6.4) is much higher than that in HS(3.9) and HL(3.4). The genetic diversity and its standard deviation among the three subspecies were in the order of HS>HL>HA. Very significant genetic differentiation was observed among the three subspecies of wild barley. Comparisons of the results from this and previous studies showed a strong Oriental-Occidental differentiation of barley, and that Shannan region of Tibet might be the center of origin of the Tibetan two-rowed wild barley, thus supporting not only the hypothesis of a mono-phyletic origin of cultivated barley but also the proposition that the Tibetan two-rowed wild barley as ultimate progenitor of Chinese cultivated barley.

  9. Generation mean analysis of grain yield and its related traits in barley (Hordeum vulgare L.

    Directory of Open Access Journals (Sweden)

    R. S. Raikwar


    Full Text Available Generation mean analysis was performed using three crosses namely DL 88 x K 560, K 603 x Azad, RD 2552 x NDB 1020 to study the nature and magnitude of gene effects for yield and its component characters in barley (Hordeum vulgare L.. The F1, F2, BC1 and BC2 of these crosses along with P1 and P2 were studied for six morphological traits. Additive x additive (i epistatic effect was more important and higher than the dominance x dominance (l epistatic effect in the inheritance of no. of effective tillers/plant in DL88 x K560, length of main spike and grain yield/plant in RD 2552 x NDB1020. The length of main spike, weight of grains/main spike, 1000-grain weight and grain yield/plant were significantly higher in RD 2552 x NDB 1020.Thus, these characters were mainly under the control of dominance x dominance (l type of epistasis. Therefore, selection for these characters would be fruitful, if delayed till dominance and epistasis effects are reduced to minimum. The additive × additive (i type gene interaction and duplicate epistasis also seen in this trait suggest the possibilities of obtaining transgressive segregants in later generations. The study revealed the importance of both additive and non-additive types of gene interaction for all the traits studied.

  10. Complete genomic sequence of barley (Hordeum vulgare) endornavirus (HvEV) determined by next-generation sequencing. (United States)

    Candresse, Thierry; Marais, Armelle; Sorrentino, Roberto; Faure, Chantal; Theil, Sébastien; Cadot, Valérie; Rolland, Mathieu; Villemot, Julie; Rabenstein, Frank


    Endornaviruses are unusual plant-, fungus- and oomycete-infecting viruses with a large, ca 14- to 17-kb linear double-stranded RNA (dsRNA) genome and a persistent lifestyle. The complete genome sequence of an endornavirus from the barley (Hordeum vulgare) Nerz variety was determined from paired Illumina MySeq reads derived from purified dsRNAs. The genome is 14,243 nt long, with 5' and 3' non-coding regions of 207 and 47 nt, respectively. It encodes a single large protein of 4663 amino acids that carries conserved motifs for a methyltransferase, a helicase and an RNA-dependent RNA polymerase. The sequence of Hordeum vulgare endornavirus (HvEV) carries all the hallmarks of a typical member of the genus Endornavirus, with the exception of an UDP-glycosyltransferase motif observed in many, but not all, endornaviral genomes. PMID:26666441

  11. Zinc Blotting Assay for Detection of Zinc-Binding Prolamin in Barley (Hordeum vulgare) Grain

    DEFF Research Database (Denmark)

    Uddin, Mohammad Nasir; Langkilde, Ane; Vincze, Éva


    -binding protein. However, to our knowledge so far this zinc blotting assay has never been applied to detect a prolamin fraction in barley grains. A radioactive zinc (65ZnCl2) blotting technique was optimized to detect zinc-binding prolamins, followed by development of an easy-to-follow nonradioactive colorimetric......In plants, zinc is commonly found bound to proteins. In barley (Hordeum vulgare), major storage proteins are alcohol-soluble prolamins known as hordeins, and some of them have the potential to bind or store zinc. 65Zn overlay and blotting techniques have been widely used for detecting zinc...... zinc blotting method with a zinc-sensing dye, dithizone. Hordeins were extracted from mature barley grain, separated by SDS-PAGE, blotted on a membrane, renatured, overlaid, and probed with zinc; subsequently, zinc-binding specificity of certain proteins was detected either by autoradiography or color...

  12. Nitrogen uptake by Azospirillum brasilense inoculated barley (Hordeum vulgare L.) as influenced by N and P fertilization

    International Nuclear Information System (INIS)

    Response of barley (Hordeum vulgare L.) in a sandy-loam soil under potted conditions revealed that application of nitrogen and phosphorus increased the population of Azospirillium in the barley rhizosphere. A two fold increase was observed in the Azospirillium population at 80 days compared to that at 40 days of plant growth. The unsterilized inoculated roots had more population than the surface sterilized inoculated roots. Increased drymatter production of barley was obtained in A. brasilense inoculated N0P1 (0 kg N and 30 kg P2O5 ha-1) treatment than uninoculated control. Also N and P uptake was higher in A. brasilense inoculated plants in the presence of both N and P fertilizers. The 15N data revealed that at harvest nearly 36 per cent of the total N uptake was from the nitrogen fixed by A. brasilense irrespective of P treatment. (author). 16 refs., 4 tabs

  13. Luteibacter rhizovicinus gen. nov., sp nov., a yellow-pigmented gammaproteobacterium isolated from the rhizosphere of barley (Hordeum vulgare L.)

    DEFF Research Database (Denmark)

    Johansen, Jens E.; Binnerup, Svend J.; Kroer, Niels;


    Three strains of Gram-negative, aerobic, yellow-pigmented, chemo-organotrophic bacteria, motile by a polar flagellum, were isolated from the rhizosphere of spring barley (Hordeum vulgare L.) at a research field near Copenhagen, Denmark. The three strains, LJ79, LJ96(T) and LJ99, formed visible...... colonies on one-tenth-strength tryptic soy broth supplemented with agar (1/10 TSBA) after incubation for 6 days at 15 degrees C. The strains hydrolysed starch, casein (skimmed milk), gelatin and various pentoses and hexoses and grew on MacConkey agar and full-strength TSBA. Growth on 1/10 TSBA occurred at...

  14. Efficient production of tetraploid barley (Hordeum vulgare L.) by colchicine treatment of diploid barley


    Ayed Sourour; Bouharb Ameni; Cherif Mejda


    An experiment was conducted to induce tetraploidy in three diploid barley varieties (Martin, Rihane and Manel) through different colchicines treatments. Colchicine was added for three different concentrations at three different stages of plant development i.e. on seed (0.05% for 48 hours), on pre-germinated seeds (0.1% for 2 hours) and on three leaf stage (0.1% for 16 hours). Colchicine application reduced significantly germination percentage and viability of plants. Seed germinat...

  15. Efficient production of tetraploid barley (Hordeum vulgare L. by colchicine treatment of diploid barley

    Directory of Open Access Journals (Sweden)

    Ayed Sourour


    Full Text Available An experiment was conducted to induce tetraploidy in three diploid barley varieties (Martin, Rihane and Manel through different colchicines treatments. Colchicine was added for three different concentrations at three different stages of plant development i.e. on seed (0.05% for 48 hours, on pre-germinated seeds (0.1% for 2 hours and on three leaf stage (0.1% for 16 hours. Colchicine application reduced significantly germination percentage and viability of plants. Seed germination was completely inhibited in Martin, while a reduction of 20% and 30% for germination percentage compared to control was recorded in varieties Manel and Rihane, respectively at 0.1% colchicine concentration. Ploidy evaluation showed no tetraploidy in all the three tested varieties by colchicine application of 0.05% for 48 hours on seeds and 0.1% for 2 hours on pre-germinated seeds. However, tetraploid plants were produced only by treatment with 0.1% for 16 hours of seedlings. The percentages of plants were 40%, 44% and 100% for Rihane, Manel and Martin, respectively. Cytological analyses showed the increase of chromosome numbers from 2n=2x=14 to 2n=4x=28. The increase of ploidy levels caused major changes in some morphological traits. In fact, the induced tetraploids in barley was accompanied by significant (P<0.01 decrease in plant height, tiller height, leaf number and leaf length compared to diploid control plants. colchicine treatment induce successfully the production of tetraploid barley plants and could be used in breeding programs.

  16. Influence of laser light on leaf area and parameters of photosynthetic activity in DH lines of spring barley (Hordeum vulgare L.)


    Garczyński S.; Rybiński W.


    The initial material for performed studies was constituted by hull and hull-less DH lines of spring barley (Hordeum vulgare L.). The kernels were irradiated with helium-neon laser (He-Ne) in red light spectrum and at the wavelength of 632 nm. Plants obtained in greenhouse conditions were analyzed for blade area and their photosynthetic activity in flag and penultimate leaves (photosynthetic and transpiration rate, photosynthetic gas efficiency). The results indicated a biostimulation effect o...

  17. BAC library resources for map-based cloning and physical map construction in barley (Hordeum vulgare L.

    Directory of Open Access Journals (Sweden)

    Wu Cheng-Cang


    Full Text Available Background Although second generation sequencing (2GS technologies allow re-sequencing of previously gold-standard-sequenced genomes, whole genome shotgun sequencing and de novo assembly of large and complex eukaryotic genomes is still difficult. Availability of a genome-wide physical map is therefore still a prerequisite for whole genome sequencing for genomes like barley. To start such an endeavor, large insert genomic libraries, i.e. Bacterial Artificial Chromosome (BAC libraries, which are unbiased and representing deep haploid genome coverage, need to be ready in place. Result Five new BAC libraries were constructed for barley (Hordeum vulgare L. cultivar Morex. These libraries were constructed in different cloning sites (HindIII, EcoRI, MboI and BstXI of the respective vectors. In order to enhance unbiased genome representation and to minimize the number of gaps between BAC contigs, which are often due to uneven distribution of restriction sites, a mechanically sheared library was also generated. The new BAC libraries were fully characterized in depth by scrutinizing the major quality parameters such as average insert size, degree of contamination (plate wide, neighboring, and chloroplast, empty wells and off-scale clones (clones with 250 fragments. Additionally a set of gene-based probes were hybridized to high density BAC filters and showed that genome coverage of each library is between 2.4 and 6.6 X. Conclusion BAC libraries representing >20 haploid genomes are available as a new resource to the barley research community. Systematic utilization of these libraries in high-throughput BAC fingerprinting should allow developing a genome-wide physical map for the barley genome, which will be instrumental for map-based gene isolation and genome sequencing.

  18. The impacts of BSMV on vegetative growth and water status in hulless barley (Hordeum vulgare var. nudum in VIGS study

    Directory of Open Access Journals (Sweden)

    Junjun Liang


    Full Text Available Barley stripe mosaic virus (BSMV is an established and extensively used virus-induced gene silencing (VIGS vector for gene function analysis in monocots. However, the phenotypes generated by targeted gene silencing may be affected or masked by symptoms of BSMV infection. To better understand the potential effects of BSMV-VIGS in hulless barley (Hordeum vulgare var. nudum, the accumulation pattern of BSMV and its impacts on vegetative growth and water status were investigated. The results indicated that the vegetative growth of infected plants was significantly and continuously impacted by BSMV from 10 to 40 days post inoculation (dpi. When the accumulation of BSMV was extremely high (7 to 11 dpi, infected plants displayed twisted leaf tips with an increased water lose rate (WLR and decreased water content (WC. Virus accumulation declined and stabilized after 25 dpi, at this stage, the WLR and WC were unaffected in the infected plants. The efficiency of VIGS was tested by the silencing of Phytoene desaturase (PDS. RT-qPCR indicated that BSMV-VIGS can be sustained with good efficiency for up to 40 dpi under an altered condition with lower temperature (22 ±1°C and higher relative humidity (70 ±10%. It was concluded that 25 to 40 dpi was the appropriate time zone for drought-related gene analysis by BSMV-VIGS under such condition.

  19. Bioaccumulation of cadmium by spring barley (Hordeum vulgare L. and its effect on selected physiological and morphological parameters

    Directory of Open Access Journals (Sweden)

    Miriama Kopernická


    Full Text Available Heavy metals and other toxic elements in the environment, mainly located in soil and groundwater, have a significant effect on plant and its productivity that has a huge attention in recent years. Accumulation of heavy metals in soil cause toxicity to plants, and contaminate the food chain. The industrial areas, as well as developing countries have been contaminated with high concentration of heavy metals. Main sources of contamination are mining and other industrial processes, as well as military and or lanfills, sludge dumps or waste disposal sites. The heavy metals are very dangerous to environment and pose serious danger to public health by entering throught the food chain or into drinking water. Phytoextraction is one way how to remove the contaminants from soil by plants. Phytoextraction of heavy metals is a technology that has been studied for several years. It is more ecological and cheaper way how to clean our environment.Several plant species are known becauce they hyperaccumulate a high contents of metals from the soil. The accumulators are mainly herbaceous species, crops and nowadays angiosperm trees with a high growth such as poplars or willows. We have focused on the determination of some morphological (lenght and weight of roots and biomass and physiological (contents of dry mass and number of lief stomata characteristics and the determination of the bioaccumulation factor and the translocation factor of cadmium by spring barley (Hordeum vulgare L.. Imprints of leaves were evaluated using an optical microscope Axiostar Plus, Carl Zeiss, lens CP Achromat 40x/0.65, eyepiece PI 10x / 18, Canon Utilities Software Zoom Browser EX 4.6 and hardware Acer Travel Mate 4600, Canon Power Shot A95. The density of stomata was evaluated on an area of 1 mm2. Samples of the dried plants (leaves and roots were mineralized by acid digestion using microwave digestion device MARS X - press 5. The end of determination to obtain the cadmium content was

  20. A flavonoid mutant of barley (Hordeum vulgare L.) exhibits increased sensitivity to UV-B radiation in the primary leaf

    International Nuclear Information System (INIS)

    The aim of the present investigation was to define the role of soluble flavonoids as UV-B protectants in the primary leaf of barley (Hordeum vulgare L.). For this purpose we used a mutant line (Ant 287) from the Carlsberg collection of proanthocyanidin-free barley containing only 7% of total extractable flavonoids in the primary leaf as compared to the mother variety (Hiege 550/75). Seven-day-old leaves from plants grown under high visible light with or without supplementary UV-B radiation were used for the determination of UV-B sensitivity. UV-B-induced changes were assessed from parameters of chlorophyll fluorescence of photosystem II, including initial and maximum fluorescence, apparent quantum yield, and photochemical and non-photochemical quenching. A quartz fibre-optic microprobe was used to evaluate the amount of potentially harmful UV-B (310 nm radiation) penetrating into the leaf as a direct consequence of flavonoid deficiency. Our data indicate an essential role of flavonoids in UV-B protection of barley primary leaves. In leaves of the mutant line grown under supplementary UV-B, an increase in 310nm radiation in the mesophyll and a strong decrease in the quantum yield of photosynthesis were observed as compared to the corresponding mother variety. Primary leaves of liege responded to supplementary UV-B radiation with a 30% increase in the major flavonoid saponarin and a 500% increase in the minor compound lutonarin. This is assumed to be an efficient protective response since no changes in variable chlorophyll fluorescence were apparent. In addition, a further reduction in UV-B penetration into the mesophyll was recorded in these leaves

  1. Adaptation and diversity along an altitudinal gradient in Ethiopian barley (Hordeum vulgare L. landraces revealed by molecular analysis

    Directory of Open Access Journals (Sweden)

    Bitocchi Elena


    Full Text Available Abstract Background Among the cereal crops, barley is the species with the greatest adaptability to a wide range of environments. To determine the level and structure of genetic diversity in barley (Hordeum vulgare L. landraces from the central highlands of Ethiopia, we have examined the molecular variation at seven nuclear microsatellite loci. Results A total of 106 landrace populations were sampled in the two growing seasons (Meher and Belg; the long and short rainy seasons, respectively, across three districts (Ankober, Mojanawadera and Tarmaber, and within each district along an altitudinal gradient (from 1,798 to 3,324 m a.s.l. Overall, although significant, the divergence (e.g. FST is very low between seasons and geographical districts, while it is high between different classes of altitude. Selection for adaptation to different altitudes appears to be the main factor that has determined the observed clinal variation, along with population-size effects. Conclusions Our data show that barley landraces from Ethiopia are constituted by highly variable local populations (farmer's fields that have large within-population diversity. These landraces are also shown to be locally adapted, with the major driving force that has shaped their population structure being consistent with selection for adaptation along an altitudinal gradient. Overall, our study highlights the potential of such landraces as a source of useful alleles. Furthermore, these landraces also represent an ideal system to study the processes of adaptation and for the identification of genes and genomic regions that have adaptive roles in crop species.

  2. The Effect of Different Gamma Radiation Doses Applied on Tokak 157/37 Barley (Hordeum vulgare) and Karahan 99 Wheat (Triticum aestivum) on M1 Generation


    Kara, Yeşim; Zeynep ERGÜN; Havser ERTEM VAİZOĞULLAR


    In this research study, the dose of different gamma radiation on seed germination of Hordeum vulgare TOKAK 157/37 barley kind and KARAHAN 99 wheatTriticum aestivum, and the mechanisms of the dose required to maximize the rate and percentage of germination and increased growth of root, seedling, TAEK was conducted in Ankara. The moisture rate has been %11, the barley and wheat seeds whose germination per cent is 98 % has been irradiated with 9 different doses between 0-600Gy in the centre of 6...

  3. Regrowth in Barley (Hordeum vulgare L.) and Rye (Secale cereale L.)

    DEFF Research Database (Denmark)

    Christiansen, J L; Jørgensen, Johannes Ravn; Jørnsgård, B; Stölen, O


    Regrowth after cutting at four development stages, from heading to grain maturity, was investigated in a pot experiment containing three rye and four barley varieties (including 2 Hordeum spontaneum lines). Regrowth in the barley varieties decreased strongly from heading to grain maturity. Rye ge...

  4. Purification and characterization of soluble (cytosolic) and bound (cell wall) isoforms of invertases in barley (Hordeum vulgare) elongating stem tissue (United States)

    Karuppiah, N.; Vadlamudi, B.; Kaufman, P. B.


    Three different isoforms of invertases have been detected in the developing internodes of barley (Hordeum vulgare). Based on substrate specificities, the isoforms have been identified to be invertases (beta-fructosidases EC The soluble (cytosolic) invertase isoform can be purified to apparent homogeneity by diethylaminoethyl cellulose, Concanavalin-A Sepharose, organo-mercurial Sepharose, and Sephacryl S-300 chromatography. A bound (cell wall) invertase isoform can be released by 1 molar salt and purified further by the same procedures as above except omitting the organo-mercurial Sepharose affinity chromatography step. A third isoform of invertase, which is apparently tightly associated with the cell wall, cannot be isolated yet. The soluble and bound invertase isoforms were purified by factors of 60- and 7-fold, respectively. The native enzymes have an apparent molecular weight of 120 kilodaltons as estimated by gel filtration. They have been identified to be dimers under denaturing and nondenaturing conditions. The soluble enzyme has a pH optimum of 5.5, Km of 12 millimolar, and a Vmax of 80 micromole per minute per milligram of protein compared with cell wall isozyme which has a pH optimum of 4.5, Km of millimolar, and a Vmax of 9 micromole per minute per milligram of protein.

  5. Sink-source proximity affecting photosynthate distributive pattern in barley (Hordeum Vulgare L.)

    International Nuclear Information System (INIS)

    Yielding ability of cereals is an interplay of source-sink capacities and is controlled presumably by physiological events at different growth stages. The translocation of 14C-sucrose from the flag leaf to the ears and other plant parts of the main tiller of barley (H. vulgare L. cv 292) were studied at its appearance (I), maturation (II) and senescence initiation (III) stages. At every stage, there was preferentially higher 14C-translocation from the flag leaf to the ears in comparison to other plant parts, indicating thereby the crucial role played by sink-source proximity in PHS'ate(photosynthate) Partg(partitioning). In order to ascertain such Partg behaviour of the different leaves on the main tiller at stage-II, the leaves starting basipetally, from flag to the fifth leaf, were labelled with 14C-sucrose and their relative translocation to the ears and roots were determined. There was a differential 14C-translocation to the sinks due to the change in the sink-source proximity, viz. >90% 14C were translocated to the ears from flag leaf, which declined to ≤5% only from the fifth leaf, the reverse being true for the roots. Further, spikelet's central grains preferentially accumulated more 14C-assimilates than the peripheral ones, probably due to being in close proximity to the unloading points. Thus, the distributive pattern of photoassimilates showed stage-specific quantitative changes and that the sink-source proximity played a crucial role in the PHS'ate Partg. (author). 3 figs., 29 refs

  6. Effects of Cerium and Titanium Oxide Nanoparticles in Soil on the Nutrient Composition of Barley (Hordeum vulgare L.) Kernels (United States)

    Pošćić, Filip; Mattiello, Alessandro; Fellet, Guido; Miceli, Fabiano; Marchiol, Luca


    The implications of metal nanoparticles (MeNPs) are still unknown for many food crops. The purpose of this study was to evaluate the effects of cerium oxide (nCeO2) and titanium oxide (nTiO2) nanoparticles in soil at 0, 500 and 1000 mg·kg−1 on the nutritional parameters of barley (Hordeum vulgare L.) kernels. Mineral nutrients, amylose, β-glucans, amino acid and crude protein (CP) concentrations were measured in kernels. Whole flour samples were analyzed by ICP-AES/MS, HPLC and Elemental CHNS Analyzer. Results showed that Ce and Ti accumulation under MeNPs treatments did not differ from the control treatment. However, nCeO2 and nTiO2 had an impact on composition and nutritional quality of barley kernels in contrasting ways. Both MeNPs left β-glucans unaffected but reduced amylose content by approximately 21%. Most amino acids and CP increased. Among amino acids, lysine followed by proline saw the largest increase (51% and 37%, respectively). Potassium and S were both negatively impacted by MeNPs, while B was only affected by 500 mg nCeO2·kg−1. On the contrary Zn and Mn concentrations were improved by 500 mg nTiO2·kg−1, and Ca by both nTiO2 treatments. Generally, our findings demonstrated that kernels are negatively affected by nCeO2 while nTiO2 can potentially have beneficial effects. However, both MeNPs have the potential to negatively impact malt and feed production. PMID:27294945

  7. Effects of Cerium and Titanium Oxide Nanoparticles in Soil on the Nutrient Composition of Barley (Hordeum vulgare L. Kernels

    Directory of Open Access Journals (Sweden)

    Filip Pošćić


    Full Text Available The implications of metal nanoparticles (MeNPs are still unknown for many food crops. The purpose of this study was to evaluate the effects of cerium oxide (nCeO2 and titanium oxide (nTiO2 nanoparticles in soil at 0, 500 and 1000 mg·kg−1 on the nutritional parameters of barley (Hordeum vulgare L. kernels. Mineral nutrients, amylose, β-glucans, amino acid and crude protein (CP concentrations were measured in kernels. Whole flour samples were analyzed by ICP-AES/MS, HPLC and Elemental CHNS Analyzer. Results showed that Ce and Ti accumulation under MeNPs treatments did not differ from the control treatment. However, nCeO2 and nTiO2 had an impact on composition and nutritional quality of barley kernels in contrasting ways. Both MeNPs left β-glucans unaffected but reduced amylose content by approximately 21%. Most amino acids and CP increased. Among amino acids, lysine followed by proline saw the largest increase (51% and 37%, respectively. Potassium and S were both negatively impacted by MeNPs, while B was only affected by 500 mg nCeO2·kg−1. On the contrary Zn and Mn concentrations were improved by 500 mg nTiO2·kg−1, and Ca by both nTiO2 treatments. Generally, our findings demonstrated that kernels are negatively affected by nCeO2 while nTiO2 can potentially have beneficial effects. However, both MeNPs have the potential to negatively impact malt and feed production.

  8. Heterologous expression of Hordeum vulgare cysteine protease in yeast

    DEFF Research Database (Denmark)

    Rosenkilde, Anne Lind; Dionisio, Giuseppe; Holm, Preben B;

    Cysteine Proteases accounts for more than 90 % of the total proteolytic activity in the degradation of barley seed storage proteins during germination. Several Cysteine proteases have been identified in barley. One of the key enzymes, Hordeum vulgare endoprotease B2 (HvEPB2) was cloned with and...

  9. Localisation of genes for resistance against ¤Blumeria graminis¤ f.sp. ¤hordei¤ and ¤Puccinia graminis¤ in a cross between a barley cultivar and a wild barleyHordeum vulgare¤ ssp. ¤spontaneum¤) line

    DEFF Research Database (Denmark)

    Backes, G.; Madsen, L.H.; Jaiser, H.; Stougaard, J.; Herz, M.; Mohler, V.; Jahoor, A.


    The aims of this investigation have been to map new (quantitative) resistance genes against powdery mildew, caused by Blumeria graminis f.sp. hordei L., and leaf rust, caused by Puccinia hordei L., in a cross between the barley (Hordeum vulgare ssp. vulgare) cultivar "Vada" and the wild barley...

  10. TaMSH7: A cereal mismatch repair gene that affects fertility in transgenic barley (Hordeum vulgare L.

    Directory of Open Access Journals (Sweden)

    Langridge Peter


    Full Text Available Abstract Background Chromosome pairing, recombination and DNA repair are essential processes during meiosis in sexually reproducing organisms. Investigating the bread wheat (Triticum aestivum L. Ph2 (Pairing homoeologous locus has identified numerous candidate genes that may have a role in controlling such processes, including TaMSH7, a plant specific member of the DNA mismatch repair family. Results Sequencing of the three MSH7 genes, located on the short arms of wheat chromosomes 3A, 3B and 3D, has revealed no significant sequence divergence at the amino acid level suggesting conservation of function across the homoeogroups. Functional analysis of MSH7 through the use of RNAi loss-of-function transgenics was undertaken in diploid barley (Hordeum vulgare L.. Quantitative real-time PCR revealed several T0 lines with reduced MSH7 expression. Positive segregants from two T1 lines studied in detail showed reduced MSH7 expression when compared to transformed controls and null segregants. Expression of MSH6, another member of the mismatch repair family which is most closely related to the MSH7 gene, was not significantly reduced in these lines. In both T1 lines, reduced seed set in positive segregants was observed. Conclusion Results presented here indicate, for the first time, a distinct functional role for MSH7 in vivo and show that expression of this gene is necessary for wild-type levels of fertility. These observations suggest that MSH7 has an important function during meiosis and as such remains a candidate for Ph2.

  11. Barley (Hordeum vulgare L.) cysteine proteases: heterologous expression, purification and characterization

    DEFF Research Database (Denmark)

    Rosenkilde, Anne Lind; Dionisio, Giuseppe; Holm, Preben Bach;


    During germination of barley seeds, mobilization of protein is essential and cysteine proteases accounts for more than 90 % of the total proteolytic activity in the degradation of barley seed storage proteins. Cysteine proteases exist as pro-enzyme and is activated through reduction of the active...... site cysteines and by removal of the pro-domain. The complement of cysteine proteases is comprehensive and for detailed studies of the individual components of this complement, a fast and efficient eukaryotic expression platform is highly desirable. A cDNA clone of the barley key cysteine endoprotease...

  12. Diversity for seedling vigor in wild barley (hordeum vulgare L. subs. simpatina) germplasm

    International Nuclear Information System (INIS)

    Seedling vigor is important for improving stand establishment of barley crops, particularly in arid regions and areas where the soil temperature is low at sowing time. Three hundred and fifteen wild barley accessions from the Wild Barley Diversity Collection (WBDC) were evaluated for nine seedling vigor traits in a poly house and growth chamber under hydroponic conditions. The accessions exhibited significant differences for all traits investigated. Traits showing greatest phenotypic variation were seedling visual score, plant height, shoot fresh weight, shoot dry weight and shoot length. Seed weight exhibited the least variation. Seed weight was significantly correlated with visual seedling score and shoot and seedling fresh and dry weight. Correlation analysis showed that the visual seedling score was a reliable method for estimating seedling vigor in wild barley. The first three principal components (PC) explained 82.3% of the variation present in the WBDC with PC1(54.0%) associated with shoot fresh weight, shoot dry weight, seedling dry weight, seedling fresh weight, shoot length and seedling length. Accessions from the southwest portion of the Fertile Crescent, like WBDC020 (Turkey), WBDC238 (Jordan) and WBDC244 (Jordan) exhibited the highest positive values for most of the plant vigor traits investigated. These wild barley accessions likely carry alleles that will be useful for the improvement of plant vigor traits in cultivated barley. (author)

  13. Evaluation of drought resistance of barley (Hordeum vulgare L. cultivars using agronomic characteristics and drought tolerance indices

    Directory of Open Access Journals (Sweden)

    Mohsen Saeidi


    Full Text Available In order to determine the performance of barley under drought stress conditions and screening quantitative indices of drought tolerance, twelve barley (Hordeum vulgare L. cultivars were tested in a split-plot arranged in a randomized complete blocks design with three replications under irrigated and post-anthesis water deficiency conditions. This study was carried out in the field research of campus of agriculture and natural resources, Razi university, Kermanshah state in the west of Iran during 2010-2011. The results showed that post anthesis water deficiency caused 22, 18.3, 5.9, 5.5 and 21.9 percent reduction in grain yield, biomass, thousand grain weight, number of grain per spike and number of spike per m2 in average respectively, but had no significant effect on harvest index. Mean comparisons showed that Nosrat cultivar with 838 g m-2 and Afzal cultivar with 392 g m-2, respectively had the highest and the lowest grain yield under non-stress condition. Under water stress environment Nosrat and Karoun cultivars with 696 and 656 g m-2 and also, Aras and Sahra cultivars with 322 and 327 g m-2, respectively had the highest and the lowest grain yield. The estimates of stress tolerance attributes indicated that the identification of drought-tolerant genotypes based on a single criterion was contradictory. For example, according to STI, GMP and MP cultivars Nosrat, Karoun and Sararud were the most, whereas Aras and Afzal cultivars the least relative tolerant genotypes. As to YI cultivars Nosrat, Karoun and Sararud were the most and Aras, Sahra and Afzal the least relative tolerant genotypes. According to YSI, SSPI, RDI and ATI indices selected the Sararud and Zarjo cultivars as the most relatively tolerant genotypes. DI selected the cultivars Sararud, Nosrat and Karoun as the best, while the cultivars Sahra, Aras and Reihan as the the worst relatively tolerant genotypes. Grain yield in stress condition was significantly and positively correlated

  14. [Hordein locus polymorphism of cultivated barley (Hordeum vulgare L.) in Turkey]. (United States)

    Pomortsev, A A; Martynov, S P; Lialina, E V


    Starch gel electrophoresis has been used to study the polymorphism of hordeins encoded by the Hrd A, Hrd B, and Hrd F loci in 93 landrace specimens of barley assigned to 17 ancient provinces located in modem Turkey. Forty-five alleles of Hrd A with frequencies of 0.11-29.34%, 51 alleles of Hrd B with frequencies of 0.11-8.07%, and 5 alleles of Hrd F with frequencies of 0.75-41.29% have been detected. Cluster analysis of the matrix of allele frequencies has demonstrated that barley populations from different old provinces of Turkey are similar to one another. Cluster structure of local barley populations has been found, most populations (82%) falling into three clusters. The first cluster comprises barley populations from six provinces (Thracia, Bithynia, Pontus, Lydia, Cappadocia, and Armenia); the second cluster, populations from five provinces (Paphlagonia, Galatia, Lycaonia, Cilicia, and Mesopotamia); and the third one, populations from three provinces (Phrygia, Karia, and Lycia). Barley populations from Mysia, Pamphlya, and Syria do not fall in any cluster. PMID:18186193

  15. Identification and Fine Mapping of a White Husk Gene in Barley (Hordeum vulgare L.). (United States)

    Hua, Wei; Zhang, Xiao-Qi; Zhu, Jinghuan; Shang, Yi; Wang, Junmei; Jia, Qiaojun; Zhang, Qisen; Yang, Jianming; Li, Chengdao


    Barley is the only crop in the Poaceae family with adhering husks at maturity. The color of husk at barely development stage could influence the agronomic traits and malting qualities of grains. A barley mutant with a white husk was discovered from the malting barley cultivar Supi 3 and designated wh (white husk). Morphological changes and the genetics of white husk barley were investigated. Husks of the mutant were white at the heading and flowering stages but yellowed at maturity. The diastatic power and α-amino nitrogen contents also significantly increased in wh mutant. Transmission electron microscopy examination showed abnormal chloroplast development in the mutant. Genetic analysis of F2 and BC1F1 populations developed from a cross of wh and Yangnongpi 5 (green husk) showed that the white husk was controlled by a single recessive gene (wh). The wh gene was initially mapped between 49.64 and 51.77 cM on chromosome 3H, which is syntenic with rice chromosome 1 where a white husk gene wlp1 has been isolated. The barley orthologous gene of wlp1 was sequenced from both parents and a 688 bp deletion identified in the wh mutant. We further fine-mapped the wh gene between SSR markers Bmac0067 and Bmag0508a with distances of 0.36 cM and 0.27 cM in an F2 population with 1115 individuals of white husk. However, the wlp1 orthologous gene was mapped outside the interval. New candidate genes were identified based on the barley genome sequence. PMID:27028408

  16. Frequency of Aneuploids in Progenies of Autotriploid Barley, Hordeum Vulgare L

    DEFF Research Database (Denmark)

    Sandfær, J.


    Chromosome counts of 863 progeny plants originating from 68 autotriploid barley plants revealed a considerable variation in chromosome numbers ranging from the diploid number (2n= 14) to 2n= 39. The most frequent groups were plants with 15 and 16 chromosomes each constituting about 27% of all pro...

  17. Complex Interspecific Hybridization in Barley (Hordeum vulgare L.) and the Possible Occurrence of Apomixis

    DEFF Research Database (Denmark)

    Bothmer, R. von; Bengtsson, M.; Flink, J.;


    mixoploid with respect to alien chromosomes (19-22). In one combination, chromosome no. 7 was duplicated. Meiosis in triple hybrids showed low, but variable pairing (1.3-5.5 chiasmata per cell). The syndesis probably did not include the barley chromosomes. Direct backcrosses to di- and tetraploid...

  18. Latent manganese deficiency increases transpiration in barley (Hordeum vulgare)

    DEFF Research Database (Denmark)

    Hebbern, Christopher Alan; Laursen, Kristian Holst; Ladegaard, Anne Hald;


    To investigate if latent manganese (Mn) deficiency leads to increased transpiration, barley plants were grown for 10 weeks in hydroponics with daily additions of Mn in the low nM range. The Mn-starved plants did not exhibit visual leaf symptoms of Mn deficiency, but Chl a fluorescence measurements...

  19. A weed suppressive index for spring barley (Hordeum vulgare) varieties

    DEFF Research Database (Denmark)

    Hansen, P K; Kristensen, K; Willas, J


    A screening programme for crop variety competitiveness would ideally be based on only a few, non-destructive measurements of key growth traits. In this study we measured the weed suppressive ability of 79 varieties of spring barley in two ways: (i) directly, by weed coverage assessments under wee...... and 24 varieties and was found valuable for future use in regular screening programmes...

  20. Molecular Marker Development and Linkage Analysis in Three Low Phytic Acid Barley (Hordeum vulgare) Mutant Lines (United States)

    Phytate is the primary form of phosphorus found in mature cereal grain. This form of phosphorus is not available to monogastric animals due to a lack of the enzyme phytase in their digestive tract. Several barley low phytic acid (lpa) mutants have been identified that contain substantial decreases...

  1. The effect of irradiating barley seeds (Hordeum Vulgare) on plantlet growth and net blotch resistance

    International Nuclear Information System (INIS)

    Barley seeds of two cultivars (Smash and Thibaut) and one line (74-F-6) with water contents adjusted between 12.8 and 13.3%, were irradiated with various doses (1-sup 1 sup 6 sup 0 Gy) of sup 6 sup 0 Co γ rays. Doses of 1-sup 4 sup 0 Gy favored an increases length of the first leaf. In general, doses of 15 and sup 2 sup 0 Gy decreased barley susceptibility to Drechrlera teres f. maculata by 25 and 21%, respectively. This reduction was a function of the line or cultivar used. The best response was obtained with cv. Smash. Seedling growth stimulation and host susceptibility to D. teres were significantly correlated (r= -0.68). The stimulatory effect of γ rays on growth could be used at low levels, to provide adequate field resistance to net blotch caused by D. teres f. maculata. (author). 28 refs., 3 tabs

  2. Tolerance of four spring barley (Hordeum vulgare L.) varieties to weed harrowing


    Hansen, Preben Klarskov; Rasmussen, Ilse A.; Holst, Niels; Andreasen, Christian


    We investigated the tolerance to weed harrowing of four spring barley varieties and examined the possible interactions between varietal weed suppressive ability and two nutrient levels. Tolerance was defined as the combined effect of crop resistance (ability to resist soil covering) and crop recovery (the ability to recover in terms of yield). The weed harrowing strategy was a combination of one pre- and one post-emergence weed harrowing. In terms of yield, the four varieties responded signif...

  3. AFLP marker linked to water-stress-tolerant bulks in barley (Hordeum vulgare L.)


    Altinkut A.; Kazan K.; Gozukirmizi N.


    The amplified fragment length polymorphism (AFLP) assay is an efficient method for the identification of molecular markers, useful in the improvement of numerous crop species. Bulked Segregant Analysis (BSA) was used to identify AFLP markers associated with water-stress tolerance in barley, as this would permit rapid selection of water-stress tolerant genotypes in breeding programs. AFLP markers linked to water-stress tolerance was identified in two DNA pools (tolerant and sensitive), which w...

  4. SEED PRODUCTION of WHEAT (Triticum aestivum L.) and BARLEY (Hordeum vulgare L.)


    KAYAÇETİN, Fatma


    Seed production of wheat and barley compose of several subsequentel processes such as production of required amount of certified seeds on time. An effective seed production program includes many basic components mechinal cleaning during sowing, harvest and the selector, removal of other species from field from heading to harvest, on time harvest and a good storage. The aim of seed production is to ensure clean seed material free from other species and weed seeds, large, plump grain without di...

  5. AFLP marker linked to water-stress-tolerant bulks in barley (Hordeum vulgare L.

    Directory of Open Access Journals (Sweden)

    A. Altinkut


    Full Text Available The amplified fragment length polymorphism (AFLP assay is an efficient method for the identification of molecular markers, useful in the improvement of numerous crop species. Bulked Segregant Analysis (BSA was used to identify AFLP markers associated with water-stress tolerance in barley, as this would permit rapid selection of water-stress tolerant genotypes in breeding programs. AFLP markers linked to water-stress tolerance was identified in two DNA pools (tolerant and sensitive, which were established using selected F2 individuals resulting from a cross between water-stress-tolerant and sensitive barley parental genotypes, based on their paraquat (PQ tolerance, leaf size, and relative water content (RWC. All these three traits were previously shown to be associated with water-stress tolerance in segregating F2 progeny of the barley cross used in a previous study. AFLP analysis was then performed on these DNA pools, using 40 primer pairs to detect AFLP fragments that are present/absent, respectively, in the two pools and their parental lines. One separate AFLP fragment, which was present in the tolerant parent and in the tolerant bulk, but absent in the sensitive parent and in the sensitive bulk, was identified. Polymorphism of the AFLP marker was tested among tolerant and sensitive F2 individuals. The presence of this marker that is associated with water-stress tolerance will greatly enhance selection for paraquat and water-stress tolerant genotypes in future breeding programs.

  6. Improvement of Forage Barley (Hordeum vulgare L.) Characters Using Gamma Rays

    International Nuclear Information System (INIS)

    Field experiments were conducted at Egyptian Atomic Energy Authority (EAEA) farm at Inshas, Egypt during 2011-2012 and 2012-2013 growing seasons on barley forage crop genotype. The aim of this investigation to evaluate the effect of different gamma ray doses (100-350 Gy) on the barley forage yield and related traits. Seeds of barley forage genotype were subjected to five gamma ray treatments (100,150, 200, 250, 300 and 350 Gy). The two cuts were taken per season, the obtained results showed that the doses of 200 and 250 Gy increased the majority of studied characters i.e., plant height, number of leaves/plant, fresh weight/plant, fresh weight/fed, and dry weight/fed. However the dry weight/ plant was decreased by some dose treatments. The low dose treatments, (100 and 150 Gy) increased the number of leaves/plant, stem diameter and leaves / stem ratio. The positive effects on yield and its components were more appeared in the second season than in the first ones.

  7. Hordein gene dose effects in triploid endosperm of barley (Hordeum vulgare L.

    Directory of Open Access Journals (Sweden)

    Perović Dragan


    Full Text Available The presence of two maternal chromosome sets in triploid barley endosperm allows the distinction of maternal and paternal hordein bands in an electrophoregram: the maternal bands are stronger due to the higher gene dose. In the F1 generation there are differences between reciprocal crosses and in the F2 generation all 16 classes that are theoretically possible for a pair of polymorphic loci can be distinguished. This full classification is rarely possible in genetic studies, and allows more accurate estimates of recombination rates. Two hordein gene clusters (Hor1 and Hor2, corresponding to hordein C and hordein B respectively were analyzed in hybrids obtained by crossing two winter barley cultivars Partizan and HWV-247. Hordein separation was performed by acid-polyacrylamide gel electrophoresis at pH 3.2 (A-PAGE. A set of most informative bands of B and C hordeins was selected in each cross by two criteria: (1 presence or absence of bands in the parents and (2 signal strength to allow doses scoring. The average genetic distance between Hor1 and Hor2 loci was 11 cM. Distances in male and female maps were not significantly different, suggesting a similar recombination rate in male and female meiosis.

  8. A single locus is responsible for salinity tolerance in a Chinese landrace barley (Hordeum vulgare L..

    Directory of Open Access Journals (Sweden)

    Rugen Xu

    Full Text Available INTRODUCTION: Salinity and waterlogging are two major abiotic stresses severely limiting barley production. The lack of a reliable screening method makes it very hard to improve the tolerance through breeding programs. METHODS: This work used 188 DH lines from a cross between a Chinese landrace variety, TX9425 (waterlogging and salinity tolerant, and a Japanese malting barley, Naso Nijo (waterlogging and salinity sensitive, to identify QTLs associated with the tolerance. RESULTS: Four QTLs were found for waterlogging tolerance. The salinity tolerance was evaluated with both a hydroponic system and in potting mixture. In the trial with potting mixture, only one major QTL was identified to associate with salinity tolerance. This QTL explained nearly 50% of the phenotypic variation, which makes it possible for further fine mapping and cloning of the gene. This QTL was also identified in the hydroponic experiment for different salt-related traits. The position of this QTL was located at a similar position to one of the major QTLs for waterlogging tolerance, indicating the possibility of similar mechanisms controlling both waterlogging and salinity tolerance. CONCLUSION: The markers associated with the QTL provided a unique opportunity in breeding programs for selection of salinity and waterlogging tolerance.

  9. Effect of nitrogen application on yield and yield components of barley (hordeum vulgare l.)

    International Nuclear Information System (INIS)

    The present research was aimed to study the effect of different levels of inorganic fertilizer N on the yield and yield components of barley varieties at KPK Agricultural University, Peshawar, Pakistan. The experiment was laid out in randomized complete block design with split plot arrangements. Barley varieties (local and sterling) were sown in the main plots whereas different nitrogen levels (i.e. 0, 20, 40, 60, 80 and 100 kg ha/sup -1/) were allotted to sub-plots. The results showed that different varieties and nitrogen levels had significantly (p<0.05) affected plant height, 1000 grains weight, grains spike/sup -1/, straw yield, grain yield, biological yield, grain and plant N. Maximum grain spike/sup -1/ , thousand grain weight and grain yield was recorded in sterling. Taller plants, highest biological yield, straw yield, grain and plant N was observed in local variety. Nitrogen applied at the rate of 60 kg ha/sup -1/ resulted in maximum grain spike/sup -1/, thousand grain weight, biological yield, grain yield, grain and plant N. (author)

  10. Effect of the simulated weightlessness (clinorotation) on a photosynthetic apparatus of barley plants (hordeum vulgare L.) (United States)

    Volovik, O. I.; Sytnik, S. K.; Topchiy, N. N.

    The effect of microgravitation (simulated by clinorotation) on the organization and functioning of chloroplasts, isolated from barley plants, is studied with the use SDS-electrophoresis, spectrophotometric and polarography methods. The relative content of monomeric forms of light harvesting complex of photosystem II (LHCII) increases at the expense of its oligomeric forms under clinorotation conditions. The decrease of the portion of the entire complex of photosystem I (PSI) as well as of the sum of the PSI complexes and the complex CPa (related to PSII) was observed in experimental variants. Clinorotation induced the decrease in PSI, PSII and full electron transport activity, and the extent of the reduction depended on the light intensity during plant growth. The ATP synthesis coupled with cyclic, noncyclic and linear electron transport was inhibited under the simulated microgravitation.

  11. Effect of low doses of gamma radiation on barley's (Hordeum Vulgare L.) susceptibility to cochliobolus sativus

    International Nuclear Information System (INIS)

    Two barley genotypes (Tadmor, W12291), and one promising line selected in AECS (76) were exposed to 60 cobalt gamma radiation. The doses used were: 0, 10, 15, 20, 30, 40 and 50 Gy. Susceptibility assessments were scored using a rating scale extending from 1 (highly resistant) to 5 (very susceptible) according to the percentage of infected area at subcrown interodes. In general, doses of 10, 15, 20 and 30 Gy increased the resistance to the pathogen Cochliobolus sativus by 56.29%, 58.29%, 54.57% and 49.71% respectively. The genotypes did not response similarly to the irradiation. The best response was obtained with c.v Tadmor. (author)

  12. Inheritance of prehaustorial resistance to Puccinia graminis f. sp. avenae in barley (Hordeum vulgare L.). (United States)

    Dracatos, Peter M; Ayliffe, Michael; Khatkar, Mehar S; Fetch, Tom; Singh, Davinder; Park, Robert F


    Rust pathogens within the genus Puccinia cause some of the most economically significant diseases of crops. Different formae speciales of P. graminis have co-evolved to mainly infect specific grass hosts; however, some genotypes of other closely related cereals can also be infected. This study investigated the inheritance of resistance to three diverse pathotypes of the oat stem rust pathogen (P. graminis f. sp. avenae) in the 'Yerong' ✕ 'Franklin' (Y/F) barley doubled haploid (DH) population, a host with which it is not normally associated. Both parents, 'Yerong' and 'Franklin', were immune to all P. graminis f. sp. avenae pathotypes; however. there was transgressive segregation within the Y/F population, in which infection types (IT) ranged from complete immunity to mesothetic susceptibility, suggesting the presence of heritable resistance. Both QTL and marker-trait association (MTA) analysis was performed on the Y/F population to map resistance loci in response to P. graminis f. sp. avenae. QTL on chromosome 1H ('Yerong' Rpga1 and Rpga2) were identified using all forms of analysis, while QTL detected on 5H ('Franklin' Rpga3 and Rpga4) and 7H (Rpga5) were only detected using MTA or composite interval mapping-single marker regression analysis respectively. Rpga1 to Rpga5 were effective in response to all P. graminis f. sp. avenae pathotypes used in this study, suggesting resistance is not pathotype specific. Rpga1 co-located to previously mapped QTL in the Y/F population for adult plant resistance to the barley leaf scald pathogen (Rhynchosporium secalis) on chromosome 1H. Histological evidence suggests that the resistance observed within parental and immune DH lines in the population was prehaustorial and caused by callose deposition within the walls of the mesophyll cells, preventing hyphal penetration. PMID:25025780

  13. Luteibacter rhizovicinus MIMR1 promotes root development in barley (Hordeum vulgare L.) under laboratory conditions. (United States)

    Guglielmetti, Simone; Basilico, Roberto; Taverniti, Valentina; Arioli, Stefania; Piagnani, Claudia; Bernacchi, Andrea


    In order to preserve environmental quality, alternative strategies to chemical-intensive agriculture are strongly needed. In this study, we characterized in vitro the potential plant growth promoting (PGP) properties of a gamma-proteobacterium, named MIMR1, originally isolated from apple shoots in micropropagation. The analysis of the 16S rRNA gene sequence allowed the taxonomic identification of MIMR1 as Luteibacter rhizovicinus. The PGP properties of MIMR1 were compared to Pseudomonas chlororaphis subsp. aurantiaca DSM 19603(T), which was selected as a reference PGP bacterium. By means of in vitro experiments, we showed that L. rhizovicinus MIMR1 and P. chlororaphis DSM 19603(T) have the ability to produce molecules able to chelate ferric ions and solubilize monocalcium phosphate. On the contrary, both strains were apparently unable to solubilize tricalcium phosphate. Furthermore, the ability to produce 3-indol acetic acid by MIMR1 was approximately three times higher than that of DSM 19603(T). By using fluorescent recombinants of strains MIMR1 and DSM 19603(T), we also demonstrated that both bacteria are able to abundantly proliferate and colonize the barley rhizosphere, preferentially localizing on root tips and in the rhizoplane. Finally, we observed a negative effect of DSM 19603(T) on barley seed germination and plant growth, whereas MIMR1, compared to the control, determined a significant increase of the weight of aerial part (+22 %), and the weight and length of roots (+53 and +32 %, respectively). The results obtained in this work make L. rhizovicinus MIMR1 a good candidate for possible use in the formulation of bio-fertilizers. PMID:23653264

  14. Mycoflora Of Barley Hordeum Vulgare L. At Different Locations In Hail Area- Saudi Arabia

    Directory of Open Access Journals (Sweden)

    Elham S. Dawood


    Full Text Available Abstract 400 grain samples collected from barley fields in Hail area at the northern part of Saudi Arabia was used for this study. Isolation and identification of seed-borne fungi were conducted according to standard tests described by the International Seed Testing Association ISTA using YGCA medium. A total of 265 of external mycoflora and 517 of internal mycoflora were grouped into five fungal genera namely Aspergillus Alternaria Penillium Fusarium and Ulocladium spp. were isolated. Comparsion between frequencies and relative densities of external and internal mycoflora was carried out among the species of the predominant genera. Aspergillus flavus and A. niger reaveled high Fr. and RD of external mycoflora A. flavus Fr.60.9 - 40.5 RD 48.3 - 40.9and A. niger Fr. 52.7- 48.6- and RD 38.7- 41.9 as external internal mycoflora mycoflora respectively. All the species of Ulocladium and Alternaria were predominant as internal mycoflora .The most predominant species of Ulocladium and Alternaria were U. atrium Fr 89 -75.5and RD -79- 62.5 as internal external mycoflora respectively and Alternaria alternate Fr. 60 - 46.6 and RD. 55-32.3as externalinternal mycoflora respectively.

  15. Purification and characterization of three chitinases and one beta-1,3-glucanase accumulating in the medium of cell suspension cultures of barley (Hordeum vulgare L.)

    DEFF Research Database (Denmark)

    Kragh, K.M.; Jacobsen, S.; Dalgaard Mikkelsen, J.;


    Three basic chitinases and one basic beta-1,3-glucanase were secreted into the medium when embryogenic cell suspensions of barley (Hordeum vulgare L.) cv. 'Igri' were cultured as undifferentiated aggregates in the presence of 2,4-D. The enzymes were purified by affinity and ion exchange......I at 8.7. Further analysis showed that this enzyme is also expressed in barley grain. The amino acid composition and five partial amino acid sequences covering 93 residues of chitinase K were determined. A high similarity was found between chitinase K and barley chitinase T and C as well as basic...... chitinases from barley aleurone and barley, bean and potato leaves. The purified beta-1,3-glucanase with a molecular weight (MW) of 32 kDa and pI greater-than-or-equal-to 9.8 constituted 1% of the soluble protein in the medium. Based on similar MW, pI and amino acid composition as well as identical N...

  16. Quantification of the tissue-culture induced variation in barley (Hordeum vulgare L.

    Directory of Open Access Journals (Sweden)

    Bednarek Piotr T


    Full Text Available Abstract Background When plant tissue is passaged through in vitro culture, many regenerated plants appear to be no longer clonal copies of their donor genotype. Among the factors that affect this so-called tissue culture induced variation are explant genotype, explant tissue origin, medium composition, and the length of time in culture. Variation is understood to be generated via a combination of genetic and/or epigenetic changes. A lack of any phenotypic variation between regenerants does not necessarily imply a concomitant lack of genetic (or epigenetic change, and it is therefore of interest to assay the outcomes of tissue culture at the genotypic level. Results A variant of methylation sensitive AFLP, based on the isoschizomeric combinations Acc65I/MseI and KpnI/MseI was applied to analyze, at both the sequence and methylation levels, the outcomes of regeneration from tissue culture in barley. Both sequence mutation and alteration in methylation pattern were detected. Two sets of regenerants from each of five DH donor lines were compared. One set was derived via androgenesis, and the other via somatic embryogenesis, developed from immature embryos. These comparisons delivered a quantitative assessment of the various types of somaclonal variation induced. The average level of variation was 6%, of which almost 1.7% could be accounted for by nucleotide mutation, and the remainder by changes in methylation state. The nucleotide mutation rates and the rate of epimutations were substantially similar between the andro- and embryo-derived sets of regenerants across all the donors. Conclusion We have developed an AFLP based approach that is capable of describing the qualitative and quantitative characteristics of the tissue culture-induced variation. We believe that this approach will find particular value in the study of patterns of inheritance of somaclonal variation, since non-heritable variation is of little interest for the improvement of plant

  17. Paradox of plant growth promotion potential of rhizobacteria and their actual promotion effect on growth of barley (Hordeum vulgare L.) under salt stress. (United States)

    Cardinale, Massimiliano; Ratering, Stefan; Suarez, Christian; Zapata Montoya, Ana Maria; Geissler-Plaum, Rita; Schnell, Sylvia


    From the rhizosphere of two salt tolerant plant species, Hordeum secalinum and Plantago winteri growing in a naturally salt meadow, 100 strains were isolation on enrichment media for various plant growth-promoting (PGP) functions (ACC deaminase activity, auxin synthesis, calcium phosphate mobilization and nitrogen fixation). Based on the taxonomic affiliation of the isolated bacteria and their enrichment medium 22 isolates were selected to test their growth promotion effect on the crop barley (Hordeum vulgare) under salt stress in pot experiment. In parallel the isolates were characterized in pure culture for their plant growth-promoting activities. Surprisingly the best promotors did not display a promising set of PGP activities. Isolates with multiple PGP-activities in pure culture like Microbacterium natoriense strain E38 and Pseudomonas brassicacearum strain E8 did not promote plant growth. The most effective isolate was strain E108 identified as Curtobacterium flaccumfaciens, which increased barley growth up to 300%. In pure culture strain E108 showed only two out of six plant growth promoting activities and would have been neglected. Our results highlight that screening based on pure culture assays may not be suitable for recognition of best plant growth promotion candidates and could preclude the detection of both new PGPR and new plant promotion mechanisms. PMID:26640049

  18. Molecular mapping of a non-host resistance gene YrpstY1 in barley (Hordeum vulgare L.) for resistance to wheat stripe rust. (United States)

    Sui, Xinxia; He, Zhonghu; Lu, Yaming; Wang, Zhenlin; Xia, Xianchun


    Cultivated barley (Hordeum vulgare L.) is considered as a non-host or inappropriate host species for wheat stripe rust caused by Puccinia striiformis f. sp. tritici. Most barley cultivars show a broad-spectrum resistance to wheat stripe rust. To determine the genes for resistance to wheat stripe rust in barley, a cross was made between a resistant barley line Y12 and a susceptible line Y16. The two parents, F(1) and 147 BC(1) plants were tested at seedling stage with Chinese prevalent race CYR32 of Puccinia striiformis f. sp. tritici by artificial inoculation in greenhouse. The results indicated that Y12 possessed one dominant resistance gene to wheat stripe rust, designated YrpstY1 provisionally. A total of 388 simple sequence repeat (SSR) markers were used to map the resistance gene in Y12 using bulked segregant analysis. A linkage map, including nine SSR loci on chromosome 7H and YrpstY1, was constructed using the BC(1) population, indicating that the resistance gene YrpstY1 is located on chromosome 7H. It is potential to transfer the resistance gene into common wheat for stripe rust resistance. PMID:21039455

  19. Root spatial metabolite profiling of two genotypes of barley (Hordeum vulgare L.) reveals differences in response to short-term salt stress. (United States)

    Shelden, Megan C; Dias, Daniel A; Jayasinghe, Nirupama S; Bacic, Antony; Roessner, Ute


    Barley (Hordeum vulgare L.) is the most salt-tolerant cereal crop and has excellent genetic and genomic resources. It is therefore a good model to study salt-tolerance mechanisms in cereals. We aimed to determine metabolic differences between a cultivated barley, Clipper (tolerant), and a North African landrace, Sahara (susceptible), previously shown to have contrasting root growth phenotypes in response to the early phase of salinity stress. GC-MS was used to determine spatial changes in primary metabolites in barley roots in response to salt stress, by profiling three different regions of the root: root cap/cell division zone (R1), elongation zone (R2), and maturation zone (R3). We identified 76 known metabolites, including 29 amino acids and amines, 20 organic acids and fatty acids, and 19 sugars and sugar phosphates. The maintenance of cell division and root elongation in Clipper in response to short-term salt stress was associated with the synthesis and accumulation of amino acids (i.e. proline), sugars (maltose, sucrose, xylose), and organic acids (gluconate, shikimate), indicating a potential role for these metabolic pathways in salt tolerance and the maintenance of root elongation. The processes involved in root growth adaptation and the underlying coordination of metabolic pathways appear to be controlled in a region-specific manner. This study highlights the importance of utilizing spatial profiling and will provide us with a better understanding of abiotic stress response(s) in plants at the tissue and cellular level. PMID:26946124

  20. The Effect of Different Gamma Radiation Doses Applied on Tokak 157/37 Barley (Hordeum vulgare and Karahan 99 Wheat (Triticum aestivum on M1 Generation

    Directory of Open Access Journals (Sweden)

    Yeşim KARA


    Full Text Available In this research study, the dose of different gamma radiation on seed germination of Hordeum vulgare TOKAK 157/37 barley kind and KARAHAN 99 wheatTriticum aestivum, and the mechanisms of the dose required to maximize the rate and percentage of germination and increased growth of root, seedling, TAEK was conducted in Ankara. The moisture rate has been %11, the barley and wheat seeds whose germination per cent is 98 % has been irradiated with 9 different doses between 0-600Gy in the centre of 60Co which has 1.92 kGy/h powers. The objective of that work was to evaluate determine the efficient gamma radiation dose and to determine the physiological effects and the action of the processing for gamma radiation in plant kinds. At the laboratory experiment it has been seen that the percentage of germination of rising radiation doses has no effect on M1 generation, but after diminishing of root length and seedling height with rising radiation doses it has been determined that the growth of the first leaf has stopped on the 14th day and this event has been given importance statistically for TOKAK 157/37 barley kind, 50 % efficient dose has been determined as ED50 485 Gy, for KARAHAN 99 wheat kind, 50 % efficient dose has been determined as ED50 370 Gy.

  1. Characterization of plant growth promoting traits of bacterial isolates from the rhizosphere of barley (Hordeum vulgare L.) and tomato (Solanum lycopersicon L.) grown under Fe sufficiency and deficiency. (United States)

    Scagliola, M; Pii, Y; Mimmo, T; Cesco, S; Ricciuti, P; Crecchio, C


    Plant Growth Promoting Bacteria (PGPB) are considered a promising approach to replace the conventional agricultural practices, since they have been shown to affect plant nutrient-acquisition processes by influencing nutrient availability in the rhizosphere and/or those biochemical processes determining the uptake at root level of nitrogen (N), phosphorus (P), and iron (Fe), that represent the major constraints for crop productivity worldwide. We have isolated novel bacterial strains from the rhizosphere of barley (Hordeum vulgare L.) and tomato (Solanum lycopersicon L.) plants, previously grown in hydroponic solution (either Fe deficient or Fe sufficient) and subsequently transferred onto an agricultural calcareous soil. PGPB have been identified by molecular tools and characterized for their capacity to produce siderophores and indole-3-acetic acid (IAA), and to solubilize phosphate. Selected bacterial isolates, showing contemporarily high levels of the three activities investigated, were finally tested for their capacity to induce Fe reduction in cucumber roots two isolates, from barley and tomato plants under Fe deficiency, significantly increased the root Fe-chelate reductase activity; interestingly, another isolate enhanced the reduction of Fe-chelate reductase activity in cucumber plant roots, although grown under Fe sufficiency. PMID:27295343

  2. Development and validation of a terrestrial biotic ligand model predicting the effect of cobalt on root growth of barley (Hordeum vulgare)

    International Nuclear Information System (INIS)

    A Biotic Ligand Model was developed predicting the effect of cobalt on root growth of barley (Hordeum vulgare) in nutrient solutions. The extent to which Ca2+, Mg2+, Na+, K+ ions and pH independently affect cobalt toxicity to barley was studied. With increasing activities of Mg2+, and to a lesser extent also K+, the 4-d EC50Co2+ increased linearly, while Ca2+, Na+ and H+ activities did not affect Co2+ toxicity. Stability constants for the binding of Co2+, Mg2+ and K+ to the biotic ligand were obtained: log K CoBL = 5.14, log K MgBL = 3.86 and log K KBL = 2.50. Limited validation of the model with one standard artificial soil and one standard field soil showed that the 4-d EC50Co2+ could only be predicted within a factor of four from the observed values, indicating further refinement of the BLM is needed. - Biotic Ligand Models are not only a useful tool to assess metal toxicity in aquatic systems but can also be used for terrestrial plants

  3. CAPACIDAD COMBINATORIA PARA RENDIMIENTO DE GRANO Y CARACTERES DE CALIDAD MALTERA EN CEBADA (Hordeum vulgare L. Combining ability for grain yield and malting quality traits in barley (Hordeum vulgare L.

    Directory of Open Access Journals (Sweden)

    Rudy Rivas P.


    Full Text Available Se cruzaron seis genotipos de cebada de ciclo de desarrollo primaveral en un arreglo dialelo, con el fin de estudiar sus capacidades combinatorias para rendimiento de grano y doce caracteres de calidad maltera. El comportamiento de los híbridos F1 fue analizado utilizando el Modelo I, método 2 de Griffing. El análisis de capacidad combinatoria general (CCG, de capacidad combinatoria específica (CCE y la relación CCG/CCE, demostraron que ocho de los trece caracteres estudiados mostraron expresión asociada a efectos génicos de tipo aditivo, que fueron: peso de grano, extracto de malta, viscosidad, friabilidad, proteína de la malta, proteína soluble, índice de Kolbach y amino nitrógeno libre (FAN: free amino nitrogen. Por otra parte en la expresión de los caracteres calibre de grano, diferencia del extracto, e índice de Hartong fueron importantes tanto los efectos aditivos como los no aditivos, siendo los primeros de mayor magnitud. Solo el rendimiento de grano y el poder diastásico mostraron predominio de acción génica de tipo no aditivo (dominancia y sobredominancia, aunque los efectos aditivos también estuvieron presentes.Six spring barley (Hordeum vulgare L. genotypes were crossed in a diallel system to study combining ability for grain yield and twelve malting quality traits. The F1 hybrids behavior was analyzed using Griffing’s Model I, method 2. The analysis for general combining ability (CCG, specific combining ability (CCE and the relationship CCG/CCE showed that expression of eight out of the thirteen traits were associated with genes which were additive in their effects: grain weight, malt extract, viscosity, friability, malt protein, soluble protein, Kolbach index and free amino nitrogen (FAN. On the other hand, the expression of grain plumpness, extract difference and the Hartong index showed both additive and non-additive genetic control, the former being of greater magnitude. Only grain yield and diastatic power

  4. Phylogenetic and comparative gene expression analysis of barley (Hordeum vulgare)WRKY transcription factor family reveals putatively retained functions betweenmonocots and dicots

    Energy Technology Data Exchange (ETDEWEB)

    Mangelsen, Elke; Kilian, Joachim; Berendzen, Kenneth W.; Kolukisaoglu, Uner; Harter, Klaus; Jansson, Christer; Wanke, Dierk


    WRKY proteins belong to the WRKY-GCM1 superfamily of zinc finger transcription factors that have been subject to a large plant-specific diversification. For the cereal crop barley (Hordeum vulgare), three different WRKY proteins have been characterized so far, as regulators in sucrose signaling, in pathogen defense, and in response to cold and drought, respectively. However, their phylogenetic relationship remained unresolved. In this study, we used the available sequence information to identify a minimum number of 45 barley WRKY transcription factor (HvWRKY) genes. According to their structural features the HvWRKY factors were classified into the previously defined polyphyletic WRKY subgroups 1 to 3. Furthermore, we could assign putative orthologs of the HvWRKY proteins in Arabidopsis and rice. While in most cases clades of orthologous proteins were formed within each group or subgroup, other clades were composed of paralogous proteins for the grasses and Arabidopsis only, which is indicative of specific gene radiation events. To gain insight into their putative functions, we examined expression profiles of WRKY genes from publicly available microarray data resources and found group specific expression patterns. While putative orthologs of the HvWRKY transcription factors have been inferred from phylogenetic sequence analysis, we performed a comparative expression analysis of WRKY genes in Arabidopsis and barley. Indeed, highly correlative expression profiles were found between some of the putative orthologs. HvWRKY genes have not only undergone radiation in monocot or dicot species, but exhibit evolutionary traits specific to grasses. HvWRKY proteins exhibited not only sequence similarities between orthologs with Arabidopsis, but also relatedness in their expression patterns. This correlative expression is indicative for a putative conserved function of related WRKY proteins in mono- and dicot species.

  5. Influence of crop rotation and meteorological conditons on density and biomass of weeds in spring barley (Hordeum vulgare L.)


    Maria Wanic; Magdalena Jastrzębska; Marta K. Kostrzewska


    The paper presents the analysis of changes in weed infestation in spring barley cultivated in the years 1990-2004 in crop rotation with a 25% proportion of this cereal (potato - spring barley - sowing peas - winter triticale), when it was grown after potato, and in crop rotation with its 75% proportion (potato - spring barley - spring barley - spring barley), when it was grown once or twice after spring barley. In the experiment, no weed control was applied. Every year in the spring (at full ...

  6. Molecular size and net charge of pathogenesis-related enzymes from barley (Hordeum vulgare L., v. Karat) infected with Drechslera teres f. teres (Sacch.) Shoem. (United States)

    Rothe, G M; Welschbillig, N; Reiss, E


    Molecular size and net charge of isoforms of pathogenesis-related (PR) chitinase, beta-1,3-glucanase and peroxidase were studied in uninfected barley (Hordeum vulgare L., v. Karat) leaves and in barley leaves infected with the pathogenic fungus Drechslera teres f. teres (Sacch.) Shoem. Molecular characteristics were determined by time-dependent polyacrylamide gradient gel electrophoresis under native conditions and by applying an extended version of the computer program MOL-MASS (Rothe, G. M., Weidmann, H., Electrophoresis 1991, 12, 703-709). Uninfected barley leaves contained predominantly one peroxidase isozyme but also three very weak peroxidases. Activities of all of these three peroxidases increased considerably after infection with Drechslera teres. The molecular masses of peroxidases 1 and 3 were estimated to be 38 +/- 5 and 42 +/- 7 kDa and their apparent valences at pH 8.4 were Z = 3.13 and 3.20, respectively. Amongst the chitinase isoforms, chitinase 1 and chitinase 2 appeared after infection, while chitinase 3 was also observed in uninfected leaves of barley. The molecular mass of chitinase 3 (31 +/- 6 kDa; f/fo = 1.20) was larger than that of chitinase 1 (20 +/- 2 kDa; f/fo = 1.04) and chitinase 2 (23 +/- 3 kDa; f/fo = 1.06). The valence of constitutive chitinase 3 (Z = 1.44 +/- 0.81) at pH 8.4 was lower than that of adaptive chitinase 1 (Z = 3.27 +/- 1.02) and chitinase 2 (Z = 2.96 +/- 1.38). Infection of barley leaves with Drechslera teres also induced the hydrolytic enzyme beta-1,3-glucanase 1; beta-1,3-glucanase 2 appeared in uninfected and in infected leaves. Constitutive beta-1,3-glucanase 2 was smaller (molecular mass 19 +/- kDa; f/fo = 1.05) than adaptive beta-1,3-glucanase 1 (molecular mass 26 +/- 4 kDa; f/fo = 1.07). The valence of adaptive beta-1,3-glucanase 1 (Z = 9.58 +/- 4.17) was approximately threefold that of beta-1,3-glucanase 2 (Z = 2.80 +/- 0.93). PMID:9629909

  7. Simultaneous estimation of relative biological effectiveness of alpha particles and protons in thermal neutron exposure of barley (Hordeum vulgare L.) seeds

    International Nuclear Information System (INIS)

    The relative biological effectiveness (RBE) of alpha particles and protons emitted during exposure of barley (Hordeum vulgare L.) seeds to thermal neutrons were estimated. sup(10)B-enriched re-dried seeds were irradiated with thermal neutrons or gamma-rays. Two assumptions so far believed that boron distribution was uniform throughout either natural dormant seeds or sup(10)B -enriched seeds, and that boron atoms enter the seeds as freely as water molecules do, were found to be invalid. A boron addition effect (BAE) as high as 58.2 was obtained after thermal neutron exposure of seeds presoaked in 4800 microg/g of sup(10)B-enriched boric acid solution. Estimates of RBE of alpha particles were nearly constant and independent of the contents of absorbed sup(10)B. RBE averaged 55.0 and 55.1 for the seed and spike presoaking methods of boron absorption, respectively. We could also obtain RBE of protons as high as 48.7 and 43.9 for the seed and spike methods, respectively. Boron addition converted the principal capture element during thermal neutron exposure from protons in dormant seeds to boron in sup(10)B enriched-seeds

  8. Influence of laser light on leaf area and parameters of photosynthetic activity in DH lines of spring barley (Hordeum vulgare L.

    Directory of Open Access Journals (Sweden)

    Garczyński S.


    Full Text Available The initial material for performed studies was constituted by hull and hull-less DH lines of spring barley (Hordeum vulgare L.. The kernels were irradiated with helium-neon laser (He-Ne in red light spectrum and at the wavelength of 632 nm. Plants obtained in greenhouse conditions were analyzed for blade area and their photosynthetic activity in flag and penultimate leaves (photosynthetic and transpiration rate, photosynthetic gas efficiency. The results indicated a biostimulation effect of laser light, causing an increase of blade area of flag and penultimate leaves. This effect was higher for flag leaves, and exposure to 180 min of irradiation was more effective as compared to 60 min. The reaction observed depended on the kind of DH lines analyzed, and two of them – R63N/14 and R58N/91 increased their blade area more effectively than others. Simultaneously, photo- synthetic and transpiration rate decreased in dependence on time of irradiation and the kind of DH lines used. On the other hand, gas exchange efficiency defined as photosynthetic coefficient of water use (CO2 assimilation / H2O transpiration increased for all DH lines and laser light exposure as compared to control.

  9. Influence of crop rotation and meteorological conditons on biodiversity of weed communities in spring barley (Hordeum vulgare L.

    Directory of Open Access Journals (Sweden)

    Magdalena Jastrzębska


    Full Text Available The paper presents the analysis of changes in weed biodiversity in spring barley cultivated in the years 1990-2004 in crop rotation with a 25% proportion of this cereal (potato - spring barley - sowing peas - winter triticale, when it was grown after potato, and in crop rotation with its 75% proportion (potato - spring barley - spring barley - spring barley, when it was grown once or twice after spring barley. In the experiment, no weed control was applied. Every year in the spring (at full emergence of the cereal and before the harvest, the composition of weed species and numbers of particular weed species were determined, and before the harvest also their biomass. On this basis, the constancy of species in particular years, Shannon-Wiener species diversity indices and diversity profiles according to Rényi were determined. Weed species richness increased linearly at all plots during the 15-year period. Chenopodium album was a constant and dominant species in terms of weed species density and biomass year after year. The quality of the plot had no clear influence on the diversity of weeds in barley. Weed density and biomass showed high year-to-year variability and a positive correlation with the amount of precipitation and a negative correlation with temperature during the period of the study. The significance of the correlation between the productivity of barley and weed diversity was not confirmed.

  10. Influence of crop rotation and meteorological conditons on biodiversity of weed communities in spring barley (Hordeum vulgare L.

    Directory of Open Access Journals (Sweden)

    Marta K. Kostrzewska


    Full Text Available The paper presents the analysis of changes in weed biodiversity in spring barley cultivated in the years 1990-2004 in crop rotation with a 25% proportion of this cereal (potato - spring barley - sowing peas - winter triticale, when it was grown after potato, and in crop rotation with its 75% proportion (potato - spring barley - spring barley - spring barley, when it was grown once or twice after spring barley. In the experiment, no weed control was applied. Every year in the spring (at full emergence of the cereal and before the harvest, the composition of weed species and numbers of particular weed species were determined, and before the harvest also their biomass. On this basis, the constancy of species in particular years, Shannon-Wiener species diversity indices and diversity profiles according to Rényi were determined. Weed species richness increased linearly at all plots during the 15-year period. Chenopodium album was a constant and dominant species in terms of weed species density and biomass year after year. The quality of the plot had no clear influence on the diversity of weeds in barley. Weed density and biomass showed high year-to-year variability and a positive correlation with the amount of precipitation and a negative correlation with temperature during the period of the study. The significance of the correlation between the productivity of barley and weed diversity was not confirmed.

  11. Influence of crop rotation and meteorological conditons on density and biomass of weeds in spring barley (Hordeum vulgare L.

    Directory of Open Access Journals (Sweden)

    Maria Wanic


    Full Text Available The paper presents the analysis of changes in weed infestation in spring barley cultivated in the years 1990-2004 in crop rotation with a 25% proportion of this cereal (potato - spring barley - sowing peas - winter triticale, when it was grown after potato, and in crop rotation with its 75% proportion (potato - spring barley - spring barley - spring barley, when it was grown once or twice after spring barley. In the experiment, no weed control was applied. Every year in the spring (at full emergence of the cereal and before the harvest, the composition of weed species and weed density of particular weed species were determined, and before the harvest also their biomass. Weed density increased linearly on all plots during the 15-year period. The average values confirm the increase in weed biomass in the case when spring barley was grown once or twice after this crop; however, those differences were influenced by the previous situation only during some seasons. Weed density and biomass showed high year-to-year variability and a positive correlation with the amount of precipitation and a negative correlation with temperature during the period of the study. A negative correlation between the yield of barley and weed biomass was shown.

  12. Induction by chromium ions of chitinases and polyamines in barley (Hordeum vulgare L.) and rape (Brassica napus L. ssp. oleifera)

    DEFF Research Database (Denmark)

    Jacobsen, S.; Hauschild, M.Z.; Rasmussen, U.


    Barley and rape seedlings were grown in hydroponic culture with increasing concentrations of CrO3 (Cr(VI)) or CrCl3 (Cr(III)). The chitinase activity and the concentrations of putrescine, spennidine and spermine were determined in the third leaf of barley seed-lings and in the second leaf of rape...

  13. Antioxidant-guided isolation and mass spectrometric identification of the major polyphenols in barley (Hordeum vulgare) grain. (United States)

    Gangopadhyay, Nirupama; Rai, Dilip K; Brunton, Nigel P; Gallagher, Eimear; Hossain, Mohammad B


    In the present study, the relative contribution of individual/classes of polyphenols in barley, to its antioxidant properties, was evaluated. Flash chromatography was used to fractionate the total polyphenol extract of Irish barley cultivar 'Irina', and fractions with highest antioxidant properties were identified using total phenolic content and three in vitro antioxidant assays: DPPH, FRAP, and ORAC. Flavanols (catechin, procyanidin B, prodelphinidin B, procyanidin C) and a novel substituted flavanol (catechin dihexoside, C27H33O16(-), m/z 613.17), were identified as constituents of the fraction with highest antioxidant capacity. Upon identification of phenolics in the other active fractions, the order of most potent contributors to observed antioxidant capacity of barley extract were, flavanols>flavonols (quercetin)>hydroxycinnamic acids (ferulic, caffeic, coumaric acids). The most abundant polyphenol in the overall extract was ferulic acid (277.7μg/gdw barley), followed by procyanidin B (73.7μg/gdw barley). PMID:27211640

  14. Heterologous expression and purification of barley (Hordeum vulgare L.) cysteine protease in yeast

    DEFF Research Database (Denmark)

    Rosenkilde, Anne Lind; Dionisio, Giuseppe; Holm, Preben Bach;


    The mobilization of protein during germination of barley seeds is essential and Cysteine Proteases accounts for more than 90 % of the total proteolytic activity in the degradation of barley seed storage proteins [1]. Cysteine proteases exist as pro-enzyme until activated through reduction of the...... active site cysteines and via removal of the pro-domain. The complement of cysteine proteases is comprehensive and for detailed studies of the individual components of this complement, a fast and efficient eukaryotic expression platform is highly desirable. The barley key cysteine protease, endoprotease...

  15. GA Enhanced a-Amylase Synthesis in Halved Grains of Barley (Hordeum vulgare): A Simple Laboratory Demonstration (United States)

    Freeland, P. W.


    A laboratory demonstration is suggested for the formation of a-amylase enzyme in halved grains of barley. Data presented in the article provide some information of the pattern of a- and b-amylase activity during germination. (PS)

  16. Analysis of molecular diversity, population structure and linkage disequilibrium in a worldwide survey of cultivated barley germplasm (Hordeum vulgare L.

    Directory of Open Access Journals (Sweden)

    Ganal Martin W


    Full Text Available Abstract Background The goal of our study was a systematic survey of the molecular diversity in barley genetic resources. To this end 953 cultivated barley accessions originating from all inhabited continents except Australia were genotyped with 48 SSR markers. Molecular diversity was evaluated with routine statistics (allelic richness, gene diversity, allele frequency, heterozygosity and unique alleles, Principal Coordinate Analysis (PCoA, and analysis of genome-wide linkage disequilibrium. Results A genotyping database for 953 cultivated barley accessions profiled with 48 SSR markers was established. The PCoA revealed structuring of the barley population with regard to (i geographical regions and (ii agronomic traits. Geographic origin contributed most to the observed molecular diversity. Genome-wide linkage disequilibrium (LD was estimated as squared correlation of allele frequencies (r2. The values of LD for barley were comparable to other plant species (conifers, poplar, maize. The pattern of intrachromosomal LD with distances between the genomic loci ranging from 1 to 150 cM revealed that in barley LD extended up to distances as long as 50 cM with r2 > 0.05, or up to 10 cM with r2 > 0.2. Few loci mapping to different chromosomes showed significant LD with r2 > 0.05. The number of loci in significant LD as well as the pattern of LD were clearly dependent on the population structure. The LD in the homogenous group of 207 European 2-rowed spring barleys compared to the highly structured worldwide barley population was increased in the number of loci pairs with r2 > 0.05 and had higher values of r2, although the percentage of intrachromosomal loci pairs in significant LD based on P 0.80 provided higher LD values as compared to 19 low polymorphic loci (PIC Conclusion A global population of cultivated barley accessions was highly structured. Clustering highlighted the accessions with the same geographic origin, as well as accessions possessing

  17. Identification and Characterization of MicroRNAs from Barley (Hordeum vulgare L. by High-Throughput Sequencing

    Directory of Open Access Journals (Sweden)

    Song Weining


    Full Text Available MicroRNAs (miRNAs are a class of endogenous RNAs that regulates the gene expression involved in various biological and metabolic processes. Barley is one of the most important cereal crops worldwide and is a model organism for genetic and genomic studies in Triticeae species. However, the miRNA research in barley has lagged behind other model species in grass family. To obtain more information of miRNA genes in barley, we sequenced a small RNA library created from a pool of equal amounts of RNA from four different tissues using Solexa sequencing. In addition to 126 conserved miRNAs (58 families, 133 novel miRNAs belonging to 50 families were identified from this sequence data set. The miRNA* sequences of 15 novel miRNAs were also discovered, suggesting the additional evidence for existence of these miRNAs. qRT-PCR was used to examine the expression pattern of six randomly selected miRNAs. Some miRNAs involved in drought and salt stress response were also identified. Furthermore, the potential targets of these putative miRNAs were predicted using the psRNATarget tools. Our results significantly increased the number of novel miRNAs in barley, which should be useful for further investigation into the biological functions and evolution of miRNAs in barley and other species.

  18. Using SSR Markers For Assessment Genetic Diversity And Detection Drought Escape Candidate Genes In Barley Lines (Hordeum Vulgare L.

    Directory of Open Access Journals (Sweden)

    Gougerdchi Vahideh


    Full Text Available Assessment of genetic diversity using molecular markers is one of the primary and important steps in breeding programs. In this study, genetic diversity of 52 barley lines evaluated using 68 SSR primer pairs and 47 primer pairs produced clear and polymorphic banding pattern. In general, 153 polymorphic alleles detected. The number of observed polymorphic alleles varied from 2 to 9, with an average of 3.26 alleles per locus. Polymorphic Information Content (PIC ranged from 0.07 to 0.81, with an average of 0.45. In this research, SSR markers differentiated the studied lines efficiently. Using cluster analysis, studied barley lines divided into two groups. Genetic diversity was relatively corresponding with geographical origins, because the lines related to a country somewhat diverged from each other. Two-rowed Iranian and Chinese barleys classified in one subgroup. Also, most six-rowed barleys classified in one subgroup. Association mapping analysis was used to identify candidate genes for drought escape in barley lines and 16 informative markers were identified after which confirmation in other tests could be suitable for marker assisted breeding drought escape.

  19. Identification of SNPs in barley(Hordeum vulgare L.)by deep sequencing of six reduced representation libraries

    Institute of Scientific and Technical Information of China (English)

    Ganggang; Guo; Dawa; Dondup; Lisha; Zhang; Sha; Hu; Xingmiao; Yuan; Jing; Zhang


    High-density genetic markers are required for genotyping and linkage mapping in identifying genes from crops with complex genomes, such as barley. As the most common variation, single nucleotide polymorphisms(SNPs) are suitable for accurate genotyping by using the next-generation sequencing(NGS) technology. Reduced representation libraries(RRLs) of five barley accessions and one mutant were sequenced using NGS technology for SNP discovery. Twenty million short reads were generated and the proportion of repetitive sequences was reduced by more than 56%. A total of 6061 SNPs were identified, and 451 were mapped to the draft sequence of the barley genome with pairing reads. Eleven SNPs were validated using length polymorphic allele-specific PCR markers.

  20. Genetic Diversity of Some Saudi Barley (Hordeum Vulgare L. Landraces Based on Two Types of Molecular Markers

    Directory of Open Access Journals (Sweden)

    Mohamed A.H.M. El-Awady


    Full Text Available Problem statement: Very little is known about the genetic diversity and morphological variability present in barley landrace in KSA, a country experiencing loss of biodiversity because of replacement of landraces with modern landraces. Approach: The molecular markers RAPD and ISSR were used as an efficient tools to estimate the intra-and inter-cultivar polymorphism among six barley KSA landraces collected from different geographical regions in order to assess the genetic relationships and develop cultivar-specific molecular fingerprints. The long term objective was to use these fingerprints to identify molecular markers that co-segregate and could be used in isolating gene(s which controlling some important traits, thereafter could be used in breeding programs (marker assisted selection. Results: Out of 20 and 10 primers of RAPD and ISSR, respectively, a clear and reproducible band profile of 13 RAPD primers and 7 ISSR primers were obtained. In RAPD analyses, 61 out of 111 bands (54.6% were polymorphic. The number of alleles ranged from 5-15 per primer, with an average of 8.54 per primer. In ISSR analyses, a total of 53 alleles were detected, among which 16 alleles (30.2% were polymorphic. The number of alleles per primer ranged from 5-10 with an average of 7.57 alleles per ISSR primer. The mean Polymorphism Information Content (PIC values were 0.45 and 0.37 for RAPD and ISSR markers, respectively. Conclusion: ISSR is better than RAPD to detect genetic diversity among the barley landraces. The RAPDs and ISSRs have confirmed each other and the ISSR results are more realistic comparing to RAPD results regarding to the geographical distribution of the six barley landraces. The outcome of this investigation can help strengthen the exiting pool of information on barley that may help assess national barley programs in KSA.

  1. Effect of Osmo-priming on Germination and Enzyme Activity in Barley (Hordeum vulgare L. Seeds under Drought Stress Conditions

    Directory of Open Access Journals (Sweden)

    Tabatabaei S. A.


    Full Text Available Seed priming was used in barley to increase seed germination and tolerance on stress exposure. Barley seeds were treated with PEG (Polyethylene 6000 mw. After 7 days our results showed that, seed priming treatments significantly (p≤ 0.01 affected germination percentage, normality seedling percentage, and germination index. Seed priming with PEG increased germination characteristics as the compared to the unprimed. Also, priming increased catalase as compared to the unprimed seeds. Therefore, the highest germination characteristics and catalase activity were attained from priming with PEG.

  2. Can barley (Hordeum vulgare L. s.l.) adapt to fast climate changes? A controlled selection experiment

    DEFF Research Database (Denmark)

    Alemayehu, Fikadu Reta; Frenck, Georg; van der Linden, Leon;


    to environmental stress, we conducted a selection experiment over five plant generations (G0–G4) in three scenarios, where atmospheric [CO2] and temperature were increased as single factors and in combination. The treatments represented the expected environmental characteristics in Northern Europe around year 2075...... to environmental change needs to be explored in order to select the most productive genotypes. Presently, it is unknown whether cereal crops like spring barley can adapt to climate stressors over relatively few generations. To evaluate if strong selection pressures could change the performance of barley...

  3. Overexpression of Cytokinin Dehydrogenase Genes in Barley (Hordeum vulgare cv. Golden Promise) Fundamentally Affects Morphology and Fertility

    Czech Academy of Sciences Publication Activity Database

    Mřížová, K.; Jiskrová, E.; Vyroubalová, Š.; Novák, Ondřej; Ohnoutková, L.; Pospíšilová, H.; Frébort, I.; Harwood, W.A.; Galuszka, P.


    Roč. 8, č. 11 (2013). E-ISSN 1932-6203 Grant ostatní: GA MŠk(CZ) ED0007/01/01 Institutional research plan: CEZ:AV0Z50380511 Keywords : MASS-SPECTROMETRY * TRANSGENIC BARLEY * ARABIDOPSIS Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.534, year: 2013

  4. Evaluation of drought tolerance and yield capacity of barley (hordeum vulgare) genotypes under irrigated and water-stressed conditions

    International Nuclear Information System (INIS)

    Twelve barley genotypes developed through different selection methods were evaluated under drought and irrigated conditions. The results of a correlation matrix revealed highly significant associations between Grain Yield (Yp) and Mean Productivity (MP), Stress Tolerance Index (STI), Geometric Mean Productivity (GMP) and Yield Index (Yi) under irrigated conditions while the Mean Productivity (MP), Yield Stability Index (Yi), Stress Tolerance Index (STI), Geometric Mean Productivity (GMP) and Yield Index (Yi) had a high response under stressed condition. Based on a principal component analysis, Geometric Mean Productivity (GMP), Mean Productivity (MP) and Stress Tolerance Index (STI) were considered to be the best parameters for selection of drought-tolerant genotypes. The 2-row barley genotypes B-07023 and B-07021 performed better in yield response under drought conditions and were more stable under stress conditions. Furthermore, drought stress reduced the yield of some genotypes while others were tolerant to drought, suggesting genetic variability in this material for drought tolerance. (author)

  5. Protein and malt quality in some gamma-ray induced high yielding mutants in barley (Hordeum vulgare)

    International Nuclear Information System (INIS)

    The results of various yield traits of 5 high yielding mutants isolated from 25 kR .gamma.-ray treated M2 population of a 6 rowed barley cv. DL-36 are reported. These mutants were superior over control in height, number of effective tillers, total grain yield and protein percentage. Though the mutants possessed high grain yields, malt quality declined due to the increase in hull percentage

  6. Antioxidant activity of 100% and 80% methanol extracts from barley seeds (Hordeum vulgare L.): stabilization of sunflower oil

    Energy Technology Data Exchange (ETDEWEB)

    Anwar, F.; Abdul Qayyum, H. M.; Hussein, A. I.; Iqbal, S.


    The antioxidant potential of 100% and 80% methanol extracts from the seeds of three barley varieties (Jou 83, Jou 87 and Haider 93) was assessed. The extract yields from barley seeds ranged from 3.23% (Haider 93,100% methanol) to 5.31% (Jou 83, 80% methanol). The total phenolic contents, DPPH radical scavenging activity (IC50 values) and inhibition of linoleic acid oxidation of barley seed extracts (BSE) were determined to be 88.1-145.7 mg/100g, 90.8-168.6 {mu}g/mL and 62.6-74.6%, respectively. The antioxidant effectiveness of BSE was also assessed by stabilizing sunflower oil (SFO) with BSE at a concentration of 600 ppm (oil weight basis). The stabilized (treated with extract) and the control (without extract addition) SFO samples were subjected to accelerated (oven heating at 60 degree centigrade for 30 days, 8 h heating cycle/day) storage. These were analyzed at regular intervals for the extent of oxidative changes according to the measurements of their contents of peroxide value, para-anisidine value, conjugated dienes and conjugated trienes. Generally, the 80% methanol extract of barely seeds demonstrated better antioxidant action than the 100% methanol extract. The antioxidant activity of BSE was also found to be considerably varied among the varieties tested. The present results suggest that antioxidant extracts from barely seeds might be used to protect vegetable oils from oxidation. (Author) 32 refs.

  7. Antioxidant activity of 100% and 80% methanol extracts from barley seeds (Hordeum vulgare L.): stabilization of sunflower oil

    International Nuclear Information System (INIS)

    The antioxidant potential of 100% and 80% methanol extracts from the seeds of three barley varieties (Jou 83, Jou 87 and Haider 93) was assessed. The extract yields from barley seeds ranged from 3.23% (Haider 93,100% methanol) to 5.31% (Jou 83, 80% methanol). The total phenolic contents, DPPH radical scavenging activity (IC50 values) and inhibition of linoleic acid oxidation of barley seed extracts (BSE) were determined to be 88.1-145.7 mg/100g, 90.8-168.6 μg/mL and 62.6-74.6%, respectively. The antioxidant effectiveness of BSE was also assessed by stabilizing sunflower oil (SFO) with BSE at a concentration of 600 ppm (oil weight basis). The stabilized (treated with extract) and the control (without extract addition) SFO samples were subjected to accelerated (oven heating at 60 degree centigrade for 30 days, 8 h heating cycle/day) storage. These were analyzed at regular intervals for the extent of oxidative changes according to the measurements of their contents of peroxide value, para-anisidine value, conjugated dienes and conjugated trienes. Generally, the 80% methanol extract of barely seeds demonstrated better antioxidant action than the 100% methanol extract. The antioxidant activity of BSE was also found to be considerably varied among the varieties tested. The present results suggest that antioxidant extracts from barely seeds might be used to protect vegetable oils from oxidation. (Author) 32 refs.

  8. HvZIP7 mediates zinc accumulation in barley (Hordeum vulgare) at moderately high zinc supply

    DEFF Research Database (Denmark)

    Tiong, Jingwen; Mcdonald, Glenn K.; Genc, Yusuf;


    were also generated to further understand the functions of HvZIP7 in metal transport. HvZIP7 is strongly induced by Zn deficiency, primarily in vascular tissues of roots and leaves, and its protein was localized in the plasma membrane. These properties are similar to its closely related homologs in...... dicots. Overexpression of HvZIP7 in barley plants increased Zn uptake when moderately high concentrations of Zn were supplied. Significantly, there was a specific enhancement of shoot Zn accumulation, with no measurable increase in iron (Fe), manganese (Mn), copper (Cu) or cadmium (Cd). HvZIP7 displays...

  9. Improving nitrogen use efficiency in barley (Hordeum vulgare L.) through the cisgenic approach

    DEFF Research Database (Denmark)

    Kichey, Thomas; Holme, Inger; Møller, Inge Skrumsager;


    Barley is one of the major crops cultivated worldwide and constitutes an important basis for animal feed. However, the production is facing a number of challenges that will be accentuated in the years to come, in particular restrictions on the use of nitrogen (N) fertilizer. In order to improve the...... separate introductions of the gene of interest and the resistance gene for selection, respectively. The transgenic lines (T0), currently growing in greenhouse will be self pollinated and the molecular, physiological and agronomic characterization of subsequent generations will be undertaken....

  10. Cloning and Characterization of Purple Acid Phosphatase Phytases from Wheat (Triticum aestivum L.), Barley (Hordeum vulgare L.), Maize (Zea maize L.) and Rice (Oryza sativa L.)

    DEFF Research Database (Denmark)

    Dionisio, Giuseppe; Madsen, Claus Krogh; Holm, Preben Bach;


    Barley (Hordeum vulgare L.) and wheat (Triticum aestivum L.) possess a significant phytase activity in the mature grains. Maize (Zea mays L.) and rice (Oryza sativa L.) possess little or virtually no pre-formed phytase activity in the mature grain and depend fully on de novo synthesis during...

  11. Biochemical characterization of protein composition of high-lysine mutant ML-109 of winter barley (Hordeum vulgare L.)

    International Nuclear Information System (INIS)

    The objective of the present studies was to determine the biochemical basis of a high lysine content in the mutant ML-109. The protein composition of kernels of high-lysine mutant of winter barley and its initial breeding line were analysed. The portion of individual fractions differing by their solubility in total proteins as well as amino acid composition of kernel protein and separated main protein fractions were also determined. The performed studies showed that a high lysine content in the kernels of the analysed mutant results from a decrease in the hordein level and from an increase in the portion of salt soluble proteins - albumins and globulins. Besides that, the obtained results indicate that the amino acid composition of the main protein fractions of the analysed mutant was advantageously changed; these fractions contained more lysine and other exogenic amino acids. (author). 15 refs, 6 tabs

  12. Carbon nanofibers suppress fungal inhibition of seed germination of maize (Zea mays) and barley (Hordeum vulgare L.) crop

    Energy Technology Data Exchange (ETDEWEB)

    Joshi, Anjali, E-mail:; Sharma, Arti [Centre For Nanoscience and Nanotechnology, Panjab University, Chandigarh (India); Nayyar, Harsh [Department of Botany, Panjab University, Chandigarh (India); Verma, Gaurav [Dr. SS Bhatnagar University Institute of Chemical Engineering and Technology, Panjab University, Chandigarh (India); Dharamvir, Keya [Department of Physics, Panjab University, Chandigarh (India)


    Carbon nanofibers (CNFs) are one of allotropes of carbon, consists of graphene layers arrangement in the form of stacked cones or like a cup diameter in nanometer and several millimeters in length. Their extraordinary mechanical, chemical and electronic properties are due to their small size. CNFs have been successfully applied in field of medicine in variety of diagnostic methods. They proven to be an excellent system for drug delivery, tissue regeneration, biosensor etc. This research focuses the applications of CNFs in all fields of Agriculture. In the we treated some fungal disease seed of maize and barley using functionalised CNFs. We find that the tested seeds grow just as well as the healthy seeds whereas the untreated fungal disease seeds, by themselves show very poor germination and seedling growth. This simple experiment shows the extraordinary ability of Carbon nanofibers in carrying effectively inside the germinated seeds.

  13. Carbon nanofibers suppress fungal inhibition of seed germination of maize (Zea mays) and barley (Hordeum vulgare L.) crop

    International Nuclear Information System (INIS)

    Carbon nanofibers (CNFs) are one of allotropes of carbon, consists of graphene layers arrangement in the form of stacked cones or like a cup diameter in nanometer and several millimeters in length. Their extraordinary mechanical, chemical and electronic properties are due to their small size. CNFs have been successfully applied in field of medicine in variety of diagnostic methods. They proven to be an excellent system for drug delivery, tissue regeneration, biosensor etc. This research focuses the applications of CNFs in all fields of Agriculture. In the we treated some fungal disease seed of maize and barley using functionalised CNFs. We find that the tested seeds grow just as well as the healthy seeds whereas the untreated fungal disease seeds, by themselves show very poor germination and seedling growth. This simple experiment shows the extraordinary ability of Carbon nanofibers in carrying effectively inside the germinated seeds

  14. Carbon nanofibers suppress fungal inhibition of seed germination of maize (Zea mays) and barley (Hordeum vulgare L.) crop (United States)

    Joshi, Anjali; Sharma, Arti; Nayyar, Harsh; Verma, Gaurav; Dharamvir, Keya


    Carbon nanofibers (CNFs) are one of allotropes of carbon, consists of graphene layers arrangement in the form of stacked cones or like a cup diameter in nanometer and several millimeters in length. Their extraordinary mechanical, chemical and electronic properties are due to their small size. CNFs have been successfully applied in field of medicine in variety of diagnostic methods. They proven to be an excellent system for drug delivery, tissue regeneration, biosensor etc. This research focuses the applications of CNFs in all fields of Agriculture. In the we treated some fungal disease seed of maize and barley using functionalised CNFs. We find that the tested seeds grow just as well as the healthy seeds whereas the untreated fungal disease seeds, by themselves show very poor germination and seedling growth. This simple experiment shows the extraordinary ability of Carbon nanofibers in carrying effectively inside the germinated seeds.

  15. Antioxidant activity of 100% and 80% methanol extracts from barley seeds (Hordeum vulgare L.: stabilization of sunflower oil

    Directory of Open Access Journals (Sweden)

    Iqbal, Shahid


    Full Text Available The antioxidant potential of 100% and 80% methanol extracts from the seeds of three barley varieties (Jou 83, Jou 87 and Haider 93 was assessed. The extract yields from barley seeds ranged from 3.23% (Haider 93,100% methanol to 5.31% (Jou 83, 80% methanol. The total phenolic contents, DPPH radical scavenging activity (IC50 values and inhibition of linoleic acid oxidation of barley seed extracts (BSE were determined to be 88.1-145.7 mg/100g, 90.8-168.6 μg/mL and 62.6-74.6%, respectively. The antioxidant effectiveness of BSE was also assessed by stabilizing sunflower oil (SFO with BSE at a concentration of 600 ppm (oil weight basis. The stabilized (treated with extract and the control (without extract addition SFO samples were subjected to accelerated (oven heating at 60ºC for 30 days, 8 h heating cycle/day storage. These were analyzed at regular intervals for the extent of oxidative changes according to the measurements of their contents of peroxide value, para-anisidine value, conjugated dienes and conjugated trienes. Generally, the 80% methanol extract of barely seeds demonstrated better antioxidant action than the 100% methanol extract. The antioxidant activity of BSE was also found to be considerably varied among the varieties tested. The present results suggest that antioxidant extracts from barely seeds might be used to protect vegetable oils from oxidation.El potencial antioxidante de extractos de metanol al 100% y el 80% de semillas de tres variedades de cebada (Jou 83, Jou 87 y Haider 93 fue evaluada. El rendimiento de los extractos de las semillas de cebada vario desde un 3.23% (Haider, 100% methanol a un 5.31% (Jou 83, 80% metanol. El contenido total de fenoles, la actividad atrapadora del radical DPPH (valores IC50 y la inhibición de la oxidación del ácido linoleico de los extractos de semilla de cebada (BSE fueron 88.1-145.7 mg/100g, 90.8-168.6 μg/mL y 62.6- 74.6%, respectivamente. La efectividad antioxidante de BSE fue tambi

  16. Melanin biosynthesis inhibitory activity of a compound isolated from young green barley (Hordeum vulgare L.) in B16 melanoma cells. (United States)

    Meng, Tian Xiao; Irino, Nobuto; Kondo, Ryuichiro


    In the course to find compounds that inhibit melanin biosynthesis (i.e., whitening agents), we evaluated the effects of the methanol-soluble fraction (i.e., the water-soluble portion of methanol extracts-CHP20P-MeOH eluted fraction) from young green barley leaves on melanin production in B16 melanoma cells. Activity-guided fractionation led to an isolate called tricin (compound 1) as an inhibitory compound of melanin production in B16 melanoma cells. Furthermore, tricin analogs such as tricetin, tricetin trimethyl ether, luteolin, and apigenin were used for analyzing the structure-activity relationships (SAR) of 5,7-dihydroxyflavones studies. Tricin demonstrated stronger inhibitory activity compared to three other compounds. The results suggest that a hydroxyl group at the C-4' position and methoxy groups at the C-3',5' positions of the tricin skeleton may have important roles in this inhibitory activity in B16 melanoma cells. Our results suggest that tricin inhibits melanin biosynthesis with higher efficacy than arbutin, and it could be used as a whitening agent. PMID:25827948

  17. Rheological study of mixed flour: wheat (Triticum vulgare, barley (Hordeum vulgare and potato (Solanum tuberosum for use in the preparation of bread

    Directory of Open Access Journals (Sweden)

    Galo Sandoval


    Full Text Available With wheat flour imported and domestic wheat cereals produced in the country, and the potato tuber, a rheological study was performed to determine the most suitable proportions of substitution of wheat flour imported with the latter and its feasibility for making bread. We worked in mixtures of flour, wheat CWRS # 1 (red spring wheat in western Canada Cañicapa barley flour, wheat and potato Cojitambo Gabriela, from Ecuadorian cultures in proportions of 10, 20 and 30% (p / p. Masses from mixtures of flours were analyzed on a Brabender Farinograph, in order to determine the water absorption, development time, stability and rate of tolerance with a view to selecting the flour blends that have a behavior similar to CWRS wheat flour # 1. The best mixtures found were: wheat flour # 1 CWRS replaced with 10, 20 and 30% barley flour Cañicapa, and the mixture of wheat flour # 1 CWRS wheat flour in Cojitambo 30%. These flour mixes selected were also subjected to rheological analysis of their masses using a computer Mixolab. The breads made from flours selected were evaluated in a sensory panel. The breads more accepted by consumers were those containing 20 and 30% barley, followed by the group of those made with imported wheat with 30% wheat Cojitambo, and containing 10% of barley flour.

  18. Sowing Density: A Neglected Factor Fundamentally Affecting Root Distribution and Biomass Allocation of Field Grown Spring Barley (Hordeum Vulgare L.

    Directory of Open Access Journals (Sweden)

    Vera L Hecht


    Full Text Available Studies after the function of root traits and the genetic variation in these traits are often conducted under controlled conditions using individual potted plants. Little is known about root growth under field conditions and how root traits are affected by agronomic practices in particular sowing density. We hypothesized that with increasing sowing density, root length density (root length per soil volume, cm cm-3 increases in the top soil as well as specific root length (root length per root dry weight, cm g-1 due to greater investment in fine roots. Therefore, we studied two spring barley cultivars at ten different sowing densities (24-340 seeds m-2 in two consecutive years in a clay loam field in Germany and established sowing density dose response curves for several root and shoot traits. We took soil cores for measuring roots up to a depth of 60 cm in and between plant rows (inter-row distance 21 cm. Root length density increased with increasing sowing density and was greatest in the plant row in the top soil (0-10 cm. Greater sowing density increased specific root length partly through greater production of fine roots in the top soil. Rooting depth of the major root axes (root diameter class 0.4-1.0 mm was not affected. Root mass fraction decreased, while stem mass fraction increased with sowing density and over time. Leaf mass fraction was constant over sowing density but greater leaf area was realized through increased specific leaf area. Considering fertilization, we assume that light competition caused plants to grow more shoot mass at the cost of investment into roots, which is partly compensated by increased SRL and increased shallow rooting. Increased biomass per area with greater densities suggest that density increases the efficiency of the cropping system, however, declines in harvest index at densities over 230 plants m-2 suggest that this efficiency did not translate into greater yield. We conclude that plant density is a

  19. Structure of Hordeum vulgare NADPH-dependent thioredoxin reductase 2. Unwinding the reaction mechanism

    DEFF Research Database (Denmark)

    Kirkensgaard, Kristine Groth; Hägglund, Per; Finnie, Christine; Svensson, Birte; Henriksen, A.


    to the active form. Here, the first crystal structure of a cereal NTR, HvNTR2 from Hordeum vulgare (barley), is presented, which is also the first structure of a monocot plant NTR. The structure was determined at 2.6 A resolution and refined to an R (cryst) of 19.0% and an R (free) of 23.8%. The...

  20. Powdery Mildew Resistance in 268 Entries of Hordeum vulgare

    DEFF Research Database (Denmark)

    Jiang, W.M.; Jørgensen, Jørgen Helms; Torp, J


    A collection of 24 'Spontaneum' barley [H. vulgare ssp. spontaneum] entries and one comprising 244 Ethiopian barleys [H. vulgare ssp. vulgare] were tested for resistance to 4 powdery mildew [used by Erysiphe graminis f. sp. hordei] cultures that carried genes for virulence corresponding to most of...

  1. Effect of pH and Recombinant Barley (Hordeum vulgare L.) Endoprotease B2 on Degradation of Proteins in Soaked Barley

    DEFF Research Database (Denmark)

    Christensen, Jesper Bjerg; Dionisio, Giuseppe; Poulsen, Hanne Damgaard; Brinch-Pedersen, Henrik


    .3. Solubilized and degraded proteins evaluated by biuret, SDS-PAGE, and differential proteomics revealed that pH 4.3 had the greatest impact on both solubilization and degradation. In order to boost proteolysis, the recombinant barley endoprotease B2 (rec-HvEP-B2) was included after 8 h using the pH 4.3 regime....... Proteolysis evaluated by SDS-PAGE and differential proteomics confirmed a powerful effect of adding rec-HvEP-B2 to the soaked barley, regardless of the genotype. Our study addresses the use of rec-HvEP-B2 as an effective feed enzyme protease. HvEP-B2 has the potential to increase the digestibility of protein...

  2. Fine structure of plastids during androgenesis in Hordeum vulgare L.

    Directory of Open Access Journals (Sweden)

    Fortunat Młodzianowski


    Full Text Available The fine structure of plastids was studied in the course of androgenesis in in the pollen of Hordeum vulgare L. It was found that these organelles occur in all stages of androgenesis. Their structure was simple and was frequently manifested on the cross section only by the presence of the envelope and matrix of different degree of density. Single thylakoids, nucleoid-like regions and starch grains were, however, also noted. The structure of plastids in embryoids formed from microspores of barley was compared with embryos developed from fertilized egg cell, and we did not found any fundamental differences between them. However, only plastid ribosomes were difficult to identify on ultrathin sections in embryoids and in the embryos.

  3. 大麦(Hordeum vulgare)昼夜节律钟基因CCA1的克隆及表达分析%Cloning and Expression Analysis of Circadian Clock Gene CCA1 in Barley (Hordeum vulgare)

    Institute of Scientific and Technical Information of China (English)

    邢国芳; 宋萌; 姚涵; 韩渊怀


    CCA 1 gene plays an important role in circadian clock sensitivity in rice (Oryza sativa L. ) and Arabidopsis thaliana. In this study, CCAl gene in barley was cloned by RT-PCR using homological primers based on the highly conserved region of the multiple alignments of the rice and Arabidopsis. The similarities of this sequence were up to 72% and 69%, respectively, to corresponding mRNA sequences of rice and maize in BLASTx of GenBank database. Using ORF Finder software, a 2157 bp open reading frame was found to code 718 amino acids. Using Compute pI/Mw tool, the amino acid sequence was analyzed, and it revealed that the molecular weight of this protein was about 77 769. 4 Da, and isoelectric point was about 6. 55. We established fluorescence quantitative RT-PCR system with barley inbred lines HUADAMAI 1 and HUADAMAI 2, and studied the expression of CCAl in leaf under 16h/8h (light/ dark) conditions. Expression analysis showed that the gene expression peaked at dawn (ZTO) then gradually declined from ZTO to ZT15, bottomed at ZT15, then increased and returned to the initial level at ZT24. This study will provide information of barley CCAl gene for further studying the function in regulating photoperiod sensitivity in barley, and provide scientific basis for clarifying the mechanism of the circadian synchronization in barley.%昼夜节律钟基因CCA1在调解水稻和拟南芥的光周期反应中起着重要作用.利用BLAST手段以玉米中的CCA1基因序列作为靶序列,调取Genbank数据库信息,并结合RT-PCR方法获得了大麦的cDNA同源序列.BLASTx分析发现其与水稻和玉米的序列相似性分别达到72%和69%.通过ORF Finder软件分析发现,该序列包含一个2157 bp的开放阅读框,编码一个由718个氨基酸残基组成的蛋白序列,其分子量为77769.4 Da,等电点为6.55.采用实时荧光定量PCR分析发现,随光照时间的变化,该基因在大麦叶片中的表达量呈现出白天不断降低而夜晚逐渐

  4. Efeitos de potenciais de água no solo, em diferentes estádios fenológicos da cultura da cevada (Hordeum vulgare L. Effects of soil water potentials at different phenological phases of barley crop (Hordeum vulgare L.

    Directory of Open Access Journals (Sweden)

    M.A. Urchei


    Full Text Available Objetivando avaliar os efeitos de défices hídricos, em três estádios fonológicos da cultura da cevada (Hordeum vulgare L., foi conduzido experimento em vasos, com delineamento em blocos ao acaso. Foram utilizados nove tratamentos decorrentes da combinação dos potenciais mínimos de água no solo de -0,05, -0,20 e -1,50 MPa, com os estádios fenológicos de máximo perfilhamento, florescimento e grão leitoso, permanecendo uniformizados durante o restante do ciclo, entre os potenciais de -0,01 a -0,05 MPa. Os resultados de produção, peso e teor de proteína dos grãos, tamanho de espigas, número total e número de espigas chochas, mostraram que os efeitos de défices hídricos variaram com a intensidade, duração e estádio fenológico da cultura, onde o estádio de florescimento mostrou-se mais sensível ao défice de água. A ocorrência de défice hídrico intenso, em cada um dos estádios, bem como ciclos repetidos de défices moderados ou intensos, levaram à diminuições significativas na produção de grãos, além de ocorrer tendência ao aumento do teor de protema dos grãos. O manejo da irrigação na cultura da cevada, quando se busca a máxima eficiência no uso da água, deve levar em conta os diferentes estádios fenológicos.The experiment was carried out under greenhouse conditions, with the objective of evaluating the effects of water deficits in three phenological phases of barley crop (Hordeum vulgare L.. Pots were arranged in a randomized block design with nine treatments. They originated from the combination of minimum soil water potentials of -0,05, -0,20 and -1,50 MPa, with the phenological phases of maximum tillering, flowering and milky grain, having been hold uniformly along the rest of the cycle, between -0,01 and -0,05 MPa potentials. Weight of grain, protein content, spike sizes, spike total number and number of hollow spikes, showed that water deficit effects varied with the intensity, duration and

  5. Winter forage quality of oats (avena sativa), barley (hordeum vulgare) and vetch (vicia sativa) in pure stand and cereal legume mixture

    International Nuclear Information System (INIS)

    A field study was carried out for two consecutive years in subtropical rainfed conditions of Rawalpindi, Pakistan to evaluate the forage quality of oats, barley and vetch grown in pure stands and cereal-legume mixtures. Treatments comprised oats pure stand, oats in oats-vetch mixture, barley pure stand, barley in barley-vetch mixture, vetch pure stand, vetch in oats-vetch mixture and vetch in barley-vetch mixture. Forage yield and quality of oats and barley were improved in oats-vetch and barley-vetch mixtures than their respective pure stands. The higher values of crude protein (CP) and lower values of neutral detergent fiber (NDF) and acid detergent fiber (ADF) reflected quality forage. CP for oats in oats-vetch -1 -1 mixture and barley in barley-vetch mixture was 175 g kg and 170 g kg, -1 respectively. NDF and ADF for oats in oats-vetch mixture were 494 g kg /sup -1/ and 341 g kg, respectively; while these values for barley in barley-vetch -1 -1 mixture were 340 g kg and 176 g kg, respectively. (author)

  6. Competition and niche differentiation in barley (Hordeum vulgare) and wheat (Triticum aestivum) mixtures under rainfed conditions in the Central Highlands of Eritrea


    Woldeamlak, A.; L. Bastiaans; Struik, P.C.


    Barley and wheat mixtures were grown in the field using additive and replacement ratios at two locations (Halhale and Mendefera) in Eritrea during the 1997 and 1998 seasons. The aim was to assess yield advantage and to analyse competition and niche differentiation using a hyperbolic regression model. It proved advantageous to grow barley and wheat in mixtures because more land area was required to obtain the same yield in sole crops. The hyperbolic regression approach confirmed that barley an...

  7. The Effect of Natural Variation at Ppd-H1 and HvELF3 on Responses to Osmotic Stress in Barley (Hordeum Vulgare)


    Haile, Ermias Habte


    The circadian clock is an important timing system that, in part, controls stress adaptation in Arabidopsis thaliana. In the model crop barley, the clock orthologs Ppd-H1 and HvELF3 are important regulators of photoperiod response and flowering. However, little is known about additional effects of the clock on plant performance and stress adaptation in barley. Therefore, the objectives of this study were i) to analyse the effects of natural variation at the barley photoperiod response and cloc...

  8. Influence of Italian ryegrass (Lolium multiflorum Lam. as intercrop with spring barley (Hordeum vulgare L. on the diversity of weed communities

    Directory of Open Access Journals (Sweden)

    Krzysztof Orzech


    Spring barley weeding was significantly higher in case of cultivating it in mixed stand with Italian ryegrass (without chemical control, than in pure stand (with control. In the plots with mixed crop, lower diversity and homogeneity of weeds’ communities were recorded than in pure stand. Barley in mixed crop sown after spring barley, during both times of evaluation (spring and before harvest, increased the value of the index of dominance according to the number of species the most. As concerns the composition of species, number and biomass, the communities of pure stand and mixed crop with Italian ryegrass on the plot after potato were the most similar.

  9. Antioxidant activity of 100% and 80% methanol extracts from barley seeds (Hordeum vulgare L.): stabilization of sunflower oil


    Iqbal, Shahid; Ijaz Hussain, Abdullah; Abdul Qayyum, Hafiz Muhammad; Anwar, Farooq


    The antioxidant potential of 100% and 80% methanol extracts from the seeds of three barley varieties (Jou 83, Jou 87 and Haider 93) was assessed. The extract yields from barley seeds ranged from 3.23% (Haider 93,100% methanol) to 5.31% (Jou 83, 80% methanol). The total phenolic contents, DPPH radical scavenging activity (IC50 values) and inhibition of linoleic acid oxidation of barley seed extracts (BSE) were determined to be 88.1-145.7 mg/100g, 90.8-168.6 μg/mL and 62.6-74.6%, respectively. ...

  10. Impact of Pre-Anthesis Water Deficit on Yield and Yield Components in Barley (Hordeum vulgare L. Plants Grown under Controlled Conditions

    Directory of Open Access Journals (Sweden)

    Zakaria I. Al-Ajlouni


    Full Text Available Drought at pre-anthesis stages can influence barley growth and results in yield losses. Therefore, it is important to understand how drought at pre-anthesis can affect different traits associated with yield reduction in barley. The objective of this study was to understand the relevance of the genetic background of major flowering time genes in barley plants subjected to pre-anthesis drought and its impact on yield and yield components. A glasshouse experiment using a Randomized Complete Block Design was conducted to investigate the effect of drought and its timing on yield and yield components on eleven barley genotypes, which were selected to represent genetic diversity of major flowering time genes (PPDH1, PPDH2, HvVrn1, HvVrn2 and HvVrn3. Barley plants were exposed to three water regimes, non-stressed and stressed, which was applied at two pre-anthesis growth stages, tillering (SS and stem elongation (SE. Results identified differences among genotypes in all measured traits. Grain yield, grain number and "thousand kernel weight" were reduced in all genotypes due to drought, irrespective of the growth stage. Early flowering genotypes had better performance as reflected in higher yield compared with late flowering genotypes. Results verified the fundamental importance of early flowering to improve productivity in response to pre-anthesis drought. The results of this study can help in selecting barley lines for future breeding purposes with improved resilience to drought conditions in Mediterranean environments.

  11. Germination and microwave processing of barley (Hordeum vulgare L) changes the structural and physicochemical properties of β-d-glucan & enhances its antioxidant potential. (United States)

    Ahmad, Mudasir; Gani, Adil; Shah, Asima; Gani, Asir; Masoodi, F A


    The nutraceutical potential of β-d-glucan is largely dependent on its structure, size and viscosity. The present study analyzed the effect of germination and microwave processing of barley on the structural, size, antioxidant and thermal characteristics of β-d-glucan. The molecular weight and viscosity of β-d-glucan obtained from germinated barley (GGB) were the lowest (144kDa and 37.33cp) as compared to β-d-glucan from microwave processed barley (GMB) and unprocessed barley (GUB). The GGB exhibited higher antioxidant potential than GMB and GUB. The Structural elucidation by ATR-FTIR revealed scission in polymeric chain and β glycosydic linkage of β-d-glucan obtained from processed barley. The highest peak intensity at glycosydic linkage in GGB confirms more scission in the molecule. The DSC curve of GGB showed the highest transition temperature. It was concluded that germination of barley can be a good approach for enhancing the antioxidant potential of β-d-glucan. PMID:27561541

  12. Effects of extraction solvent mixtures on antioxidant activity evaluation and their extraction capacity and selectivity for free phenolic compounds in barley (Hordeum vulgare L.). (United States)

    Zhao, Haifeng; Dong, Jianjun; Lu, Jian; Chen, Jian; Li, Yin; Shan, Lianju; Lin, Yan; Fan, Wei; Gu, Guoxian


    Four kinds of solvent extracts from three Chinese barley varieties (Ken-3, KA4B, and Gan-3) were used to examine the effects of extraction solvent mixtures on antioxidant activity evaluation and their extraction capacity and selectivity for free phenolic compounds in barley through free radical scavenging activity, reducing power and metal chelating activity, and individual and total phenolic contents. Results showed that extraction solvent mixtures had significant impacts on antioxidant activity estimation, as well as different extraction capacity and selectivity for free phenolic compounds in barley. The highest DPPH* and ABTS*+ scavenging activities and reducing power were found in 80% acetone extracts, whereas the strongest *OH scavenging activity, O2*- scavenging activity, and metal chelating activity were found in 80% ethanol, 80% methanol, and water extracts, respectively. Additionally, 80% acetone showed the highest extraction capacity for (+)-catechin and ferulic, caffeic, vanillic, and p-coumaric acids, 80% methanol for (-)-epicatechin and syringic acid, and water for protocatechuic and gallic acids. Furthermore, correlations analysis revealed that TPC, reducing power, DPPH* and ABTS*+ scavenging activities were well positively correlated with each other (p extract free phenolic compounds from barley. DPPH* scavenging activity and ABTS*+ scavenging activity or reducing power could be used to assess barley antioxidant activity. PMID:16968094

  13. Molecular Mechanisms Underlying Hull-Caryopsis Adhesion/Separation Revealed by Comparative Transcriptomic Analysis of Covered/Naked Barley (Hordeum vulgare L.

    Directory of Open Access Journals (Sweden)

    Ruijun Duan


    Full Text Available The covered/naked caryopsis trait of barley is an important agronomic trait because it is directly linked to dietary use. The formation of covered/naked caryopsis is controlled by an NUD transcription factor, which is involved in pericarp cuticle development. However, the molecular mechanism underlying this trait remains so far largely unknown. In this study, comparative transcriptomes of grains three weeks after anthesis of Tibetan Hulless barley landrace Dulihuang and covered barley Morex were analyzed using RNA-seq technique. A total of 4031 differentially expressed genes (DEGs were identified. The Nud gene was overexpressed in Morex, with trace expression in Dulihuang. Among seventeen cuticle related DEGs, sixteen were down regulated and one up regulated in Morex. These results suggest that the Nud gene in covered caryopsis might down regulate cuticle related genes, which may cause a permeable cuticle over pericarp, leading to a hull-caryopsis organ fusion. A functional cuticle covering the pericarp of naked caryopsis might be the result of deletion or low expression level of the Nud gene. The functional cuticle defines a perfect boundary to separate the caryopsis from the hull in naked barley.

  14. Detection of duplicates among repatriated Nordic spring barley (Hordeum vulgare L. s.l.) accessions using agronomic and morphological descriptors and microsatellite markers

    DEFF Research Database (Denmark)

    Lund, Birgitte; Ortiz, Rodomiro; von Bothmer, Roland; Andersen, Sven Bode


    Duplicate accessions in gene banks may be increasing while funding resources to maintain them are not always available. This research investigated the ability of agronomic and morphological descriptors for detecting duplicates among 138 repatriated putative Nordic barley germplasm and compared th...... selection intensity) and are therefore complementary. © 2012 Springer Science+Business Media B.V....

  15. Shoot apex development date of anthesis and grain yield of autumn-sown spring and winter barley hordeum-vulgare after different sowing times

    DEFF Research Database (Denmark)

    Knopp, E.


    One spring and eight winter barley cultivars were sown at intervals from the middle of September (normal) until the end of October (late). The apical meristem of the spring cultivar had developed furthest until the onset of winter. It had started ear differentiation after normal sowing. Among the...

  16. Genetic Study of the Manganese Use Efficiency Trait in Winter Barley (Hordeum vulgare L.) by Genome- Wide Association and Genomic Selection

    DEFF Research Database (Denmark)

    Leplat, Florian Jean Victor

    functionality in Mn dependent pathways and processes. In a the second step, a genuine statistical method to assist breeding programs in selecting new varieties, named Genomic Selection (GS), was applied. It was demonstrated that GS is an effective tool to be used in breeding programs for selecting more...... efficiency remained elusive. This PhD study aimed to understand better the genetic determination of the trait and propose new insights for plant breeding purposes. Two genome-wide approaches were used in a winter barley collection to characterize the genetic control of the trait. First, a Genome...... efficient varieties for Mn efficiency. The obtained results, using the two different genome-wide approaches, provided useful information for future barley breeding for Mn efficiency. Moreover candidate genes identification opened perspectives for a better characterization of Mn efficiency trait at the...

  17. In silico and in vitro analyses of the angiotensin-I converting enzyme inhibitory activity of hydrolysates generated from crude barley (Hordeum vulgare) protein concentrates. (United States)

    Gangopadhyay, Nirupama; Wynne, Kieran; O'Connor, Paula; Gallagher, Eimear; Brunton, Nigel P; Rai, Dilip K; Hayes, Maria


    Angiotensin-I-converting enzyme (ACE-I) plays a key role in control of hypertension, and type-2 diabetes mellitus, which frequently co-exist. Our current work utilised in silico methodologies and peptide databases as tools for predicting release of ACE-I inhibitory peptides from barley proteins. Papain was the enzyme of choice, based on in silico analysis, for experimental hydrolysis of barley protein concentrate, which was performed at the enzyme's optimum conditions (60 °C, pH 6.0) for 24 h. The generated hydrolysate was subjected to molecular weight cut-off (MWCO) filtration, following which the non-ultrafiltered hydrolysate (NUFH), and the generated 3 kDa and 10 kDa MWCO filtrates were assessed for their in vitro ACE-I inhibitory activities. The 3 kDa filtrate (1 mg/ml), that demonstrated highest ACE-I inhibitory activity of 70.37%, was characterised in terms of its peptidic composition using mass spectrometry and 1882 peptides derived from 61 barley proteins were identified, amongst which 15 peptides were selected for chemical synthesis based on their predicted ACE-I inhibitory properties. Of the synthesized peptides, FQLPKF and GFPTLKIF were most potent, demonstrating ACE-I IC50 values of 28.2 μM and 41.2 μM respectively. PMID:26948626

  18. Dipeptidyl Peptidase IV Inhibitory Peptides Derived from Oat (Avena sativa L.), Buckwheat (Fagopyrum esculentum), and Highland Barley (Hordeum vulgare trifurcatum (L.) Trofim) Proteins. (United States)

    Wang, Feng; Yu, Guoyong; Zhang, Yanyan; Zhang, Bolin; Fan, Junfeng


    Peptides released from oat, buckwheat, and highland barley proteins were examined for their in vitro inhibitory effects on dipeptidyl peptidase IV (DPP4), an enzyme that deactivates incretin hormones involved in insulin secretion. All of the hydrolysates exhibited DPP4 inhibitory activities, with IC50 values ranging from 0.13 mg/mL (oat glutelin alcalase digestion) to 8.15 mg/mL (highland barley albumin tryptic digestion). The lowest IC50 values in gastrointestinal, alcalase, and tryptic digestions were 0.99 mg/mL (oat flour), 0.13 mg/mL (oat glutelin), and 1.83 mg/mL (highland barley glutelin). In all, 35 peptides of more than seven residues were identified in the tryptic hydrolysates of oat globulin using liquid chromatography-mass spectroscopy. Peptides LQAFEPLR and EFLLAGNNK were synthesized and their DPP4 inhibitory activities determined. LQAFEPLR showed high in vitro DPP4 inhibitory activity with an IC50 value of 103.5 μM. PMID:26468909

  19. Mass Spectrometric Imaging of Wheat (Triticum spp.) and Barley (Hordeum vulgare L.) Cultivars: Distribution of Major Cell Wall Polysaccharides According to Their Main Structural Features. (United States)

    Veličković, Dušan; Saulnier, Luc; Lhomme, Margot; Damond, Aurélie; Guillon, Fabienne; Rogniaux, Hélène


    Arabinoxylans (AX) and (1→3),(1→4)-β-glucans (BG) are the main components of cereal cell walls and influence many aspects of their end uses. Important variations in the composition and structure of these polysaccharides have been reported among cereals and cultivars of a given species. In this work, the spatial distribution of AX and BG in the endosperm of mature grains was established for nine wheat varieties and eight barley varieties using enzymatically assisted mass spectrometry imaging (MSI). Important structural features of the AX and BG polymers that were previously shown to influence their physicochemical properties were assessed. Differences in the distribution of AX and BG structures were observed, both within the endosperm of a given cultivar and between wheat and barley cultivars. This study provides a unique picture of the structural heterogeneity of AX and BG polysaccharides at the scale of the whole endosperm in a series of wheat and barley cultivars. Thus, it can participate meaningfully in a strategy aiming at understanding the structure-function relationships of these two polymers. PMID:27463368

  20. Quantitative Trait Loci for Salinity Tolerance Identified under Drained and Waterlogged Conditions and Their Association with Flowering Time in Barley (Hordeum vulgare. L.

    Directory of Open Access Journals (Sweden)

    Yanling Ma

    Full Text Available Salinity is one of the major abiotic stresses affecting crop production via adverse effects of osmotic stress, specific ion toxicity, and stress-related nutritional disorders. Detrimental effects of salinity are also often exacerbated by low oxygen availability when plants are grown under waterlogged conditions. Developing salinity-tolerant varieties is critical to overcome these problems, and molecular marker assisted selection can make breeding programs more effective.In this study, a double haploid (DH population consisting of 175 lines, derived from a cross between a Chinese barley variety Yangsimai 1 (YSM1 and an Australian malting barley variety Gairdner, was used to construct a high density molecular map which contained more than 8,000 Diversity Arrays Technology (DArT markers and single nucleotide polymorphism (SNP markers. Salinity tolerance of parental and DH lines was evaluated under drained (SalinityD and waterlogged (SalinityW conditions at two different sowing times.Three quantitative trait loci (QTL located on chromosome 1H, single QTL located on chromosomes 1H, 2H, 4H, 5H and 7H, were identified to be responsible for salinity tolerance under different environments. Waterlogging stress, daylight length and temperature showed significant effects on barley salinity tolerance. The QTL for salinity tolerance mapped on chromosomes 4H and 7H, QSlwd.YG.4H, QSlwd.YG.7H and QSlww.YG.7H were only identified in winter trials, while the QTL on chromosome 2H QSlsd.YG.2H and QSlsw.YG.2H were only detected in summer trials. Genes associated with flowering time were found to pose significant effects on the salinity QTL mapped on chromosomes 2H and 5H in summer trials. Given the fact that the QTL for salinity tolerance QSlsd.YG.1H and QSlww.YG.1H-1 reported here have never been considered in the literature, this warrants further investigation and evaluation for suitability to be used in breeding programs.

  1. AB-QTL analysis reveals new alleles associated to proline accumulation and leaf wilting under drought stress conditions in barley (Hordeum vulgare L.

    Directory of Open Access Journals (Sweden)

    Sayed Mohammed A


    Full Text Available Abstract Background Land plants have evolved several measures to maintain their life against abiotic stresses. The accumulation of proline is the most generalized response of plants under drought, heat or salt stress conditions. It is known as an osmoprotectant which also acts as an instant source of energy during drought recovery process. But, both its role and genetic inheritance are poorly understood in agriculture crops. In the present work, advanced backcross quantitative trait locus (AB-QTL analysis was performed to elucidate genetic mechanisms controlling proline accumulation and leaf wilting in barley under drought stress conditions. Results The analysis revealed eight QTL associated to proline content (PC and leaf wilting (WS. QTL for PC were localized on chromosome 3H, 4H, 5H and 6H. The strongest QTL effect QPC.S42.5H was detected on chromosome 5H where drought inducible exotic allele was associated to increase PC by 54%. QTL effects QPC.S42.3H, QPC.S42.4H and QPC.S42.6H were responsible to heighten PC due to the preeminence of elite alleles over the exotic alleles which ranged from 26% to 43%. For WS, QTL have been localized on chromosome 1H, 2H, 3H and 4H. Among these, QWS.S42.1H and QWS.S42.4H were associated to decrease in WS due to the introgression of exotic alleles. In addition, two digenic epistatic interaction effects were detected for WS where the additive effect of exotic alleles imparted a favorable increase in the trait value. Conclusions The present data represents a first report on whole-genome mapping of proline accumulation and leaf wilting in barley. The detected QTL are linked to new alleles from both cultivated and wild accessions which bring out an initial insight on the genetic inheritance of PC and WS. These QTL alleles are fixed in the isogenic background of Scarlett, which will allow for positional cloning of underlying genes and to develop drought resilient barley cultivars.

  2. Identification of Barley (Hordeum vulgare L. Autophagy Genes and Their Expression Levels during Leaf Senescence, Chronic Nitrogen Limitation and in Response to Dark Exposure

    Directory of Open Access Journals (Sweden)

    Liliana Avila-Ospina


    Full Text Available Barley is a cereal of primary importance for forage and human nutrition, and is a useful model for wheat. Autophagy genes first described in yeast have been subsequently isolated in mammals and Arabidopsis thaliana. In Arabidopsis and maize it was recently shown that autophagy machinery participates in nitrogen remobilization for grain filling. In rice, autophagy is also important for nitrogen recycling at the vegetative stage. In this study, HvATGs, HvNBR1 and HvATI1 sequences were identified from bacterial artificial chromosome (BAC, complementary DNA (cDNA and expressed sequence tag (EST libraries. The gene models were subsequently determined from alignments between genome and transcript sequences. Essential amino acids were identified from the protein sequences in order to estimate their functionality. A total of twenty-four barley HvATG genes, one HvNBR1 gene and one HvATI1 gene were identified. Except for HvATG5, all the genomic sequences found completely matched their cDNA sequences. The HvATG5 gene sequence presents a gap that cannot be sequenced due to its high GC content. The HvATG5 coding DNA sequence (CDS, when over-expressed in the Arabidopsis atg5 mutant, complemented the plant phenotype. The HvATG transcript levels were increased globally by leaf senescence, nitrogen starvation and dark-treatment. The induction of HvATG5 during senescence was mainly observed in the flag leaves, while it remained surprisingly stable in the seedling leaves, irrespective of the leaf age during stress treatment.

  3. Evaluation of recurrent radiation with Cobalt 60 gamma rays on agronomic traits of barley (Hordeum Vulgare L.) in the R2M1 generation

    International Nuclear Information System (INIS)

    The objective of this work was to evaluate the effect of recurrent radiation on agronomic traits in two barley varieties. The research was carried out at experimental fields pertaining to the Instituto de Investigacion Agropecuaria, Acuicola y Forestal of the Estado de Mexico (ICAMEX). The biological material was irradiated in the Gamma Cell 220 at the Instituto Nacional de Investigaciones Nucleares (ININ). The experimental design was divided plots in the randomized blocks, with four replications. The factor varieties (Cerro Prieto and Puebla) was assigned to the big plots mean while in the factor doses was assignated to the small plots (0, 10, 20, 30, 40 and 50 krad of gamma rays). The variables under study were: germination, number of shoots, plant height, incidence of Puccinia striiformis, days to flowering, days to physiological maturity, spike length and yield. The analysis of variance exhibited no significant differences between varieties for all the studied variables. Regarding to dose, most of the studied variables exhibited significant differences, except for incidence of Puccinia striiformis and days to flowering. The interaction variety x doses showed significance only for the variable days to flowering and days to physiological maturity. The mean separation by Tukey test at 0.05 and the regression analysis showed that the variables: germination, number of shoots, plant height, spike length and yield decreased as the dose increased. On the other hand in the variables incidence of Puccinia striiformis, days to flowering and days to physiological maturity exhibited a direct relationship with the dose. (Author)

  4. Morphological, Physiological and Biochemical Impact of Ink Industry Effluent on Germination of Maize (Zea mays), Barley (Hordeum vulgare) and Sorghum (Sorghum bicolor). (United States)

    Zayneb, Chaâbene; Lamia, Khanous; Olfa, Ellouze; Naïma, Jebahi; Grubb, C Douglas; Bassem, Khemakhem; Hafedh, Mejdoub; Amine, Elleuch


    The present study focuses on effects of untreated and treated ink industry wastewater on germination of maize, barley and sorghum. Wastewater had a high chemical oxygen demand (COD) and metal content compared to treated effluent. Germination decreased with increasing COD concentration. Speed of germination also followed the same trend, except for maize seeds exposed to untreated effluent (E), which germinated slightly faster than controls. These alterations of seedling development were mirrored by changes in soluble protein content. E exerted a positive effect on soluble protein content and maximum levels occurred after 10 days with treated effluent using coagulation/flocculation (TEc/f) process and treated effluent using combined process (coagulation/flocculation/biosorption) (TEc/f/b). Likewise, activity of α-amylase was influenced by effluent composition. Its expression depended on the species, exposure time and applied treatment. Nevertheless, current results indicated TEc/f/b had no observable toxic effects on germination and could be a beneficial alternative resource to irrigation water. PMID:26341252

  5. Leaf proteome alterations in the context of physiological and morphological responses to drought and heat stress in barley (Hordeum vulgare L.). (United States)

    Rollins, J A; Habte, E; Templer, S E; Colby, T; Schmidt, J; von Korff, M


    The objective of this study was to identify barley leaf proteins differentially regulated in response to drought and heat and the combined stresses in context of the morphological and physiological changes that also occur. The Syrian landrace Arta and the Australian cultivar Keel were subjected to drought, high temperature, or a combination of both treatments starting at heading. Changes in the leaf proteome were identified using differential gel electrophoresis and mass spectrometry. The drought treatment caused strong reductions of biomass and yield, while photosynthetic performance and the proteome were not significantly changed. In contrast, the heat treatment and the combination of heat and drought reduced photosynthetic performance and caused changes of the leaf proteome. The proteomic analysis identified 99 protein spots differentially regulated in response to heat treatment, 14 of which were regulated in a genotype-specific manner. Differentially regulated proteins predominantly had functions in photosynthesis, but also in detoxification, energy metabolism, and protein biosynthesis. The analysis indicated that de novo protein biosynthesis, protein quality control mediated by chaperones and proteases, and the use of alternative energy resources, i.e. glycolysis, play important roles in adaptation to heat stress. In addition, genetic variation identified in the proteome, in plant growth and photosynthetic performance in response to drought and heat represent stress adaption mechanisms to be exploited in future crop breeding efforts. PMID:23918963

  6. Development of mutants of local barley bakur (T. Hordeum vulgare. c v Bakkur L.) with good quantitative and qualitative traits under rainfed condition

    International Nuclear Information System (INIS)

    Seeds of local barley bakur were exposed to 150 Gy of gamma rays from cobalt 60 source irradiated seeds were planted in rows as M1.From M1 magnetized population plants , the main spike of each plants were collected, threshed and planted head to row method in 2008 winter season as M2. Evaluation of mutants was done for the increase in long spike and level of resistance to loading in compare with mother variety (untreated) resulted in selecting fifty mutated plants. These plants were planted as plant/ row method along with the mother variety and evaluated for grain yield and level of resistance for lodging which consequent y resulted in selecting of twenty four mutant lines which were varied in plant height long spike and yield. These lines were planted in the research farm during 2009 and the research farm during 2009 and 2011 winter season as M4 and M5 for two consecutive season resulted in selecting eight mutant lines which were distinguished of others in respect of level of resistance and increase of yield. These mutant lines were planted in plots in Kawkban and Bani-Mater locations during 2010 and 2011 seasons along with mother variety and improved variety Kawkban-1 which dominated in the region. Data were collected from the trail analyzed them separate y over each location. Results showed that the mutant line Al-e rra-B-008-15 was the best in grain yield and early maturity followed by Al-erra-B-008-20 and Al-erra-B-008-20. In the meantime these mutant line showed resistance to loading compare with other including the mother variety. There fore it can be recommended to register these mutants as a new varieties for Kawkaban Bain-Mater regions as well as for similar areas in the central and northern regions. This research summarizing results obtained from the trail conducted in both research farm and in farmer fields at Kawkaban and Bani-Mater locations. (Author)

  7. Development of the terrestrial biotic ligand model for predicting nickel toxicity to barley (Hordeum vulgare): ion effects at low pH. (United States)

    Antunes, Paula M C; Kreager, Nancy J


    The focus of the present study was to investigate the potential for Al3+, Mg2+, and H+ to influence Ni2+ toxicity for barley seedlings grown in acidic aqueous solutions and to assess the capacity of a two-site terrestrial biotic ligand model (tBLM) to accurately predict 50% effect activities (EA50s). To accomplish these objectives, 48-h EA50Ni2+ values were obtained for three sets of exposures in which the pH and activity of Al3+ and Mg2+ were varied. Exposures contained both Al alone and in combination with Mg so that compound ion effects could be investigated. A tBLM was then constructed to predict EA50Ni2+ values from the exposure solution chemistry. The results show a slight protective effect of H+ against Ni2+ toxicity and a strong protective effect of Mg2+, as indicated by a 4.6- and 8.0-fold increase in the measured EA50Ni2+ values corresponding to changes in pH from 6.0 to 4.5 and {Mg2+} from 0 to 1.40 mM, respectively. Increasing solution {Al3+} from 0 to 0.5 microM had no effect on Ni2+ toxicity, although Al itself negatively affected root elongation. Comparison of EA50 values calculated as both Ni2+ and measured concentration of total Ni in the root ([Root-Ni]T) showed [Root-Ni]T to be a more normalized measure of Ni bioavailability. The strong correlation between root growth inhibition and tBLM-predicted root-Ni accumulation suggests that toxicity was influenced by Ni2+ binding to low-affinity ligands within the cell wall, in addition to Ni2+ uptake through Mg2+ transporters. Predicted EA50Ni2+ values generated with the model were all within a factor of +/-1.5 from measured values--a result that emphasizes the advantage of using the tBLM for risk assessment. PMID:19374472

  8. Proteomic Response of Hordeum vulgare cv. Tadmor and Hordeum marinum to Salinity Stress: Similarities and Differences between a Glycophyte and a Halophyte. (United States)

    Maršálová, Lucie; Vítámvás, Pavel; Hynek, Radovan; Prášil, Ilja T; Kosová, Klára


    Response to a high salinity treatment of 300 mM NaCl was studied in a cultivated barley Hordeum vulgare Syrian cultivar Tadmor and in a halophytic wild barley H. marinum. Differential salinity tolerance of H. marinum and H. vulgare is underlied by qualitative and quantitative differences in proteins involved in a variety of biological processes. The major aim was to identify proteins underlying differential salinity tolerance between the two barley species. Analyses of plant water content, osmotic potential and accumulation of proline and dehydrin proteins under high salinity revealed a relatively higher water saturation deficit in H. marinum than in H. vulgare while H. vulgare had lower osmotic potential corresponding with high levels of proline and dehydrins. Analysis of proteins soluble upon boiling isolated from control and salt-treated crown tissues revealed similarities as well as differences between H. marinum and H. vulgare. The similar salinity responses of both barley species lie in enhanced levels of stress-protective proteins such as defense-related proteins from late-embryogenesis abundant family, several chaperones from heat shock protein family, and others such as GrpE. However, there have also been found significant differences between H. marinum and H. vulgare salinity response indicating an active stress acclimation in H. marinum while stress damage in H. vulgare. An active acclimation to high salinity in H. marinum is underlined by enhanced levels of several stress-responsive transcription factors from basic leucine zipper and nascent polypeptide-associated complex families. In salt-treated H. marinum, enhanced levels of proteins involved in energy metabolism such as glycolysis, ATP metabolism, and photosynthesis-related proteins indicate an active acclimation to enhanced energy requirements during an establishment of novel plant homeostasis. In contrast, changes at proteome level in salt-treated H. vulgare indicate plant tissue damage as

  9. Comparison of foliar anatomy of ten bread wheat (triticum, poaceae) and ten barley (hordeum, poaceae) cultivars

    International Nuclear Information System (INIS)

    The aim of this study is to determine anatomical differences and classification of leaf and leaf cell characteristics (cuticle thickness, upper epidermis thickness, lower epidermis thickness, mesophyll thickness, parenchyma thickness and leaf thickness) between 10 bread wheat cultivars (Triticum aestivum L.) and 10 barley cultivars (Hordeum vulgare L.). Classification of leaf characteristics in bread wheat and barley cultivars and relationship between leaf characteristics are made by principal component and correlation analyses. Highest thickness belongs to W8 Mufitbey cultivar in mesophyll and lower epidermis and W1 Sonmez 01 cultivar have the lowest thickness of upper epidermis in bread wheat. In Barley, B1 Ince cultivar has highest leaf thickness mesophyll and parenchyma; lowest thickness of cuticle is included B7 Cumhuriyet 50 cultivar. All other cultivars have homogenous contents of leaf characteristics. (author)

  10. Effects of Different Temperature and Harvest Time on Barley(Hordeum vulgare L.) Sprouts Production%不同温度处理和采收时间对大麦芽苗菜生产的影响

    Institute of Scientific and Technical Information of China (English)

    李春龙; 韩春梅; 叶少平; 李龙秀; 林依倔


    [目的]确定大麦(Hordeum vulgare L.)芽苗菜生产的适宜处理温度和采收时间.[方法]利用正交试验设计,研究不同温度处理(15、20、25、30℃)和采收时间(9、10、11 d)2个因素对大麦芽苗菜生长和产量的影响.[结果]A3B2(即处理温度为25℃,采收时间为10 d)处理下大麦芽苗菜的株高较高为12.7 cm,生物产量和经济产量最高,分别为77.19和1.44 kg/m2.[结论]该研究可为提高大麦芽苗菜产量、制订高产优质的栽培技术提供理论依据.

  11. The activity of some oxidoreductases in Hordeum vulgare L. plants treated with ethylmethanesulfonate and Rosmarinus officinalis L. hydro-alcoholic extracts


    Gogu Gheorghita; Elena Ciornea; Ioana Daciana Mierlici


    This paper focuses on the activity of some oxidoreductases (catalase, peroxidase, superoxide- dismutase) in barley seedlings (Hordeum vulgare L.) after 6 hours of seeds treatment with different concentrations (0,01 – 0,50%) of ethyl-methane-sulfonate and 12 hours with hydro-alcoholic 0,5% rosemary (Rosmarinus officinalis L.) extract (EHR). The EMS treatments led to an obvious increase of the superoxide dismutase, catalase and peroxidase activity in plants, while the application of the hydro-a...

  12. Reduction of gramine concentration by gamma-irradiation in seedlings of Hordeum vulgare var. Amaginijo

    International Nuclear Information System (INIS)

    The effects of gamma-irradiation on gramine concentration in seedlings of barley (Hordeum vulgare var. Amaginijo) were investigated. Similarly to other barley cultivars, this amine appeared in shoots of sprouting seedlings and its concentration increased in the course of subsequent development to attain a maximum around the ninth day. Exposure of two-day-old seedlings to gamma-radiation resulted in significant reductions of the concentration as compared with non-irradiated control, dependent upon the radiation dose, whilst the five-day-old seedlings were slightly affected. Seeds were more radioresistant than younger seedlings, when the decline in gramine quantity was taken as a marker of radiation effect. Longer storage of irradiated seeds enhanced the decrease of this compound in seedlings. At relatively low doses, gramine concentration was successively recovered to reach the control level during further growth. This decline of gramine content could not be correlated solely with water content of seeds and oxygen did not seem to be a critical factor. On the basis of these results, probable mechanisms for radiation-induced reduction of the amine concentration are discussed. In these experiments it was found that changing patterns of gramine content were in close parallel with those of growth

  13. Transferability and polymorphism of barley EST-SSR markers used for phylogenetic analysis in Hordeum chilense

    Directory of Open Access Journals (Sweden)

    Dorado Gabriel


    Full Text Available Abstract Background Hordeum chilense, a native South American diploid wild barley, is a potential source of useful genes for cereal breeding. The use of this wild species to increase genetic variation in cereals will be greatly facilitated by marker-assisted selection. Different economically feasible approaches have been undertaken for this wild species with limited direct agricultural use in a search for suitable and cost-effective markers. The availability of Expressed Sequence Tags (EST derived microsatellites or simple sequence repeat (SSR markers, commonly called as EST-SSRs, for barley (Hordeum vulgare represents a promising source to increase the number of genetic markers available for the H. chilense genome. Results All of the 82 barley EST-derived SSR primer pairs tested for transferability to H. chilense amplified products of correct size from this species. Of these 82 barley EST-SSRs, 21 (26% showed polymorphism among H. chilense lines. Identified polymorphic markers were used to test the transferability and polymorphism in other Poaceae family species with the aim of establishing H. chilense phylogenetic relationships. Triticum aestivum-H. chilense addition lines allowed us to determine the chromosomal localizations of EST-SSR markers and confirm conservation of the linkage group. Conclusion From the present study a set of 21 polymorphic EST-SSR markers have been identified to be useful for diversity analysis of H. chilense, related wild barleys like H. murinum, and for wheat marker-assisted introgression breeding. Across-genera transferability of the barley EST-SSR markers has allowed phylogenetic inference within the Triticeae complex.

  14. [In vitro effect of Hordeum vulgare on the crystallization of calcium oxalate monohydrate (whewellite)]. (United States)

    Djaroud, Samira; Harrache, Djamila; Amar, Amina


    The recommended conservative treatment of hyperoxaluria is mainly based on hyperhydration and ingestion of inhibitors of crystallization. In accordance with this context, the aim of this study was to determine the in vitro effect of Hordeum vulgare on calcium oxalate crystallization oxalo-dependent. The crystallization of calcium oxalate monohydrate in supersaturated aqueous solution at 37 °C, was followed in a model turbidimetric continuous in a closed system. The proposed model is very good reproducibility (CV < 10%), crystallization was monitored continuously in the presence of Hordeum vulgare at different concentrations (0.0625 to 1 g/L). The comparison of turbidimetric parameters, that characterize the growth stage of monohydrated oxalate calcium crystals and observation of the crystals obtained at the end of crystallization into scanning electron microscopy, have been able to demonstrate the inducing effect of Hordeum vulgare to 0.0625 g/L and a slight inhibitory effect at the others concentrations. PMID:23207820

  15. Enhanced Pb Absorption by Hordeum vulgare L. and Helianthus annuus L. Plants Inoculated with an Arbuscular Mycorrhizal Fungi Consortium. (United States)

    Arias, Milton Senen Barcos; Peña-Cabriales, Juan José; Alarcón, Alejandro; Maldonado Vega, María


    The effect of an arbuscular mycorrhizal fungi (AMF) consortium conformed by (Glomus intraradices, Glomus albidum, Glomus diaphanum, and Glomus claroideum) on plant growth and absorption of Pb, Fe, Na, Ca, and (32)P in barley (Hordeum vulgare L.) and sunflower (Helianthus annuus L.) plants was evaluated. AMF-plants and controls were grown in a substrate amended with powdered Pb slag at proportions of 0, 10, 20, and 30% v/v equivalent to total Pb contents of 117; 5,337; 13,659, and 19,913 mg Pb kg(-1) substrate, respectively. Mycorrhizal root colonization values were 70, 94, 98, and 90%, for barley and 91, 97, 95, and 97%, for sunflower. AMF inoculum had positive repercussions on plant development of both crops. Mycorrhizal barley absorbed more Pb (40.4 mg Pb kg(-1)) shoot dry weight than non-colonized controls (26.5 mg Pb kg(-1)) when treated with a high Pb slag dosage. This increase was higher in roots than shoots (650.0 and 511.5 mg Pb kg(-1) root dry weight, respectively). A similar pattern was found in sunflower. Plants with AMF absorbed equal or lower amounts of Fe, Na and Ca than controls. H. vulgare absorbed more total P (1.0%) than H. annuus (0.9%). The arbuscular mycorrizal consortium enhanced Pb extraction by plants. PMID:25495930

  16. Separate Location of Parental Chromosomes in Squashed Metaphases of Hybrid between Hordeum vulgare L. and Four Polyploid, Alien Species

    DEFF Research Database (Denmark)

    Jensen, J.; Linde-Laursen, Ib


    In 38 squashed, somatic metaphases of four hybrids between diploid Hordeum vulgare and two tetra-and two hexaploid alien species, each of the H. vulgare chromosomes was identifed, and differentiated from the chromosomes of the other parental species, by its Giemsa C-banding pattern. The H. vulgare...

  17. The activity of some oxidoreductases in Hordeum vulgare L. plants treated with ethylmethanesulfonate and Rosmarinus officinalis L. hydro-alcoholic extracts

    Directory of Open Access Journals (Sweden)

    Gogu Gheorghita


    Full Text Available This paper focuses on the activity of some oxidoreductases (catalase, peroxidase, superoxide- dismutase in barley seedlings (Hordeum vulgare L. after 6 hours of seeds treatment with different concentrations (0,01 – 0,50% of ethyl-methane-sulfonate and 12 hours with hydro-alcoholic 0,5% rosemary (Rosmarinus officinalis L. extract (EHR. The EMS treatments led to an obvious increase of the superoxide dismutase, catalase and peroxidase activity in plants, while the application of the hydro-alcoholic rosemary extract, after the EMS treatment, led to a significant decrease of the activities of these enzymes, since the rosemary extract has an obvious antioxidant effect.

  18. Implication of phospholipase D in response of Hordeum vulgare root to short-term potassium deprivation. (United States)

    Hafsi, Chokri; Russo, Marco A; Sgherri, Cristina; Izzo, Riccardo; Navari-Izzo, Flavia; Abdelly, Chedly


    To verify the possible involvement of lipids and several other compounds including hydrogen peroxide (H(2)O(2)) and glyceraldehyde-3-phosphate dehydrogenase (G3PDH) in the response of Hordeum vulgare to early potassium deprivation, plants were grown in hydroponic conditions for 30d with a modified Hewitt nutrient solution containing 3mM K(+). They were then incubated for increasing periods of time ranging from 2 to 36h in the same medium deprived of K(+). In contrast to leaves, root K(+) concentration showed its greatest decrease after 6h of treatment. The main lipids of the control barley roots were phospholipids (PL), representing more than 50% of the total lipids. PL did not change with treatment, whereas free sterols (FS) decreased following K(+) deprivation, showing a reduction of approximately 17% after 36h. With respect to the individual PL, 30h K(+) deprivation led to a reduction in phosphatidylcholine (PC), phosphatidylserine (PS), and phosphatidylinositol (PI) levels, whereas phosphatidylglycerol (PG), phosphatidylethanolamine (PE), and phosphatidic acid (PA) levels increased. The maximum PA accumulation and the highest phospholipase D (PLD) activation, estimated by an accumulation of phosphatidylbutanol (PtBut), were observed after 24h of K(+) starvation. At the root level, H(2)O(2) showed the maximum value after 6h of incubation in -K solution. In parallel, G3PDH activity reached its minimum. On the basis of a concomitant stimulation of PLD activity and, consequently, PA accumulation, enhancement of H(2)O(2) production, and inhibition of G3PDH activity, we suggest a possible involvement of these three compounds in an early response to K(+) deprivation. PMID:18814934

  19. Yield of Different Green Forage Crops, in Pure Stand and in Mixtures Part 1.: Spring (two roweed Barley (Hordeum vulgare L., Pea (Pisum sativum L. and Vetch (Vicia sp. L.

    Directory of Open Access Journals (Sweden)

    R. Hoffman


    Full Text Available Green fodder crops in pure stand and in mixtures have a great potential and will have a great role in the nutrition for ruminants in Hungary. Therefore experiment was carried out to measure the born of green fodder crop production in the present situation of cattle husbandry. The experimental area was situated on the farm of the Department of Botany and Plant Production at the University of Kaposvár, Faculty of Animal Science. The type of the soil was brown forest soil with clay illuvitation. The small plot trials were carried out in four repetitions using conventional random adjustment. After the harvesting the yield of the plots were weighted and the dry matter content, crude protein yield crude fibber was determined by Weendei analysis. The chemical components of the variations were determined in two repetitions. The following species was used in the small plot trial: spring barley, pea and vetch. The highest green and dry matter yield was measured at the barley varieties in pure stand. Between the barley varieties Annabell gave the highest green, DM and crude protein yield. Spring Barley Annabell and pea Rubin in mixture gave the highest yield of crude protein.

  20. Engineering of the aspartate family biosynthetic pathway in barley (Hordeum vulgare L.) by transformation with heterologous genes encoding feed-back-insensitive aspartate kinase and dihydrodipicolinate synthase

    DEFF Research Database (Denmark)

    Brinch-Pedersen, Henrik; Galili, G; Knudsen, S;


    In prokaryotes and plants the synthesis of the essential amino acids lysine and threonine is predominantly regulated by feed-back inhibition of aspartate kinase (AK) and dihydrodipicolinate synthase (DHPS). In order to modify the flux through the aspartate family pathway in barley and enhance the...

  1. Screening for spontaneous virulent mutants of erysiphe-graminis-f-sp-hordei on barley hordeum-vulgare lines with resistance genes ml-a-1 ml-a-6 ml-a-12 and ml-g

    DEFF Research Database (Denmark)

    Torp, J.; Jensen, Hans Peter


    Seedlings of 4 barley lines with powdery mildew resistance genes Ml-al, Ml-a6, Mla12 or Ml-g were inoculated with powdery mildew culture CR3 which is avirulent to the 4 host lines. Inoculation density was 1.2 infectious conidia/mm2, and in total 50 million conidia were screened for the occurrence...

  2. Genotype-Dependent Effect of Exogenous Nitric Oxide on Cd-induced Changes in Antioxidative Metabolism, Ultrastructure, and Photosynthetic Performance in Barley Seedlings (Hordeum vulgare)

    DEFF Research Database (Denmark)

    Chen, Fei; Wang, Fang; Sun, Hongyan;


    A greenhouse hydroponic experiment was performed using Cd-sensitive (cv. Dong 17) and Cd-tolerant (Weisuobuzhi) barley seedlings to evaluate how different genotypes responded to cadmium (Cd) toxicity in the presence of sodium nitroprusside (SNP), a nitric oxide (NO) donor. Results showed that 5 μ...

  3. Hordeum vulgare cysteine protease heterologous expressed in yeast

    DEFF Research Database (Denmark)

    Rosenkilde, Anne Lind; Dionisio, Giuseppe; Holm, Preben Bach;

    During germination of barley seeds, the mobilization of protein is essential and Cysteine Proteases accounts for more than 90 % of the total proteolytic activity in the degradation of barley seed storage proteins [1]. Cysteine proteases exist as pro-enzyme until activated through reduction of the...... active site cysteines and via removal of the pro-domain. The complement of cysteine proteases is comprehensive and for detailed studies of the individual components of this complement, a fast and efficient eukaryotic expression platform is highly desirable. One of the key cysteine proteases in Barley...

  4. Physiological and biochemical reactions of Hordeum vulgare seedlings to the action of silver nanoparticles

    Directory of Open Access Journals (Sweden)

    N. O. Khromykh


    Full Text Available Morphometrical indexes, and spectrophotometrically measured protein and glutathione (GSH, GSSG contents and activity of peroxidase (POD, EC, glutathione-reductase (GR, EC and glutathione S-transferase (GST, EС were examined in Hordeum vulgare L. seedlings after 0.01 and 0.1 mg/l AgNPs treatment during 24 h. We tested the hypothesis that the action of nanoparticles has a stressful effect on the physiological and biochemical processes of seedlings. Growth of roots was inhibited and fresh weight decreased by 29% and 21% under low and high concentrations respectively. Conversely, leaf growth was intensified, and leaf length (16% and 18% and fresh weight (35% and 44% increased at low and high concentrations respectively. POD activity in roots increased by 26% and 7%, and decreased in leaves to 57% and 81% of control at low and high concentrations respectively. GSH content changed insignificantly, but GSSG content increased in roots (2 and 2.5-fold and in leaves (13% and 30% at both AgNPs concentrations. GSH/GSSG-ratio decreased in roots (1.9 and 2.6-fold and in leaves (1.1 and 1.3-fold at low and high concentrations respectively. GR activity decreased at a concentration of 0.01 mg/l (7% in roots and 17% in leaves respectively and increased at 0.1 mg/l (52% in roots and 6% in leaves. GST activity increased in leaves (52% and 78% at low and high concentrations but decreased by 17% in roots under high concentration of nanosilver. Thus, the action of AgNPs on barley seedlings had a dose-dependent and organ-specific character. The various directions of changes in growth, metabolic processes and activity of antioxidant defense systems appear to be a stress response of barley seedlings to the impact of AgNPs, which underlines the necessity of detailed study of plant intracellular processes exposed to the action of nanomaterial.

  5. Evaluation of Hairy Vetch (Vicia villosa Roth in Pure and Mixed Cropping with Barley (Hordeum vulgare L. to Determine the Best Combination of Legume and Cereal for Forage Production

    Directory of Open Access Journals (Sweden)

    Seyedeh S. Shobeiri


    Full Text Available Problem statement: Mixed cereal-legume cropping can supply valuable forage in dry areas, as well as improving soil characteristics to approach sustainable farming systems in these regions. Approach: In order to comprise quality and quantity of produced forage and to determine the best planting ratio in a hairy vetch and barley mix cropping, a two year study was conducted during 2008 and 2009 in Zanjan Center for Research of Agricultural Science and Natural Resources, Zanjan, Iran, using these two forage crops in a completely randomized block design with five treatments and four replications. Hairy vetch and barley were single- or mix cropped at 100:0, 75:25, 50:50, 25:75 and 0:100 ratios. Results: Analysis of variance of two years data showed hay yield, absorbed N, P and K amounts and crude protein content varied among years and different planting ratio, significantly, with higher amounts in the second year. The highest dry matter yield, absorbed N, P and K and crude protein content were obtained in 50:50 planting ratio. The land equivalent ratio was more than one for all mix cropping treatments, with the highest value in 50:50 planting ratio, which also led to the highest LER in respect to crude protein. Conclusion: A 50:50 mixture of barley-hairy vetch can produce the highest dry forage yield, with a higher LER and the highest forage quality than sole cropping.

  6. The rpg4-mediated resistance to wheat stem rust (Puccinia graminis) in barley (Hordeum vulgare) requires Rpg5, a second NBS-LRR gene, and an actin depolymerization factor. (United States)

    Wang, X; Richards, J; Gross, T; Druka, A; Kleinhofs, A; Steffenson, B; Acevedo, M; Brueggeman, R


    The rpg4 gene confers recessive resistance to several races of wheat stem rust (Puccinia graminis f. sp. tritici) and Rpg5 provides dominant resistance against isolates of the rye stem rust (P. graminis f. sp. secalis) in barley. The rpg4 and Rpg5 genes are tightly linked on chromosome 5H, and positional cloning using high-resolution populations clearly separated the genes, unambiguously identifying Rpg5; however, the identity of rpg4 remained unclear. High-resolution genotyping of critical recombinants at the rpg4/Rpg5 locus, designated here as rpg4-mediated resistance locus (RMRL) delimited two distinct yet tightly linked loci required for resistance, designated as RMRL1 and RMRL2. Utilizing virus-induced gene silencing, each gene at RMRL1, i.e., HvRga1 (a nucleotide-binding site leucine-rich repeat [NBS-LRR] domain gene), Rpg5 (an NBS-LRR-protein kinase domain gene), and HvAdf3 (an actin depolymerizing factor-like gene), was individually silenced followed by inoculation with P. graminis f. sp. tritici race QCCJ. Silencing each gene changed the reaction type from incompatible to compatible, indicating that all three genes are required for rpg4-mediated resistance. This stem rust resistance mechanism in barley follows the emerging theme of unrelated pairs of genetically linked NBS-LRR genes required for specific pathogen recognition and resistance. It also appears that actin cytoskeleton dynamics may play an important role in determining resistance against several races of stem rust in barley. PMID:23216085

  7. In vitro inhibition of platelet aggregation by peptides derived from oat (Avena sativa L.), highland barley (Hordeum vulgare Linn. var. nudum Hook. f.), and buckwheat (Fagopyrum esculentum Moench) proteins. (United States)

    Yu, Guoyong; Wang, Feng; Zhang, Bolin; Fan, Junfeng


    Bioactive compounds present in foods could have beneficial effects on human health. In this study, we report the capacity of peptides released from oat, highland barley, and buckwheat proteins after enzymatic digestion to inhibit platelet aggregation in vitro. All hydrolysates showed high antiplatelet activity, with IC50 values of 0.282mg/ml (oat flour gastrointestinal hydrolysate, 6h) to 2.496mg/ml (highland barley glutelin tryptic hydrolysate, 14h) in a dose-dependent manner. Thirty-eight peptides with more than seven residues were identified in the tryptic hydrolysates of oat globulin. Results of computational modeling revealed that nine peptides, including ALPIDVLANAYR, EFLLAGNNKR, GEEFGAFTPK, QLAQIPR, LQAFEPLR, ALPVDVLANAYR, GEEFDAFTPK, QKEFLLAGNNK, and TNPNSMVSHIAGK bound the cyclooxygenase-1 active centers with low binding energy (-6.5 to -7.5kcal/mol). This is the first report to identify antiplatelet peptides from grain hydrolysates and the binding modes at the molecular level, leading to their possible use as functional food ingredients to prevent thrombosis. PMID:26471595

  8. Gaseous nitrogen losses from field plots grown with pea (Pisum sativum L.) or spring barley (Hordeum vulgare L.) estimated by 15N mass balance and acetylene inhibition techniques

    DEFF Research Database (Denmark)

    Bertelsen, F.; Jensen, E.S.


    In a mass balance of N-15-labelled nitrate added to soil grown with pea or barley, denitrification estimates using the acetylene-inhibition technique were compared with unaccounted for N-15. During the growth season of 1989, which was drier than average, N losses due to denitrification estimated by...... the acetylene-inhibition technique were negligible. A substantial amount of fertilizer N was unaccounted for by the N-15 mass balance, especially in the pea plots. The loss took place during the period of grain-filling in which no leaching occurred, and was accompanied by a decrease in N-15 content of...... the plants. Volatilization of ammonia from the aerial parts of the plants is a possible explanation of the observed loss. An estimation of denitrification relying only on the N-15 mass balance would have resulted in an overestimation of denitrification....

  9. Chromosomal Location and Expression of Green Fluorescent Protein (gfp) Gene in Microspore Derived Transgenic Barley (Hordeum vulgare L.)%转基因大麦中gfp基因的染色体位置及其表达

    Institute of Scientific and Technical Information of China (English)

    陈建民; Carlson A R; 万建民; Kasha K J


    通过对大麦小孢子进行基因枪轰击获得4株转绿色荧光蛋白基因(gfp)的植株(A、C、D、E),以gfp基因为探针进行荧光原位杂交(FISH)研究转化植株中转基因插入位置和基因表达.4个株系在染色体7L(5HL)的不同位置都有一个插入点,而E株系在染色体5S(7HS)还有第2个插入点.所有的转基因T0代植株都是半合子并在T1、T2代发生分离.D株系GFP未表达,但FISH和PCR分析表明gfp基因已成功插入其染色体.各株系在根尖和花粉中的GFP表达水平不同:C株系在花粉表达强而在根尖表达中等;A株系在花粉中等表达而在根尖表达较淡;E株系则在根尖高表达,花粉中等表达.A和C株系在根尖和花粉的GFP分离都表现单位点特性,而E株系的根尖分离表现重叠作用(15∶1)特征,但在花粉中表达GFP的频率低.PCR结果和3个分离株系的根尖表达结果一致.D和E株系的GFP表达不正常可能和gfp基因插入位置或基因的结构有关.%Four doubled haploid barley lines (A,C,D,E) derived from gfp (green fluorescent protein) transformation and selection following particle bombardment of microspores were studied for gene expression pattern and the location of genome inserts.The integration sites were detected by fluorescence in situ hybridization (FISH) using the gfp plasmid DNA as a probe.Plants from events A,C,D and E all have a single insert site on chromosome 7L(5HL) at different locations while line E has a second insert site on chromosome 5S(7HS).All original transgenic plants were hemizygous for the transgenes and segregated in the T1 and T2 generations.Although line D had no GFP expression,FISH and PCR could detect gfp gene on its chromosome in transformed plants.Expression levels of GFP varied with lines and tissues examined.Plants from line C showed good expression in pollen and an intermediate level in root tips.Plants from A have intermediate expression of GFP in the pollen and light expression in the

  10. AFLP genetic polymorphism in wild barley (Hordeum spontaneum) populations in Israel

    NARCIS (Netherlands)

    Turpeinen, T.; Vanhala, T.; Nevo, E.; Nissila, E.


    The genetic diversity produced by the amplified fragment length polymorphism (AFLP) method was studied in 94 genotypes of wild barley, Hordeum spontaneum (C. Koch) Thell., originating from ten ecologically and geographically different locations in Israel. Eight primer pairs produced 204 discernible

  11. Molecular modeling approach to explore the role of cathepsin B from Hordeum vulgare in the degradation of Aβ peptides. (United States)

    Dhanavade, Maruti J; Parulekar, Rishikesh S; Kamble, Subodh A; Sonawane, Kailas D


    The pathological hallmark of Alzheimer's disease is the accumulation of Aβ peptides in human brains. These Aβ peptides can be degraded by several enzymes such as hACE, hECE, hIDE and cathepsin B. Out of which cathepsin B also belongs to the papain super family and has been found in human brains, it has a role in Aβ peptide degradation through limited proteolysis. The Aβ concentrations are maintained properly by its production and clearance via receptor-mediated cellular uptake and direct enzymatic degradation. However, the reduced production of Aβ degrading enzymes as well as their Aβ degrading activity in human brains initiate the process of accumulation of Aβ peptides. So it becomes essential to investigate the molecular interactions involved in the process of Aβ degradation in detail at the atomic level. Hence, homology modeling, molecular docking and molecular dynamics simulation techniques have been used to explore the possible role of cathepsin B from Hordeum vulgare in the degradation of amyloid beta (Aβ) peptides. The homology model of cathepsin B from Hordeum vulgare shows good similarity with human cathepsin B. Molecular docking and MD simulation results revealed that the active site residues Cys32, HIS112, HIS113 are involved in the catalytic activity of cathepsin B. The sulfhydryl group of the Cys32 residue of cathepsin B from Hordeum vulgare cleaves the Aβ peptide from the carboxylic end of Glu11. Hence, this structural study might be helpful in designing alternative strategies for the treatment of AD. PMID:26568474

  12. Soil fertility status and nutrients provided to spring barley (Hordeum distichon L.) by pig slurry


    Melisa Gómez-Garrido; Silvia Martínez-Martínez; Ángel Faz Cano; Asuman Büyükkilif-Yanardag; Arocena, Joselito M.


    Nutrient recycling using pig slurry is a common agricultural practice to manage the ever-increasing amounts of wastes from the pig industry. This study was conducted in the southeast of Spain to quantify the enrichments in major (N, P, K, Mg) and minor (Zn, Fe, Cu, and Mn) nutrients in soils amended with D1-170 kg N ha-1 (European Union legislated dose) or D2-340 kg N ha-1, and understand the influence of pig slurry on yield and nutrient uptake in two crop seasons of spring barley (Hordeum di...

  13. Taxonomy Icon Data: barley [Taxonomy Icon

    Lifescience Database Archive (English)

    Full Text Available _S.png Hordeum_vulgare_NS.png ...

  14. QTLs for straw quality characteristics identified in recombinant inbred lines of a Hordeum vulgare x H. spontaneum cross in a Mediterranean environment. (United States)

    Grando, S; Baum, M; Ceccarelli, S; Goodchild, A; El-Haramein, F Jaby; Jahoor, A; Backes, G


    Barley straw is commonly used as animal feed in many developing countries. Even a small increase in its nutritive value can have a large impact on animal production, and hence, on rural livelihood and human nutrition. Straw quality is strongly affected by environmental factors and is, therefore, difficult to improve with empirical breeding. The objective of this study was to identify molecular markers to facilitate the improvement of straw quality in barley. For this purpose, we have used the genetic linkage map that was already developed for recombinant inbred lines (RILs) of the cross between a Hordeum vulgare cultivar ('Arta') and a H. spontaneum line (H. spontaneum 41-1), covering a total of 890 cM. Straw parameters from RILs grown at Tel Hadya and Breda (ICARDA's research stations) in 2 years (1996/1997 and 1997/1998) were analyzed by NIRS for predicted nutritional characteristics including neutral detergent fiber, acid detergent fiber, lignin, digestible organic matter in dry matter, voluntary intake, crude protein, and straw morphology (the percentage of blades, sheaths, and stems). Localization of QTLs was performed using Windows QTL Cartographer, version 2.0. Seventy-three QTLs were identified, the majority of which (17) in the driest of the four environments. Only six QTLs were identified in two environments; in five cases, one of the two was the wettest environment. This is discussed in relation to the possibility of improving straw quality in favorable environments where yields are higher, rather than in dry environments where straw quality is already relatively good. PMID:15678328

  15. Molecular Phylogeography of Domesticated Barley Traces Expansion of Agriculture in the Old World


    Saisho, Daisuke; Purugganan, Michael D.


    Barley (Hordeum vulgare ssp. vulgare) was first cultivated 10,500 years ago in the Fertile Crescent and is one of the founder crops of Eurasian agriculture. Phylogeographic analysis of five nuclear loci and morphological assessment of two traits in >250 domesticated barley accessions reveal that landraces found in South and East Asia are genetically distinct from those in Europe and North Africa. A Bayesian population structure assessment method indicates that barley accessions are subdivided...

  16. Soil fertility status and nutrients provided to spring barley (Hordeum distichon L. by pig slurry

    Directory of Open Access Journals (Sweden)

    Melisa Gómez-Garrido


    Full Text Available Nutrient recycling using pig slurry is a common agricultural practice to manage the ever-increasing amounts of wastes from the pig industry. This study was conducted in the southeast of Spain to quantify the enrichments in major (N, P, K, Mg and minor (Zn, Fe, Cu, and Mn nutrients in soils amended with D1-170 kg N ha-1 (European Union legislated dose or D2-340 kg N ha-1, and understand the influence of pig slurry on yield and nutrient uptake in two crop seasons of spring barley (Hordeum distichon L. Compared to control, D2 increased NO3--N by 11.4X to 109 mg kg-1, Olsen-P by 6.9X to 423 mg kg-1, exchange K (2.5X to 1.6 cmol+ kg-1, Mg (1.7X to 1.8 cmol+ kg-1, diethylene-triamine pentaacetic acid (DTPA-Zn (94X to 18.2 mg kg-1, and Fe (2X to 11.3 mg kg-1. Available NO3--N, Olsen-P, and DTPA-Zn have the best correlations with crop yield and nutrient uptake. These results indicate that the assessment of soil fertility status at 1-mo after pig slurry addition provides a good indicator for potential yield and uptake of barley. However, it is suggested that leachates should be monitored to effectively manage potential releases of nitrate and phosphate into the environment.

  17. Barley coleoptile peroxidases. Purification, molecular cloning, and induction by pathogens

    DEFF Research Database (Denmark)

    Kristensen, B.K.; Bloch, H.; Rasmussen, Søren Kjærsgård


    A cDNA clone encoding the Prx7 peroxidase from barley (Hordeum vulgare L.) predicted a 341-amino acid protein with a molecular weight of 36,515. N- and C-terminal putative signal peptides were present, suggesting a vacuolar location of the peroxidase. Immunoblotting and reverse-transcriptase poly......A cDNA clone encoding the Prx7 peroxidase from barley (Hordeum vulgare L.) predicted a 341-amino acid protein with a molecular weight of 36,515. N- and C-terminal putative signal peptides were present, suggesting a vacuolar location of the peroxidase. Immunoblotting and reverse...

  18. Molecular mapping of greenbug (Schizaphis graminum) resistance gene Rsg1 in barley (United States)

    The greenbug, Schizaphis graminum (Rondani) is an extremely damaging aphid pest of barley (Hordeum vulgare L., 2n = 2x =14 L.) particularly in the southern Great Plains of the US. The simply inherited, dominant resistance gene Rsg1 is presented in all greenbug-resistant US barley cultivars, includi...

  19. Effects of INH, DNP, 2, 4-D and CMU on the sugar content of the barley and maize leaves; Efecto de cuatro inhibidores metabolicos (INH, DNP, 2, 3-D y CMU) sobre el contenido en azucares de hohas de cebada (Hordeum vulgare L.) y Maiz (Zea mais L.)

    Energy Technology Data Exchange (ETDEWEB)

    Fernandez, J.; Sancho, P.


    1 ppm of the chemicals in nutritive solution was absorbed by barley and maize roots during 24 and 48 hours in dark or light conditioners in order to determine the best conditions. for the obtention of labelled sugars with high specific activity. Results show that the highest specific activity was obtained In maize plants treated with DNP for 24 hours in dark conditions. (Author) 51 refs.

  20. Lysine-Rich Proteins in High-Lysine Hordeum Vulgare Grain

    DEFF Research Database (Denmark)

    Ingversen, J.; Køie, B.


    The salt-soluble proteins in barley grain selected for high-lysine content (Hiproly, CI 7115 and the mutants 29 and 86) and of a control (Carlsberg II) with normal lysine content, contain identical major proteins as determined by MW and electrophoretic mobility. The concentration of a protein group...... with a high lysine content varies significantly among the barleys examined. One protein, present in large amounts in Hiproly, is assumed to be partially responsible for the high-lysine character of Hiproly, CI 7115 and the mutants 29 and 86....

  1. Effects of INH, DNP, 2,4-D and CMU on the photosynthetic activity of barley and maize plants; Efecto de cuatro inhibidores metabolicos (INH, DNP, 2, 4-D y CMU) sobre la actividad fotosintetica de plantular de cebada (Hordeum vulgare L.) y Maiz (Zea mais L.)

    Energy Technology Data Exchange (ETDEWEB)

    Fernandez, J.; Prieto, M. P.


    Determinations of the rate of photosynthesis were made in barley and maize leaves treated with INH, DNP, 2,4-D or CMU. 1 ppm of the chemicals in nutritive solutions was absorbed by roots during 24 or 48 hours in both dark and light conditions. After this period, photosynthetic activity, compensation point and 14{sup C}O{sub 2} assimilation were determined. Results show that INH increases the rate of photosynthesis, DNP and 2,4-D do not alter it sensibly and CMU acts as a strong inhibitor of photosynthesis. Some possible applications for ths obtention of labelled compounds by biosynthesis are discussed. (Author) 87 refs.

  2. Responses to iron limitation in Hordeum vulgare L. as affected by the atmospheric CO2 concentration. (United States)

    Haase, S; Rothe, A; Kania, A; Wasaki, J; Römheld, V; Engels, C; Kandeler, E; Neumann, G


    Elevated atmospheric CO2 treatments stimulated biomass production in Fe-sufficient and Fe-deficient barley plants, both in hydroponics and in soil culture. Root/shoot biomass ratio was increased in severely Fe-deficient plants grown in hydroponics but not under moderate Fe limitation in soil culture. Significantly increased biomass production in high CO2 treatments, even under severe Fe deficiency in hydroponic culture, indicates an improved internal Fe utilization. Iron deficiency-induced secretion of PS in 0.5 to 2.5 cm sub-apical root zones was increased by 74% in response to elevated CO2 treatments of barley plants in hydroponics but no PS were detectable in root exudates collected from soil-grown plants. This may be attributed to suppression of PS release by internal Fe concentrations above the critical level for Fe deficiency, determined at final harvest for soil-grown barley plants, even without additional Fe supply. However, extremely low concentrations of easily plant-available Fe in the investigated soil and low Fe seed reserves suggest a contribution of PS-mediated Fe mobilization from sparingly soluble Fe sources to Fe acquisition of the soil-grown barley plants during the preceding culture period. Higher Fe contents in shoots (+52%) of plants grown in soil culture without Fe supply under elevated atmospheric CO2 concentrations may indicate an increased efficiency for Fe acquisition. No significant influence on diversity and function of rhizosphere-bacterial communities was detectable in the outer rhizosphere soil (0-3 mm distance from the root surface) by DGGE of 16S rRNA gene fragments and analysis of marker enzyme activities for C-, N-, and P-cycles. PMID:18453445

  3. Sequencing of 15,622 gene-bearing BACs clarifies the gene-dense regions of the barley genome (United States)

    Barley (Hordeum vulgare L.) possesses a large and highly repetitive genome of 5.1 Gb that has hindered the development of a complete sequence. In 2012, the International Barley Sequencing Consortium released a resource integrating whole-genome shotgun sequences with a physical and genetic framework....

  4. Obtaining somaclonal lines in cereals (Triticum aestivum L. and Hordeum vulgare L.)

    International Nuclear Information System (INIS)

    A system of high-volume wheat and barley plant breeding from somatic cells cultivated in vitro is developed. The frequency of morphogenetic cell line formation is a very important factor characterizing the morphogenetic properties of plants, introduced in the culture in vitro. This value reflects the possibility of regeneration of a certain number of plants in vitro. Statistic analysis of the cell line induction frequencies and frequencies of morphogenetic line occurrence shows, that both processes are explained genetically. The data exist which point to increasing morphological potentials of cell cultures after irradiation with certain radiation doses

  5. Differentially expressed genes between drought-tolerant and drought-sensitive barley genotypes in response to drought stress during the reproductive stage


    Guo, P; Baum, M.; Grando, S.; Ceccarelli, S.; Bai, G.; Li, R; Von Korff, M; Varshney, R.,; Graner, A.; Valkoun, V.


    Drought tolerance is a key trait for increasing and stabilizing barley productivity in dry areas worldwide. Identification of the genes responsible for drought tolerance in barley (Hordeum vulgare L.) will facilitate understanding of the molecular mechanisms of drought tolerance, and also facilitate the genetic improvement of barley through marker-assisted selection or gene transformation. To monitor the changes in gene expression at the transcriptional level in barley leaves during the repro...

  6. Wheat and barley exposure to nanoceria: Implications for agricultural productivity (United States)

    The impacts of man-made nanomaterials on agricultural productivity are not yet well understood. A soil microcosm study was performed to assess the physiological, phenological, and yield responses of wheat (Triticum aestivum) and barley (Hordeum vulgare L.) exposed to nanoceria (n...

  7. Zinc biofortification of cereals: rice differs from wheat and barley

    NARCIS (Netherlands)

    Stomph, T.J.; Jiang, W.; Struik, P.C.


    In their review, mainly focused on bread wheat (Triticum aestivum), durum wheat (Triticum durum) and barley (Hordeum vulgare), Palmgren et al. 1 M.G. Palmgren et al., Zinc biofortification of cereals: problems and solutions, Trends Plant Sci. 13 (2008), pp. 464–473. Article | PDF (905 K) | View Reco

  8. Wheat and barley seed systems in Ethiopia and Syria

    NARCIS (Netherlands)

    Bishaw, Z.


    Keywords: Wheat,Triticumspp., Barley,Hordeumvulgare L., Seed Systems, Formal Seed Sector, Informal Seed Sector, National Seed Program, Seed Source, Seed Selection, Seed Management, Seed Quality,

  9. Effects of a Dietary Supplement with Barley Sprout Extract on Blood Cholesterol Metabolism


    A Ri Byun; Hyejin Chun; Jin Lee; Sang Wha Lee; Hong Soo Lee; Kyung Won Shim


    Objective. Barley sprout (Hordeum vulgare L.) contains 4.97% fat, 52.6% polysaccharide, and 34.1% protein along with a variety of vitamins, minerals, and polyphenolic compounds. Hexacosanol is one such compound from the barley leaf that might improve cholesterol metabolism by decreasing cholesterol synthesis. Method. Therefore, this study was conducted to investigate the effects of barley sprout extract on serum lipid metabolism in healthy volunteers (n = 51). Subjects were randomly divided i...

  10. Effect of herbicide clomazone on photosynthetic processes in primary barley (Hordeum vulgare L.) leaves

    Czech Academy of Sciences Publication Activity Database

    Kaňa, R.; Špundová, M.; Ilík, P.; Lazár, D.; Klem, K.; Tomek, P.; Nauš, J.; Prášil, Ondřej


    Roč. 78, - (2004), s. 161-170. ISSN 0048-3575 R&D Projects: GA ČR GA522/00/1274; GA ČR GP522/01/P098 Institutional research plan: CEZ:AV0Z5020903 Keywords : clomazone * herbicide * photosynthesis Subject RIV: ED - Physiology Impact factor: 1.133, year: 2004

  11. Expression of dehydrin 5 during the development of frost tolerance in barley (Hordeum vulgare)

    Czech Academy of Sciences Publication Activity Database

    Kosová, K.; Holková, L.; Prášil, I.T.; Prášilová, P.; Bradáčová, M.; Vítámvás, P.; Čapková, Věra


    Roč. 165, č. 11 (2008), s. 1142-1151. ISSN 0176-1617 R&D Projects: GA MZe QF3191; GA MZe 1G57060 Institutional research plan: CEZ:AV0Z50380511 Keywords : Cold acclimation * Dehydrin 5 * Frost tolerance Subject RIV: GE - Plant Breeding Impact factor: 2.437, year: 2008

  12. A comparative study of some barley (Hordeum Vulgare L.) lines and mutants under local environmental condition

    International Nuclear Information System (INIS)

    Yield, 1000 grain weight and other agronomical traits were studied under the rain fed condition. Nineteen pure lines (doubled haploid) and mutants and two controls were grown in the field. Net blotch resistance in 150 (Dh), mutants, and their parental genotype were used to determine their resistance level against three strains of net bloch. Differences were found among the genotypes. Five lines (Dh) and mutants resistant to net blotch with good agronomic performance were selected for further investigation. (author)

  13. Durable resistance to net blotch and agronomic performance in some barley mutants [Hordeum vulgare L.; Syria

    International Nuclear Information System (INIS)

    Seeds from the net blotch (Pyrenophora teres) susceptible cultivar Thibaut were treated by gamma ray radiation and subsequently evaluated for reaction to the pathogen in the M2-M5 generations. Grain yield and agronomic characteristics of putative mutants were compared with Thibaut in two different locations. Genetic variation among some mutant lines/cv Thibaut was estimated using Amplified Fragment Length Polymorphism (AFLP) markers. Sixteen mutant lines and their mother cultivar Thibaut were analyzed with 14 EcoR1-Mse1 primer combinations. A total number of 504 AFLP bands were analyzed for each pair mutant/Thibaut. Narrow genetic variation among all genotypes was detected with an average of genetic similarity of 0.96. Cluster analysis with the entire AFLP data divided all genotypes into two major groups. The resistant mutant lines were grouped in one subcluster with 0.98 similarity index. Some resistant mutant lines to net blotch with good agronomic performances were produced

  14. Effects of drought stress on growth and yield of barley


    H. Samarah, Nezar


    International audience Barley (Hordeum vulgare) grown in Mediterranean regions undergoes drought stress during the grain-filling period. A greenhouse experiment was conducted to study the effect of drought stress on grain growth and yield of barley. Plants were exposed to three drought treatments at the beginning of grain filling: (1) well-watered at 100% field capacity, (2) mild drought stress at 60% field capacity, and (3) severe drought stress at 20% field capacity until grain maturity....

  15. Does boron affect hormone levels of barley cultivars?


    Muavviz Ayvaz; Mesut Koyuncu; Avni Guven; FAGERSTEDT, KURT V.


    Background: When mineral nutrients are present in excess or in inadequate amounts, their effects can be severe in plants and can be considered as abiotic stress. In this study, we report how hormonal levels in barley cultivars respond to the toxic effect of boron, an essential plant micronutrient. Material and methods: Two different barley (Hordeum vulgare) cultivars (Vamik Hoca and Efes 98) were used as a study material. Boron was applied in three different concentrations (0, 10, 20 ppm) ...

  16. Mapping genes in barley for resistance to Puccinia coronata from couch grass and to P. striiformis from brome, wheat and barley

    NARCIS (Netherlands)

    Niks, R.E.; Alemu, Sisay K.; Marcel, T.C.; Heyzen, van Skye


    Barley (Hordeum vulgare L.) mapping populations have been developed that are useful to study the inheritance of quantitative resistance to adapted and unadapted rust fungi. In a recent host range study, we found that the parents of those mapping populations also differed in their resistance to th

  17. A novel itera-like densovirus isolated by viral metagenomics from the sea barley Hordeum marinum


    François, Sarah; Bernardo, Pauline; Filloux, Denis; Roumagnac, Philippe; Yaverkovski, N.; Froissart, Rémy


    Densoviruses (DVs) infect arthropods and belong to the Parvoviridae family. Here, we report the complete coding sequence of a novel DV isolated from the plant Hordeum marinum (Poaceae) by viral metagenomics, and we confirmed reamplification by PCR. Phylogenetic analyses showed that this novel DV is related to the genus Iteradensovirus.

  18. Etude des caracteres d'enracinement et de leur role dans l'adaptation au deficit hydrique chez l'orge (Hordeum vulgare L.)


    Khaldoun, A; Chery, J; Monneveux, P.


    Les effets d’un déficit hydrique sur les caractéristiques de l’enracinement de 5 variétés d’orge (Hordeum vulgare L) ont été comparés. Les génotypes, originaires de la zone méditerranéenne, ont été cultivés en serre et en pots sous différentes conditions de déficit hydrique. Cela a permis de mettre en évidence d’importantes différences variétales pour la plupart des caractères étudiés : - nombre de racines principales; - volume racinaire; - rapport entre la masse de matière sèche des pa...

  19. Registration of 'Stoneham' spring feed barley resistant to Russian wheat aphid (United States)

    'Stoneham' (REG. No.; PI 641940) a Russian wheat aphid (RWA, Diuraphis noxia Kurdjumov)-resistant, spring, two-rowed, feed barley (Hordeum vulgare) tested as 97BX 27-132, was developed and released by the USDA-ARS, Stillwater, OK and Aberdeen, ID; Colorado State University; and the University of Neb...

  20. Starch and Prolamin Level in Single and Double High-Lysine Barley Mutants

    DEFF Research Database (Denmark)

    Kreis, M.; Doll, Hans


    At maturity the high-lysine barley (Hordeum vulgare L.) Ris0 mutants 1508, 527 and 29 kernels contained about 20% less starch and twice as much free sugars as the parent varieties Bomi and Carlsberg II. An enhanched effect on starch reduction and free sugar accumulation was observed during kernel...

  1. Biochemistry, Structure and Function of Non-Wheat Proteins: Case Study of Barley ß-Amylase (United States)

    The importance of a protein is not always evident and may be due to its multifunctional nature. ß-Amylase in seeds of barley (Hordeum vulgare L.) constitutes approximately 2% of the total protein in mature seeds and is assumed to be important when storage proteins are mobilized to support protein s...

  2. A comparison of two milling strategies to reduce the mycotoxin deoxynivalenol in barley (United States)

    The trichothecene mycotoxin deoxynivalenol (DON), a common contaminant of wheat (Triticum aestivum L.) and barley (Hordeum vulgare L.) grain, is a threat to feed and food safety in the United States. New strategies to reduce the threat of DON need to be developed and implemented. Previous work has...

  3. Barley grain maturation and germination: Metabolic pathway and regulatory network commonalities and differences highlighted by new MapMan/PageMan profiling tools


    Sreenivasulu, N.; Usadel, B.; Winter, A.; Radchuk, V.; Scholz, U.; Stein, N.; Weschke, W.; Strickert, M.; Close, T; Stitt, M.; Graner, A; Wobus, U


    Plant seeds prepare for germination already during seed maturation. We performed a detailed transcriptome analysis of barley (Hordeum vulgare) grain maturation, desiccation, and germination in two tissue fractions (starchy endosperm / aleurone and embryo / scutellum) using the Affymetrix Barley1 GeneChip. To aid data evaluation, Arabidopsis thaliana MapMan and PageMan tools were adapted to barley. The analyses allow a number of conclusions: (1) Cluster analysis revealed a smooth transition in...

  4. Comparative studies on ThreeTriticum species and hordeum2 as affected by gamma irradiation

    International Nuclear Information System (INIS)

    Wheat grains of three species, i. e. T. monococcun, T. durum and T. aestivum as well as grain of Giza-117 barley Hordeum vulgar were irradiated with 0, 1, 2, 4, 16 or 64 krad. It could be concluded that the stimulation dosage was 1 rad for both monococcum and aestivum and 4 krad for durum., whereas, the dosage 2 krad was the promising dosage for barley (Hordeum vulgare) cv. Giza-117, in this respect. This conclusion was based on the changes in germination percentage, height of plant, number of spikes per plant, weight of spikes per plant, Yield of grains per feddan, yield of straw per feddan and weight of 1000 grains, as well as total-N, soluble-N and protein content. The higher dosage depressed progressively the aforementioned characters. (author)

  5. Diversity of Fungal Pathogens Infecting Hordeum L. in Macedonia, Symptoms and Morphology


    Karov, Ilija; Mitrev, Sasa; Kovacevik, Biljana; Kostadinovska, Emilija


    During April, May and June 2006, 2007, 2008 and 2009 several plant pathogenic fungi are discovered on barley variety Hordeum vulgare L. Ement. Lam. in Macedonia. The monitoring confirms the presence of Cochliobolus sativus (Ito & Kurib.) Drechsler ex Dastur, Blumeria graminis (Erysiphe graminis DC.), Gaeumannomyces graminis var. tritici (Sacc.) Arx & Oliver, Puccinia hordei Otth., and Ustilago nuda (Jensen) Rostr. The presence of anamorph Septoria tritici Rob ex Desm., which telemorph i...

  6. Differential expression of two ß-amylase genes (Bmy1 and Bmy2) in developing and mature barley grain (United States)

    Barley (Hordeum vulgare L.) endosperm-specific (Bmy1) and ubiquitous (Bmy2) ß-amylase were studied during the late maturation phase of seed development in four genotypes. Sequencing of Bmy2 from genomic DNA revealed six polymorphisms in the introns and two synonymous SNPs in the coding region. Acc...

  7. Grain Yield Variation in Malting Barley Cultivars in Uruguay and Its Consequences for the Design of a Trials Network

    NARCIS (Netherlands)

    Ceretta, S.S.E.; Eeuwijk, van F.A.


    The efficiency of cultivar trial networks is an important subject in official cultivar testing. We investigated this efficiency for malting barley (Hordeum vulgare L.) in Uruguay, using data on 213 cultivars tested across an eight-year period at six locations. The variance-components approach was us

  8. Effects of CO2 enrichment on the metabolism of soluble amino acids and organic acids in barley primary leaves (United States)

    Responses of soluble amino acids and organic acids to CO2 enrichment were determined with barley primary leaves (Hordeum vulgare L. cv. Brant) grown in controlled environment chambers. Total soluble amino acids were enhanced 33% by CO2 enrichment when determined 9 days after sowing (DAS). However,...

  9. Starch and Free Sugars during Kernel Development of Bomi Barley and its High-Lysine Mutant 1508

    DEFF Research Database (Denmark)

    Kreis, Michael


    At maturity the high-lysine barley (Hordeum vulgare L.) Ris0 mutants 1508, 527 and 29 kernels contained about 20% less starch and twice as much free sugars as the parent varieties Bomi and Carlsberg II. An enhanched effect on starch reduction and free sugar accumulation was observed during kernel...

  10. Sequencing of 15622 gene-bearing BACs clarifies the gene-dense regions of the barley genome

    Czech Academy of Sciences Publication Activity Database

    Munoz-Amatriain, M.; Lonardi, S.; Luo, M.C.; Madishetty, K.; Svensson, J.T.; Moscou, M. J.; Wanamaker, S.; Kudrna, D.; Zheng, J.; Šimková, Hana; Doležel, Jaroslav; Grimwood, J.; Mammadov, J.; Close, T.J.


    Roč. 84, č. 1 (2015), s. 216-227. ISSN 0960-7412 R&D Projects: GA MŠk(CZ) LO1204 Institutional support: RVO:61389030 Keywords : Barley * Hordeum vulgare L * BAC sequencing Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 5.972, year: 2014

  11. Integrated transcriptomics and proteomics analysis of storage protein composition in developing barley grain to improve nutritional profile

    DEFF Research Database (Denmark)

    Kaczmarczyk, Agnieszka Ewa; Dionisio, Giuseppe; Renaut, Jenny;


    The aim of the study was to understand the molecular and biochemical mechanisms underpinning the effect of nitrogen (N) on barley (Hordeum vulgare) storage protein production (hordeins) during grain filling. Using a combination of advanced biochemistry methods, we could comprehensively describe...

  12. N-acyl-homoserine lactone uptake and systemic transport in barley rest upon active parts of the plant

    Czech Academy of Sciences Publication Activity Database

    Sieper, T.; Forczek, Sándor; Matucha, Miroslav; Kraemer, P.; Hartmann, A.; Schroeder, P.


    Roč. 201, č. 2 (2014), s. 545-555. ISSN 1469-8137 Institutional support: RVO:61389030 Keywords : barley (Hordeum vulgare) * monoclonal antibodies * N-acyl-homoserine lactones (HSLs) Subject RIV: EF - Botanics Impact factor: 6.373, year: 2013

  13. Characterization of a multifunctional inositol phosphate kinase from rice and barley belonging to the ATP-grasp superfamily

    DEFF Research Database (Denmark)

    Josefsen, L.; Bohn, L.; Sørensen, M.B.;


    OsIpk and HvIk, inositol phosphate kinases, were cloned from rice (Oryza sativa L. var. indica, IR64) and barley (Hordeum vulgare) respectively.. IP Sequence alignment showed that they belong to the ATP-grasp family, which includes inositol 1,3,4-trisphosphate 5/6-kinase from humans and Arabidops...

  14. Green manuring effect of pure and mixed barley - hairy vetch winter cover crops on maize and processing tomato N nutrition

    DEFF Research Database (Denmark)

    Tosti, Giacomo; Benincasa, Paolo; Farneselli, Michela;


    can influence the N uptake and N status of different subsequent summer cash crops. In this study the N effect of barley (Hordeum vulgare L.) and hairy vetch (Vicia villosa Roth.) grown in pure stands or in mixtures with different sowing proportion was tested on maize (Zea Mays L.) and processing...

  15. Real-time weed detection, decision making and patch spraying in maize, sugarbeet, winter wheat and winter barley

    DEFF Research Database (Denmark)

    Gerhards, R; Christensen, Svend


    with weed infestation levels higher than the economic weed threshold; a review of such work is provided. This paper presents a system for site-specific weed control in sugarbeet (Beta vulgaris L.), maize (Zea mays L.), winter wheat (Triticum aestivum L.) and winter barley (Hordeum vulgare L...

  16. Implementation of biochemical screening to improve baking quality of barley

    DEFF Research Database (Denmark)

    Vincze, Éva; Dionisio, Giuseppe; Aaslo, Per;


    Barley (Hordeum vulgare) has the potential to offer considerable human nutritional benefits, especially as supplement to wheat-based breads. Under current commercial baking conditions it is not possible to introduce more that 20% barley flour to the wheat bread without negative impact on the...... physical chemical properties of the bread products due to the poor baking properties of barley flour. As a consequence, the nutritional advantages of barley are not fully exploited. The inferior leavening and baking properties of barley can, in part, be attributed to the physical properties of the storage...... proteins. Changing the storage protein composition can lessen this problem. Our working hypothesis was that exploiting the substantial genetic variation within the gene pool for storage proteins could enable improving the baking qualities of barley flour. We characterised forty-nine barley cultivars for...

  17. Implementation of biochemical screening to improve baking quality of barley

    DEFF Research Database (Denmark)

    Vincze, Éva; Dionisio, Giuseppe; Aaslo, Per; Langkilde, Ane; Bowra, Steve

    Barley (Hordeum vulgare) has the potential to offer considerable human nutritional benefits, especially as supplement to wheat-based breads. Under current commercial baking conditions it is not possible to introduce more that 20% barley flour to the wheat bread without negative impact on the...... physical chemical properties of the bread products due to the poor baking properties of barley flour. As a consequence, the nutritional advantages of barley are not fully exploited. The inferior leavening and baking properties of barley can, in part, be attributed to the physical properties of the storage...... proteins. Changing the storage protein composition can lessen this problem. Our working hypothesis was that exploiting the substantial genetic variation within the gene pool for storage proteins could enable improving the baking qualities of barley flour. We characterised forty-nine barley cultivars for...

  18. Barley metallothioneins

    DEFF Research Database (Denmark)

    Hegelund, Josefine Nymark; Schiller, Michaela; Kichey, Thomas; Hansen, Thomas Hesselhøj; Pedas, Pai; Husted, Søren; Schjørring, Jan Kofod


    Metallothioneins (MTs) are low-molecular-weight, cysteine-rich proteins believed to play a role in cytosolic zinc (Zn) and copper (Cu) homeostasis. However, evidence for the functional properties of MTs has been hampered by methodological problems in the isolation and characterization of the prot...... storage in developing and mature grains. The localization of MT4 and its discrimination against Cd make it an ideal candidate for future biofortification strategies directed toward increasing food and feed Zn concentrations....... proteins. Here, we document that barley (Hordeum vulgare) MT3 and MT4 proteins exist in planta and that they differ in tissue localization as well as in metal coordination chemistry. Combined transcriptional and histological analyses showed temporal and spatial correlations between transcript levels and...

  19. Utilization of Different Bmy1 Intron III Alleles for Predicting ß-Amylase Activity and Thermostability in Wild and Cultivated Barley (United States)

    Polymorphisms in intron III of barley (Hordeum vulgare L.) endosperm-specific beta-amylase (Bmy1) have been associated with beta-amylase activity and thermostability and are thought to have potential as a selective marker for breeding elite malting cultivars. The third intron of Bmy1 was sequenced ...

  20. Population structure revealed by different marker types (SSR or DArT) has an impact on the results of genome-wide association mapping in European barley cultivars

    NARCIS (Netherlands)

    Matthies, I.E.; Hintum, van T.J.L.; Weise, S.; Röder, M.S.


    Diversity arrays technology (DArT) and simple sequence repeat (SSR) markers were applied to investigate population structure, extent of linkage disequilibrium and genetic diversity (kinship) on a genome-wide level in European barley (Hordeum vulgare L.) cultivars. A set of 183 varieties could be cle

  1. Identification of barley and rye varieties using matrix- assisted laser desorption/ionisation time-of-flight mass spectrometry with neural networks

    DEFF Research Database (Denmark)

    Bloch, H.A.; Petersen, Marianne Kjerstine; Sperotto, Maria Maddalena;


    developed, which combines analysis of alcohol-soluble wheat proteins (gliadins) using matrix-assisted laser desorption/ionisation time-of-flight mass spectrometry with neural networks. Here we have applied the same method for the identification of both barley (Hordeum vulgare L.) and rye (Secale cereale L...

  2. Functional proteomics of barley and barley chloroplasts – strategies, methods and perspectives

    DEFF Research Database (Denmark)

    Petersen, Jørgen; Rogowska-Wrzesinska, Adelina; Jensen, Ole Nørregaard


    whole-genome sequencing of barley revealed approximately 26,100 open reading frames, which provides a foundation for detailed molecular studies of barley by functional genomics and proteomics approaches. Such studies will provide further insights into the mechanisms of, for example, drought and stress......Barley (Hordeum vulgare) is an important cereal grain that is used in a range of products for animal and human consumption. Crop yield and seed quality has been optimized during decades by plant breeding programs supported by biotechnology and molecular biology techniques. The recently completed...... tolerance, micronutrient utilization, and photosynthesis in barley. In the present review we present the current state of proteomics research for investigations of barley chloroplasts, i.e., the organelle that contain the photosynthetic apparatus in the plant. We describe several different proteomics...

  3. Resistance to Barley Leaf Stripe

    DEFF Research Database (Denmark)

    Nørgaard Knudsen, J. C.


    well adapted Northwest European spring cultivars. Virulence matching two hitherto not overcome resistances was demonstrated. Differences in apparent race nonspecific or partial resistance were also present, changing the percentage of infected plants of susceptible genotypes from about 20 to 44 per cent.......Ten barley [Hordeum vulgare] genotypes were inoculated with twelve isolates of Pyrenophora graminea of diverse European and North African origin. Race specific resistance occurred. Four, possibly five, genetically different sources of race-specific resistance were found, three of them occurring in...

  4. Analysis of inhibition of photosynthesis due to water stress in the C3 species Hordeum vulgare and Vicia faba: Electron transport, CO 2 fixation and carboxylation capacity. (United States)

    Lal, A; Ku, M S; Edwards, G E


    A C3 monocot, Hordeum vulgare and C3 dicot, Vicia faba, were studied to evaluate the mechanism of inhibition of photosynthesis due to water stress. The net rate of CO2 fixation (A) and transpiration (E) were measured by gas exchange, while the true rate of O2 evolution (J O2) was calculated from chlorophyll fluorescence analysis through the stress cycle (10 to 11 days). With the development of water stress, the decrease in A was more pronounced than the decrease in J O2 resulting in an increased ratio of Photosystem II activity per CO2 fixed which is indicative of an increase in photorespiration due to a decrease in supply of CO2 to Rubisco. Analyses of changes in the J O2 A ratios versus that of CO2 limited photosynthesis in well watered plants, and RuBP pool/RuBP binding sites on Rubisco and RuBP activity, indicate a decreased supply of CO2 to Rubisco under both mild and severe stress is primarily responsible for the decrease in CO2 fixation. In the early stages of stress, the decrease in C i (intercellular CO2) due to stomatal closure can account for the decrease in photosynthesis. Under more severe stress, CO2 supply to Rubisco, calculated from analysis of electron flow and CO2 exchange, continued to decrease. However, C i, calculated from analysis of transpiration and CO2 exchange, either remained constant or increased which may be due to either a decrease in mesophyll conductance or an overestimation of C i by this method due to patchiness in conductance of CO2 to the intercellular space. When plants were rewatered after photosynthesis had dropped to 10-30% of the original rate, both species showed near full recovery within two to four days. PMID:24271534

  5. Effect of caffeine on peroxidase activity and gamma-ray-induced oxic and anoxic damage in Hordeum vulgare

    International Nuclear Information System (INIS)

    The influence of caffeine during and after gamma radiation of barley seeds was studied using seedling injury and peroxidase activity as parameters. The radiation-induced stimulation of peroxidase activity is evident in eight-day only seedlings but not in embryos (i.e. immediately after irradiation). Caffeine present during irradiation of seeds soaked in oxygenated water diminishes seedling injury and also reduces the peroxidase activity to the level observed in eight-day old seedlings of unirradiated seeds. Caffeine, however, produces just the opposite effect (i.e. enhances the seedling injury and peroxidase activity of eight-day old seedlings) when applied during irradiation of seeds soaked in oxygen-free water. There is no evidence that caffeine effects enzyme activity under in vitro conditions. (author)

  6. Genetic structure and ecogeographical adaptation in wild barley (Hordeum chilense Roemer et Schultes as revealed by microsatellite markers

    Directory of Open Access Journals (Sweden)

    Sourdille Pierre


    Full Text Available Abstract Background Multi-allelic microsatellite markers have become the markers of choice for the determination of genetic structure in plants. Synteny across cereals has allowed the cross-species and cross-genera transferability of SSR markers, which constitute a valuable and cost-effective tool for the genetic analysis and marker-assisted introgression of wild related species. Hordeum chilense is one of the wild relatives with a high potential for cereal breeding, due to its high crossability (both interspecies and intergenera and polymorphism for adaptation traits. In order to analyze the genetic structure and ecogeographical adaptation of this wild species, it is necessary to increase the number of polymorphic markers currently available for the species. In this work, the possibility of using syntenic wheat SSRs as a new source of markers for this purpose has been explored. Results From the 98 wheat EST-SSR markers tested for transferability and polymorphism in the wild barley genome, 53 primer pairs (54.0% gave cross-species transferability and 20 primer pairs (20.4% showed polymorphism. The latter were used for further analysis in the H. chilense germplasm. The H. chilense-Triticum aestivum addition lines were used to test the chromosomal location of the new polymorphic microsatellite markers. The genetic structure and diversity was investigated in a collection of 94 H. chilense accessions, using a set of 49 SSR markers distributed across the seven chromosomes. Microsatellite markers showed a total of 351 alleles over all loci. The number of alleles per locus ranged from two to 27, with a mean of 7.2 alleles per locus and a mean Polymorphic Information Content (PIC of 0.5. Conclusions According to the results, the germplasm can be divided into two groups, with morphological and ecophysiological characteristics being key determinants of the population structure. Geographic and ecological structuring was also revealed in the analyzed

  7. A study on zinc distribution in calcareous soils for cowpea (Vigna Unguiculata L.) and barely ( Hordeum Vulgare L.) (United States)

    Boroomand, Naser; Maleki, Mohammad Reza


    Compared to other cereals, such as wheat and barley cultivars which have low sensitivity to Zn deficiency, cowpea is sensitive to zinc (Zn) deficiency, however it extensively grows even in soils with deficient in Zn. A 8-week greenhouse experiment was conducted to study the response of cowpea and barely to Zn in calcareous soils with different DTPA- Zn. The soil samples were taken from soil surface up to 0.3 m in which their DTPA- Zn ranged from 0.5 to 3.5 mg kg-1. Shoot dry matter, concentration and uptake of Zn were found to be significantly correlated with soil DTPA- Zn in cowpea and barely. Critical deficiency level of Zn in cowpea was 1.3 mg kg-1 in soil and 28.5 mg kg-1 in shoot dry matter, however, to barely symptoms of Zn deficiency was not observed and concentration of Zn was higher than the critical level reported in literatures. Organic carbon (OC), calcium carbonate equivalent (CCE), pH and field capacity soil moisture content(FC) were significantly correlated with plant responses to Zn which were the most influenced characteristics to Zn uptake by plants.

  8. Identification and characterization of barley RNA-directed RNA polymerases

    DEFF Research Database (Denmark)

    Madsen, Christian Toft; Stephens, Jennifer; Hornyik, Csaba;


    in dicot species. In this report, we identi!ed and characterized HvRDR1, HvRDR2 and HvRDR6 genes in the monocot plant barley (Hordeum vulgare). We analysed their expression under various biotic and abiotic stresses including fungal and viral infections, salicylic acid treatment as well as during plant...... development. The different classes and subclasses of barley RDRs displayed contrasting expression patterns during pathogen challenge and development suggesting their involvement in speci!c regulatory pathways. Their response to heat and salicylic acid treatment suggests a conserved pattern of expression...

  9. Environmental influence on the effect of gamma irradiation on proximate chemical composition of barley (Hordeum vulgare L.)

    International Nuclear Information System (INIS)

    Effects of 10, 20 and 30 krad gamma rays on Ash, Moisture, Crude protein, Crude fat, Crude fibre and Nitrogen free extract contents of barely variety, C-63 sown on 5th and 20th November and 5th December were observed. Sowing dates had significant effects for all characters except moisture percentage and carbohydrates. Ash, moisture and carbohydrates percentages had increased due to early sowing, while crude protein, fat and fibre percentages had decreased due to late sowing. Radiation effects were highly significant for all characters except moisture percentage. The severity of stimulatory or inhibitory effect, in general, was dependent upon the intensity of radiation doses and time of sowing for all characters studied. Maximum stimulatory effects were due to 30 krad which were 6.23, 32.78, 4.92 and 29.07% for Ash, Protein, fat and fibre, respectively than their respective controls. The retarding effects of 14.57 and 8.20% for moisture and carbohydrate were also found due to 30 krad, as compared with their respective controls

  10. The cytogenetic disturbance of barley (Hordeum vulgare L.) sprouts under the action of gamma-irradiation of seeds and drought

    International Nuclear Information System (INIS)

    Research results showed that gamma-irradiation of seeds in 2,5 and 5,0 Gy doses raised the sensitivity of plants to the further stressful factor action. In the process of seeds germination the drought served as the factor modifying the damaging influence of the ionizing radiation on genome of plants. On the one hand, there was noticed the antagonism of interaction of both factors on seeds germination and the mitotic activity of root cells, on the other hand – synergism of action on the output of aberrant cells


    Directory of Open Access Journals (Sweden)



    Full Text Available The use of Simazin herbicide to Miraj and to Dana cultivars, in concentration of 0.1%, 0.2%, 0.5% and 1% determinated the variation of some physiological indices. The energy and the faculty of germination decreased to both cultivars, proportionally to the increase of the pesticide concentration. The process of photosynthesis was intensified at the high doses of herbicide also producing the accumulation of total mineral elements.

  12. Characterization and partial purification of beta-1,3-D-glucan (callose) synthase from barley (Hordeum vulgare) leaves

    DEFF Research Database (Denmark)

    Pedersen, L.H.; Jacobsen, S.; Hejgaard, J.;


    was inhibited by UDP and uridine 5' triphosphate (UTP). Glucanase digestion of the in vitro product showed that it was a beta-1,3-linked polysaccharide. Two different procedures were used for further enrichment of polypeptides involved in callose synthase activity. Sucrose gradient centrifugation with...

  13. Barley Seed Germination/Root Elongation Toxicity Test For Evaluation Of Sludge Pre-Treatment


    Eriksson, Eva; Kusk, Kresten Ole; Barrett Sørensen, Mie; Møller Kudahl, Cevilie; Davidsson, Åsa


    Application of sludge from wastewater treatment plants (WWTPs) on agricultural land is an approach for nutrient recycling that rise challenges due to recalcitrant and harmful pollutants. In this study we assessed the feasibility of a seed germination test to evaluate sludge ecotoxicity and compared germination responses from two test parameters, root elongation and seed germination (sprouts elongation) of the barley (Hordeum vulgare). 2nd objective was to evaluate sewage sludge pre-treatments...

  14. Engineering high-level aluminum tolerance in barley with the ALMT1 gene


    Delhaize, Emmanuel; Ryan, Peter R.; Hebb, Diane M.; Yamamoto, Yoko; Sasaki, Takayuki; Matsumoto, Hideaki


    Acidity is a serious limitation to plant production on many of the world's agricultural soils. Toxic aluminium (Al) cations solubilized by the acidity rapidly inhibit root growth and limit subsequent uptake of water and nutrients. Recent work has shown that the ALMT1 gene of wheat (Triticum aestivum) encodes a malate transporter that is associated with malate efflux and Al tolerance. We generated transgenic barley (Hordeum vulgare) plants expressing ALMT1 and assessed their ability to exude m...

  15. Increased symplasmic permeability in barley root epidermal cells correlates with defects in root hair development


    Marzec, M; Muszynska, A. (Agata); Melzer, M.; Sas-Nowosielska, H; Kurczynska, E U; Wick, S.


    It is well known that the process of plant cell differentiation depends on the symplasmic isolation of cells. Before starting the differentiation programme, the individual cell or group of cells should restrict symplasmic communication with neighbouring cells. We tested the symplasmic communication between epidermal cells in the different root zones of parental barley plants Hordeum vulgare L., cv. ‘Karat’ with normal root hair development, and two root hairless mutants (rhl1.a and rhl1.b). T...

  16. Structure and Function of the Bacterial Root Microbiota in Wild and Domesticated Barley


    Bulgarelli, D.; Garrido Oter, R.; Muench, P.; Weiman, A.; Droege, J.; Pan, Y.; McHardy, A; Schulze-Lefert, P.


    Summary The microbial communities inhabiting the root interior of healthy plants, as well as the rhizosphere, which consists of soil particles firmly attached to roots, engage in symbiotic associations with their host. To investigate the structural and functional diversification among these communities, we employed a combination of 16S rRNA gene profiling and shotgun metagenome analysis of the microbiota associated with wild and domesticated accessions of barley (Hordeum vulgare). Bacterial f...

  17. Callus Production and Plant Regeneration from Anther Culture of Some Turkish Barley Cultivars


    SAVAŞKAN, Çigdem


    Anther culture of four different barley cultivars ( Hordeum vulgareL. cvs. Anadolu, Cumhuriyet-50, Obruk-86 and Tokak-157/37) currently cultivated in Turkey has been investigated. Two different culture media (BAC3 and FHG) were used and the effect of a 21-day cold pretreatment was studied. Androgenesis on BAC3 medium was evaluated statistically in all genotypes and the percentage of anther response and the frequency of calli production were found significantly different (P

  18. The sensitivity of barley, field beans and sugar beet to soil compaction


    Brereton, Jeremy Charles


    The sensitivity of spring barley (Hordeum vulgare, cv. Carnival), field beans (Vicia faba, ev. Maris Bead) and sugar beet (Beta vulgaris,cv. Monoire) to topsoil compaction induced by tractor wheelings, post sowing, on a coarse gravelly loam of the Arrow series was investigated in 1983 and 1984. The study revealed that in both years topsoil compaction increased the dry bulk density, vane shear strength and cone resistance of the soil. Although compaction reduced only the plant population o...

  19. Morocco as a possible domestication center for barley: biochemical and agromorphological evidence.


    Molina Cano, J.L.; Fra-Mon, P.; Salcedo Duran, Gabriel; Aragoncillo Ballesteros, Cipriano; Roca Togores, F.; García Olmedo, Francisco


    The distribution of genetic variants of a group of low molecular weight, chloroform-methanol soluble proteins (CM proteins), among Moroccan and non-Moroccan accessions of Hordeum spontaneum and among selections from several Moroccan landraces of H. vulgare and cultivars of the same species with widespread European origin, suggests that domestication of barley might have taken place in Morocco. An agromorphological characterization of the H. spontaneum accessions further supports this hypothes...

  20. Mathematical Modelling of Allelopathy: IV. Assessment of Contributions of Competition and Allelopathy to Interference by Barley


    Liu, Li; An, Min; Johnson, I. R.; Lovett, J.V.


    One of the main challenges to the research on allelopathy is technically the separation of allelopathic effect from competition, and quantitatively, the assessment of the contribution of each component to overall interference. A simple mathematical model is proposed to calculate the contribution of allelopathy and competition to interference. As an example of applying the quantitative model to interference by barley (Hordeum vulgare cv. Triumph), the approach used was an addition of allelopat...

  1. Genetic Diversity of SSR Markers in Cultivated Hordeum vulgare L. in Qinghai Province%青海省栽培青稞SSR标记遗传多样性研究

    Institute of Scientific and Technical Information of China (English)

    田海宁; 杨菁; 何桂芳


    [ Objective] The aim was to analyze genetic diversity of SSR markers in Hordeum vulgare L. in Qinghai Province and lay a foundation for screening and protecting some excellent H. vulgare cultivars. [ Method] SSR markers were used to evaluate the genetic diversity of 42 cultivated H. vulgare from Qinghai Province. [ Result ] 42 H. vulgare showed polymorphism in 7 SSR markers locus. A total of 24 alleles were identified, and the number of alleles per locus ranged from 1 to 6, with an average of 3.0. According to SSR markers polymorphism, 42 H. vulgare could be divided into 4 groups, namely Ⅰ, Ⅱ, Ⅲ and IV. [ Result] The study indicated that cultivated H. vulgare from Qinghai Province is rich in genetic diversity, which will provide reference for selecting parent of H. vulgare breeding.%[目的]分析我国青海省青稞SSR标记遗传多样性,为具有某些优异特性的青稞品种或资源筛选及青稞资源的保护奠定基础.[方法]利用SSR标记评估42份青海省栽培青稞的遗传多样性.[结果]42份青稞材料在7个SSR标记位点处表现出多态性,各位点扩增的等位基因数为1~6个,共鉴定出24个等位基因,每位点平均3.0个;根据SSR标记多态性可将42份青稞材料分为4组,即Ⅰ、Ⅱ、Ⅲ和Ⅳ.[结论]该研究表明青海省栽培青稞具有丰富的遗传多样性,可为青稞育种亲本选择提供参考.

  2. Effect of different doses of post-emergence-applied iodosulfuron on weed control and grain yield of malt barley (Hordeum distichum L., under Mediterranean conditions

    Directory of Open Access Journals (Sweden)

    Barros José Calado


    Full Text Available A study was carried out over a two year period (2009/2010 and 2012/2013 on an experimental farm in the Alentejo region (Beja, in southern Portugal where rainfed malt barley (Hordeum distichum L. is sown at the end of autumn or beginning of winter (November- December. The aim of this experiment was to study the efficiency of the herbicide iodosulfuron-methyl-sodium to control post-emergence broadleaved weeds in this cereal crop. The malt barley crop was established using no-till farming. This technology provides the necessary machine bearing capacity of the soil to assure the post-emergence application of herbicides at two different weed development stages. The herbicide iodosulfuron-methyl-sodium was applied at three doses (5.0, 7.5, and 10.0 g a. i. · ha-1 and at two different broadleaved weed development stages (3 to 4 and 6 to 7 pairs of leaves, that also corresponded to two different crop development stages (beginning of tillering and complete tillering. The results indicated that early herbicide application timing provided a significantly higher efficiency for all the applied herbicide doses, but this better weed control was not reflected in a higher crop grain yield. The lack of a higher crop grain yield was probably due to a crop phytotoxicity of the herbicide, when used at an early application timing.

  3. Influence of Straw Pulp Film Mulching on Water Conservation Effect of Hordeum vulgare Farmland in Tibet%西藏青稞农田草浆地膜覆盖的保水效果研究

    Institute of Scientific and Technical Information of China (English)



    采用对比方法研究了草浆地膜覆盖对青稞(Hordeum vulgare)农田土壤的保水作用,以期明确草浆地膜的农田保水理论依据和保水效果.结果表明:草浆地膜覆盖下的土壤表面相对湿度、土壤紧实度和土壤含水量等指标均低于塑料地膜覆盖处理,其中土壤含水量指标显著低于后者(n=3,P<0.05);与对照相比,草浆地膜覆盖下0~5 cm土层内土壤紧实度显著降低,但土壤温度与对照相比相差不大,同时土壤表层水分散失明显减少,土壤含水量增加7.59%,达到显著差异水平(n=3,P<0.05).草浆地膜覆盖保水效果十分明显.%In order to offer theoretical basis and clarify practical effect, straw pulp film and plastic film were compared to investigate the effect of film mulches for water conservation of soil in Hordeum vulgare farmland. Plastic film, straw pulp film and CK treatment were administrated; the effect was compared by measuring relative humidity of soil surface, soil temperature, soil compaction and water content. The results showed that all four factors monitored were lower in the treatment of straw pulp film than the plastic film, among which water content of the former was significantly reduced than the latter(n=3, P<0.05). In the treatment of straw pulp film comparing to CK, soil compaction was significantly reduced(n=3, P<0.05), while no significant difference in soil temperature was shown between the two. The evaporation of soil moisture reduced dramatically in the treatment of straw pulp film, resulting in a 7.59% statistically significant increase in the water content of soil (n=3, P<0.05). In conclusion, the straw pulp film mulch has significantly improved the water conservation of the soil in Hordeum vulgare farmland.

  4. Wild Barley,Hordeum spontaneum,a Genetic Resource for Crop Improvement in Cold and Arid Regions

    Institute of Scientific and Technical Information of China (English)

    Eviatar; Nevo


    Food security in cold and arid regions in the world is threatened by stressful and unpredictable environments.The sus-tainable and economically viable solution for increasing stability of food productivity in cold and arid regions is genetic improvement of crops towards high resistance to abiotic stresses,mainly cold and drought resistance.It is often empha-sized that crop genetic improvement lies in exploiting the gene pools of the wild relatives of the crop plant.Wild barley,H.spontaneum,the progenitor of cultivated barley,is a selfing annual grass of predominantly Mediterranean and Irano-Turanian distribution that penetrates into desert environments where it maintains stable populations.Wild barley is also found in cold regions,such as in Tibet.The adaptation of wild barley to the arid region in Israel and Jordan,and the cold region in Tibet has accumulated rich genetic diversities for drought,salt,and cold resistances in wild barley,which is the genetic resource for barley and other crop improvement in arid and cold regions.These genetic diversities are revealed by allozymes,DNA-based molecular markers,and morphological and physiological traits of wild barley plants.Quantita-tive trait loci(QTLs) related to drought resistance were identified in wild barley via the QTL mapping approach.Drought resistance genes such as dehydrins,hsdr4,and eibi1 were identified in wild barley based on the candidate gene approach,gene differential expression approach,and molecular genetic approach,respectively.Genetics and genomics of wild bar-ley cold resistance have not been exploited yet,remaining a huge treasure for future crop improvement of cold resistance.Advanced backcross QTL analysis,the introgression libraries based on wild barley as donors,a QTL approach based on wide crosses using wild barley,and positional cloning of natural QTLs will play prevailing roles to help us understand the molecular control of cold and drought tolerance.Integration of QTL information into a

  5. Mutational Events in a Homeobox Gene Vrs1 that Created a Six-Rowed Spike in Barley Domestication

    International Nuclear Information System (INIS)

    Early cultivators of barley (Hordeum vulgare ssp. vulgare) selected a phenotype with a six-rowed spike that stably produced three times the usual grain number during domestication. SIX-ROWED SPIKE 1 (Vrs1) isolated from barley encoded a homeodomain leucine zipper I-class protein (HD-ZIP I), a potential transcription factor. Vrs1 is expressed only in lateral spikelet primordia of the early developmental stage. Fifty-four six-rowed mutant lines showed mutational events at the vrs1 gene except for five mutant lines, which suggested mutational events at the regulatory regions of Vrs1. We found three haplotypes among six-rowed barley revealing loss-of-function mutation of the homeobox gene Vrs1, while another allele showed no DNA changes throughout the coding region of the Vrs1 gene indicating another origin of the six-rowed barley. (author)

  6. Study of variation in radiosensitivity of barley (Hardeum Vulgare) as a function of seed water content

    International Nuclear Information System (INIS)

    The study of the sorption curve representing the development of water content versus relative humidity, in barley seeds (CV. Thibaut), shows that water is present in three different states: Constitutive water at less than 8.1%, absorption water between 8.1 and 10.9%, and free water at more than 10.9%. Along with these states, radiosensitivity is respectively high, low, and high. The seeds detached from the rachis have less radioresistance than the attached ones. However, this difference in behaviour is reduced when the water content is high (presence of free water). We also observed that growth was stimulated by weak doses of irradiation (20 Gy), whatever the water content was. (author). 35 refs., 4 figs., 1 tab

  7. Multi-method research strategy for understanding changes in storage protein composition in developing barley grain to improve nutritional profile

    DEFF Research Database (Denmark)

    Kaczmarczyk, Agnieszka Ewa

    Barley (Hordeum vulgare L.) is cultivated in a range of diverse environments and is widely utilised as feed for animal and as malt in brewing. Nitrogen (N) is a key macronutrient whch directly increases plant growth and is used as a fertiliser to meet the demands for higher yield. However, the in...... regimes. To reach the objective, integrated transcriptomics and proteomics analysis complemented with AAs profiling have been undertaken....

  8. Root hair mutants of barley

    International Nuclear Information System (INIS)

    Barley mutants without root hairs or with short or reduced root hairs were isolated among M2 seeds of 'Lux' barley (Hordeum vulgare L.) after acidified sodium azide mutagenesis. Root hair mutants are investigated intensively in Arabidopsis where about 40 genes are known. A few root hair mutants are known in maize, rice, barley and tomato. Many plants without root hairs grow quite well with good plant nutrition, and mutants have been used for investigations of uptake of strongly bound nutrients like phosphorus, iron, zinc and silicon. Seed of 'Lux' barley (Sejet Plant Breeding, Denmark) were soaked overnight, and then treated with 1.5-millimolarsodium azide in 0.1 molar sodium phosphate buffer, pH 3, for 2.5 hours according to the IAEA Manual on Mutation Breeding (2nd Ed.). After rinsing in tap water and air-drying, the M2 seeds were sown in the field the same day. Spikes, 4-6 per M1 plant, were harvested. The mutation frequency was similar to that obtained with other barley cultivars from which low-phytate mutants were isolated [5]. Seeds were germinated on black filter paper in tap water for 3 or 4 days before scoring for root hair mutants

  9. Morocco as a possible domestication center for barley: biochemical and agromorphological evidence. (United States)

    Molina-Cano, J L; Fra-Mon, P; Salcedo, G; Aragoncillo, C; de Togores, F R; García-Olmedo, F


    The distribution of genetic variants of a group of low molecular weight, chloroform-methanol soluble proteins (CM proteins), among Moroccan and non-Moroccan accessions of Hordeum spontaneum and among selections from several Moroccan landraces of H. vulgare and cultivars of the same species with widespread European origin, suggests that domestication of barley might have taken place in Morocco. An agromorphological characterization of the H. spontaneum accessions further supports this hypothesis. The possible Moroccan origin of the French cultivar 'Hatif de Grignon' and of several Spanish 6-rowed barleys is also presented. PMID:24241109

  10. Hordein polypeptide patterns in relation to malting quality in Brazilian barley varieties

    Directory of Open Access Journals (Sweden)

    Echart-Almeida Cinara


    Full Text Available Since there is evidence that malting quality is related to the storage protein (hordein fraction, in the present work the hordein polypeptide patterns from 13 barley (Hordeum vulgare L. varieties of different malting quality were analysed in order to explore the feasibility of using hordein electrophoresis to assist in the selection of malting barleys. The formation of clusters separating the varieties with higher malting quality from the others with lower quality suggests that there is a relationship between the general hordein polypeptide pattern and malting quality in the varieties analysed. By the Sperman's correlation test three hordein bands correlated negatively with malting quality in the germplasm studied.

  11. Optimising root growth to improve uptake and utilization of water and nitrogen in wheat and barley


    César de Carvalho, Pedro Miguel


    Durum wheat (Triticum turgidum L. var durum) and spring barley (Hordeum vulgare L.) are the most widely grown crop species in the semi-arid to arid areas of the Mediterranean region. However, their average on-farm yields are relatively low, 1.95 and 2.60 t ha-1, respectively (FAO, 2007). Water is generally recognized as the most limiting factor for barley and durum wheat production in the Mediterranean, though it has been found, at least for some regions, that N fertilizer applications have b...

  12. Compared cycling in a soil-plant system of pea and barley residue nitrogen

    DEFF Research Database (Denmark)

    Jensen, E.S.


    Field experiments were carried out on a temperate soil to determine the decline rate, the stabilization in soil organic matter and the plant uptake of N from N-15-labelled crop residues. The fate of N from field pea (Pisum sativum L.) and spring barley (Hordeum vulgare L.) residues was followed in...... soil-plant system....... unplanted and planted plots and related to their chemical composition. In the top 10 cm of unplanted plots, inorganic N was immobilized after barley residue incorporation, whereas the inorganic N pool was increased during the initial 30 days after incorporation (DAI) of pea residues. Initial net...

  13. Bioacumulación de arsénico en las etapas de desarrollo de la cebada maltera (Hordeum distichon L. Arsenic bioaccumulation in the stages of development of malt barley (Hordeum distichon L.

    Directory of Open Access Journals (Sweden)

    Francisco Prieto García

    cultivo para estimar niveles de contaminación por arsénico.The contamination by arsenic in water and ground of Zimapán, Hidalgo, Mexico, causes that malt barley (Hordeum distichon L. grown in this region, accumulates this element. The objective was to measure the levels of arsenic accumulated in organs and tissues of barley under controlled conditions, at different stages of development. Malt barley cv. Esmeralda was grown in 25 pots, five pots per differentiated trial. Trials include negative (not contaminated ground and water and positive controls. Five plants by pot were used and the accumulation of arsenic in each one was evaluated in five organs: root, stem, leaf, glean and grain, at each of five stages of development (coleoptiles formation or first leaf, macollo or true leaves from an armpit first knot that becomes present separated from the ground and forms the first spike, formation of spikes and seed filling. A random block design with three treatments was used: with arsenic, positive control and negative control. Malt barley presented high accumulation of arsenic at different stages of development, directly proportional to the time of exposition. Roots presented the highest accumulation of arsenic (100 and 300 mg kg-1, followed by leaves (80 to 180 mg kg-1 and stem (70 to 110 mg kg-1. The level of accumulation of arsenic in grains was between 40-90 mg kg-1, amount that according to Argentinean norms can be considered as highly contaminated. For the bioaccumulation index (BI, the leaves presented the high values, classified as medium values (0.1-1 for green plants. This organ can be indicative of contamination level in the ground. The largest values for the BI were observed in the stem, this organ can be a malt barley specific indicator of the level of arsenic contamination.

  14. A redox-dependent dimerization switch regulates activity and tolerance for reactive oxygen species of barley seed glutathione peroxidase

    DEFF Research Database (Denmark)

    Navrot, Nicolas; Skjoldager, Nicklas; Bunkenborg, Jakob;


    Monomeric and dimeric forms of recombinant barley (Hordeum vulgare subsp. vulgare) glutathione peroxidase 2 (HvGpx2) are demonstrated to display distinctly different functional properties in vitro. Monomeric HvGpx2 thus has five fold higher catalytic efficiency than the dimer towards tert......-butyl hydroperoxide, but is more sensitive to inactivation by hydrogen peroxide. Treatment of the monomer with hydrogen peroxide results in dimer formation. This observed new behavior of a plant glutathione peroxidase suggests a mechanism involving a switch from a highly catalytically competent monomer to a less...

  15. Biochemical and Immunological Study on the Effects of Barley and its Components as Hypoglycemic Agents in Diabetic Rats


    Mokhtar I. Yousef; Medhat Haroun; Mohamed H. El-Masry; Reham E.  Ateia


    The present study was carried out to investigate the hypoglycemic effect of barley (Hordeum vulgare L) and some of its components such as amino acids (L-leucine and L-glutamine) and chromium picolinate on some biochemical and immunological parameters of alloxan induced diabetic rats. Alloxan-diabetic rats were treated with barley water (10% w/v) at a dose 10 ml Kg-1 b.wt., chromium picolinate at 15 µg Kg-1 b.wt., L-leucine plus L-glutamine at 4.5 mg & 15 mg Kg-1 b.wt., and/or the co...

  16. Barley coleoptile peroxidases. Purification, molecular cloning, and induction by pathogens

    DEFF Research Database (Denmark)

    Kristensen, B.K.; Bloch, H.; Rasmussen, Søren Kjærsgård


    A cDNA clone encoding the Prx7 peroxidase from barley (Hordeum vulgare L.) predicted a 341-amino acid protein with a molecular weight of 36,515. N- and C-terminal putative signal peptides were present, suggesting a vacuolar location of the peroxidase. Immunoblotting and reverse-transcriptase poly......A cDNA clone encoding the Prx7 peroxidase from barley (Hordeum vulgare L.) predicted a 341-amino acid protein with a molecular weight of 36,515. N- and C-terminal putative signal peptides were present, suggesting a vacuolar location of the peroxidase. Immunoblotting and reverse...... from barley coleoptiles. P9.3 and P7.3 had Reinheitszahl values of 3.31 and 2.85 and specific activities (with 2,2'-azino-di-[3-ethyl-benzothiazoline-6-sulfonic acid], pH 5.5, as the substrate) of 11 and 79 units/mg, respectively. N-terminal amino acid sequencing and matrix-assisted laser desorption...

  17. Tracer study on sulphur use efficiency in potato-barley sequence on acid soil of Shimla

    International Nuclear Information System (INIS)

    Controlled studies were conducted on acidic soil of Fagu (Shimla) to study the efficiency of labelled ammonium sulphate as effected by farmyard manure (FYM) on potato (Solanum tuberosum L.) and its residual effect on succeeding barley (Hordeum vulgare L.). The direct and residual effects of FYM and sulphur on dry matter yield and S concentration in potato and barley plants were significant. Applied FYM had a positive effect on radioassay values i.e. % Sdff and % S utilization by potato from labelled S carrier, whereas, the residual effect of applied S on barley was more than its direct effect on potato. Results indicate that combined application of S and FYM resulted in 3.4 per cent more S contribution to barley crop and was reflected in % S utilization values. (author)

  18. QTLs for straw quality characteristics identified in recombinant inbred lines of a Hordeum vulgare x H spontaneum cross in a Mediterranean environment

    DEFF Research Database (Denmark)

    Grando, S.; Baum, M.; Ceccarelli, S.; Goodchild, A.; El-Haramein, F.J.; Jahoor, A.; Backes, G.


    Barley straw is commonly used as animal feed in many developing countries. Even a small increase in its nutritive value can have a large impact on animal production, and hence, on rural livelihood and human nutrition. Straw quality is strongly affected by environmental factors and is, therefore, ...

  19. The fungi communities of the soil environment of Triticum aestivum and its forecrops: Hordeum vulgare, Vicia faba ssp. minor and Trifolium pratense


    Elżbieta Pląskowska


    The species spectrum and abundance of the fungi communities were affected by the soil environment developed by wheat and its forecrops, and by atmospheric conditions. The fungi of the genus Fusarium were the greatest threat to winter wheat regardless of the forecrop. The field bean was the best forecrop to the wheat whereas spring barley was the worst.

  20. Japon Balığı (Carassius Auratus L. 1758) ve Arpa Bitkisinin (Hordeum Vulgare L.) Gelişimi ve Su Kalitesinin İyileştirilmesi Üzerine Aquaponik Sistemin Etkileri


    KESKİNBALTA, Mehmet Anıl; HAMZAOĞLU, Gökhan; ÇELİK, Meryem Yeşim; DERNEKBAŞI, Seval


    Bu araştırmada, Japon balığı (Carassius auratus L. 1758) ve arpa bitkisi (Hordeum vulgare L.) kullanılarak model bir akuaponik sistem oluşturulmuştur. Araştırma süresince arpa bitkisinin suyun nitrit, nitrat ve fosfat değerlerinde yaptığı değişim ve balıkların gelişimi üzerindeki etkilerinin belirlenmesi amaçlanmıştır. 30 günlük araştırma süresince günlük olarak pH, sıcaklık ve oksijen değerleri ölçülmüştür. Haftalık olarak bitki yetiştirme yatağına giren ve bitkiden süzülen suyun nitrit (NO2...

  1. Barley grain for ruminants: A global treasure or tragedy

    Directory of Open Access Journals (Sweden)

    Nikkhah Akbar


    Full Text Available Abstract Barley grain (Hordeum vulgare L. is characterized by a thick fibrous coat, a high level of ß-glucans and simply-arranged starch granules. World production of barley is about 30 % of that of corn. In comparison with corn, barley has more protein, methionine, lysine, cysteine and tryptophan. For ruminants, barley is the third most readily degradable cereal behind oats and wheat. Due to its more rapid starch fermentation rate compared with corn, barley also provides a more synchronous release of energy and nitrogen, thereby improving microbial nutrient assimilation. As a result, feeding barley can reduce the need for feeding protected protein sources. However, this benefit is only realized if rumen acidity is maintained within an optimal range (e.g., > 5.8 to 6.0; below this range, microbial maintenance requirements and wastage increase. With a low pH, microbial endotoxines cause pro-inflammatory responses that can weaken immunity and shorten animal longevity. Thus, mismanagement in barley processing and feeding may make a tragedy from this treasure or pearl of cereal grains. Steam-rolling of barley may improve feed efficiency and post-rumen starch digestion. However, it is doubtful if such processing can improve milk production and feed intake. Due to the need to process barley less extensively than other cereals (as long as the pericarp is broken, consistent and global standards for feeding and processing barley could be feasibly established. In high-starch diets, barley feeding reduces the need for capacious small intestinal starch assimilation, subsequently reducing hindgut starch use and fecal nutrient loss. With its nutritional exclusivities underlined, barley use will be a factual art that can either matchlessly profit or harm rumen microbes, cattle production, farm economics and the environment.

  2. Physiological and molecular changes in barley and wheat under salinity. (United States)

    Temel, Aslihan; Gozukirmizi, Nermin


    In this study, it was aimed to compare salinity-induced changes in barley (Hordeum vulgare L. cv. Bornova-92) and bread wheat (Triticum aestivum L. cv. Gerek-79). Seeds were germinated under saline conditions (0, 50, 100, 250, and 500 mM NaCl) for 2 days and recovered under non-saline conditions for 2 days. At the end of the salt treatment, germination, water content (WC), total soluble protein content, and catalase (CAT, EC activity were affected in both species, while superoxide dismutase (SOD, EC activity was affected in barley. Salinity affected WC, protein content, and CAT activity in both species, while it affected germination in barley and affected fresh weight and SOD activity in wheat after recovery. Physiological responses of both species were correlated. Expression of α-tubulin, Atls1, and Lls1 genes was down-regulated in barley after 250 mM NaCl treatment. HVA1 gene was highly (more than 50-fold) stimulated by salinity in barley. However, α-tubulin and Atls1 genes were down-regulated, and Lls1 gene was up-regulated in wheat after recovery from 250-mM NaCl treatment. Increase in HVA1 expression was not significant in wheat. The expression profiles of barley and wheat under salinity are different, and barley tended to regulate gene expression faster than wheat. PMID:25578157

  3. Molecular phylogeography of domesticated barley traces expansion of agriculture in the Old World. (United States)

    Saisho, Daisuke; Purugganan, Michael D


    Barley (Hordeum vulgare ssp. vulgare) was first cultivated 10,500 years ago in the Fertile Crescent and is one of the founder crops of Eurasian agriculture. Phylogeographic analysis of five nuclear loci and morphological assessment of two traits in >250 domesticated barley accessions reveal that landraces found in South and East Asia are genetically distinct from those in Europe and North Africa. A Bayesian population structure assessment method indicates that barley accessions are subdivided into six clusters and that barley landraces from 10 different geographical regions of Eurasia and North Africa show distinct patterns of distribution across these clusters. Using haplotype frequency data, it appears that the Europe/North Africa landraces are most similar to the Near East population (F ST = 0.15) as well as to wild barley (F ST = 0.11) and are strongly differentiated from all other Asian populations (F ST = 0.34-0.74). A neighbor-joining analysis using these F ST estimates also supports a division between European, North African, and Near East barley types from more easterly Asian accessions. There is also differentiation in the presence of a naked caryopsis and spikelet row number between eastern and western barley accessions. The data support the differential migration of barley from two domestication events that led to the origin of barley--one in the Fertile Crescent and another farther east, possibly at the eastern edge of the Iranian Plateau--with European and North African barley largely originating from the former and much of Asian barley arising from the latter. This suggests that cultural diffusion or independent innovation is responsible for the expansion of agriculture to areas of South and East Asia during the Neolithic revolution. PMID:17947416

  4. Archaeogenetic evidence of ancient nubian barley evolution from six to two-row indicates local adaptation.

    Directory of Open Access Journals (Sweden)

    Sarah A Palmer

    Full Text Available BACKGROUND: Archaeobotanical samples of barley (Hordeum vulgare L. found at Qasr Ibrim display a two-row phenotype that is unique to the region of archaeological sites upriver of the first cataract of the Nile, characterised by the development of distinctive lateral bracts. The phenotype occurs throughout all strata at Qasr Ibrim, which range in age from 3000 to a few hundred years. METHODOLOGY AND FINDINGS: We extracted ancient DNA from barley samples from the entire range of occupancy of the site, and studied the Vrs1 gene responsible for row number in extant barley. Surprisingly, we found a discord between the genotype and phenotype in all samples; all the barley had a genotype consistent with the six-row condition. These results indicate a six-row ancestry for the Qasr Ibrim barley, followed by a reassertion of the two-row condition. Modelling demonstrates that this sequence of evolutionary events requires a strong selection pressure. CONCLUSIONS: The two-row phenotype at Qasr Ibrim is caused by a different mechanism to that in extant barley. The strength of selection required for this mechanism to prevail indicates that the barley became locally adapted in the region in response to a local selection pressure. The consistency of the genotype/phenotype discord over time supports a scenario of adoption of this barley type by successive cultures, rather than the importation of new barley varieties associated with individual cultures.

  5. Fungitoxicity of some higher plants and synergistic activity of their essential oils against Sclerotium rolfsii sacc. causing foot-rot disease of barley. (United States)

    Singh, R K

    Twenty five plant species were screened for their volatile components against hyphal growth and sclerotia formation of Sclerotium rolfsii causing foot rot disease of barley (Hordeum vulgare). Leaves of Chenopodium ambrosioides (CA), Lippia alba (LA), Azadirachta indica (AI) and Eucalyptus globulus (EG) were found to be strongly toxic. Their volatile active factors were isolated in the form of essential oils which were tested for toxicity individually and in six combinations (1:1 v/v) viz. CA-LA, LA-AI, CA-AI, CA-EG, and EG-AI. The oil combinations were found to be more fungitoxic than the individual oils. The CA-LA, LA-AI, EG-AI, and CA-EG combinations exhibited a broad fnngitoxic spectrum while CA-AI, LA-EG combinations possessed a narrow range of toxicity. None of the six oil combinations showed phytotoxic behaviour on seed germination, seedling growth and general morphology of Hordeum vulgare. PMID:18697732

  6. Differential appearance of isoforms and cultivar variation in protein temporal profiles revealed in the maturing barley grain proteome

    DEFF Research Database (Denmark)

    Finnie, Christine; Bak-Jensen, K.S.; Laugesen, Sabrina; Roepstorff, P.; Svensson, Birte


    Proteome analysis of mature barley (Hordeum vulgare subsp. vulgare) seeds has led to the identification of proteins in about 450 spots on 2D-gels. To shed light on the role of some of these proteins, their temporal appearance was monitored over 5 weeks during grain-filling and maturation of field......-grown barley. Appearance profiles are described for 105 proteins identified in 185 2D-gel spots in the overlapping pI ranges 4-7 and 6-11. Grouping of proteins according to appearance across functional categories revealed instances of differential regulation of protein forms. Thus, a single 1-cys...... modification or defence against fungal pathogens. Comparison of two cultivars, Barke and Morex, led to identification of protein spots appearing earlier in Morex than Barke, reflecting the faster maturation of Morex seeds....

  7. Constructing the barley model for genetic transformation in Triticeae

    Institute of Scientific and Technical Information of China (English)

    LÜ Bo; WU Jia-jie; FU Dao-lin


    Barley (Hordeum vulgare L.) is one of the oldest domesticated crops, showing dramatic adaptation to various climate and environmental conditions. As a major cereal crop, barley ranks the 4th after wheat, maize and rice in terms of planting area and production al over the world. Due to its diploid nature, the cultivated barley is considered as an ideal model to study the polyploid wheat and other Triticeae species. Here, we reviewed the development, optimization, and application of transgenic approaches in barley. The most efifcient and robust genetic transformation has been built on the Agrobacterium-mediated transfer in conjunction with the immature embryo-based regeneration. We then discussed future considerations of using more practical technologies in barley transformation, such as the T-DNA/transposon tagging and the genome editing. As a cereal crop amenable to genetic transformation, barley wil serve as the most valuable carrier for global functional genomics in Triticeae and is becoming the most practical model for generating value-added products.

  8. The comparison of nitrogen use and leaching in sole cropped versus intercropped pea and barley

    DEFF Research Database (Denmark)

    Hauggaard-Nielsen, H.; Ambus, P.; Jensen, E.S.


    harvested in sole cropped barley. Calculation of the LER showed that plant growth resources were used from 17 to 31% more efficiently by the intercrop than by the sole crops. Pea increased the N derived from N-2 fixation from 70% when sole cropped to 99% of the total aboveground N accumulation when...... significantly different from the sole cropped pea and barley lysimeters. Soil N balances indicated depletion of N in the soil-plant system during the experimental period, independent of cropping system and residue management. N complementarity in the cropping system and the synchrony between residual N......The effect of sole and intercropping of field pea (Pisum sativum L.) and spring barley (Hordeum vulgare L.) and of crop residue management on crop yield, NO3- leaching and N balance in the cropping system was tested in a 2-year lysimeter experiment on a temperate sandy loam soil. The crop rotation...

  9. Engineering high-level aluminum tolerance in barley with the ALMT1 gene. (United States)

    Delhaize, Emmanuel; Ryan, Peter R; Hebb, Diane M; Yamamoto, Yoko; Sasaki, Takayuki; Matsumoto, Hideaki


    Acidity is a serious limitation to plant production on many of the world's agricultural soils. Toxic aluminium (Al) cations solubilized by the acidity rapidly inhibit root growth and limit subsequent uptake of water and nutrients. Recent work has shown that the ALMT1 gene of wheat (Triticum aestivum) encodes a malate transporter that is associated with malate efflux and Al tolerance. We generated transgenic barley (Hordeum vulgare) plants expressing ALMT1 and assessed their ability to exude malate and withstand Al stress. ALMT1 expression in barley conferred an Al-activated efflux of malate with properties similar to those of Al-tolerant wheat. The transgenic barley showed a high level of Al tolerance when grown in both hydroponic culture and on acid soils. These findings provide additional evidence that ALMT1 is a major Al-tolerance gene and demonstrate its ability to confer effective tolerance to acid soils through a transgenic approach in an important crop species. PMID:15471989

  10. Transcriptional Activity of rRNA Genes in Barley Cells after Mutagenic Treatment. (United States)

    Kwasniewska, Jolanta; Jaskowiak, Joanna


    In the present study, the combination of the micronucleus test with analysis of the activity of the rRNA genes in mutagen-treated Hordeum vulgare (barley) by maleic hydrazide (MH) cells was performed. Simultaneously fluorescence in situ hybridization (FISH) with 25S rDNA as probes and an analysis of the transcriptional activity of 35S rRNA genes with silver staining were performed. The results showed that transcriptional activity is always maintained in the micronuclei although they are eliminated during the next cell cycle. The analysis of the transcriptional activity was extended to barley nuclei. MH influenced the fusion of the nucleoli in barley nuclei. The silver staining enabled detection of the nuclear bodies which arose after MH treatment. The results confirmed the usefulness of cytogenetic techniques in the characterization of micronuclei. Similar analyses can be now extended to other abiotic stresses to study the response of plant cells to the environment. PMID:27257817

  11. Maize, Sunflower and Barley Sensitivity to the Residual Activity of Clomazone in Soil

    Directory of Open Access Journals (Sweden)

    Jelena Gajić Umiljendić


    Full Text Available Sensitivity of maize, sunflower and barley to clomazone residues in loamy soil wasassessed in the study using bioassay. Clomazone was applied at a series of concentrationsfrom 0.12 to 12 mg a.i./kg of soil. After 14 days, morphological (shoot height, fresh and dryweight and physiological (content of carotenoids, chlorophyll a and chlorophyll b parameterswere measured. The results showed that morphological parameters are not valid indicatorsof clomazone sensitivity. Based on the results showing inhibition of the physiologicalparameters, I50 values were calculated and used to estimate the difference in sensitivitybetween the species tested. Sunflower was the most sensitive species, while the differencein sensitivity between maize and barley was not significant.Nomenclature: clomazone (2-(2-chlorbenzyl-4,4-dimethyl-1,2-oxazolidin-3-one, maize(Zea mays L., sunflower (Helianthus annuus L., barley (Hordeum vulgare L.

  12. Golgi localized barley MTP8 proteins facilitate Mn transport


    Pedas, Pai Rosager; Schiller, Michaela; Hegelund, Josefine Nymark; Ladegaard, Anne Hald; Schjørring, Jan Kofod; Husted, Søren


    Many metabolic processes in plants are regulated by manganese (Mn) but limited information is available on the molecular mechanisms controlling cellular Mn homeostasis. In this study, a yeast assay was used to isolate and characterize two genes, MTP8.1 and MTP8.2 , which encode membrane-bound proteins belonging to the cation diffusion facilitator (CDF) family in the cereal species barley (Hordeum vulgare). Transient expression in onion epidermal cells showed that MTP8.1 and MTP8.2 proteins fu...

  13. Rhizodeposition of N by pea and barley and its effect on soil N dynamics

    DEFF Research Database (Denmark)

    Jensen, E.S.


    Rhizodeposition of N during plant growth influences the microbial activity in the rhizosphere and constitutes a source of labile organic N, but has not been quantified to the same degree as the rhizodeposition of C. The rhizodeposition of N, defined as root-derived N present in the soil after...... removal of visible roots and root fragments, was determined during field pea (Pisum sativum L.) and spring barley (Hordeum vulgare L.) growth in a sandy soil at a low concentration of mineral N using a continuous split-root N-15-labelling technique. The N rhizodeposition constituted 15 and 48% of the...

  14. Quantifying relationships between rooting traits and water uptake under drought in Mediterranean barley and durum wheat

    Institute of Scientific and Technical Information of China (English)

    Pedro Carvalho; Sayed AzamAli; M. John Foulkes


    In Mediterranean regions drought is the major factor limiting spring barley and durum wheat grain yields. This study aimed to compare spring barley and durum wheat root and shoot responses to drought and quantify relationships between root traits and water uptake under terminal drought. One spring barley (Hordeum vulgare L. cv. Rum) and two durum wheat Mediterranean cultivars (Triticum turgidum L. var durum cvs Hourani and Karim) were examined in soil-column experi-ments under wel watered and drought conditions. Root system architecture traits, water uptake, and plant growth were measured. Barley aerial biomass and grain yields were higher than for durum wheat cultivars in wel watered conditions. Drought decreased grain yield more for barley (47%) than durum wheat (30%, Hourani). Root-to-shoot dry matter ratio increased for durum wheat under drought but not for barley, and root weight increased for wheat in response to drought but decreased for barley. The critical root length density (RLD) and root volume density (RVD) for 90%available water capture for wheat were similar to (cv. Hourani) or lower than (cv. Karim) for barley depending on wheat cultivar. For both species, RVD accounted for a slightly higher proportion of phenotypic variation in water uptake under drought than RLD.

  15. The draft genome of Tibetan hulless barley reveals adaptive patterns to the high stressful Tibetan Plateau. (United States)

    Zeng, Xingquan; Long, Hai; Wang, Zhuo; Zhao, Shancen; Tang, Yawei; Huang, Zhiyong; Wang, Yulin; Xu, Qijun; Mao, Likai; Deng, Guangbing; Yao, Xiaoming; Li, Xiangfeng; Bai, Lijun; Yuan, Hongjun; Pan, Zhifen; Liu, Renjian; Chen, Xin; WangMu, QiMei; Chen, Ming; Yu, Lili; Liang, Junjun; DunZhu, DaWa; Zheng, Yuan; Yu, Shuiyang; LuoBu, ZhaXi; Guang, Xuanmin; Li, Jiang; Deng, Cao; Hu, Wushu; Chen, Chunhai; TaBa, XiongNu; Gao, Liyun; Lv, Xiaodan; Abu, Yuval Ben; Fang, Xiaodong; Nevo, Eviatar; Yu, Maoqun; Wang, Jun; Tashi, Nyima


    The Tibetan hulless barley (Hordeum vulgare L. var. nudum), also called "Qingke" in Chinese and "Ne" in Tibetan, is the staple food for Tibetans and an important livestock feed in the Tibetan Plateau. The diploid nature and adaptation to diverse environments of the highland give it unique resources for genetic research and crop improvement. Here we produced a 3.89-Gb draft assembly of Tibetan hulless barley with 36,151 predicted protein-coding genes. Comparative analyses revealed the divergence times and synteny between barley and other representative Poaceae genomes. The expansion of the gene family related to stress responses was found in Tibetan hulless barley. Resequencing of 10 barley accessions uncovered high levels of genetic variation in Tibetan wild barley and genetic divergence between Tibetan and non-Tibetan barley genomes. Selective sweep analyses demonstrate adaptive correlations of genes under selection with extensive environmental variables. Our results not only construct a genomic framework for crop improvement but also provide evolutionary insights of highland adaptation of Tibetan hulless barley. PMID:25583503

  16. Genetic diversity and ecological niche modelling of wild barley: refugia, large-scale post-LGM range expansion and limited mid-future climate threats?

    Directory of Open Access Journals (Sweden)

    Joanne Russell

    Full Text Available Describing genetic diversity in wild barley (Hordeum vulgare ssp. spontaneum in geographic and environmental space in the context of current, past and potential future climates is important for conservation and for breeding the domesticated crop (Hordeum vulgare ssp. vulgare. Spatial genetic diversity in wild barley was revealed by both nuclear- (2,505 SNP, 24 nSSR and chloroplast-derived (5 cpSSR markers in 256 widely-sampled geo-referenced accessions. Results were compared with MaxEnt-modelled geographic distributions under current, past (Last Glacial Maximum, LGM and mid-term future (anthropogenic scenario A2, the 2080s climates. Comparisons suggest large-scale post-LGM range expansion in Central Asia and relatively small, but statistically significant, reductions in range-wide genetic diversity under future climate. Our analyses support the utility of ecological niche modelling for locating genetic diversity hotspots and determine priority geographic areas for wild barley conservation under anthropogenic climate change. Similar research on other cereal crop progenitors could play an important role in tailoring conservation and crop improvement strategies to support future human food security.

  17. Effect of irradiated food on life cycle of Trogoderma granarium by gamma irradiations infesting stored barley (Hordum vulgare)

    International Nuclear Information System (INIS)

    To study the effect of irradiated food on the life cycle of Trogoderma granarium crushed barley were irradiated by Gamma irradiations. Fresh eggs were collected from stock culture for getting newly hatched first instar larvae. Twenty, first instar larvae were collected and transferred to the culture tubes containing irradiated food. The larva was observed till the emergence of adults. To calculate the survivality of insects the newly emerged adults were counted daily till the last adult and the emerged beetles were removed. The observation was also made in regard to the time required for adult emergence. The test insect was reared on Gamma irradiated food and survival rate, developmental period and growth index were recorded in different does as 0.1, 0.2, 0.3, 0.4 and 0.5 KGy. The survival rate, developmental period and growth rate of test insect were recorded as 95%, 26.00 and 0.049 respectively at highest dose of 0.5 KGy. Where as 96.67%, 25.33 and 0.051 at lowest dose of 0.1 KGy was recorded. In control condition, they were 98.33%, 29.67 and 0.043 respectively. Irradiation against barley grains had no such effect on the developmental period, survival rate and growth index of Trogoderma granarium. It provides effective alternative to fumigants chemical pesticides which have numerous hazards and create environmental pollution. (author)

  18. Effects of a Dietary Supplement with Barley Sprout Extract on Blood Cholesterol Metabolism. (United States)

    Byun, A Ri; Chun, Hyejin; Lee, Jin; Lee, Sang Wha; Lee, Hong Soo; Shim, Kyung Won


    Objective. Barley sprout (Hordeum vulgare L.) contains 4.97% fat, 52.6% polysaccharide, and 34.1% protein along with a variety of vitamins, minerals, and polyphenolic compounds. Hexacosanol is one such compound from the barley leaf that might improve cholesterol metabolism by decreasing cholesterol synthesis. Method. Therefore, this study was conducted to investigate the effects of barley sprout extract on serum lipid metabolism in healthy volunteers (n = 51). Subjects were randomly divided into two groups: one group consumed a single capsule of barley leaf extract daily (n = 25, 42.48 ± 13.58 years) and the other consumed placebo capsules (n = 26, 40.54 ± 11.1 years) for 12 weeks. Results. After 12 weeks, total cholesterol and low-density lipoprotein- (LDL-) cholesterol were not lower in the barley sprout extract group compared to the placebo group (p = 0.415 and p = 0.351, resp.) and no differences in clinical or laboratory findings were observed between both groups. Conclusion. Our study failed to show significant lipid-lowering effects of barley sprout extract, possibly due to dosage, duration of therapy, and small sample size. Despite our nonsignificant findings, barley sprout has a possibility as a functional health food; therefore future research is needed. PMID:26101533

  19. Effects of a Dietary Supplement with Barley Sprout Extract on Blood Cholesterol Metabolism

    Directory of Open Access Journals (Sweden)

    A Ri Byun


    Full Text Available Objective. Barley sprout (Hordeum vulgare L. contains 4.97% fat, 52.6% polysaccharide, and 34.1% protein along with a variety of vitamins, minerals, and polyphenolic compounds. Hexacosanol is one such compound from the barley leaf that might improve cholesterol metabolism by decreasing cholesterol synthesis. Method. Therefore, this study was conducted to investigate the effects of barley sprout extract on serum lipid metabolism in healthy volunteers (n=51. Subjects were randomly divided into two groups: one group consumed a single capsule of barley leaf extract daily (n=25, 42.48 ± 13.58 years and the other consumed placebo capsules (n=26, 40.54 ± 11.1 years for 12 weeks. Results. After 12 weeks, total cholesterol and low-density lipoprotein- (LDL- cholesterol were not lower in the barley sprout extract group compared to the placebo group (p=0.415 and p=0.351, resp. and no differences in clinical or laboratory findings were observed between both groups. Conclusion. Our study failed to show significant lipid-lowering effects of barley sprout extract, possibly due to dosage, duration of therapy, and small sample size. Despite our nonsignificant findings, barley sprout has a possibility as a functional health food; therefore future research is needed.

  20. The role of root hairs in cadmium acquisition by barley

    Energy Technology Data Exchange (ETDEWEB)

    Zheng Ruilun; Li Huafen [Key Laboratory of Plant-Soil Interactions of the Ministry of Education, College of Resources and Environmental Sciences, China Agricultural University, Beijing 100094 (China); Jiang Rongfeng, E-mail: [Key Laboratory of Plant-Soil Interactions of the Ministry of Education, College of Resources and Environmental Sciences, China Agricultural University, Beijing 100094 (China); Roemheld, Volker [Institute of Plant Nutrition, University of Hohenheim, D-70593 Stuttgart (Germany); Zhang Fusuo [Key Laboratory of Plant-Soil Interactions of the Ministry of Education, College of Resources and Environmental Sciences, China Agricultural University, Beijing 100094 (China); Zhao Fangjie [Soil Science Department, Rothamsted Research, Harpenden, Hertfordshire AL5 2JQ (United Kingdom)


    The role of root hairs in Cd acquisition from soil was investigated in three pot experiments using a root hairless mutant (bald root barley, brb) and its wild-type (WT) cultivar of barley (Hordeum vulgare). brb had significantly lower concentrations and lower total amounts of Cd in shoots than WT. The Cd uptake efficiency based on total root length was 8-45% lower in brb than in WT. The difference between brb and WT increased with increasing extractable Cd in soil under the experimental conditions used. Additions of phosphate to soil decreased Cd extractability. Both soil and foliar additions of phosphate decreased root length, and root hair formation in WT. These effects resulted in decreased Cd uptake with increasing P supply. Cd uptake in WT correlated significantly with root length, root hair length and density, and soil extractable Cd. Root hairs contribute significantly to Cd uptake by barley. - Research highlights: The Cd uptake efficiency was significantly lower in brb than in WT. Additions of phosphate to soil decreased Cd extractability and Cd uptake. Both soil and foliar additions of phosphate decreased root length, and root hair formation in WT. Root hairs contribute significantly to Cd uptake by barley. - The Cd uptake efficiency based on total root length was 8-45% lower in a barley root hairless mutant than in its wild-type, indicating an important role of root hairs in Cd acquisition.

  1. The role of root hairs in cadmium acquisition by barley

    International Nuclear Information System (INIS)

    The role of root hairs in Cd acquisition from soil was investigated in three pot experiments using a root hairless mutant (bald root barley, brb) and its wild-type (WT) cultivar of barley (Hordeum vulgare). brb had significantly lower concentrations and lower total amounts of Cd in shoots than WT. The Cd uptake efficiency based on total root length was 8-45% lower in brb than in WT. The difference between brb and WT increased with increasing extractable Cd in soil under the experimental conditions used. Additions of phosphate to soil decreased Cd extractability. Both soil and foliar additions of phosphate decreased root length, and root hair formation in WT. These effects resulted in decreased Cd uptake with increasing P supply. Cd uptake in WT correlated significantly with root length, root hair length and density, and soil extractable Cd. Root hairs contribute significantly to Cd uptake by barley. - Research highlights: → The Cd uptake efficiency was significantly lower in brb than in WT. → Additions of phosphate to soil decreased Cd extractability and Cd uptake. → Both soil and foliar additions of phosphate decreased root length, and root hair formation in WT. → Root hairs contribute significantly to Cd uptake by barley. - The Cd uptake efficiency based on total root length was 8-45% lower in a barley root hairless mutant than in its wild-type, indicating an important role of root hairs in Cd acquisition.

  2. Insoluble Fiber in Young Barley Leaf Suppresses the Increment of Postprandial Blood Glucose Level by Increasing the Digesta Viscosity

    Directory of Open Access Journals (Sweden)

    Akira Takano


    Full Text Available Barley (Hordeum vulgare L. is a well-known cereal plant. Young barley leaf is consumed as a popular green-colored drink, which is named “Aojiru” in Japan. We examined the effects of barley leaf powder (BLP and insoluble fibers derived from BLP on postprandial blood glucose in rats and healthy Japanese volunteers. BLP and insoluble fibers derived from BLP suppressed the increment of postprandial blood glucose levels in rats (, and increased the viscosity of their digesta. The insoluble fibers present in BLP might play a role in controlling blood glucose level by increasing digesta viscosity. In human, BLP suppressed the increment of postprandial blood glucose level only in those which exhibited higher blood glucose levels after meals (. BLP might suppress the increment of postprandial blood glucose level by increasing digesta viscosity in both of rats and humans who require blood glucose monitoring.

  3. Transfer of N and P from intact or decomposing roots of pea to barley interconnected by an arbuscular mycorrhizal fungus

    DEFF Research Database (Denmark)

    Johansen, A.; Jensen, E.S.


    The role of arbuscular mycorrhizas in the transfer of N and P between pea (Pisum sativum L.) and barley (Hordeum vulgare L.) plants was studied in a controlled environment. The plants were grown together in PVC containers, either in symbiosis with Glomus intraradices Schenck and Smith or as non-mycorrhizal...... hyphae between mycorrhizal donor and receiver plants. No significant transfer of N was detected from intact pea donor plants to the barley receiver plants in the non-mycorrhizal controls. Mycorrhizal colonization slightly increased the transfer of N. However, the net transfer of N was almost...... insignificant since N was also transferred in the reverse direction, from barley to pea. Removal of the pea donor-plant shoots increased the N transfer to 4% of the donor-root N in the non-mycorrhizal controls. Contrastingly, 15% of the donor-root N was transferred to the receiver plants, when plants were...

  4. Crystal structure of an essential enzyme in seed starch degradation - barley limit dextrinase in complex with cyclodextrins

    DEFF Research Database (Denmark)

    Vester-Christensen, Malene Bech; Abou Hachem, Maher; Svensson, Birte;


    Barley limit dextrinase [Hordeum vulgare limit dextrinase (HvLD)] catalyzes the hydrolysis of α-1,6 glucosidic linkages in limit dextrins. This activity plays a role in starch degradation during germination and presumably in starch biosynthesis during grain filling. The crystal structures of Hv......-stranded β-sandwich domain, a six-stranded β-sandwich domain belonging to the carbohydrate binding module 48 family, a catalytic (β/α)8-like barrel domain that lacks α-helix 5, and a C-terminal eight-stranded β-sandwich domain of unknown function. The CDs are bound at the active site occupying carbohydrate...

  5. Response of photosynthetic apparatus of spring barley (Hordeum vulgare L.) to combined effect of elevated CO2 concentration and different growth irradiances

    Czech Academy of Sciences Publication Activity Database

    Kurasová, I.; Kalina, J.; Štroch, M.; Urban, Otmar; Špunda, V.


    Roč. 41, č. 2 (2003), s. 209-219. ISSN 0300-3604 R&D Projects: GA ČR GA522/00/1381; GA MŠk LN00A141 Institutional research plan: CEZ:AV0Z6087904 Keywords : CO2 concentration * fluorescence * photosynthesis Subject RIV: ED - Physiology Impact factor: 0.661, year: 2003

  6. Bacterial community responses to soil-injected liquid ammonium nutrition and effect of temperature on barley (Hordeum vulgare L.) grain yield formation


    Matoka, Charles Mboya


    Injection of concentrated liquid ammonium nutrition into soil is an agricultural practice aimed at mitigating nitrogen losses. In Germany, it is referred to as controlled uptake long term ammonium nutrition (CULTAN) technique. Being an anion, nitrate is mobile in soil and thus is not bound to negatively charged surfaces of clay minerals or organic compounds. This may thus result in leaching and may eventually cause environmental pollution. Ammonium ions, on the other hand, may be unspecifical...

  7. The cytogenetic disturbances in sprouts of barley (Hordeum vulgare L.) under the actions of gamma-irradiating of seeds and drought

    International Nuclear Information System (INIS)

    The gamma-irradiating of seeds in doses 2.5 and 5.0 Gy raises sensitivity of plants to operation of the stressful factor. The drought at germination of seeds as the modifying factor of damaging operation of an ionizing radiation on a genome of plants was shown. (authors)

  8. DNA binding sites recognised in vitro by a knotted class 1 homeodomain protein encoded by the hooded gene, k, in barley (Hordeum vulgare)

    DEFF Research Database (Denmark)

    Krusell, L; Rasmussen, I; Gausing, K


    The homeodomain of the knotted classes of transcription factors from plants differs from the well characterized Antp/En type homeodomains from Drosophila at key amino acid residues contributing to the DNA binding. A cDNA, Hvh21, derived from the hooded gene and encoding a full length homolog of...

  9. Influence of jet-cooking and pH on extraction and molecular weight of ß-glucan and arabinoxylan from barley (Hordeum vulgare Prowashonupana) (United States)

    Food processing conditions may affect the solubility and molecular weight of beta-glucans and arabinoxylans in cereal products. This can dramatically affect the functional and physiological properties of the final products. Therefore, the purpose of the research was to explore the effects of jet-c...

  10. A Substantial Fraction of Barley (Hordeum vulgare L.) Low Phytic Acid Mutations Have Little or No Effect on Yield across Diverse Production Environments


    Victor Raboy; Kevin Peterson; Chad Jackson; Marshall, Juliet M.; Gongshe Hu; Hirofumi Saneoka; Phil Bregitzer


    The potential benefits of the low phytic acid (lpa) seed trait for human and animal nutrition, and for phosphorus management in non-ruminant animal production, are well documented. However, in many cases the lpa trait is associated with impaired seed or plant performance, resulting in reduced yield. This has given rise to the perception that the lpa trait is tightly correlated with reduced yield in diverse crop species. Here we report a powerful test of this correlation. We measured grain yie...

  11. Physiological, Biochemical and Molecular Characterization of Barley (Hordeum vulgare L.) and Maize (Zea mays L.) for Improving Manganese Efficiency

    DEFF Research Database (Denmark)

    Long, Lizhi

    Manganese (Mn) deficiency is a nutritional problem, causing significant reductions in crop yields and in severe cases resulting in complete loss of crops during winter time. Different plant species and genotypes within the same species vary in their tolerance with respect to growth in soils with ...

  12. Uptake, degradation and chiral discrimination of N-acyl-D/L-homoserine lactones by barley (Hordeum vulgare) and yam bean (Pachyrhizus erosus) plants

    Czech Academy of Sciences Publication Activity Database

    Götz, C.; Fekete, A.; Gebefuegi, I.; Forczek, Sándor; Fuksová, Květoslava; Li, X.; Englmann, M.; Gryndler, Milan; Hartmann, A.; Matucha, Miroslav; Schmitt-Kopplin, P.


    Roč. 389, č. 5 (2007), s. 1447-1457. ISSN 1618-2642 Institutional research plan: CEZ:AV0Z50380511; CEZ:AV0Z50200510 Keywords : UPLC * FTICR-MS * tritium autoradiography Subject RIV: EF - Botanics Impact factor: 2.867, year: 2007

  13. A mutant homeobox gene created six-rowed spike in barley domestication

    International Nuclear Information System (INIS)

    Increased seed production has been a common goal during the domestication of cereal crops. Early cultivators of barley (Hordeum vulgare ssp. vulgare) selected a phenotype with a six-rowed spike that stably produced three times the usual grain number during domestication. We isolated the SIX-ROWED SPIKE 1 (Vrs1) from barley by chromosome walking. We discovered that Vrs1 encodes a homeodomain leucine zipper I-class protein (HD-ZIP I), a potential transcription factor. RNA in situ hybridization revealed that the Vrs1 is expressed only in lateral spikelet primordia. Sequencing alleles of 54 six-rowed mutant lines revealed a single amino acid substitution in 22 lines, creation of a new stop codon in 12 lines, a nucleotide substitution in the conserved splicing site in 3 lines, a frameshift mutation by a deletion in 5 lines, complete deletion of the gene region in 7 lines, and no DNA changes throughout the coding region with no gene expression detected in the remaining 5 lines. We found three haplotypes among six-rowed barley revealing loss-of-function mutation of the homeobox gene Vrs1. We found that two of them independently originated from two different type two-rowed barleys, but origin of the remaining one six-rowed allele remained unclear. (author)

  14. Genetic differentiation and geographical Relationship of Asian barley landraces using SSRs

    Directory of Open Access Journals (Sweden)

    Rehan Naeem


    Full Text Available Genetic diversity in 403 morphologically distinct landraces of barley (Hordeum vulgare L. subsp. vulgare originating from seven geographical zones of Asia was studied using simple sequence repeat (SSR markers from regions of medium to high recombination in the barley genome. The seven polymorphic SSR markers representing each of the chromosomes chosen for the study revealed a high level of allelic diversity among the landraces. Genetic richness was highest in those from India, followed by Pakistan while it was lowest for Uzbekistan and Turkmenistan. Out of the 50 alleles detected, 15 were unique to a geographic region. Genetic diversity was highest for landraces from Pakistan (0.70 ± 0.06 and lowest for those from Uzbekistan (0.18 ± 0.17. Likewise, polymorphic information content (PIC was highest for Pakistan (0.67 ± 0.06 and lowest for Uzbekistan (0.15 ± 0.17. Diversity among groups was 40% compared to 60% within groups. Principal component analysis clustered the barley landraces into three groups to predict their domestication patterns. In total 51.58% of the variation was explained by the first two principal components of the barley germplasm. Pakistan landraces were clustered separately from those of India, Iran, Nepal and Iraq, whereas those from Turkmenistan and Uzbekistan were clustered together into a separate group.

  15. The effect of irradiation treatment on Beta-Glucan and protein quality of barley

    International Nuclear Information System (INIS)

    Samples of barley (hordeum vulgare L) grains were tested for nutritional value after being irradiated at dose levels of 10, 20, and 30 KGy. The gross composition of raw and irradiated beans was similar. Soluble protein was reduced by 16.76%, 28.84% and 44.76% when barley grains were irradiated at 10, 20, and 30 KGy, respectively, The amount of water-soluble beta-glucan in raw barley was increased linearly from 1.76 to 2.40 g/100 g of sample as a function of dose. Meanwhile, the effect of irradiation treatment on total beta-glucan (3.90 g/100 g) was insignificant while the level of insoluble beta-glucan was decreased with increasing the dose levels of irradiation. The protein efficiency ratio (PER) of processed barley grains at the doses applied was increased by 6.38%, 12.77%, and 1135%, respectively as compared with the value for raw grains. The data showed that the radiation processing of raw barley grains increased the solubility of beta-glucan, the most anti nutritional factor in the grains and improved the PER in rats. Therefore it could be concluded thal the irradiation treatment (up tp 30 KGy) up-grade the biological value of barley through increase the solubility of Beta-glucan that affect the performance of animals

  16. Increased symplasmic permeability in barley root epidermal cells correlates with defects in root hair development. (United States)

    Marzec, M; Muszynska, A; Melzer, M; Sas-Nowosielska, H; Kurczynska, E U


    It is well known that the process of plant cell differentiation depends on the symplasmic isolation of cells. Before starting the differentiation programme, the individual cell or group of cells should restrict symplasmic communication with neighbouring cells. We tested the symplasmic communication between epidermal cells in the different root zones of parental barley plants Hordeum vulgare L., cv. 'Karat' with normal root hair development, and two root hairless mutants (rhl1.a and rhl1.b). The results clearly show that symplasmic communication was limited during root hair differentiation in the parental variety, whereas in both root hairless mutants epidermal cells were still symplasmically connected in the corresponding root zone. This paper is the first report on the role of symplasmic isolation in barley root cell differentiation, and additionally shows that a disturbance in the restriction of symplasmic communication is present in root hairless mutants. PMID:23927737

  17. Nitrogen immobilization and mineralization during initial decomposition of 15N-labelled pea and barley residues

    DEFF Research Database (Denmark)

    Jensen, E.S.


    The immobilization and mineralization of N following plant residue incorporation were studied in a sandy loam soil using N-15-labelled field pea (Pisum sativum L.) and spring barley (Hordeum vulgare L.) straw. Both crop residues caused a net immobilization of soil-derived inorganic N during the...... biomass. A comparison of the N-15 enrichments of the soil organic N and the newly formed biomass N pools indicated that either residue N may have been assimilated directly by the microbial biomass without entering the soil inorganic N pool or the biomass had a higher preference for mineralized ammonium...... the decomposition of the barley residue. The net mineralization of residue-derived N was 2% in the barley and 22% in the pea residue treatment after 84 days of incubation. The results demonstrated that even if crop residues have a relative low C/N ratio (15), transient immobilization of soil N in the...

  18. Mechanisms involved in control of ¤Blumeria graminis¤ f.sp. ¤hordei¤ in barley treated with mycelial extracts from cultured fungi

    DEFF Research Database (Denmark)

    Haugaard, H.; Collinge, D.B.; Lyngkjær, Michael Foged


    Treatment with mycelial extracts, prepared from liquid cultures of Bipolaris oryzae , Pythium ultimum and Rhizopus stolonifer , protected barley (Hordeum vulgare ) against powdery mildew disease caused by the fungus Blumeria graminis f.sp. hordei . The mechanisms of this protection were studied...... with B. oryzae and P. ultimum mycelial extracts, and to a lesser extent R. stolonifer mycelial extract, compared with water-treated leaves. It is suggested that the protection mechanism of the mycelial extracts involves direct antifungal effects and possible induced resistance for the B. oryzae and P...

  19. Involvement of Alternative Splicing in Barley Seed Germination.

    Directory of Open Access Journals (Sweden)

    Qisen Zhang

    Full Text Available Seed germination activates many new biological processes including DNA, membrane and mitochondrial repairs and requires active protein synthesis and sufficient energy supply. Alternative splicing (AS regulates many cellular processes including cell differentiation and environmental adaptations. However, limited information is available on the regulation of seed germination at post-transcriptional levels. We have conducted RNA-sequencing experiments to dissect AS events in barley seed germination. We identified between 552 and 669 common AS transcripts in germinating barley embryos from four barley varieties (Hordeum vulgare L. Bass, Baudin, Harrington and Stirling. Alternative 3' splicing (34%-45%, intron retention (32%-34% and alternative 5' splicing (16%-21% were three major AS events in germinating embryos. The AS transcripts were predominantly mapped onto ribosome, RNA transport machineries, spliceosome, plant hormone signal transduction, glycolysis, sugar and carbon metabolism pathways. Transcripts of these genes were also very abundant in the early stage of seed germination. Correlation analysis of gene expression showed that AS hormone responsive transcripts could also be co-expressed with genes responsible for protein biosynthesis and sugar metabolisms. Our RNA-sequencing data revealed that AS could play important roles in barley seed germination.

  20. Semidwarf, high yielding and high protein mutants in barley

    International Nuclear Information System (INIS)

    An induced mutations programme was undertaken in barley (Hordeum vulgare L.) with the primary objective of developing some semidwarf, short duration, high yielding types as most of the local cultivars grown in Meerut are tall statured with maturity period of 130-140 days. In recent years, the barley crop in this region, particularly at flowering/grain filling stages during February/March, has often been affected by unexpected rains accompanied by gusty winds, resulting in severe lodging of the crop and thereby reduction in crop yields. To combat this problem it is necessary to develop short statured types of barley, which can withstand lodging. If such types are associated with early maturity, that will be of greater help. Dry seeds of three local cultivars of barley 'K-169', 'K-272' and 'DL-281' were irradiated with gamma rays at 100; 200; 300 and 400 Gy. A number of morphological mutants for different plant characters like plant height (dwarfs and semidwarfs), maturity period (early and late maturing), spike density and size (lax panicled and erectoides), high tillering and chlorophyll deficiency (virescent) types were isolated from M2 mutated populations of the three varieties. Among these mutants, one semidwarf mutant (No. 3-20-5) of parent cultivar K-169 is of particular interest because of increased yield and significantly high protein content, besides the short stature

  1. Single and combined toxicity of copper and cadmium to H. vulgare growth and heavy metal bioaccumulation

    Directory of Open Access Journals (Sweden)

    Žaltauskaitė J.


    Full Text Available The single and combined effects of copper (Cu and cadmium (Cd (0.1-10 mg L−1 in spring barley (Hordeum vulgare L. plants grown in hydroponics are investigated. The aim of the study was to investigate the interactive effect of the binary mixture of Cu and Cd to the growth of H. vulgare and accumulation of these metals by the plants. Single and combined metal treatment led to major effects in the growth of roots and shoots and dry weight of barley. Exposure to metals altered the content of photosynthetic pigments and caused lipid peroxidation. It was observed that combined effects of heavy metals to plants are endpoint and concentration depending. The binary mixture Cu+Cd exhibited additive or less than additive interaction for dry weight, root length and shoot height. Analysis of tissue metal concentrations showed that Cu and Cd were mainly accumulated in the roots and the combination of Cu+Cd had less than additive response of metal bioaccumulation in the leaves and roots.

  2. Genetic Diversity in A Core Subset of Wild Barley Germplasm

    Directory of Open Access Journals (Sweden)

    Yong-Bi Fu


    Full Text Available Wild barley [Hordeum vulgare ssp. spontaneum (C. Koch Thell.] is a part of the primary gene pool with valuable sources of beneficial genes for barley improvement. This study attempted to develop a core subset of 269 accessions representing 16 countries from the Plant Gene Resources of Canada (PGRC collection of 3,782 accessions, and to characterize them using barley simple sequence repeat (SSR markers. Twenty-five informative primer pairs were applied to screen all samples and 359 alleles were detected over seven barley chromosomes. Analyses of the SSR data showed the effectiveness of the stratified sampling applied in capturing country-wise SSR variation. The frequencies of polymorphic alleles ranged from 0.004 to 0.708 and averaged 0.072. More than 24% or 7% SSR variation resided among accessions of 16 countries or two regions, respectively. Accessions from Israel and Jordan were genetically most diverse, while accessions from Lebanon and Greece were most differentiated. Four and five optimal clusters of accessions were obtained using STRUCTURE and BAPS programs and partitioned 16.3% and 20.3% SSR variations, respectively. The five optimal clusters varied in size from 15 to 104 and two clusters had only country-specific accessions. A genetic separation was detected between the accessions east and west of the Zagros Mountains only at the country, not the individual, level. These SSR patterns enhance our understanding of the wild barley gene pool, and are significant for conserving wild barley germplasm and exploring new sources of useful genes for barley improvement.

  3. Competition and dry matter yield in intercrops of barley and legume for forage

    Directory of Open Access Journals (Sweden)



    Full Text Available For increasing land use efficiency intercropping plays a pivotal role. Barley (Hordeum vulgare L., vetch (Vicia villosa, and grass pea (Lathyrus sativus L. monocultures as well as mixtures of barley with each of the above legumes, in three seeding ratios (i.e., barley: legume 75:25, 50:50 and 25:75, based on seed numbers were used to investigated forage yield and competition indices such as land equivalent ratio (LER,competitive ratio (CR, relative crowding coefficient (RCC, aggressivity (A, actual yield loss (AYL, monetary advantage index (MAI and intercropping advantage (IA.The experimental was arranged asa randomized complete block design (RCBD with three replications.The results showed that intercropping reduced the dry matter yield of the three component plants, compared with their respective monocrops. The greatest value of total dry matter yield was obtained from barley25-grass pea75 (5.44 t ha-1 mixture, followed by grass pea sole crop (4.99 t ha-1. The total AYL values were positive and greater than 0 in all mixtures, indicating an advantage from intercropping over sole crops. Intercropped barley had a higher relative crowding coefficient (K=1.64 than intercropped legumes (K=1.20, indicating that barley was more competitive than legumes in mixtures. Furthermore, grass pea was more competitive than vetch in mixtures with barley. The highest LER, SPI and MAI were obtained when barley was mixed at a rate of 25% with 75% seed rate of grass pea. It is concluded that intercropping of barley with grass pea has a good potential to improve the performance of forage with high land-use efficiency.

  4. Nitrogen acquisition by pea and barley and the effect of their crop residues on available nitrogen for subsequent crops

    DEFF Research Database (Denmark)

    Jensen, E.S.


    . The pea and barley residue N recovered constituted only 2.5% and <1%, respectively, of total N in the N-fertilized barley. The total N uptake in a test crop of mustard grown in the second autumn following pea and barley cultivation was not significantly influenced by pre-precrop and residue treatment......Nitrogen acquisition by field pea (Pisum sativum L.) and spring barley (Hordeum vulgare L.) grown on a sandy loam soil and availability of N in three subsequent sequences of a cropping system were studied in an outdoor pot experiment. The effect of crop residues on the N availability was evaluated...... using N-15-labelled residues. Field pea fixed 75% of its N requirement and the N-2 fixation almost balanced the N removed with the seeds. The barley crop recovered 80% of the N-15-labelled fertilizer N supplied and the N in the barley grain corresponded to 80% of the fertilizer N taken up by the crop...

  5. Effects of Single and Multifactor Treatments with Elevated Temperature, CO2 and Ozone on Oilseed Rape and Barley

    DEFF Research Database (Denmark)

    Clausen, Sabine Karin; Frenck, Georg; van der Linden, Leon Gareth;


    yield and biomass. Seed number increased by about 47 % in barley and by 26 % in oilseed rape, but in oilseed rape, the TSW was significantly decreased, possibly because of shortening of the seed filling period. Higher temperatures decreased yield and biomass significantly in both species. A......We investigated the effect of elevated [CO2], [O3] and temperature on plant productivity and if these climate factors interacted with each other in multifactor treatments. The climate effects were studied in 14 different cultivars/lines of European spring oilseed rape (Brassica napus L.) and spring...... barley (Hordeum vulgare L.). Seven genotypes of each species were cultivated in six single- and multifactor treatments with ambient or elevated CO2 (385 ppm and 700 ppm), O3 (20 ppb and 60 ppb) and temperature (12/19 °C and 17/24 °C). Growth and production parameters were measured. Elevated CO2 increased...

  6. [Cytogenetic analysis of alloplasmic recombinant lines (H. vulgare)-T. aestivum with unstable fertility and viability]. (United States)

    Badaeva, E D; Pershina, L A; Bil'danova, L L


    Comparative cytogenetic analysis was performed with four alloplasmic recombinant (Hordeum vulgare)-Triticum aestivum lines differing in morphological traits, number of seeds per spike, and seed plumpness. None of the lines displayed introgression of the barley genetic material: the karyotypes included only common wheat chromosomes. Two lines, 79(B) and 79(D), were cytogenetically stable. Plants of lines 79(A) and 79(C) displayed a high frequency of unbalanced chromosome aberrations, including dicentric and polycentric chromosomes, terminal deletions varying in size, acentric fragments, and multiple unidentifiable translocations. Previous studies of the mitochondrial genome showed that the two cytologically unstable lines, which were also unstable in fertility and viability, are characterized by heteroplasmy at the mitochondrial 18S-5S locus (simultaneous presence of barley and wheat fragments). Stable lines 79(B) and 79(D) with normal fertility contained only wheat mitochondrial markers. It was assumed that the substantial instability of the nuclear genome in lines 79(C) and 79(A) was a result of nuclear-cytoplasmic incompatibility and was associated with heteroplasmy, while elimination or considerable reduction of barley material in the mitochondrial genome stabilized the nuclear genome of lines 79(B) and 79(D). In turn, the instability of the nuclear genome was responsible for a decrease in viability and fertility of plants. PMID:16583704

  7. Comparison of barley stripe mosaic virus strains. (United States)

    Hafez, Elsayed E; Abdel Aleem, Engy E; Fattouh, Faiza A


    BSMV (barley stripe mosaic virus) particles were obtained in a pure state from infected host plant tissues of Hordeum vulgare. The three genomic parities (alpha, beta and gamma) were amplified by PCR using specific primers for each particle; each was cloned. Partial sequence of the alpha, beta and gamma segments was determined for the Egyptian isolate of barley stripe mosaic virus (BSMV AE1). Alignment of nucleotide sequences with that of other known strains of the virus, BSMV type strains (CV17, ND18 and China), and the generation of phylogenetic trees was performed. A low level of homology was detected comparing 467 bp of the a and 643 bp of the segments to that of the other strains, and thus BSMV alpha and beta segments were in separate clusters. However, 1154 bp of the gamma segments of BSMV AE1 showed a high level of homology especially to strain BSMV ND18, as they both formed a distinct cluster. Northern blotting of pure BSMV AE1 virus and H. vulgare-infected tissue were compared using an alpha ND18 specific probe. Western blotting using antibodies specific for the coat protein (CP) and the triple gene block 1 (TGB1) protein, which are both encoded by the beta ND18 segment, still indicated a high level of similarity between proteins produced by BSMV ND18 and AE1. We suggest that the BSMV AE1 isolate is a distinct strain of BSMV which reflects the genetic evolutionary divergence among BSMV strains and members of the Hordeivirus group. PMID:18533473

  8. Linkage mapping of putative regulator genes of barley grain development characterized by expression profiling

    Directory of Open Access Journals (Sweden)

    Wobus Ulrich


    Full Text Available Abstract Background Barley (Hordeum vulgare L. seed development is a highly regulated process with fine-tuned interaction of various tissues controlling distinct physiological events during prestorage, storage and dessication phase. As potential regulators involved within this process we studied 172 transcription factors and 204 kinases for their expression behaviour and anchored a subset of them to the barley linkage map to promote marker-assisted studies on barley grains. Results By a hierachical clustering of the expression profiles of 376 potential regulatory genes expressed in 37 different tissues, we found 50 regulators preferentially expressed in one of the three grain tissue fractions pericarp, endosperm and embryo during seed development. In addition, 27 regulators found to be expressed during both seed development and germination and 32 additional regulators are characteristically expressed in multiple tissues undergoing cell differentiation events during barley plant ontogeny. Another 96 regulators were, beside in the developing seed, ubiquitously expressed among all tissues of germinating seedlings as well as in reproductive tissues. SNP-marker development for those regulators resulted in anchoring 61 markers on the genetic linkage map of barley and the chromosomal assignment of another 12 loci by using wheat-barley addition lines. The SNP frequency ranged from 0.5 to 1.0 SNP/kb in the parents of the various mapping populations and was 2.3 SNP/kb over all eight lines tested. Exploration of macrosynteny to rice revealed that the chromosomal orders of the mapped putative regulatory factors were predominantly conserved during evolution. Conclusion We identified expression patterns of major transcription factors and signaling related genes expressed during barley ontogeny and further assigned possible functions based on likely orthologs functionally well characterized in model plant species. The combined linkage map and reference

  9. Competition and Facilitation in Hairy Vetch-Barley Intercrops

    Directory of Open Access Journals (Sweden)

    Giacomo Tosti


    Full Text Available Intercrops between legumes and non-legumes are widely used for fodder production and as cover crops, but little quantitative data are available on competition between species in the mixture. The objective of the present study was to assess the interaction between hairy vetch (Vicia villosa Roth. and barley (Hordeum vulgare L. grown as pure crops or intercrops with different proportions of seed rates at sowing. A 4-year field study was conducted using hairy vetch and barley as pure stands at full sowing density and as intercrops at different proportions of their own full seed rate according to the replacement principle. Interaction between species was evaluated on the basis of Land Equivalent Ratio (LER, Relative Neighbour Effect (RNE and Aggressivity (A calculated on biomass and nitrogen (N accumulation. The N accumulation of the mixed crops increased linearly with the legume proportion in the mixture. The mixtures were more efficient than the pure crops in terms of N use (LER > 1. Partial LER values indicated that the barley component benefited from the presence of the legume, while the hairy vetch partial LER decreased with increasing barley proportion in the mixture. The competitive response in terms of biomass accumulation was high for both species when their density in the mixture was high. Concerning N accumulation, barley benefited from an asymmetric interspecific facilitation while the vetch behaviour was similar to that observed for biomass accumulation. Barley dominance progressively increased reaching a maximum just before the last sampling date. At the last sampling date the competitive ability of hairy vetch showed a considerable increase in all mixtures (A ≈ 0. These findings indicate that the use of mixtures between hairy vetch and barley allows an increase in the use efficiency of N resource with respect to pure crops. Barley is the dominant component of the mixture and the hairy vetch is able to cope with the cereal

  10. Energy consumption in barley and turnip rape cultivation for bioethanol and biodiesel (RME) production

    Energy Technology Data Exchange (ETDEWEB)

    Mikkola, Hannu; Ahokas, Jukka [University of Helsinki, Faculty of Agriculture and Forestry, Department of Agricultural Sciences, FIN-00014 Helsingin yliopisto (Finland); Pahkala, Katri [MTT, Agrifood Research Finland, Crop Science and Technology, FIN-31600 Jokioinen (Finland)


    The energy consumption for six spring barley (Hordeum vulgare L.) production chains and five spring turnip rape (Brassica rapa ssp. oleifera (DC) Metsg.) production chains were compared with each other and in relation to the energy content of the seed yield. Two cultivation intensities, standard and intensive production, were used for barley. Fertiliser production and grain drying were the most energy consuming phases of the chains. The production of nitrogen fertiliser alone accounted for 1/3-1/2 of the total energy consumption of the production chains. If barley were direct drilled and the yield stored in airtight silos, instead of drying, the energy consumption would decrease by 30-34%. Use of wood-chips instead of oil for grain drying would decrease the use of fossil fuel to the same extent. The input-output ratios for the intensive barley production chains were 0.18-0.25. They were somewhat lower than the ratios for the standard production intensity. The intensive production was more energy efficient despite higher input rates. The input-output ratios for turnip rape production were 0.32-0.34. The energy consumption for manufacturing, repair and maintenance of machines and buildings requires more research because it is a significant factor but the data available are largely old and few studies have been conducted. (author)

  11. Root border cell development is a temperature-insensitive and Al-sensitive process in barley. (United States)

    Pan, Jian-Wei; Ye, Dan; Wang, Li-Ling; Hua, Jing; Zhao, Gu-Feng; Pan, Wei-Huai; Han, Ning; Zhu, Mu-Yuan


    In vivo and in vitro experiments showed that border cell (BC) survival was dependent on root tip mucigel in barley (Hordeum vulgare L. cv. Hang 981). In aeroponic culture, BC development was an induced process in barley, whereas in hydroponic culture, it was a kinetic equilibrium process during which 300-400 BCs were released into water daily. The response of root elongation to temperatures (10-35 degrees C) was very sensitive but temperature changes had no great effect on barley BC development. At 35 degrees C, the root elongation ceased whereas BC production still continued, indicating that the two processes might be regulated independently under high temperature (35 degrees C) stress. Fifty microM Al could inhibit significantly BC development by inhibiting pectin methylesterase activity in the root cap of cv. 2000-2 (Al-sensitive) and cv. Humai 16 (Al-tolerant), but 20 microM Al could not block BC development in cv. Humai 16. BCs and their mucigel of barley had a limited role in the protection of Al-induced inhibition of root elongation, but played a significant role in the prevention of Al from diffusing into the meristems of the root tip and the root cap. Together, these results suggested that BC development was a temperature-insensitive but Al-sensitive process, and that BCs and their mucigel played an important role in the protection of root tip and root cap meristems from Al toxicity. PMID:15215510

  12. Endogenous hormone levels affect the regeneration ability of callus derived from different organs in barley. (United States)

    Hisano, Hiroshi; Matsuura, Takakazu; Mori, Izumi C; Yamane, Miki; Sato, Kazuhiro


    Hordeum vulgare (barley) is an important agricultural crop worldwide. A simple and efficient transformation system is needed to analyze the functions of barley genes and generate lines with improved agronomic traits. Currently, Golden Promise and Igri are the most amenable barley cultivars for stable transformation. Here we evaluated the regeneration ratios and endogenous hormone levels of calli derived from various malting barley cultivars, including Golden Promise, Haruna Nijo, and Morex. We harvested samples not only from immature embryos, but also from different explants of juvenile plants, cotyledons, coleoptiles, and roots. The callus properties differed among genotypes and explant types. Calli derived from the immature embryos of Golden Promise, which showed the highest ratio of regeneration of green shoots, had the highest contents of indoleacetic acid, trans-zeatin, and cis-zeatin. By contrast, calli derived from the cotyledons of Morex and the immature embryos of Haruna Nijo had elevated levels of salicylic acid and abscisic acid, respectively. We thus propose that the former phytohormones are positively associated with the regeneration ability of callus but the later phytohormones are negatively associated. PMID:26735586

  13. Structure and function of the bacterial root microbiota in wild and domesticated barley. (United States)

    Bulgarelli, Davide; Garrido-Oter, Ruben; Münch, Philipp C; Weiman, Aaron; Dröge, Johannes; Pan, Yao; McHardy, Alice C; Schulze-Lefert, Paul


    The microbial communities inhabiting the root interior of healthy plants, as well as the rhizosphere, which consists of soil particles firmly attached to roots, engage in symbiotic associations with their host. To investigate the structural and functional diversification among these communities, we employed a combination of 16S rRNA gene profiling and shotgun metagenome analysis of the microbiota associated with wild and domesticated accessions of barley (Hordeum vulgare). Bacterial families Comamonadaceae, Flavobacteriaceae, and Rhizobiaceae dominate the barley root-enriched microbiota. Host genotype has a small, but significant, effect on the diversity of root-associated bacterial communities, possibly representing a footprint of barley domestication. Traits related to pathogenesis, secretion, phage interactions, and nutrient mobilization are enriched in the barley root-associated microbiota. Strikingly, protein families assigned to these same traits showed evidence of positive selection. Our results indicate that the combined action of microbe-microbe and host-microbe interactions drives microbiota differentiation at the root-soil interface. PMID:25732064

  14. Evidences for growth-promoting and fungicidal effects of low doses of tricyclazole in barley. (United States)

    Kumar, Manoj; Chand, Ramesh; Shah, Kavita


    The effect of increasing concentrations (5-100 mg L(-1)) of tricyclazole (TCZ), an important fungicide commonly used for control of spot blotch disease, was investigated for changes in physiological and biochemical parameters in 10 and 20-days-old barley plants (Hordeum vulgare L., cv. RD-2508). A 10 mg L(-1) dose of TCZ supplemented with nutrient solution in barley plants reflected a lowered infection with a significant increase in plant growth, plant biomass, leaf chlorophyll level, altered reactive oxygen species (ROS) formation and altered activity of key antioxidant enzymes viz. superoxide dismutase (SOD, EC:, catalase (CAT, EC:, ascorbate peroxidase (APX, EC: and guaiacol peroxidase (GPX, EC: To our knowledge this is the first report that provides evidence for TCZ to act both as a fungicide as well as to have plant growth-promoting activity. The study suggests that this dual property of tricyclazole has a potential for integration in disease management programs in barley. Application of low doses of TCZ can fit in well with environment friendly strategies for sustainable barley crop production, more yield and minimal soil contamination. PMID:26995312

  15. Phytoremediation of Petroleum-Contaminated Soils around Isfahan Oil Refinery (Iran by Sorghum and Barley

    Directory of Open Access Journals (Sweden)

    Farida Irajy Asiabadi


    Full Text Available Petroleum compounds are one of the most frequently encountered pollutants in soils adjacent to oil refineries. Phytoremediation,where feasible, has become a cost-effective alternative to physicochemical methods of soil remediation. In this study, sorghum (Sorghum bicolor and barley (Hordeum vulgare were selected for phytoremediationand the diminution in the concentration of oil-based contaminants was measured during a 90-day period. Contaminated and control treatments were compared in terms of root and shoot dry weight. Comparisons revealed reductions of about 22% and 30% in root dry matter and 51% and 42% in shoot dry matter of sorghum and barley in contaminated soil, respectively. The control and planted soils were significantly different in total and oil-degrading bacterial counts. Moreover, the concentration of total petroleum hydrocarbons decreased by 52%-64% in 90 days. Since planting the contaminated soil with sorghum and barley resulted in an improvement of 30% compared to unplanted contaminated soil, the two plants were highly efficient in removing petroleum from oil-contaminated soils. Therefore, despite the necessity of further studies to enhance the efficacy of phytoremediation by assessing the appropriateness of various plant species, some genotypes like sorghum and barley were found suitable choices for phytoremediation of the investigated petroleum-contaminated soil.

  16. Cloning and Characterization of Purple Acid Phosphatase Phytases from Wheat, Barley, Maize and Rice

    DEFF Research Database (Denmark)

    Dionisio, Giuseppe; Madsen, Claus Krogh; Holm, Preben Bach;


    is demonstrated that wheat, barley, maize, and rice all possess purple acid phosphatase (PAP) genes that, expressed in Pichia pastoris, give fully functional phytases (PAPhys) with very similar enzyme kinetics. Preformed wheat PAPhy was localized to the protein crystalloid of the aleurone vacuole......Barley (Hordeum vulgare) and wheat (Triticum aestivum) possess significant phytase activity in the mature grains. Maize (Zea mays) and rice (Oryza sativa) possess little or virtually no preformed phytase activity in the mature grain and depend fully on de novo synthesis during germination. Here, it....... Phylogenetic analyses indicated that PAPhys possess four conserved domains unique to the PAPhys. In barley and wheat, the PAPhy genes can be grouped as PAPhy_a or PAPhy_b isogenes (barley, HvPAPhy_a, HvPAPhy_b1, and HvPAPhy_b2; wheat, TaPAPhy_a1, TaPAPhy_a2, TaPAPhy_b1, and TaPAPhy_b2). In rice and maize, only...

  17. Submergence sensitivity of durum wheat, bread wheat and barley at the germination stage

    Directory of Open Access Journals (Sweden)

    Iduna Arduini


    Full Text Available Soil waterlogging at initial growth stages can cause heavy yield losses of winter cereals. Therefore, the screening for submergence tolerance traits in seeds of commercial varieties is of high concern worldwide. Ten Italian varieties of durum wheat (Triticum durum Desf., bread wheat (T. aestivum L. and barley (Hordeum vulgare L. were investigated for their ability to germinate in submerged conditions and to recover after submergence periods of three to 15 days. Submergence prevented germination and decreased germinability, at rates that increased with duration of submergence. Sensitivity ranked in the order: barley >durum wheat >bread wheat. We related the higher sensitivity of barley to its slower germination and slightly higher leakage of electrolytes, whereas the percentage of abnormal seedlings was lower than in other species. It was less than 4%, compared to less than 15 and 8% in durum wheat and bread wheat, respectively. Wide varietal differences were found in all species. According to variety, after 6-day submergence, germinability ranged from 2 to 42% in barley, from 5 to 80% in durum wheat, and from 30 to 77% in bread wheat. Varieties with more than 40% seed survival were three, six and seven per species, in the same order. The differential submergence sensitivity of varieties indicates a potential to select for waterlogging tolerance within Italian genotypes of winter cereal crops.

  18. Barley Leaf Area and Leaf Growth Rates Are Maximized during the Pre-Anthesis Phase

    Directory of Open Access Journals (Sweden)

    Ahmad M. Alqudah


    Full Text Available Leaf developmental traits are an important component of crop breeding in small-grain cereals. Surprisingly, little is known about the genetic basis for the differences in barley (Hordeum vulgare L. leaf development. The two barley row-type classes, i.e., two- and six-rowed, show clear-cut differences in leaf development. To quantify these differences and to measure the genetic component of the phenotypic variance for the leaf developmental differences in both row-type classes we investigated 32 representative spring barley accessions (14 two- and 18 six-rowed accessions under three independent growth conditions. Leaf mass area is lower in plants grown under greenhouse (GH conditions due to fewer, smaller, and lighter leaf blades per main culm compared to pot- and soil-grown field plants. Larger and heavier leaf blades of six-rowed barley correlate with higher main culm spike grain yield, spike dry weight, and harvest index; however, smaller leaf area (LA in two-rowed barley can be attributed to more spikes, tillers, and biological yield (aboveground parts. In general, leaf growth rate was significantly higher between awn primordium and tipping stages. Moderate to very high broad-sense heritabilities (0.67–0.90 were found under all growth conditions, indicating that these traits are predominantly genetically controlled. In addition, our data suggests that GH conditions are suitable for studying leaf developmental traits. Our results also demonstrated that LA impacts single plant yield and can be reconsidered in future breeding programs. Six-rowed spike 1 (Vrs1 is the major determinate of barley row-types, the differences in leaf development between two- and six-rowed barleys may be attributed to the regulation of Vrs1 in these two classes, which needs further testing.

  19. Density and relative frequency effects on competitive interactions and resource use in pea–barley intercrops

    DEFF Research Database (Denmark)

    Hauggaard-Nielsen, H.; Andersen, H.K.; Jørnsgaard, B.;


    . Intercropped pea did not increase its reliance on atmospheric nitrogen fixation compared to the pea sole crop. With respect to soil nitrogen uptake there were no effect of plant density but a strong effect of the relative frequency of pea in the intercrop, the greater the proportion the lower the uptake...... expected proportions sown; however, at high density the suppression of barley strongly increased the proportion of pea in the final grain yield. Weed infestation levels decreased as density was raised and the suppressing effect of density was clearly stronger the greater the frequency of pea in the crop...... competitiveness towards weeds or specific grain yield composition are wanted. Keywords: Competition dynamics; Grain quality; Hordeum vulgare; Intercropping; Nitrogen use; Organic farming; Pisum sativum; Weeds; Yield Abbreviations: IC, mixed intercropping; LER, land equivalent ratio; N, nitrogen; REIc, relative...

  20. Oxidation of proline decreases immunoreactivity and alters structure of barley prolamin. (United States)

    Huang, Xin; Sontag-Strohm, Tuula; Stoddard, Frederick L; Kato, Yoji


    Elimination of celiac-toxic prolamin peptides and proteins is essential for Triticeae products to be gluten-free. Instead of enzymatic hydrolysis, in this study we investigated metal-catalyzed oxidation of two model peptides, QQPFP, and PQPQLPY, together with a hordein isolate from barley (Hordeum vulgare L.). We established a multiple reaction monitoring (MRM) LC-MS method to detect and quantify proline oxidation fragments. In addition to fragmentation, aggregation and side chain modifications were identified, including free thiol loss, carbonyl formation, and dityrosine formation. The immunoreactivity of the oxidized hordein isolate was considerably decreased in all metal-catalyzed oxidation systems. Cleavage of peptides or protein fragments at the numerous proline residues partially accounts for the decrease. Metal-catalyzed oxidation can thus be used in the modification and elimination of celiac-toxic peptides and proteins. PMID:27507515

  1. Possible role for abscisic acid in regulation of photosynthetic and photorespiratory carbon metabolism in barley leaves

    International Nuclear Information System (INIS)

    The influence of abscisic acid (ABA) on carbon metabolism, rate of photorespiration, and the activity of the photorespiratory enzymes ribulose bisphosphate oxygenase and glycolate oxidase in 7-day-old barley seedlings (Hordeum vulgare L. var. Alfa) was investigated. Plants treated with ABA had enhanced incorporation of labeled carbon from 14CO2 into glycolic acid, glycine, and serine, while 14C incorporation into 3-phosphoglyceric acid and sugarphosphate esters was depressed. Parallel with this effect, treated plants showed a rise in activity of RuBP oxygenase and glycolic acid oxidase. The rate of photorespiration was increased twofold by ABA treatment at IO-6 molar while the CO2-compensation point increased 46% and stomatal resistance increased more than twofold over control plants

  2. Starch and Prolamin Level in Single and Double High-Lysine Barley Mutants

    DEFF Research Database (Denmark)

    Kreis, M.; Doll, Hans


    At maturity the high-lysine barley (Hordeum vulgare L.) Ris0 mutants 1508, 527 and 29 kernels contained about 20% less starch and twice as much free sugars as the parent varieties Bomi and Carlsberg II. An enhanched effect on starch reduction and free sugar accumulation was observed during kernel...... development when the single mutants 527 and 29 are combined with the mutant 1508. At maturity, kernels of the double mutants 527/1508 and 29/1508 contained, respectively, 68 and 43% less starch than Bomi. The double mutant 29/1508 kernel had a slightly lower prolamin content than mutant 1508 which is the most...... prolamin-deficient single mutant. In the double mutant 527/1508, however, an almost complete suppression of prolamin synthesis was observed during kernel development. The percentage of lysine in the seed proteins of the double mutants was about the same as in the most extreme single mutant 1508. Based on...

  3. Barley NARROW LEAFED DWARF1 encoding a WUSCHEL-RELATED HOMEOBOX 3 (WOX3) regulates the marginal development of lateral organs. (United States)

    Yoshikawa, Takanori; Tanaka, Shin-Ya; Masumoto, Yuuki; Nobori, Naoya; Ishii, Hiroto; Hibara, Ken-Ichiro; Itoh, Jun-Ichi; Tanisaka, Takatoshi; Taketa, Shin


    Barley (Hordeum vulgare L.) is the fourth most-produced cereal in the world and is mainly utilized as animal feed and malts. Recently barley attracts considerable attentions as healthy food rich in dietary fiber. However, limited knowledge is available about developmental aspects of barley leaves. In the present study, we investigated barley narrow leafed dwarf1 (nld1) mutants, which exhibit thin leaves accompanied by short stature. Detailed histological analysis revealed that leaf marginal tissues, such as sawtooth hairs and sclerenchymatous cells, were lacked in nld1, suggesting that narrowed leaf of nld1 was attributable to the defective development of the marginal regions in the leaves. The defective marginal developments were also appeared in internodes and glumes in spikelets. Map-based cloning revealed that NLD1 encodes a WUSCHEL-RELATED HOMEOBOX 3 (WOX3), an ortholog of the maize NARROW SHEATH genes. In situ hybridization showed that NLD1 transcripts were localized in the marginal edges of leaf primordia from the initiating stage. From these results, we concluded that NLD1 plays pivotal role in the increase of organ width and in the development of marginal tissues in lateral organs in barley. PMID:27436952

  4. Drivers of Phosphorus Uptake by Barley Following Secondary Resource Application (United States)

    Brod, Eva; Øgaard, Anne Falk; Krogstad, Tore; Haraldsen, Trond Knapp; Frossard, Emmanuel; Oberson, Astrid


    Minable rock phosphate is a finite resource. Replacing mineral phosphorus (P) fertilizer with P-rich secondary resources is one way to manage P more efficiently, but the importance of physicochemical and microbial soil processes induced by secondary resources for plant P uptake is still poorly understood. Using radioactive-labeling techniques, the fertilization effects of dairy manure, fish sludge, meat bone meal, and wood ash were studied as P uptake by barley after 44 days and compared with those of water-soluble mineral P (MinP) and an unfertilized control (NoP) in a pot experiment with an agricultural soil containing little available P at two soil pH levels, approximately pH 5.3 (unlimed soil) and pH 6.2 (limed soil). In a parallel incubation experiment, the effects of the secondary resources on physicochemical and microbial soil processes were studied. The results showed that the relative agronomic efficiency compared with MinP decreased in the order: manure ≥fish sludge ≥wood ash ≥meat bone meal. The solubility of inorganic P in secondary resources was the main driver for P uptake by barley (Hordeum vulgare). The effects of secondary resources on physicochemical and microbial soil processes were of little overall importance. Application of organic carbon with manure resulted in microbial P immobilization and decreased uptake by barley of P derived from the soil. On both soils, P uptake by barley was best explained by a positive linear relationship with the H2O + NaHCO3-soluble inorganic P fraction in fertilizers or by a linear negative relationship with the HCl-soluble inorganic P fraction in fertilizers. PMID:27243015

  5. Drivers of Phosphorus Uptake by Barley Following Secondary Resource Application. (United States)

    Brod, Eva; Øgaard, Anne Falk; Krogstad, Tore; Haraldsen, Trond Knapp; Frossard, Emmanuel; Oberson, Astrid


    Minable rock phosphate is a finite resource. Replacing mineral phosphorus (P) fertilizer with P-rich secondary resources is one way to manage P more efficiently, but the importance of physicochemical and microbial soil processes induced by secondary resources for plant P uptake is still poorly understood. Using radioactive-labeling techniques, the fertilization effects of dairy manure, fish sludge, meat bone meal, and wood ash were studied as P uptake by barley after 44 days and compared with those of water-soluble mineral P (MinP) and an unfertilized control (NoP) in a pot experiment with an agricultural soil containing little available P at two soil pH levels, approximately pH 5.3 (unlimed soil) and pH 6.2 (limed soil). In a parallel incubation experiment, the effects of the secondary resources on physicochemical and microbial soil processes were studied. The results showed that the relative agronomic efficiency compared with MinP decreased in the order: manure ≥fish sludge ≥wood ash ≥meat bone meal. The solubility of inorganic P in secondary resources was the main driver for P uptake by barley (Hordeum vulgare). The effects of secondary resources on physicochemical and microbial soil processes were of little overall importance. Application of organic carbon with manure resulted in microbial P immobilization and decreased uptake by barley of P derived from the soil. On both soils, P uptake by barley was best explained by a positive linear relationship with the H2O + NaHCO3-soluble inorganic P fraction in fertilizers or by a linear negative relationship with the HCl-soluble inorganic P fraction in fertilizers. PMID:27243015

  6. Drivers of phosphorus uptake by barley following secondary resource application

    Directory of Open Access Journals (Sweden)

    Eva eBrod


    Full Text Available Minable rock phosphate is a finite resource. Replacing mineral phosphorus (P fertilizer with P-rich secondary resources is one way to manage P more efficiently, but the importance of physicochemical and microbial soil processes induced by secondary resources for plant P uptake are still poorly understood. Using radioactive labelling techniques, the fertilization effects of dairy manure, fish sludge, meat bone meal and wood ash were studied as P uptake by barley after 44 days and compared with those of water-soluble mineral P (MinP and an unfertilized control (NoP in a pot experiment with an agricultural soil containing little available P at two soil pH levels, approximately pH 5.3 (unlimed soil and pH 6.2 (limed soil. In a parallel incubation experiment, the effects of the secondary resources on physicochemical and microbial soil processes were studied. The results showed that the relative agronomic efficiency compared with MinP decreased in the order: manure ≥ fish sludge ≥ wood ash ≥ meat bone meal. The solubility of inorganic P in secondary resources was the main driver for P uptake by barley (Hordeum vulgare. The effects of secondary resources on physicochemical and microbial soil processes were of little overall importance. Application of organic carbon with manure resulted in microbial P immobilisation and decreased uptake by barley of P derived from the soil. On both soils, P uptake by barley was best explained by a positive linear relationship with the H2O + NaHCO3-soluble inorganic P fraction in fertilizers, or by a linear negative relationship with the HCl-soluble inorganic P fraction in fertilizers.

  7. Transfer of radiocaesium to barley, rye grass and pea

    International Nuclear Information System (INIS)

    In areas with intensive farming, as in Denmark, it is of great interest to identify possible countermeasures to be taken in order to reduce the longterm effects of radioactive contamination of arable land. The most important longer-lived radionuclides from the Chernobyl were 137Cs and 134Cs. The aim of the present project was to identify crops with relatively low or high root uptake of these two isotopes. Although such differences may be small, a shift in varieties might be a cost-effective way to reduce collective doses. The experiment was carried out at Risoe National Laboratory in the summer of 1988. The species used were: spring barley (Hordeum vulgare L) varieties: Golf, Apex, Anker, Sila; Perennial rye grass (Lolium perenne L.) varieties: Darbo (early) and Patoro (late); Italian rye-grass (Lolium multiflorum) variety: Prego; and pea (Pisum arvense L.) variety: Bodil. Each crop was grown in two types of soil, a clay-loam and an organic soil. 137Cs was added to the clay-loam. The organic soil, which was contaminated with 137Cs from the Chernobyl accident, was supplied with 134Cs. Sila barley and Italian rye-grass were identified among the species tested as plants with a relative high uptake of radio-caesium. (author)

  8. Does boron affect hormone levels of barley cultivars?

    Directory of Open Access Journals (Sweden)

    Muavviz Ayvaz


    Full Text Available Background: When mineral nutrients are present in excess or in inadequate amounts, their effects can be severe in plants and can be considered as abiotic stress. In this study, we report how hormonal levels in barley cultivars respond to the toxic effect of boron, an essential plant micronutrient. Material and methods: Two different barley (Hordeum vulgare cultivars (Vamik Hoca and Efes 98 were used as a study material. Boron was applied in three different concentrations (0, 10, 20 ppm to plants that had grown from seeds for four weeks. Plants were harvested, stem-root length and stem-root dry-fresh weight content were determined. For further analysis, chlorophyll, total protein, endogenic IAA and ABA content analyses were carried out. Results: According to the data obtained, plant growth and development decreased with increasing boron concentrations. With increasing boron concentrations, soluble total protein increased in both cultivars. Boron application led to increased endogenic IAA content in both cultivars. 10 and 20 ppm boron application led to increased endogenic ABA content in Vamik Hoca cultivar whereas endogenic ABA content decreased in Efes 98. Absence of boron application led to increased endogenic IAA and ABA content in both cultivars. Conclusion: As a result, the response to boron is different in the two cultivars and Efes 98 may be more resistant to the toxicity than Vamik Hoca cultivar.


    Directory of Open Access Journals (Sweden)

    Marián Tomka


    Full Text Available Identification and characterization of genotypes is essential for improving the quality of cultivated varieties in breeding programs. Information about the origin of varieties can help farmers in selecting appropriate varieties to specific growing conditions or end use of crops. A set of ten microsatellite markers was used to describe genetic diversity in a sample of 30 barley (Hordeum vulgare L. genotypes. A total of 55 different alleles were amplified using ten SSR markers localized on chromosomes 1H, 2H, 3H, 5H, 6H, 7H with an average number of 5.5 alleles per locus. On the basis of allele frequencies we have calculated diversity index, polymorphic information content and index of probability, which have mean values of 0.664; 0.643 and 0.126 respectively. These values indicate high differentiation ability of SSR markers. In the created dendrogram using hierarchical cluster analysis using UPGMA algorithm we were able to differentiate all 30 barley genotypes. The results show that DNA markers are suitable for the identification and differentiation of genotypes and indicated the effectiveness of microsatellite markers to describe genetic diversity.

  10. High-moisture air-tight storage of barley and wheat improves nutrient digestibility. (United States)

    Poulsen, H D; Blaabjerg, K; Nørgaard, J V; Ton Nu, M A


    Barley (Hordeum vulgare) and wheat (Triticum aestivum) are often stored dry with 14% or less moisture, which during rainy periods may require that grains are dried after harvest. The hypothesis is that air-tight storage of high-moisture barley and wheat will increase nutrient digestibility due to chemical conversions prior to feeding. The objective was to evaluate the effect of high moisture compared to dry storage of barley and wheat on digestibility of P and CP. The crops were grown on 1 field keeping other factors constant. Half of the grains was harvested in the morning after a rainy day and stored in air-tight silos (DM, %: barley, 85.2; wheat, 82.8) and the other half was harvested later the same day (windy and sunny) and stored dry (DM, %: barley, 89.8; wheat, 88.3). After 6 mo of storage, 1 low- and 1 high-moisture diet were prepared with a barley:wheat ratio of 1:1 mixed with soybean (Glycine max) meal and rapeseed cake to produce a compound diet without inorganic P and microbial phytase. Sixteen 45-kg pigs housed in metabolism crates were fed either the low- or the high-moisture diet for 5 d for adaptation and 7 d for total collection of feces. Digestibility of P was 12% higher (P pigs. Therefore, high-moisture air-tight storage saved energy (without drying) and at the same time enhanced P digestibility and increased the nutritional value of grain probably through enzymatic activity during storage. PMID:23365343

  11. The Genetic Architecture of Barley Plant Stature. (United States)

    Alqudah, Ahmad M; Koppolu, Ravi; Wolde, Gizaw M; Graner, Andreas; Schnurbusch, Thorsten


    Plant stature in temperate cereals is predominantly controlled by tillering and plant height as complex agronomic traits, representing important determinants of grain yield. This study was designed to reveal the genetic basis of tillering at five developmental stages and plant height at harvest in 218 worldwide spring barley (Hordeum vulgare L.) accessions under greenhouse conditions. The accessions were structured based on row-type classes [two- vs. six-rowed] and photoperiod response [photoperiod-sensitive (Ppd-H1) vs. reduced photoperiod sensitivity (ppd-H1)]. Phenotypic analyses of both factors revealed profound between group effects on tiller development. To further verify the row-type effect on the studied traits, Six-rowed spike 1 (vrs1) mutants and their two-rowed progenitors were examined for tiller number per plant and plant height. Here, wild-type (Vrs1) plants were significantly taller and had more tillers than mutants suggesting a negative pleiotropic effect of this row-type locus on both traits. Our genome-wide association scans further revealed highly significant associations, thereby establishing a link between the genetic control of row-type, heading time, tillering, and plant height. We further show that associations for tillering and plant height are co-localized with chromosomal segments harboring known plant stature-related phytohormone and sugar-related genes. This work demonstrates the feasibility of the GWAS approach for identifying putative candidate genes for improving plant architecture. PMID:27446200

  12. Effect of nitrogen nutrition on endosperm protein synthesis in wild and cultivated barley grown in spike culture

    International Nuclear Information System (INIS)

    In normal growth conditions, total protein percent, in the endosperm at maturity in barley cultivar Hordeum vulgare L. cv Ruth was about 14%, whereas in an accession of wild barley, Hordeum spontaneum Koch line 297, it was about 28%. Spike culture experiments were conducted to ascertain whether there were basic differences between the two genotypes under conditions of widely different nitrogen supply. Spikes of each genotype were grown from 8 to 25 days after flowering in in vitro culture in a growth medium containing 0 to 4 grams per liter nitrogen supplied as NH4NO3. Spikes were pulse-labeled at intervals from 12 to 24 days after flowering with 3.7 megabecquerel of [3H]leucine to determine relative rates of synthesis of hordein-1 and hordein-2 polypedtides. At low nitrogen levels Ruth had a lower protein content than 297, but at increasing nitrogen levels its protein content increased rapidly and reached a maximum (35%) higher than 297 (30%). The relative contribution of the hordein fraction to total protein increased mainly with time, and hordein-1 to total hordein increased mainly with nitrogen level, in both genotypes. There appeared to be no fundamental limitations in the capacity of Ruth to accumulate protein: 297 appears to have a greater basal level of nitrogen availability under normal conditions

  13. Transcriptome Analysis of High-Temperature Stress in Developing Barley Caryopses :Early Stress Responses and Effects on Storage Compound Biosynthesis

    Institute of Scientific and Technical Information of China (English)

    Elke Mangelsen; Joachim Kilian; Klaus Harter; Christer Jansson; Dierk Wanke; Eva Sundberg


    High-temperature stress,like any abiotic stress,impairs the physiology and development of plants,including the stages of seed setting and ripening.We used the Aflymetrix 22K Barley1 GeneChip microarray to investigate the response of developing barley(Hordeum vulgare)seeds,termed caryopses,after 0.5,3,and 6 h of heat stress exposure;958 induced and 1122 repressed genes exhibited spatial and temporal expression patterns that provide a detailed insight into the caryopses'early heat stress responses.Down-regulation of genes related to storage compound biosynthesis and cell growth provides evidence for a rapid impairment of the caryopsis' development.Increased levels of sugars and amino acids were indicative for both production of compatible solutes and feedback-induced accumulation of substrates for storage compound biosynthesis.Metadata analysis identified embryo and endosperm as primary locations of heat stress responses,indicating a strong impact of short-term heat stress on central developmental functions of the caryopsis.A comparison with heat stress responses in Arabidopsis shoots and drought stress responses in barley caryopses identified both conserved and presumably heat-and caryopsis-specific stress-responsive genes.Summarized,our data provide an important basis for further investigation of gene functions in order to aid an improved heat tolerance and reduced losses of yield in barley as a model for cereal crops.

  14. Investigation of the somaclonal and mutagen induced variability in barley by the application of protein and DNA markers

    International Nuclear Information System (INIS)

    Barley, Hordeum vulgare L., is one of the most important crop species for Bulgaria. The characterisation of the genetic pool is of great necessity for the Bulgarian barley breeding programme which is directed toward improving quantitative and qualitative traits. Molecular markers [protein, restriction fragment length polymorphisms (RFLP) and randomly amplified polymorphic DNA (RAPD)] have been applied to characterise the Bulgarian barley cultivars and their regenerants. The changes in DNA loci coding for 26S, 5.8S and 18S rRNA repeats, C hordein locus and mitochondrial DNA organisation have been investigated. The potential for ribosomal DNA length polymorphism in Bulgarian barley cultivars appear to be limited to three different repeat lengths (10.2, 9.5 and 9.0kb) and three plant rDNA phenotypes. Polymorphism was not observed in ribosomal DNA repeat units in somaclonal variants. Variation concerning C hordein electrophoretic pattern was observed in one line from cultivar Jubiley. Analysis of the HorI locus reveals RFLPs in sequences coding for C hordeins in this line. Mitochondrial molecular markers are convenient for detection of DNA polymorphisms in the variant germplasm as well as for the somaclonal variants derived from it. Two lines from Ruen revealed polymorphic bands after hybridisation with mitochondrial DNA probe. RAPD assays have been carried out by using 20 different 10-mer primers. Heritable polymorphism in several tissue culture derived (TCD) lines was observed. RAPD assay is a sensitive and representative approach to distinguish the variability created by tissue culture and mutagenesis

  15. Dwarf and semi-dwarf barley mutants in cross-breeding

    International Nuclear Information System (INIS)

    Barley (Hordeum vulgare L.) is an important stress tolerant rabi cereal. It is consumed as food and as animal feed, and is used in the malt industry in India. The local genotypes are prone to lodging and low yields. Mutation breeding work, using physical mutagens, was initiated at the Agricultural Research Station, Durgapura, Jaipur, to evolve non-lodging, dwarf and high yielding genotypes suitable for direct and indirect utilization. Subsequently, a suitable dwarf cultivar, RDB-1, was developed by irradiating a tall local cultivar, RS-17, with 4.5 x 1012n/cm2. Later, other genotypes, e.g. Azam dwarf-1 and Azam dwarf-13, were also identified as spontaneous mutants. These three mutants were used extensively and successfully in the barley cross-breeding programme in India for developing dwarf genotypes that are non-lodging, have a high yield, and are hulled and hull-less. So far, 15 promising cultivars have been identified by scientific evaluation committees for cultivation in varied agroclimatic farming environments. These new genotypes have increased the per unit production of barley in India. (author). 6 refs, 1 tab

  16. A role for barley CRYPTOCHROME1 in light regulation of grain dormancy and germination. (United States)

    Barrero, Jose M; Downie, A Bruce; Xu, Qian; Gubler, Frank


    It is well known that abscisic acid (ABA) plays a central role in the regulation of seed dormancy and that transcriptional regulation of genes encoding ABA biosynthetic and degradation enzymes is responsible for determining ABA content. However, little is known about the upstream signaling pathways impinging on transcription to ultimately regulate ABA content or how environmental signals (e.g., light and cold) might direct such expression in grains. Our previous studies indicated that light is a key environmental signal inhibiting germination in dormant grains of barley (Hordeum vulgare), wheat (Triticum aestivum), and Brachypodium distachyon and that this effect attenuates as after-ripening progresses further. We found that the blue component of the light spectrum inhibits completion of germination in barley by inducing the expression of the ABA biosynthetic gene 9-cis-epoxycarotenoid dioxygenase and dampening expression of ABA 8'-hydroxylase, thus increasing ABA content in the grain. We have now created barley transgenic lines downregulating the genes encoding the blue light receptors CRYTOCHROME (CRY1) and CRY2. Our results demonstrate that CRY1 is the key receptor perceiving and transducing the blue light signal in dormant grains. PMID:24642944

  17. The gene Sr33, an ortholog of barley Mla genes, encodes resistance to wheat stem rust race Ug99. (United States)

    Periyannan, Sambasivam; Moore, John; Ayliffe, Michael; Bansal, Urmil; Wang, Xiaojing; Huang, Li; Deal, Karin; Luo, Mingcheng; Kong, Xiuying; Bariana, Harbans; Mago, Rohit; McIntosh, Robert; Dodds, Peter; Dvorak, Jan; Lagudah, Evans


    Wheat stem rust, caused by the fungus Puccinia graminis f. sp. tritici, afflicts bread wheat (Triticum aestivum). New virulent races collectively referred to as "Ug99" have emerged, which threaten global wheat production. The wheat gene Sr33, introgressed from the wild relative Aegilops tauschii into bread wheat, confers resistance to diverse stem rust races, including the Ug99 race group. We cloned Sr33, which encodes a coiled-coil, nucleotide-binding, leucine-rich repeat protein. Sr33 is orthologous to the barley (Hordeum vulgare) Mla mildew resistance genes that confer resistance to Blumeria graminis f. sp. hordei. The wheat Sr33 gene functions independently of RAR1, SGT1, and HSP90 chaperones. Haplotype analysis from diverse collections of Ae. tauschii placed the origin of Sr33 resistance near the southern coast of the Caspian Sea. PMID:23811228

  18. Effect of DTPA on concentration ratios of 237Np and 244Cm in vegetative parts of bush bean and barley

    International Nuclear Information System (INIS)

    Bush beans (Phaseolus vulgaris L.) and barley (Hordeum vulgare L.) were grown in two different soils (noncalcareous and calcareous) in containers in a glasshouse with 530 pCi/g 237Np or 15040 pCi/g 244Cm mixed into separate containers of the soil. The chelating agent DTPA at 100 μg/g soil was added to one half of the containers. The concentration ratio (C.R.) without DTPA was two orders of magnitude higher for 237Np than for 244Cm by two and three orders of magnitude but had little influence on 237Np. For the calcareous soil with DTPA, 244Cm C.R.'s were greater than those for 237Np. In bush beans both 237Np and 244Cm C.R.'s were higher in primary leaves than in trifoliate leaves which were higher than for stems

  19. Complex interplay of future climate levels of CO2, ozone and temperature on susceptibility to fungal diseases in barley

    DEFF Research Database (Denmark)

    Mikkelsen, Bolette Lind; Bagger Jørgensen, Rikke; Lyngkjær, Michael Foged


    Barley (Hordeum vulgare) was grown in different climatic environments with elevated [CO2] (700 vs 385 ppm), [O3] (60/90 vs 20 ppb) and temperature (24/19 vs 19/12°C day/night) as single factors and in combinations, to evaluate the impact of these climatic factors on photosynthesis and susceptibil...... disease decreased despite the individual promoting effect of temperature and ozone, emphasizing the importance of conducting multifactorial experiments when evaluating the potential effects of climate change.......-secreting hemibiotrophic spot blotch fungus increased compared to ambient conditions, implying that climate-induced changes in disease severity could be linked to the trophic lifestyle of the pathogens. Elevated [CO2] decreased powdery mildew infection but had no effect on spot blotch disease compared to ambient condition...

  20. Differential gene expression for suicide-substrate serine proteinase inhibitors (serpins) in vegetative and grain tissues of barley

    DEFF Research Database (Denmark)

    Roberts, T.H.; Marttila, S.; Rasmussen, S.K.; Hejgaard, Jørn


    and vascular tissues of roots, and to the phloem of coleoptiles and leaves. The identification of BSZ4 in vegetative tissues by western blotting was confirmed for the roots by purification and amino acid sequencing, and for the leaves by in vitro reactive-centre loop cleavage studies. Plant serpins...... plant serpins are unknown. Expression studies of genes encoding members of three subfamilies of serpins (BSZx, BSZ4 and BSZ7) in developing grain and vegetative tissues of barley (Hordeum vulgare L.) showed that transcripts encoding BSZx, which inhibits distinct proteinases at overlapping reactive...... centres in vitro, were ubiquitous at low levels, but the protein could not be detected. EST analysis showed that expression of genes for serpins with BSZx-type reactive centres in vegetative tissues is widespread in the plant kingdom, suggesting a common regulatory function. For BSZ4 and BSZ7, expression...

  1. The differential loading of two barley CENH3 variants into distinct centromeric substructures is cell type- and development-specific. (United States)

    Ishii, Takayoshi; Karimi-Ashtiyani, Raheleh; Banaei-Moghaddam, Ali Mohammad; Schubert, Veit; Fuchs, Jörg; Houben, Andreas


    The organization of centromeric chromatin of diploid barley (Hordeum vulgare) encoding two (α and β) CENH3 variants was analysed by super-resolution microscopy. Antibody staining revealed that both CENH3 variants are organized in distinct but intermingled subdomains in interphase, mitotic and meiotic centromeres. Artificially extended chromatin fibres illustrate that these subdomains are formed by polynucleosome clusters. Thus, a CENH3 variant-specific loading followed by the arrangement into specific intermingling subdomains forming the centromere region appears. The CENH3 composition and transcription vary among different tissues. In young embryos, most interphase centromeres are composed of both CENH3 variants, while in meristematic root cells, a high number of nuclei contain βCENH3 mainly dispersed within the nucleoplasm. A similar distribution and no preferential arrangement of the two CENH3 variants in relationship to the spindle poles suggest that both homologs meet the same function in metaphase cells. PMID:25688006

  2. Protein quality in cereals and pulses. 1. Application of microbiological and other in vitro methods in the evaluation of rice (Oryza sativa L.), sorghum (Sorghum vulgare Pers.), barley and field beans (Vicia faba L.). (United States)

    Ford, J E; Hewitt, D


    1. The Streptococcus zymogenes assay procedure was modified and used in the estimation of available methionine and relative nutritional value in rice (Oryza sativa L.), sorghum (Sorghum vulgare Pers.), barley and field beans (Vicia faba L.). The results were assessed in relation to the content of tannins and 'dye-binding lysine', and to published information on the nutritional quality of some of the test samples. 2. In grain of ten varieties of sorghum, for which other workers had reported a correlation (r -0.82; P less than 0.01) between tannin content and amino acid digestibility in chicks, the available methionine content ranged from 6.3 to 17.7 g/kg protein (nitrogen x 6.25) and was highly correlated with tannin content (r -0.97; P less than 0.001). The content of total methionine and dye-binding lysine varied little between varieties and was not related to tannin content. 3. In nine samples of rice the availability of methionine was uniformly high, in accordance with literature values for true digestibility of the N. 4. In field beans the presence of tammins in the seed coat was associated with a significant (P less than 0.001) reduction in the availability of methionine. In eleven tannin-free varieties the coefficient of availability averaged 0.791, compared with 0.685 in eleven tannin-containing varieties. The standard deviation associated with both values was 0.04. There was no such difference between the corresponding dye-binding lysine values. 5. Thirty-three samples of barley were examined, representing fourteen varieties, four of which had been grown at several widely different latitudes in England and Sweden. There was little difference in methionine content between samples. The average availability coefficient for eighteen samples grown in England was 0.995+/-0.044, and for fifteen varieties grown in Sweden it was 0.851+/-0.042. The difference was not associated with any difference in tannin content, which was uniformly low. The findings contradict

  3. Genetic diversity and geographical differentiation of cultivated six-rowed naked barley landraces from the Qinghai-Tibet plateau of China detected by SSR analysis

    Directory of Open Access Journals (Sweden)

    Zong-Yun Feng


    Full Text Available Cultivated six-rowed naked barley (Hordeum vulgare ssp. hexastichon var. nudum Hsü is the oldest cultivated barley in China. We used 35 simple sequence repeat (SSR markers selected from seven barley linkage groups to study the genetic diversity, geographical differentiation and evolutionary relationships among 65 H. vulgare ssp. hexastichon landrace accessions collected from the Qinghai-Tibet plateau of China, 25 accessions from Tibet (TB, 20 from Qinghai (QH and 20 from Ganzi (GZ prefecture in Sichuan province. At the 35 SSR loci we identified 248 alleles among the 65 accessions, 119 (47.98% of the alleles being common alleles. We also found that the TB accessions possessed 47 private alleles, about 1.5 times more than the 31 private alleles found in the QH accessions and about 5 times more than 9 private alleles found in the GZ accessions. Generally, the TB accessions showed significantly higher genetic diversity than either the QH or GZ accessions whereas no significant difference in genetic diversity was found between the QH and GZ accessions. Partitioning analysis of genetic diversity showed that about 81% of the total variation was due to within-subgroup diversity and about 19% was clearly accounted for by geographical differentiation among the three subgroups. The distributions of alleles for most loci (71.4% were significantly different among the three subgroups and geographical differentiation could be found according to the distribution of SSR alleles. Cluster analysis indicated that most of the accessions could be clustered into groups which basically coincided with their geographical distribution. These results suggest that Tibet might be a center of genetic diversity for cultivated barley, the cultivated six-rowed naked barley on the Qinghai-Tibet plateau of China may have evolved in Tibet and spread to Qinghai and then to Ganzi prefecture of Sichuan province.

  4. The Genetic Basis of Composite Spike Form in Barley and 'Miracle-Wheat'. (United States)

    Poursarebani, Naser; Seidensticker, Tina; Koppolu, Ravi; Trautewig, Corinna; Gawroński, Piotr; Bini, Federica; Govind, Geetha; Rutten, Twan; Sakuma, Shun; Tagiri, Akemi; Wolde, Gizaw M; Youssef, Helmy M; Battal, Abdulhamit; Ciannamea, Stefano; Fusca, Tiziana; Nussbaumer, Thomas; Pozzi, Carlo; Börner, Andreas; Lundqvist, Udda; Komatsuda, Takao; Salvi, Silvio; Tuberosa, Roberto; Uauy, Cristobal; Sreenivasulu, Nese; Rossini, Laura; Schnurbusch, Thorsten


    Inflorescences of the tribe Triticeae, which includes wheat (Triticum sp. L.) and barley (Hordeum vulgare L.) are characterized by sessile spikelets directly borne on the main axis, thus forming a branchless spike. 'Compositum-Barley' and tetraploid 'Miracle-Wheat' (T. turgidum convar. compositum (L.f.) Filat.) display noncanonical spike-branching in which spikelets are replaced by lateral branch-like structures resembling small-sized secondary spikes. As a result of this branch formation 'Miracle-Wheat' produces significantly more grains per spike, leading to higher spike yield. In this study, we first isolated the gene underlying spike-branching in 'Compositum-Barley,' i.e., compositum 2 (com2). Moreover, we found that COM2 is orthologous to the branched head(t) (bh(t)) locus regulating spike branching in tetraploid 'Miracle-Wheat.' Both genes possess orthologs with similar functions in maize BRANCHED SILKLESS 1 (BD1) and rice FRIZZY PANICLE/BRANCHED FLORETLESS 1 (FZP/BFL1) encoding AP2/ERF transcription factors. Sequence analysis of the bh(t) locus in a collection of mutant and wild-type tetraploid wheat accessions revealed that a single amino acid substitution in the DNA-binding domain gave rise to the domestication of 'Miracle-Wheat.' mRNA in situ hybridization, microarray experiments, and independent qRT-PCR validation analyses revealed that the branch repression pathway in barley is governed through the spike architecture gene Six-rowed spike 4 regulating COM2 expression, while HvIDS1 (barley ortholog of maize INDETERMINATE SPIKELET 1) is a putative downstream target of COM2. These findings presented here provide new insights into the genetic basis of spike architecture in Triticeae, and have disclosed new targets for genetic manipulations aiming at boosting wheat's yield potential. PMID:26156223

  5. The miR9863 family regulates distinct Mla alleles in barley to attenuate NLR receptor-triggered disease resistance and cell-death signaling.

    Directory of Open Access Journals (Sweden)

    Jie Liu


    Full Text Available Barley (Hordeum vulgare L. Mla alleles encode coiled-coil (CC, nucleotide binding, leucine-rich repeat (NB-LRR receptors that trigger isolate-specific immune responses against the powdery mildew fungus, Blumeria graminis f. sp. hordei (Bgh. How Mla or NB-LRR genes in grass species are regulated at post-transcriptional level is not clear. The microRNA family, miR9863, comprises four members that differentially regulate distinct Mla alleles in barley. We show that miR9863 members guide the cleavage of Mla1 transcripts in barley, and block or reduce the accumulation of MLA1 protein in the heterologous Nicotiana benthamiana expression system. Regulation specificity is determined by variation in a unique single-nucleotide-polymorphism (SNP in mature miR9863 family members and two SNPs in the Mla miR9863-binding site that separates these alleles into three groups. Further, we demonstrate that 22-nt miR9863s trigger the biogenesis of 21-nt phased siRNAs (phasiRNAs and together these sRNAs form a feed-forward regulation network for repressing the expression of group I Mla alleles. Overexpression of miR9863 members specifically attenuates MLA1, but not MLA10-triggered disease resistance and cell-death signaling. We propose a key role of the miR9863 family in dampening immune response signaling triggered by a group of MLA immune receptors in barley.

  6. Temporal and spatial distribution of roots and competition for nitrogen in pea-barley intercrops - a field study employing P-32 technique

    DEFF Research Database (Denmark)

    Hauggaard-Nielsen, H.; Ambus, P.; Jensen, E.S.


    was the dominant component of the pea-barley intercrop, obtaining 90% of its sole crop yield, while pea produced only 15% of the grains of a sole crop pea. Intercropping of pea and barley improved the utilization of plant growth resources (LER > 1) as compared to sole crops. Root system distribution......Root system dynamics, productivity and N use were studied in inter- and sole crops of field pea (Pisum sativum L.) and spring barley (Hordeum vulgare L.) on a temperate sandy loam. A P-32 tracer placed at a depth of 12.5, 37.5, 62.5 or 87.5 cm was employed to determine root system dynamics by...... sampling crop leaves at 0, 15, 30 and 45 cm lateral distance. N-15 addition was used to estimate N-2 fixation by pea, using sole cropped barley as reference crop. The Land Equivalent Ratio (LER), which is defined as the relative land area under sole crops that is required to produce the yields achieved in...

  7. Genetic Diversity Analysis of Tibetan Wild Barley Using SSR Markers%应用微卫星标记研究西藏野生大麦的遗传多样性

    Institute of Scientific and Technical Information of China (English)

    冯宗云; 刘仙俊; 张义正; 凌宏清


    以西藏不同地区的106份野生大麦为材料,其中包括50份野生二棱大麦(HS),27份野生瓶形大麦(HL)和29份野生六棱大麦(HA),用Liu等(1996)发表的SSR连锁图的每个连锁群的两个臂的不同位置上选取3~5个共30个SSR标记,研究了西藏3类野生大麦的遗传多样性.结果表明,这3类野生大麦在遗传组成及等位变异频率分布上存在着明显的遗传分化.在总样本中,共检测到229个等位变异,平均每个SSR位点检测到7.6个等位变异,其中70个为这3类野生大麦间共同的等位变异,等位变异数在这3类野生大麦间有明显的差异,亚种间的遗传多样性明显高于亚种内的遗传多样性.其遗传多样性大小顺序为HS>HL>HA.聚类分析表明,野生二棱大麦、野生六棱大麦分别聚在不同的两类,而野生瓶形大麦中各有约50%的材料分别聚在这两类.根据本研究及前人研究结果,我们认为中国栽培大麦是从野生二棱大麦经野生瓶形大麦向野生六棱大麦进化的.该结果支持了栽培大麦起源的"野生二棱大麦单系起源论"的观点.%One hundred and six accessions of wild barley collected from Tibet, China, including 50 entries of the two-rowed wild barley Hordeum vulgare ssp. spontaneum (HS), 29 entries of the six-rowed wild barley Hordeum vulgare ssp. agriocrithon (HA),and 27 entries of the six-rowed wild barley Hordeum vulgare ssp. agriocrithon var. lagunculiforme (HL), were analyzed using 30 SSR markers selected from the seven barley linkage groups for studying genetic diversity and evolutionary relationship of the three subspecies of Tibetan wild barley to cultivated barley in China. Over the 30 genetic loci that were studied, 229 alleles were identified among the 106 accessions, of which 70 were common alleles. H. vulgare ssp. spontaneum possesses about thrice more private alleles (2.83 alleles/locus) than HS (0.93 alleles/locus), whereas almost no private alleles were detected

  8. Cytological study of Hordeum bulbosum L. in Iran


    Hamed Khodayari; Hojjatolah Saeidi


    Hordeum bulbosum L. (Poaceae) is considered to be sources of useful alleles which can be used in cereal improvement. Thirty two native Iranian H. bulbosum were collected from different localities and were studied by karyotype analysis. We assessed the karyotype asymmetry of the Iranian bulbous barley populations and analyzed the data to look for their geographic distribution correlations. All of the studied populations were tetraploid (2n=4x=28) and the analysed parameters of karyotype of H. ...

  9. Quantitative analysis of total amino acid in barley leaves under herbicide stress using spectroscopic technology and chemometrics. (United States)

    Bao, Yidan; Kong, Wenwen; He, Yong; Liu, Fei; Tian, Tian; Zhou, Weijun


    Visible and near infrared (Vis/NIR) spectroscopy were employed for the fast and nondestructive estimation of the total amino acid (TAA) content in barley (Hordeum vulgare L.) leaves. The calibration set was composed of 50 samples; and the remaining 25 samples were used for the validation set. Seven different spectral preprocessing methods and six different calibration methods (linear and nonlinear) were applied for a comprehensive prediction performance comparison. Successive projections algorithm (SPA) and regression coefficients (RC) were applied to select effective wavelengths (EWs). The results indicated that the latent variables-least-squares-support vector machine (LV-LS-SVM) model achieved the optimal performance. The prediction results by LV-LS-SVM with raw spectra were achieved with a correlation coefficients (r) = 0.937 and root mean squares error of prediction (RMSEP) = 0.530. The overall results showed that the NIR spectroscopy could be used for determination of TAA content in barley leaves with an excellent prediction precision; and the results were also helpful for on-field monitoring of barley growing status under herbicide stress during different growth stages. PMID:23202000

  10. Quantitative Analysis of Total Amino Acid in Barley Leaves under Herbicide Stress Using Spectroscopic Technology and Chemometrics

    Directory of Open Access Journals (Sweden)

    Weijun Zhou


    Full Text Available Visible and near infrared (Vis/NIR spectroscopy were employed for the fast and nondestructive estimation of the total amino acid (TAA content in barley (Hordeum vulgare L. leaves. The calibration set was composed of 50 samples; and the remaining 25 samples were used for the validation set. Seven different spectral preprocessing methods and six different calibration methods (linear and nonlinear were applied for a comprehensive prediction performance comparison. Successive projections algorithm (SPA and regression coefficients (RC were applied to select effective wavelengths (EWs. The results indicated that the latent variables-least-squares-support vector machine (LV-LS-SVM model achieved the optimal performance. The prediction results by LV-LS-SVM with raw spectra were achieved with a correlation coefficients (r = 0.937 and root mean squares error of prediction (RMSEP = 0.530. The overall results showed that the NIR spectroscopy could be used for determination of TAA content in barley leaves with an excellent prediction precision; and the results were also helpful for on-field monitoring of barley growing status under herbicide stress during different growth stages.

  11. Transfer of N and P from intact or decomposing roots of pea to barley interconnected by an arbuscular mycorrhizal fungus

    DEFF Research Database (Denmark)

    Johansen, A.; Jensen, E.S.


    of growth. In half of the containers, the donor-plant shoot was removed 42 d after the start of labelling and the roots were left in the soil to decompose. The reverse transfer of N and P, from barley donor to pea receiver plants was also measured to allow calculation of the net transfer through......The role of arbuscular mycorrhizas in the transfer of N and P between pea (Pisum sativum L.) and barley (Hordeum vulgare L.) plants was studied in a controlled environment. The plants were grown together in PVC containers, either in symbiosis with Glomus intraradices Schenck and Smith or as non......-mycorrhizal controls, and with their root systems separated by an intermediate buffer zone (2 cm), confined by fine nylon mesh. The pea donor plants were supplied simultaneously with N-15 and P-32, using a split-root labelling technique, in order to follow the flow of N and P to the barley receiver plants during 60 d...

  12. Isolation and purification of a papain inhibitor from Egyptian genotypes of barley seeds and its in vitro and in vivo effects on the cowpea bruchid, Callosobruchus maculatus (F.). (United States)

    Abd El-Latif, Ashraf Oukasha


    The cysteine inhibitors that are known as cystatin have been identified and characterized from several plant species. In the current study, 44 barley (Hordeum vulgare) genotypes including 3 varieties and 41 promising lines were screened for their potential as protease inhibitors. The barley genotypes showed low inhibitory activity against trypsin and chymotrypsin enzymes with a mean of 4.15 TIU/mg protein and 4.40 CIU/mg protein. The barley variety, Giza 123, showed strong papain inhibitory activity of 97.09 PIU/mg proteins and was subjected for further purification studies using ammonium sulfate fractionation and DEAE-Sephadex A-25 column. Barley purified proteins showed two bands on SDS-PAGE corresponding to a molecular mass of 12.4-54.8 kDa. The purified barley PI was found to be stable at a temperature below 80 °C and at a wide range of pH from 2 to 12. Barley PI was found to have higher potential inhibitory activity against papain enzyme compared to the standard papain inhibitor, E-64 with an IC50 value of 21.04 µg/ml and 25.62 µg/ml for barley PI and E-64, respectively. The kinetic analysis revealed a non-competitive type of inhibition with a Ki value of 1.95 × 10(-3 )µM. The antimetabolic effect of barley PI was evaluated against C. maculatus by incorporating the F30-60 protein of the purified inhibitor into the artificial diet using artificial seeds. Barley PI significantly prolonged the development of C. maculatus in proportion to PI concentration. Barley PI significantly increased the mortality of C. maculatus and caused a significant reduction in its fecundity. On the other hand, barley PI seemed to have non-significant effects on the adult longevity and the adult dry weight. The in vitro and in vivo results proved the efficiency of the papain inhibitory protein isolated from barley as a tool for managing the cowpea bruchid, C. maculatus. PMID:25752426

  13. Cell layer-specific distribution of transiently expressed barley ESCRT-III component HvVPS60 in developing barley endosperm. (United States)

    Hilscher, Julia; Kapusi, Eszter; Stoger, Eva; Ibl, Verena


    The significance of the endosomal sorting complexes required for transport (ESCRT)-III in cereal endosperm has been shown by the identification of the recessive mutant supernumerary aleurone layer1 (SAL1) in maize. ESCRT-III is indispensable in the final membrane fission step during biogenesis of multivesicular bodies (MVBs), responsible for protein sorting to vacuoles and to the cell surface. Here, we annotated barley ESCRT-III members in the (model) crop Hordeum vulgare and show that all identified members are expressed in developing barley endosperm. We used fluorescently tagged core ESCRT-III members HvSNF7a/CHMP4 and HvVPS24/CHMP3 and the associated ESCRT-III component HvVPS60a/CHMP5 for transient localization studies in barley endosperm. In vivo confocal microscopic analyses show that the localization of recombinantly expressed HvSNF7a, HvVPS24 and HvVPS60a differs within barley endosperm. Whereas HvSNF7a induces large agglomerations, HvVPS24 shows mainly cytosolic localization in aleurone and subaleurone. In contrast, HvVPS60a localizes strongly at the plasma membrane in aleurone. In subaleurone, HvVPS60a was found to a lesser extent at the plasma membrane and at vacuolar membranes. These results indicate that the steady-state association of ESCRT-III may be influenced by cell layer-specific protein deposition or trafficking and remodelling of the endomembrane system in endosperm. We show that sorting of an artificially mono-ubiquitinated Arabidopsis plasma membrane protein is inhibited by HvVPS60a in aleurone. The involvement of HvVPS60a in different cell layer-specific trafficking pathways, reflected by localization of HvVPS60a at the plasma membrane in aleurone and at the PSV membrane in subaleurone, is discussed. PMID:25796522

  14. Effect of microbial phytase on phosphorus digestibility in non-heat-treated and heat-treated wheat-barley pig diets. (United States)

    Blaabjerg, K; Nørgaard, J V; Poulsen, H D


    The objective was to evaluate effects of microbial phytase on apparent total tract digestibility (ATTD) of P in a non-heat-treated and a heat-treated wheat (Triticum aestivum)-barley (Hordeum vulgare) diet fed without inorganic P in a 2 × 3 factorial arrangement. The basal diet was ground and half of the batch was steam pelleted at 81°C and crumbled. Phytase was added at 0, 250, and 500 phytase units (FTU)/kg as-fed (Aspergillus niger). The study comprised 36 pigs from 6 litters. Pigs were housed in metabolism crates and fed 1 of 6 diets for 12 d: 5 d for adaptation and 7 d for total collection of feces. The ATTD of P was highest (P feed (meal or pellets) containing plant phytase should be considered to avoid over- or underestimation of effects of microbial phytase. PMID:23365331

  15. Genetic Diversity and Association Analysis of SSR Markers with Leaf Stripe Resistance in Barley(Hordeum vulgare)%大麦遗传多样性及SSR标记与大麦条纹病抗性关联分析

    Institute of Scientific and Technical Information of China (English)

    司二静; 赖勇; 孟亚雄; 李葆春; 马小乐; 尚勋武; 王化俊


    为了解大麦(Horeumvulgare)亲本材料遗传多样性,筛选与大麦条纹病性状相关联的SSR标记,利用100对多态性SSR引物对86个大麦品种进行分析,共检测出269个等位变异,平均每对引物为2.69个,变幅为2~5;等位基因频率为0.012~0.988; Shannon指数为0.064~1.385;遗传相似系数为0.547~0.955;多态性信息含量(polymorphic information content,PIC)为0.023~0.737,平均为0.357.群体遗传结构分析表明,供试大麦亲本材料可分为5个亚群.根据一般线性模型(general linear model,GLM)分析,共5个标记与大麦条纹病抗性性状关联,解释率在6.20%~11.15%之间,其中TACMD和MGB317达到极显著水平(P<0.01),解释率分别为9.24%和9.45%;根据混合线性模型(mixed linear model,MLM)分析,发现3个与大麦条纹病抗性相关的标记,解释率在4.57%~17.63%之间,标记HVM54达到极显著水平(P<0.01),解释率为17.63%.本研究为大麦条纹病抗病育种提供了一定理论依据.

  16. Cold-induced accumulation of protein in the leaves of spring and winter barley cultivars. (United States)

    Karimzadeh, G; Darvishzadeh, R; Jalali-Javaran, M; Dehghani, H


    Electrophoretic pattern and quantitative changes in soluble proteins were determined in the leaves of spring and winter cultivars of barley (Hordeum vulgare L., cv. Makouei and cv. Reyhan, respectively) exposed to 4 degrees C for 14 d. Seedlings were grown in a controlled growth chamber for 2 weeks at a constant air temperature of 20 degrees C and then transferred to constant 4 degrees C for 14 d followed by returning to 20 degrees C (cold treatment), or they were maintained throughout at 20 degrees C during the experimental period of 40 d (control treatment). Plants were sampled every 48 h for leaf fresh weight measurements. Total leaf soluble proteins were extracted and their concentration was either determined by a colorimetric method, or size-fractionated on SDS-PAGE. Low temperature-induced increases in protein amount occurred over the second week of exposure to cold treatment irrespective of cultivar: the winter cultivar was 2 d prior in this response. The protein patterns and their density showed differences between-cultivars and between-temperature treatments. A new cold-induced polypeptide was recognized in the leaves of winter barley cultivar on day 22 (8 d at 4 degrees C) compared to the control. This polypeptide was produced earlier over the first 48 h of low temperature in the winter cultivar compared with the spring one, recognizing in the leaves of cold-treated seedling until day 26. This more rapid response to a low temperature by the winter barley cultivar indicates a more sensitive response compared with the spring barley, probably cold-shock protein is a component of this cold-induced response. PMID:15813217

  17. Mitogen-Activated Protein Kinase Kinase 3 Regulates Seed Dormancy in Barley. (United States)

    Nakamura, Shingo; Pourkheirandish, Mohammad; Morishige, Hiromi; Kubo, Yuta; Nakamura, Masako; Ichimura, Kazuya; Seo, Shigemi; Kanamori, Hiroyuki; Wu, Jianzhong; Ando, Tsuyu; Hensel, Goetz; Sameri, Mohammad; Stein, Nils; Sato, Kazuhiro; Matsumoto, Takashi; Yano, Masahiro; Komatsuda, Takao


    Seed dormancy has fundamental importance in plant survival and crop production; however, the mechanisms regulating dormancy remain unclear [1-3]. Seed dormancy levels generally decrease during domestication to ensure that crops successfully germinate in the field. However, reduction of seed dormancy can cause devastating losses in cereals like wheat (Triticum aestivum L.) and barley (Hordeum vulgare L.) due to pre-harvest sprouting, the germination of mature seed (grain) on the mother plant when rain occurs before harvest. Understanding the mechanisms of dormancy can facilitate breeding of crop varieties with the appropriate levels of seed dormancy [4-8]. Barley is a model crop [9, 10] and has two major seed dormancy quantitative trait loci (QTLs), SD1 and SD2, on chromosome 5H [11-19]. We detected a QTL designated Qsd2-AK at SD2 as the single major determinant explaining the difference in seed dormancy between the dormant cultivar "Azumamugi" (Az) and the non-dormant cultivar "Kanto Nakate Gold" (KNG). Using map-based cloning, we identified the causal gene for Qsd2-AK as Mitogen-activated Protein Kinase Kinase 3 (MKK3). The dormant Az allele of MKK3 is recessive; the N260T substitution in this allele decreases MKK3 kinase activity and appears to be causal for Qsd2-AK. The N260T substitution occurred in the immediate ancestor allele of the dormant allele, and the established dormant allele became prevalent in barley cultivars grown in East Asia, where the rainy season and harvest season often overlap. Our findings show fine-tuning of seed dormancy during domestication and provide key information for improving pre-harvest sprouting tolerance in barley and wheat. PMID:26948880

  18. Evaluation of Chlorophyll Content and Fluorescence Parameters as Indicators of Drought Tolerance in Barley

    Institute of Scientific and Technical Information of China (English)

    LI Rong-hua; GUO Pei-guo; Michael Baum; Stefania Grando; Salvatore Ceccarelli


    Drought is a major abiotic stress that severely affects food production worldwide. Agronomic and physiological traits associated with drought tolerance are suitable indicators for selection of drought tolerance genotypes to reduce the impact of water deficit on crop yield in breeding program. The objective of this study was to identify indicators related to drought tolerance through analysis of photosynthetic traits in barley (Hordeum vulgare L.). These traits included chlorophyll content, initial fluorescence (Fo), maximum primary yield of photochemistry of pho tosystem Ⅱ (Fv / Fo) and maximum quantum yield of photosystem Ⅱ (Fv/Fm). Four genotypes (Tadmor, Arta, Morocco9-75 and WI2291) variable in drought tolerance were used to investigate the correlation between these traits and drought tolerance. The results reflected that all of these traits were affected negatively in the four genotypes at different levels of post-anthesis drought stress, but the decrease in drought tolerant genotypes was much less than that of drought sensitive genotypes. The results further revealed that the components of the photosynthetic apparatus could be damaged significantly in drought sensitive genotypes, while drought tolerant genotypes were relatively less affected. On the other hand, the values of chlorophyll content, Fo, Fv/Fo and Fv/Fm in drought tolerance genotypes were significantly higher than those in drought sensitive genotypes under drought stress. It was concluded that chlorophyll content, Fo, Fv / Fo and Fv / Fm could be considered as reliable indicators in screening barley germplasm for drought tolerance.

  19. Identification of drought-inducible genes and differentially expressed sequence tags in barley. (United States)

    Diab, Ayman A; Teulat-Merah, Béatrice; This, Dominique; Ozturk, Neslihan Z; Benscher, David; Sorrells, Mark E


    Drought limits cereal yields in several regions of the world and plant water status plays an important role in tolerance to drought. To investigate and understand the genetic and physiological basis of drought tolerance in barley, differentially expressed sequence tags (dESTs) and candidate genes for the drought response were mapped in a population of 167 F8 recombinant inbred lines derived from a cross between "Tadmor" (drought tolerant) and "Er/Apm" (adapted only to specific dry environments). One hundred sequenced probes from two cDNA libraries previously constructed from drought-stressed barley (Hordeum vulgare L., var. Tokak) plants and 12 candidate genes were surveyed for polymorphism, and 33 loci were added to a previously published map. Composite interval mapping was used to identify quantitative trait loci (QTL) associated with drought tolerance including leaf relative water content, leaf osmotic potential, osmotic potential at full turgor, water-soluble carbohydrate concentration, osmotic adjustment, and carbon isotope discrimination. A total of 68 QTLs with a limit of detection score > or =2.5 were detected for the traits evaluated under two water treatments and the two traits calculated from both treatments. The number of QTLs identified for each trait varied from one to 12, indicating that the genome contains multiple genes affecting different traits. Two candidate genes and ten differentially expressed sequences were associated with QTLs for drought tolerance traits. PMID:15517148

  20. Rapid incorporation of 14C of glucose into phytosiderophores in iron-deficient barley roots

    International Nuclear Information System (INIS)

    Feeding experiments with 14C-labeled compounds were conducted to clarify the biosynthetic pathway of methionine for the production of the mugineic acid family of phytosiderophores (MAs) assuming that glucose may be converted to MAs through the glycolytic pathway, TCA cycle, and homoserine. CArbon-14 labeled glucose or homoserine was fed to intact roots of iron-deficient barley (Hordeum vulgare L. cv. Minorimugi) plants, and 14C-labeled glucose, malate, succinate, pyruvate, or glycerol was fed to excised roots of iron-deficient barley. In the feeding experiment with 14C-glucose using intact roots, 14C of glucose was incorporated into MAs rapidly and the molar radioactivity of the amino butanoic acid unit (C-4 unit) of the MAs was higher than that of citrate and malate. Carbon-14 of homoserine was incorporated into threonine rather than into MAS. Carbon-14 of malate, succinate, or pyruvate fed to the excised roots was not incorporated into MAS, while 14C of glycerol was incorporated into MAs. It was suggested that MAs may be synthesized from glucose through an unknown pathway that bypasses the organic acids of the TCA cycle, aspartate and homoserine; and that glycerol may be involved in the unknown pathway

  1. Determination of Heavy Metals in Eight Barley Cultivars Collected from Wheat Research Station Tandojam, Sindh, Pakistan

    Directory of Open Access Journals (Sweden)

    Fateh M. Soomro


    Full Text Available Barley (Hordeum Vulgare L. is one of the most important foods for animals and possesses high nutritional value. In this paper, we have focused our study to find out the chemical parameters, especially metal content of this class of food commodity and its soil, which is not frequently used for human food. Wet digestion method was used to destroy the organic matrix to determine the content of eleven metals i.e. Iron, Zinc, Manganese, Copper, Cobalt, Chromium, Nickel, Lead, Cadmium, Barium and Aluminium, from eight Pakistani barley cultivars. The highest level of elements were determined in order; Cd < Ni < Pb < Cr < Co < Cu < Ba < Al < Mn < Zn < Fe in mg/kg. All analysis was carried out by using air- acetylene except Al and Ba where as both of these metals analysed on air-acetylene and nitrous oxide flame on Atomic Absorption Spectrophotometer. Among all these entries, maximum concentration of Fe was detected in B6, Zn in B5, Mn, & Cu in B2 & B5, Co in B1, Ba in B7, Al in B8 and rest of the elements i.e. Cr, Pb, Ni and Cd were found to be with little difference of concentration among cultivars.

  2. Molecular identification based on coat protein sequences of the Barley yellow dwarf virus from Brazil

    Directory of Open Access Journals (Sweden)

    Talita Bernardon Mar


    Full Text Available Yellow dwarf disease, one of the most important diseases of cereal crops worldwide, is caused by virus species belonging to the Luteoviridae family. Forty-two virus isolates obtained from oat (Avena sativa L., wheat (Triticum aestivum L., barley (Hordeum vulgare L., corn (Zea mays L., and ryegrass (Lolium multiflorum Lam. collected between 2007 and 2008 from winter cereal crop regions in southern Brazil were screened by polymerase chain reaction (PCR with primers designed on ORF 3 (coat protein - CP for the presence of Barley yellow dwarf virus and Cereal yellow dwarf virus (B/CYDV. PCR products of expected size (~357 bp for subgroup II and (~831 bp for subgroup I were obtained for three and 39 samples, respectively. These products were cloned and sequenced. The subgroup II 3' partial CP amino acid deduced sequences were identified as BYDV-RMV (92 - 93 % of identity with "Illinois" Z14123 isolate. The complete CP amino acid deduced sequences of subgroup I isolates were confirmed as BYDV-PAV (94 - 99 % of identity and established a very homogeneous group (identity higher than 99 %. These results support the prevalence of BYDV-PAV in southern Brazil as previously diagnosed by Enzyme-Linked Immunosorbent Assay (ELISA and suggest that this population is very homogeneous. To our knowledge, this is the first report of BYDV-RMV in Brazil and the first genetic diversity study on B/CYDV in South America.

  3. Lil3 Assembles with Proteins Regulating Chlorophyll Synthesis in Barley.

    Directory of Open Access Journals (Sweden)

    Astrid Mork-Jansson

    Full Text Available The light-harvesting-like (LIL proteins are a family of membrane proteins that share a chlorophyll a/b-binding motif with the major light-harvesting antenna proteins of oxygenic photoautotrophs. LIL proteins have been associated with the regulation of tetrapyrrol biosynthesis, and plant responses to light-stress. Here, it was found in a native PAGE approach that chlorophyllide, and chlorophyllide plus geranylgeraniolpyrophosphate trigger assembly of Lil3 in three chlorine binding fluorescent protein bands, termed F1, F2, and F3. It is shown that light and chlorophyllide trigger accumulation of protochlorophyllide-oxidoreductase, and chlorophyll synthase in band F3. Chlorophyllide and chlorophyll esterified to geranylgeraniol were identified as basis of fluorescence recorded from band F3. A direct interaction between Lil3, CHS and POR was confirmed in a split ubiquitin assay. In the presence of light or chlorophyllide, geranylgeraniolpyrophosphate was shown to trigger a loss of the F3 band and accumulation of Lil3 and geranylgeranyl reductase in F1 and F2. No direct interaction between Lil3 and geranylgeraniolreductase was identified in a split ubiquitin assay; however, accumulation of chlorophyll esterified to phytol in F1 and F2 corroborated the enzymes assembly. Chlorophyll esterified to phytol and the reaction center protein psbD of photosystem II were identified to accumulate together with psb29, and APX in the fluorescent band F2. Data show that Lil3 assembles with proteins regulating chlorophyll synthesis in etioplasts from barley (Hordeum vulgare L..

  4. UV-B response of green and etiolated barley seedlings

    International Nuclear Information System (INIS)

    Seven-d-old etiolated and green barley seedlings (Hordeum vulgare cv. Alfa) were irradiated with UV-B for 30 min and then kept for 24 h in light or darkness. Chlorophyll (Chl) synthesis was inhibited by about 30% as a result of UV-B irradiation, but there were no significant changes in photochemical activity measured by variable to maximum fluorescence ratio (Fv/Fm), quantum yield and oxygen evolution rate. Electron transport of etiolated seedlings was similar to that of green ones, nevertheless, the Chl content was more then 2-fold lower. Ribulose-1,5-bisphosphate carboxylase/oxygenase large and small subunits were diminished as a result of UV-B irradiation in both etiolated and green plants, especially in those kept in the darkness. Catalase activity decreased and total superoxide dismutase activity increased in both types of plants following UV-B treatment. When benzidine was used as a substrate, an isoform located between guaiacol peroxidases 2 and 3 (guaiacol peroxidase X) appeared, which was specific for UV-B treatment. As a result of irradiation, the contents of UV-B absorbing and UV-B induced compounds increased in green seedlings but not in etiolated ones

  5. Golgi localized barley MTP8 proteins facilitate Mn transport

    DEFF Research Database (Denmark)

    Pedas, Pai Rosager; Schiller, Michaela; Hegelund, Josefine Nymark;


    Many metabolic processes in plants are regulated by manganese (Mn) but limited information is available on the molecular mechanisms controlling cellular Mn homeostasis. In this study, a yeast assay was used to isolate and characterize two genes, MTP8.1 and MTP8.2 , which encode membrane-bound pro......Many metabolic processes in plants are regulated by manganese (Mn) but limited information is available on the molecular mechanisms controlling cellular Mn homeostasis. In this study, a yeast assay was used to isolate and characterize two genes, MTP8.1 and MTP8.2 , which encode membrane......-bound proteins belonging to the cation diffusion facilitator (CDF) family in the cereal species barley (Hordeum vulgare). Transient expression in onion epidermal cells showed that MTP8.1 and MTP8.2 proteins fused to the green fluorescent protein (GFP) are localized to Golgi. When heterologously expressed......8 proteins are involved in Mn loading to the Golgi apparatus and play a role in Mn homeostasis by delivering Mn to Mn-dependent enzymes and/or by facilitating Mn efflux via secretory vesicles. This study highlights the importance of MTP transporters in Mn homeostasis and is the first report of Golgi...

  6. Breeding of Hordeum Vulgare L. via chemical and physical Mutagenesis

    International Nuclear Information System (INIS)

    A field experiment was conducted under field conditions to compare for yield, yield components and some agronomic traits, of four selective mutants that have been obtained by using chemical mutagen (Sodium Azide) and physical mutagen ( Gamma ray, 20 KG) and their parent Arivate and Numar. The results show that the selective mutants have a high degree of genetic stability and exceeded their parents in some agronomic parameters. There fore, the two best selective mutants were accepted for registration and release under the name of Barrak and Amel as a new varieties by Nacional Committee for Registration and Release of Agricultural varieties

  7. Vulgar Music and Technology (United States)

    Stivers, Richard


    Rock music, rap, and heavy metal are all forms of vulgar music. Vulgarity refers to actions and communication that are "common, noisy, and gross," and are "untranscendent." A technological society is a vulgar society in its base of materialism and exclusive concern with power. Its excessive rationality produces a need for escape, for ecstasy, for…

  8. Influence of NaCl-Induced Salinity and Cd Toxicity on Respiration Activity and Cd Availability to Barley Plants in Farmyard Manure-Amended Soil

    Directory of Open Access Journals (Sweden)

    Adel R. A. Usman


    Full Text Available The objective of this study was to evaluate the Cd availability and toxicity as affected by NaCl-induced salinity and farmyard manure addition. The Cd availability and toxicity were investigated in greenhouse pot and incubation experiments were conducted on a calcareous loamy sand soil contaminated with Cd (0.5, 1.5, 3, 6, 12, and 24 mg kg−1 of soil and amended with two rates of 0.0 and 30 g farmyard manure (FYM kg−1. Barley seeds (Hordeum vulgare L. were sown in pots and irrigated with water containing different levels of salinity (0, 30, 60, and 120 mM NaCl. The results revealed that the DTPA-extractable Cd and its content in barley plant shoots tended to increase in line as Cd was applied and salt levels increased. Elevated decreases in the soil basal respiration with increased Cd applied and NaCl-induced salinity were found. However, applying FYM significantly reduced Cd availability and increased plant growth and soil respiration activity. The results clearly showed that adding farmyard manure as soil organic amendment decreased the availability of Cd to barley plants and mitigated the toxicity of both Cd and salinity to soil microbial activity.

  9. Wheat and barley dehydrins under cold, drought and salinity - what can LEA-II proteins tell us about plant stress response?

    Directory of Open Access Journals (Sweden)

    Klára eKosová


    Full Text Available Dehydrins as a group of Late embryogenesis abundant II (LEA-II proteins represent important dehydration-inducible proteins whose accumulation is induced by developmental processes (embryo maturation as well as by several abiotic stress factors (low temperatures, drought, salinity. In the review, an overview of studies aimed at investigation of dehydrin accumulation patterns at transcript and protein levels as well as their possible functions in common wheat (Triticum aestivum, durum wheat (Triticum durum and barley (Hordeum vulgare plants exposed to various abiotic stress factors (cold, frost, drought, salinity is provided. Possible roles of dehydrin proteins in an acquisition and maintenance of an enhanced frost tolerance are analysed in the context of plant developmental processes (vernalization. Quantitative and qualitative differences as well as posttranslational modifications in accumulated dehydrin proteins between barley cultivars revealing differential tolerance to drought and salinity are also discussed. Current knowledge on dehydrin role in wheat and barley response to major dehydrative stresses is summarized and the major challenges in dehydrin research are outlined.

  10. Wheat and barley dehydrins under cold, drought, and salinity - what can LEA-II proteins tell us about plant stress response? (United States)

    Kosová, Klára; Vítámvás, Pavel; Prášil, Ilja T


    Dehydrins as a group of late embryogenesis abundant II proteins represent important dehydration-inducible proteins whose accumulation is induced by developmental processes (embryo maturation) as well as by several abiotic stress factors (low temperatures, drought, salinity). In the review, an overview of studies aimed at investigation of dehydrin accumulation patterns at transcript and protein levels as well as their possible functions in common wheat (Triticum aestivum), durum wheat (T. durum), and barley (Hordeum vulgare) plants exposed to various abiotic stress factors (cold, frost, drought, salinity) is provided. Possible roles of dehydrin proteins in an acquisition and maintenance of an enhanced frost tolerance are analyzed in the context of plant developmental processes (vernalization). Quantitative and qualitative differences as well as post-translational modifications in accumulated dehydrin proteins between barley cultivars revealing differential tolerance to drought and salinity are also discussed. Current knowledge on dehydrin role in wheat and barley response to major dehydrative stresses is summarized and the major challenges in dehydrin research are outlined. PMID:25071816

  11. HVP10 encoding V-PPase is a prime candidate for the barley HvNax3 sodium exclusion gene: evidence from fine mapping and expression analysis. (United States)

    Shavrukov, Yuri; Bovill, Jessica; Afzal, Irfan; Hayes, Julie E; Roy, Stuart J; Tester, Mark; Collins, Nicholas C


    In cereals, a common salinity tolerance mechanism is to limit accumulation of Na(+) in the shoot. In a cross between the barley variety Barque-73 (Hordeum vulgare ssp. vulgare) and the accession CPI-71284 of wild barley (H. vulgare ssp. spontaneum), the HvNax3 locus on chromosome 7H was found to determine a ~10-25 % difference in leaf Na(+) accumulation in seedlings grown in saline hydroponics, with the beneficial exclusion trait originating from the wild parent. The Na(+) exclusion allele was also associated with a 13-21 % increase in shoot fresh weight. The HvNax3 locus was delimited to a 0.4 cM genetic interval, where it cosegregated with the HVP10 gene for vacuolar H(+)-pyrophosphatase (V-PPase). Sequencing revealed that the mapping parents encoded identical HVP10 proteins, but salinity-induced mRNA expression of HVP10 was higher in CPI-71284 than in Barque-73, in both roots and shoots. By contrast, the expression of several other genes predicted by comparative mapping to be located in the HvNax3 interval was similar in the two parent lines. Previous work demonstrated roles for V-PPase in ion transport and salinity tolerance. We therefore considered transcription levels of HVP10 to be a possible basis for variation in shoot Na(+) accumulation and biomass production controlled by the HvNax3 locus under saline conditions. Potential mechanisms linking HVP10 expression patterns to the observed phenotypes are discussed. PMID:23277165

  12. The CELLULOSE-SYNTHASE LIKE C (CSLC) Family of Barley Includes Members that Are Integral Membrane Proteins Targeted to the Plasma Membrane

    Institute of Scientific and Technical Information of China (English)

    Fenny M. Dwivany; Dina Yuli; Rachel A. Burton; Neil J. Shirley; Sarah M. Wilson; Geoffrey B. Fincher; Antony Bacic; Ed Newbigin; Monika S. Doblin


    The CELLULOSESYNTHASE-LIKE C(CSLC) family is an ancient lineage within the CELLULOSE SYNTHASE/CEL-LULOSE SYNTHASE-LIKE (CESA/CSL) polysaccharide synthase superfamily that is thought to have arisen before the diver-gence of mosses and vascular plants. As studies in the flowering plant Arabidopsis have suggested synthesis of the (1,4)-β-glucan backbone of xyloglucan (XyG), a wall polysaccharide that tethers adjacent cellulose microfibrils to each other, as a probable function for the CSLCs, CSLC function was investigated in barley (Hordeum vulgare L.), a species with low amounts of XyG in its walls. Four barley CSLC genes were identified (designated HvCSLC1-4). Phylogenetic analysis reveals three well supported clades of CSLCs in flowering plants, with barley having representatives in two of these clades. The four barley CSLCs were expressed in various tissues, with in situ PCR detecting transcripts in all cell types of the coleoptile and root, including cells with primary and secondary cell walls. Co-expression analysis showed that HvCSLC3 was coor-dinately expressed with putative XyG xylosyltransferase genes. Both immuno-EM and membrane fractionation showed that HvCSLC2 was located in the plasma membrane of barley suspension-cultured cells and was not in internal membranes such as endoplasmic reticulum or Golgi apparatus. Based on our current knowledge of the sub-cellular locations of poly-saccharide synthesis, we conclude that the CSLC family probably contains more than one type of polysaccharide synthase.

  13. Biochemical and Immunological Study on the Effects of Barley and its Components as Hypoglycemic Agents in Diabetic Rats

    Directory of Open Access Journals (Sweden)

    Mokhtar I. Yousef


    Full Text Available The present study was carried out to investigate the hypoglycemic effect of barley (Hordeum vulgare L and some of its components such as amino acids (L-leucine and L-glutamine and chromium picolinate on some biochemical and immunological parameters of alloxan induced diabetic rats. Alloxan-diabetic rats were treated with barley water (10% w/v at a dose 10 ml Kg-1 b.wt., chromium picolinate at 15 µg Kg-1 b.wt., L-leucine plus L-glutamine at 4.5 mg & 15 mg Kg-1 b.wt., and/or the combination of barley plus chromium plus L-leucine and L-glutamine at the same previous doses in the same water volume, respectively. Rats received the treatments in their drinking water for four weeks. The levels of glucose, immunoglobulin G (IgG, total lipids (TL, cholesterol, triglycerides (TG, low-density lipoprotein (LDL and very low-density lipoprotein (VLDL were significantly (P<0.05 increased, while high-density lipoprotein (HDL decreased in plasma of alloxan-diabetic rats compared to control group. The activities of aspartate aminotransferase (AST, alanine aminotransferase (ALT, acid phosphatase (AcP and alkaline phosphatase (AlP were significantly (P<0.05 decreased in both plasma and liver of alloxan-diabetic rats. On the other hand, the activity of lactate dehydrogenase (LDH decreased in plasma and increased in liver of alloxan-diabetic rats. Treatment of the diabetic rats with repeated doses of any one of the three treatments alone could restore the changes of the above parameters to their normal levels after four weeks of treatment. However, treatment with the combination of all together did not show complete restoration. Furthermore, the electron microscope results were supported biochemical and immunological findings. The present results showed that barley, amino acids and chromium picolinate exerted antihyperglycemic effects and consequently may alleviate liver damage caused by alloxan-induced diabetes.

  14. Barley root hair growth and morphology in soil, sand, and water solution media and relationship with nickel toxicity. (United States)

    Lin, Yanqing; Allen, Herbert E; Di Toro, Dominic M


    Barley, Hordeum vulgare (Doyce), was grown in the 3 media of soil, hydroponic sand solution (sand), and hydroponic water solution (water) culture at the same environmental conditions for 4 d. Barley roots were scanned, and root morphology was analyzed. Plants grown in the 3 media had different root morphology and nickel (Ni) toxicity response. Root elongations and total root lengths followed the sequence soil > sand > water. Plants grown in water culture were more sensitive to Ni toxicity and had greater root hair length than those from soil and sand cultures, which increased root surface area. The unit root surface area as root surface area per centimeter of length of root followed the sequence water > sand > soil and was found to be related with root elongation. Including the unit root surface area, the difference in root elongation and 50% effective concentration were diminished, and percentage of root elongations can be improved with a root mean square error approximately 10% for plants grown in different media. Because the unit root surface area of plants in sand culture is closer to that in soil culture, the sand culture method, not water culture, is recommended for toxicity parameter estimation. Environ Toxicol Chem 2016;35:2125-2133. © 2016 SETAC. PMID:26841366

  15. Assessment of a sewage sludge treatment on cadmium, copper and zinc bioavailability in barley, ryegrass and earthworms

    Energy Technology Data Exchange (ETDEWEB)

    Renoux, Agnes Y. [Sanexen Environmental Services Inc., 1471 Lionel-Boulet Boulevard, Varennes, Quebec J3X 1P7 (Canada)]. E-mail:; Rocheleau, Sylvie [Biotechnology Research Institute, National Research Council of Canada, 6100 Royalmount Avenue, Montreal, Quebec H4P 2R2 (Canada); Sarrazin, Manon [Biotechnology Research Institute, National Research Council of Canada, 6100 Royalmount Avenue, Montreal, Quebec H4P 2R2 (Canada); Sunahara, Geoffrey I. [Biotechnology Research Institute, National Research Council of Canada, 6100 Royalmount Avenue, Montreal, Quebec H4P 2R2 (Canada)]. E-mail:; Blais, Jean-Francois [Institut national de la recherche scientifique (INRS-ETE), Centre Eau, Terre et Environnement, 490 rue de la Couronne street, Quebec, Quebec G1K 9A9 (Canada)]. E-mail:


    The toxicity and bioavailability of metals were assessed to verify the efficiency of a new chemical leaching process (METIX-AC) to minimize the risk of metals found in municipal sewage sludge. For this purpose, sludge samples were spiked with cadmium, copper and/or zinc before being treated using METIX-AC. The sludge decontamination resulted in a removal of spiked metals (79-89%), in a decrease of the more labile fractions, and in a corresponding increase of the residual fraction. The toxicity observed after exposure of two plant species, barley (Hordeum vulgare) and ryegrass (Lolium perenne), and a terrestrial invertebrate, Eisenia andrei, to sludge-soil mixtures, disappeared after treatment, although the adverse effects were minor before treatment. The sludge treatment also significantly decreased the bioaccumulation of cadmium, copper, and zinc in the exposed species. For cadmium, maximum tissue concentrations of 0.45 {+-} 0.08 mg/kg in barley, 0.79 {+-} 0.27 mg/kg in ryegrass, and 21.82 {+-} 1.85 mg/kg in earthworm exposed to sludge before treatment decreased after treatment to values similar to those observed with negative controls. - Assessment of a sewage sludge treatment on metal bioavailability as measured by metal speciation, toxicity and bioaccumulation.

  16. Molecular cloning and characterization of beta-expansin gene related to root hair formation in barley. (United States)

    Kwasniewski, Miroslaw; Szarejko, Iwona


    Root hairs are specialized epidermal cells that play a role in the uptake of water and nutrients from the rhizosphere and serve as a site of interaction with soil microorganisms. The process of root hair formation is well characterized in Arabidopsis (Arabidopsis thaliana); however, there is a very little information about the genetic and molecular basis of root hair development in monocots. Here, we report on isolation and cloning of the beta-expansin (EXPB) gene HvEXPB1, tightly related to root hair initiation in barley (Hordeum vulgare). Using root transcriptome differentiation in the wild-type/root-hairless mutant system, a cDNA fragment present in roots of wild-type plants only was identified. After cloning of full-length cDNA and genomic sequences flanking the identified fragment, the subsequent bioinformatics analyses revealed homology of the protein coded by the identified gene to the EXPB family. Reverse transcription-PCR showed that expression of HvEXPB1 cosegregated with the root hair phenotype in F2 progeny of the cross between the hairless mutant rhl1.a and the wild-type Karat parent variety. Expression of the HvEXPB1 gene was root specific; it was expressed in roots of wild-type forms, but not in coleoptiles, leaves, tillers, and spikes. The identified gene was active in roots of two other analyzed root hair mutants: rhp1.a developing root hair primordia only and rhs1.a with very short root hairs. Contrary to this, a complete lack of HvEXPB1 expression was observed in roots of the spontaneous root-hairless mutant bald root barley. All these observations suggest a role of the HvEXPB1 gene in the process of root hair formation in barley. PMID:16679418

  17. Role of nitrate and nitrite in the induction of nitrite reductase in leaves of barley seedlings (United States)

    Aslam, M.; Huffaker, R. C.


    The role of NO3- and NO2- in the induction of nitrite reductase (NiR) activity in detached leaves of 8-day-old barley (Hordeum vulgare L.) seedlings was investigated. Barley leaves contained 6 to 8 micromoles NO2-/gram fresh weight x hour of endogenous NiR activity when grown in N-free solutions. Supply of both NO2- and NO3- induced the enzyme activity above the endogenous levels (5 and 10 times, respectively at 10 millimolar NO2- and NO3- over a 24 hour period). In NO3(-)-supplied leaves, NiR induction occurred at an ambient NO3- concentration of as low as 0.05 millimolar; however, no NiR induction was found in leaves supplied with NO2- until the ambient NO2- concentration was 0.5 millimolar. Nitrate accumulated in NO2(-)-fed leaves. The amount of NO3- accumulating in NO2(-)-fed leaves induced similar levels of NiR as did equivalent amounts of NO3- accumulating in NO3(-)-fed leaves. Induction of NiR in NO2(-)-fed leaves was not seen until NO3- was detectable (30 nanomoles/gram fresh weight) in the leaves. The internal concentrations of NO3-, irrespective of N source, were highly correlated with the levels of NiR induced. When the reduction of NO3- to NO2- was inhibited by WO4(2-), the induction of NiR was inhibited only partially. The results indicate that in barley leaves in NiR is induced by NO3- directly, i.e. without being reduced to NO2-, and that absorbed NO2- induces the enzyme activity indirectly after being oxidized to NO3- within the leaf.

  18. Molecular mapping of a recessive gene for resistance to stripe rust in barley. (United States)

    Yan, G P; Chen, X M


    Barley stripe rust, caused by Puccinia striiformis f. sp. hordei, is one of the most important barley (Hordeum vulgare) diseases in the United States. The disease is best controlled using resistant cultivars. Barley genotype Grannenlose Zweizeilige (GZ) has a recessive gene (rpsGZ) that is effective against all races of P. striiformis f. sp. hordei identified so far in the USA. To develop a molecular map for mapping the gene, F(8 )recombinant inbred lines (RILs) were developed from the Steptoe X GZ cross through single-seed descent. Seedlings of the parents and RILs were evaluated for resistance to races PSH-14 and PSH-54 of P. striiformis f. sp. hordei under controlled greenhouse conditions. Genomic DNA was extracted from the parents and 182 F(8 )RILs and used for linkage analysis. The resistance gene analog polymorphism (RGAP) technique was used to identify molecular markers for rpsGZ. A linkage group for the gene was constructed with 12 RGAP markers, of which two markers co-segregated with the resistance locus, and two markers were closely linked to the locus with a genetic distance of 0.9 and 2.0 cM, respectively. These four markers were present only in the susceptible parent. The closest marker to the resistance allele was 11.7 cM away. Analyses of two sets of barley chromosome addition lines of wheat with the two RGAP markers that were cosegregating with the susceptibility allele showed that rpsGZ and the markers were located on the long arm of barley chromosome 4H. Further, tests with four simple sequence repeat (SSR) markers confirmed the chromosomal location of the rpsGZ gene and also integrated the RGAP markers into the known SSR-based linkage map of barley. The closest SSR marker EBmac0679 had a genetic distance of 7.5 cM with the gene in the integrated linkage map constructed with the 12 RGAP markers and 4 SSR markers. The information on chromosomal location and molecular markers for rpsGZ should be useful for incorporating this gene into commercial

  19. Genetic Characterization of Resistance to Wheat Stem Rust Race TTKSK in Landrace and Wild Barley Accessions Identifies the rpg4/Rpg5 Locus. (United States)

    Mamo, Bullo Erena; Smith, Kevin P; Brueggeman, Robert S; Steffenson, Brian J


    Race TTKSK of the wheat stem rust pathogen (Puccinia graminis f. sp. tritici) threatens the production of wheat and barley worldwide because of its broad-spectrum virulence on many widely grown cultivars. Sources of resistance against race TTKSK were recently identified in several barley landraces (Hordeum vulgare subsp. vulgare) and wild barley accessions (H. vulgare subsp. spontaneum). The objectives of this study were to characterize the inheritance of resistance to wheat stem rust race TTKSK in four barley landraces (Hv501, Hv545, Hv602, and Hv612) and two wild barley (WBDC213 and WBDC345) accessions, map the resistance genes, and determine the allelic relationships among the genes in these accessions and the previously described rpg4/Rpg5 locus. Resistant accessions were crossed with the susceptible cv. Steptoe and resulting F3 populations were evaluated for resistance to race TTKSK at the seedling stage. Segregation of F3 families in populations involving the resistance sources of Hv501, Hv545, Hv612, WBDC213, and WBDC345 fit a 1:2:1 ratio for homozygous resistant (HR)/segregating (SEG)/homozygous susceptible (HS) progenies (with χ2=2.27 to 5.87 and P=0.053 to 0.321), indicating that a single gene confers resistance to race TTKSK. Segregation of F3 families in cross Steptoe/Hv602 did not fit a 1:2:1 ratio (HR/SEG/HS of 20:47:43 with χ2=11.95 and P=0.003), indicating that more than one gene is involved in imparting resistance to race TTKSK. Bulked segregant analysis using >1,500 single-nucleotide polymorphism markers positioned a resistance locus in all six populations on chromosome 5HL in very close proximity to the known location of the rpg4/Rpg5 complex locus. Allelism tests were conducted by making crosses among resistant accessions Hv501, Hv545, and Hv612 and also Q21861 with the rpg4/Rpg5 complex. No segregation was observed in F2 families inoculated with race TTKSK, demonstrating that all Hv lines carry the same allele for resistance and that it

  20. The family of DOF transcription factors in Brachypodium distachyon: phylogenetic comparison with rice and barley DOFs and expression profiling

    Directory of Open Access Journals (Sweden)

    Hernando-Amado Sara


    Full Text Available Abstract Background Transcription factors (TFs are proteins that have played a central role both in evolution and in domestication, and are major regulators of development in living organisms. Plant genome sequences reveal that approximately 7% of all genes encode putative TFs. The DOF (DNA binding with One Finger TF family has been associated with vital processes exclusive to higher plants and to their close ancestors (algae, mosses and ferns. These are seed maturation and germination, light-mediated regulation, phytohormone and plant responses to biotic and abiotic stresses, etc. In Hordeum vulgare and Oryza sativa, 26 and 30 different Dof genes, respectively, have been annotated. Brachypodium distachyon has been the first Pooideae grass to be sequenced and, due to its genomic, morphological and physiological characteristics, has emerged as the model system for temperate cereals, such as wheat and barley. Results Through searches in the B. distachyon genome, 27 Dof genes have been identified and a phylogenetic comparison with the Oryza sativa and the Hordeum vulgare DOFs has been performed. To explore the evolutionary relationship among these DOF proteins, a combined phylogenetic tree has been constructed with the Brachypodium DOFs and those from rice and barley. This phylogenetic analysis has classified the DOF proteins into four Major Cluster of Orthologous Groups (MCOGs. Using RT-qPCR analysis the expression profiles of the annotated BdDof genes across four organs (leaves, roots, spikes and seeds has been investigated. These results have led to a classification of the BdDof genes into two groups, according to their expression levels. The genes highly or preferentially expressed in seeds have been subjected to a more detailed expression analysis (maturation, dry stage and germination. Conclusions Comparison of the expression profiles of the Brachypodium Dof genes with the published functions of closely related DOF sequences from the cereal

  1. Conversion of deoxynivalenol to 3-acetyldeoxynivalenol in barley-derived fuel ethanol co-products with yeast expressing trichothecene 3-O-acetyltransferases

    Directory of Open Access Journals (Sweden)

    Brooks Wynse S


    Full Text Available Abstract Background The trichothecene mycotoxin deoxynivalenol (DON may be concentrated in distillers dried grains with solubles (DDGS; a co-product of fuel ethanol fermentation when grain containing DON is used to produce fuel ethanol. Even low levels of DON (≤ 5 ppm in DDGS sold as feed pose a significant threat to the health of monogastric animals. New and improved strategies to reduce DON in DDGS need to be developed and implemented to address this problem. Enzymes known as trichothecene 3-O-acetyltransferases convert DON to 3-acetyldeoxynivalenol (3ADON, and may reduce its toxicity in plants and animals. Results Two Fusarium trichothecene 3-O-acetyltransferases (FgTRI101 and FfTRI201 were cloned and expressed in yeast (Saccharomyces cerevisiae during a series of small-scale ethanol fermentations using barley (Hordeum vulgare. DON was concentrated 1.6 to 8.2 times in DDGS compared with the starting ground grain. During the fermentation process, FgTRI101 converted 9.2% to 55.3% of the DON to 3ADON, resulting in DDGS with reductions in DON and increases in 3ADON in the Virginia winter barley cultivars Eve, Thoroughbred and Price, and the experimental line VA06H-25. Analysis of barley mashes prepared from the barley line VA04B-125 showed that yeast expressing FfTRI201 were more effective at acetylating DON than those expressing FgTRI101; DON conversion for FfTRI201 ranged from 26.1% to 28.3%, whereas DON conversion for FgTRI101 ranged from 18.3% to 21.8% in VA04B-125 mashes. Ethanol yields were highest with the industrial yeast strain Ethanol Red®, which also consumed galactose when present in the mash. Conclusions This study demonstrates the potential of using yeast expressing a trichothecene 3-O-acetyltransferase to modify DON during commercial fuel ethanol fermentation.

  2. Influence of silicon on microdistribution of mineral ions in roots of salt-stressed barley as associated with salt tolerance in plants

    Institute of Scientific and Technical Information of China (English)

    梁永超; 丁瑞兴


    Two contrasting barley (Hordeum vulgare L.) cultivars: Kepin No.7 (salt sensitive), and Jian 4 (salt tolerant) were grown hydroponically to investigate the microdistribution of mineral ions in roots as affected by silicon (Si) with respect to salt tolerance. The experiment was undertaken consisting of two treatments with 3 replicates: (i) 120 mmol@L?1 NaCl alone (referred to as Si(NaCl+), (ii) 120 mmol@L?1 NaCl + 1.0 mmol@L?1 Si (as potassium silicate) (referred to as Si+NaCl+). Plant root tips were harvested for microanalysis using an energy dispersive X-ray microanalyzer (EDX) 30 d after transplanting. Higher Cl and Na X-ray peaks were recorded in the root epidermal, cortical and stelar cells of roots for the treatment Si(NaCl+ with the majorities of Na and Cl being accumulated in epidermal and cortical cells, while relatively low K peaks were observed regardless of the barley cultivars used. By contrast, considerably higher K peaks were detected in the epidermal, cortical and stelar cells of the roots for the treatment Si+NaCl+, but lower Cl and Na peaks were also observed for this treatment with both Na and Cl ions being evenly distributed in the epidermal, cortical and stelar cells. These findings directly support our previous finding, which showed that Si depressed the uptake of sodium but enhanced the uptake of potassium by salt-stressed barley. We believe that one of the possible mechanisms involved in Si-enhancement of salt tolerance in barley is attributed to the Si-induced changes in the uptake and microdistribution of mineral ions in plants.

  3. Glyoxylate cycle and metabolism of organic acids in the scutellum of barley seeds during germination. (United States)

    Ma, Zhenguo; Marsolais, Frédéric; Bernards, Mark A; Sumarah, Mark W; Bykova, Natalia V; Igamberdiev, Abir U


    During the developmental processes from dry seeds to seedling establishment, the glyoxylate cycle becomes active in the mobilization of stored oils in the scutellum of barley (Hordeum vulgare L.) seeds, as indicated by the activities of isocitrate lyase and malate synthase. The succinate produced is converted to carbohydrates via phosphoenolpyruvate carboxykinase and to amino acids via aminotransferases, while free organic acids may participate in acidifying the endosperm tissue, releasing stored starch into metabolism. The abundant organic acid in the scutellum was citrate, while malate concentration declined during the first three days of germination, and succinate concentration was low both in scutellum and endosperm. Malate was more abundant in endosperm tissue during the first three days of germination; before citrate became predominant, indicating that malate may be the main acid acidifying the endosperm. The operation of the glyoxylate cycle coincided with an increase in the ATP/ADP ratio, a buildup of H2O2 and changes in the redox state of ascorbate and glutathione. It is concluded that operation of the glyoxylate cycle in the scutellum of cereals may be important not only for conversion of fatty acids to carbohydrates, but also for the acidification of endosperm and amino acid synthesis. PMID:27181945

  4. Spatio-temporal dynamics of fructan metabolism in developing barley grains. (United States)

    Peukert, Manuela; Thiel, Johannes; Peshev, Darin; Weschke, Winfriede; Van den Ende, Wim; Mock, Hans-Peter; Matros, Andrea


    Barley (Hordeum vulgare) grain development follows a series of defined morphological and physiological stages and depends on the supply of assimilates (mainly sucrose) from the mother plant. Here, spatio-temporal patterns of sugar distributions were investigated by mass spectrometric imaging, targeted metabolite analyses, and transcript profiling of microdissected grain tissues. Distinct spatio-temporal sugar balances were observed, which may relate to differentiation and grain filling processes. Notably, various types of oligofructans showed specific distribution patterns. Levan- and graminan-type oligofructans were synthesized in the cellularized endosperm prior to the commencement of starch biosynthesis, while during the storage phase, inulin-type oligofructans accumulated to a high concentration in and around the nascent endosperm cavity. In the shrunken endosperm mutant seg8, with a decreased sucrose flux toward the endosperm, fructan accumulation was impaired. The tight partitioning of oligofructan biosynthesis hints at distinct functions of the various fructan types in the young endosperm prior to starch accumulation and in the endosperm transfer cells that accomplish the assimilate supply toward the endosperm at the storage phase. PMID:25271242

  5. Regulation and mechanism of potassium release from barley roots: an in planta 42K+ analysis. (United States)

    Coskun, Devrim; Britto, Dev T; Kronzucker, Herbert J


    Potassium (K(+) ) flux into plant cells is a well-characterized ion transport phenomenon. By contrast, little is known about the mechanisms and regulation of K(+) flux from the cell. Here, we present a radioisotopic analysis of K(+) fluxes from roots of intact barley (Hordeum vulgare), in the context of recent discoveries in the molecular biology and electrophysiology of this process. Plants were labelled with (42)K(+), and kinetics of its release from roots were monitored at low (0.1 mM) or high (1.0 mM) external K concentration, [K(+)](ext), and with the application of channel modulators and nutrient shifts. At 0.1 (but not 1.0) mM [K(+)], where K(+) efflux is thought to be mediated by K(+)-outward-rectifying channels, (42)K(+) efflux was inhibited by the channel blockers barium (Ba(2+)), caesium (Cs(+)), tetraethylammonium (TEA(+)), and lanthanum (La(3+)). Ammonium and nitrate (10 mM) stimulated and inhibited (42)K(+) efflux, respectively, while 10 mM [K(+)](ext) or [Rb(+) ](ext) decreased it. No evidence for the involvement of ATP-binding cassettes, nonselective cation channels, or active K(+)-efflux pumps was found. Our study provides new evidence for the thermodynamic transition between high- and low-affinity transport, from the efflux perspective, identifying the operation of channels at low [K(+)], and the cessation of transmembrane efflux at high [K(+)]. PMID:20731780

  6. [14C]sucrose uptake and labeling of starch in developing grains of normal segl barley

    International Nuclear Information System (INIS)

    Previous work showed that the segl mutant of barley (Hordeum vulgare o Betzes) did not differ from normal Betzes in plant growth, photosynthesis, or fertility, but it produced only shrunken seeds regardless of pollen source. To determine whether defects in sucrose uptake or starch synthesis resulted in the shrunken condition, developing grains of Betzes and segl were cultured in [14C]sucrose solutions after slicing transversely to expose the endosperm cavity and free space. In both young grains (before genotypes differed in dry weight) and older grains (17 days after anthesis, when segl grains were smaller than Betzes), sucrose uptake and starch synthesis were similar in both genotypes on a dry weight basis. To determine if sucrose was hydrolyzed during uptake, spikes of Betzes and segl were allowed to take up [fructose-U-14C]sucrose 14 days after anthesis and the radioactivity of endosperm sugars was examined during 3 hours of incubation. Whereas less total radioactivity entered the endosperm and the endosperm cavity (free space) of segl, in both genotypes over 96% of the label of endosperm sugars was in sucrose, and there was no apparent initial or progressive randomization of label among hexose moieties of sucrose as compared to the free space sampled after 1 hour of incubation. The authors conclude that segl endosperms are capable of normal sucrose uptake and starch synthesis and that hydrolysis of sucrose is not required for uptake in either genotype. Evidence suggests abnormal development of grain tissue of maternal origin during growth of segl grains

  7. Utilization of Mutagenic Treatments for Improving Barley Disease Resistance to Powdery Mildew

    International Nuclear Information System (INIS)

    This program aims to improve barley (Hordeum vulgar L.) resistance to powdery mildew (Erysiphe graminis f. sp. hordi) using mutation induction technique via physical and chemical mutagens. Grains of two local cultivars were treated with gamma rays (150, 250 GY) at a dose rate of 9.02 Rad/ Sec alone or with the concentrations of chemical mutagens, i.e.,EMS (4 and 8 mM), MH (10 and 20 mM) for two hours. After mass selection for the resistance in M2, the two cultivars were varied in their responses to the fifteen treatments. In M3 generation, the frequencies of plant resistance were increased at 20 mM of MH, 8 mM of EMS or 250 GY with either of them for the cultivar G124. However, the same trend was also found at 10 mM of MH, 250GY alone and with 4 or 8 mM EMS for cultivar G125. Moreover, eight mutants were selected from the progenies of M4 plants and evaluated in M5 generation. These mutants are characterized by highly disease resistance and high yield components, one of them has been characterized by non crytics and awnless .The desirable mutants should go to further evaluation for grain yield and grain quality in subsequent generations. (author)

  8. Microarray analysis of spring barley cultivars displaying differing sensitivity to physiological leaf spot (PLS

    Directory of Open Access Journals (Sweden)

    Moran Mary G.


    Full Text Available Physiological leaf spot (PLS is a disorder of spring barley (Hordeum vulgare L., which has become more pronounced in recent years. The initial symptoms are small chlorotic/brown spots on the upper four leaves, which may develop into necrotic lesions with an irregular shape. As PLS occurs on leaves that are directly exposed to sunlight, it is thought that high light stress could be a trigger for the condition. This study concentrates on two cultivars, Cooper and Crusader, which display differential sensitivity to PLS. Biochemical measurements and enzyme assays revealed substantial difference in levels of ascorbate, type III peroxidases, and superoxide dismutase between the chosen cultivars during the 2003 growing season. A global gene expression study, using these field samples, was performed by microarray analysis. This supported the biochemical findings and highlighted additional sets of genes differentially expressed between the cultivars. Transcripts of particular interest, which appeared, included calcium signalling genes, cold-responsive genes and those involved in the assembly of Photosystem I. We conclude that susceptibility to PLS is related to levels of expression of genes with a role in countering the effects of oxidative stress.

  9. Soil Quality Indicators as Affected by a Long Term Barley-Maize and Maize Cropping Systems

    Directory of Open Access Journals (Sweden)

    Anna Corsini


    Full Text Available Most soil studies aim a better characterization of the system through indicators. In the present study nematofauna and soil structure were chosen as indicators to be assess soil health as related to agricultural practices. The field research was carried out on the two fodder cropping systems continuous maize (CM, Zea mays L. and a 3-year rotation of silage-maize – silage-barley (Hordeum vulgare L. with Italian ryegrass (R3 and grain-maize maintained in these conditions for 18 years. Each crop system was submitted to two management options: 1 the high input level (H, done as a conventional tillage, 2 the low input level (L, where the tillage was replaced by harrowing and the manure was reduced by 30%. The effects of the two different cropping systems was assessed on soil nematofauna and soil physic parameters (structure or aggregate stability. Comparison was made of general composition, trophic structure and biodiversity of the nematofauna collected in both systems. Differences in nematode genera composition and distribution between the two systems were also recorded. The monoculture, compared to the three year rotation, had a negative influence on the nematofauna composition and its ecological succession. The Structural Stability Index (SSI values indicate that both the cropping systems had a negative effect on the aggregate stability. The results indicate that nematofauna can be used to assess the effects of cropping systems on soil ecosystem, and therefore be considered a good indicator of soil health to integrate information from different chemical or physical indicators.

  10. Soil Quality Indicators as Affected by a Long Term Barley-Maize and Maize Cropping Systems

    Directory of Open Access Journals (Sweden)

    Barbara Manachini


    Full Text Available Most soil studies aim a better characterization of the system through indicators. In the present study nematofauna and soil structure were chosen as indicators to be assess soil health as related to agricultural practices. The field research was carried out on the two fodder cropping systems continuous maize (CM, Zea mays L. and a 3-year rotation of silage-maize – silage-barley (Hordeum vulgare L. with Italian ryegrass (R3 and grain-maize maintained in these conditions for 18 years. Each crop system was submitted to two management options: 1 the high input level (H, done as a conventional tillage, 2 the low input level (L, where the tillage was replaced by harrowing and the manure was reduced by 30%. The effects of the two different cropping systems was assessed on soil nematofauna and soil physic parameters (structure or aggregate stability. Comparison was made of general composition, trophic structure and biodiversity of the nematofauna collected in both systems. Differences in nematode genera composition and distribution between the two systems were also recorded. The monoculture, compared to the three year rotation, had a negative influence on the nematofauna composition and its ecological succession. The Structural Stability Index (SSI values indicate that both the cropping systems had a negative effect on the aggregate stability. The results indicate that nematofauna can be used to assess the effects of cropping systems on soil ecosystem, and therefore be considered a good indicator of soil health to integrate information from different chemical or physical indicators.

  11. Transgenic barley overexpressing a cytokinin dehydrogenase gene shows greater tolerance to drought stress. (United States)

    Pospíšilová, Hana; Jiskrová, Eva; Vojta, Petr; Mrízová, Katarína; Kokáš, Filip; Čudejková, Mária Majeská; Bergougnoux, Veronique; Plíhal, Ondřej; Klimešová, Jana; Novák, Ondřej; Dzurová, Lenka; Frébort, Ivo; Galuszka, Petr


    Together with auxins, cytokinins are the main plant hormones involved in many different physiological processes. Given this knowledge, cytokinin levels can be manipulated by genetic modification in order to improve agronomic parameters of cereals in relation to, for example, morphology, yield, and tolerance to various stresses. The barley (Hordeum vulgare) cultivar Golden Promise was transformed using the cytokinin dehydrogenase 1 gene from Arabidopsis thaliana (AtCKX1) under the control of mild root-specific β-glucosidase promoter from maize. Increased cytokinin degradation activity was observed positively to affect the number and length of lateral roots. The impact on morphology depended upon the recombinant protein's subcellular compartmentation. While assumed cytosolic and vacuolar targeting of AtCKX1 had negligible effect on shoot growth, secretion of AtCKX1 protein to the apoplast had a negative effect on development of the aerial part and yield. Upon the application of severe drought stress, all transgenic genotypes maintained higher water content and showed better growth and yield parameters during revitalization. Higher tolerance to drought stress was most caused by altered root morphology resulting in better dehydration avoidance. PMID:26773738

  12. Unraveling the Wheat Stem Rust Infection Process on Barley Genotypes Through Relative qPCR and Fluorescence Microscopy. (United States)

    Zurn, J D; Dugyala, S; Borowicz, P; Brueggeman, R; Acevedo, M


    The infection process of wheat stem rust (Puccinia graminis f. sp. tritici) on barley (Hordeum vulgare) is often observed as a mesothetic infection type at the seedling stages, and cultivars containing the same major resistance genes often show variation in the level of resistance provided against the same pathogen race or isolate. Thus, robust phenotyping data based on quantification of fungal DNA can improve the ability to elucidate host-pathogen interaction, especially at early time points of infection when disease symptoms are not yet evident. Quantitative real-time polymerase chain reaction (qPCR) was used to determine the amount of fungal DNA relative to host DNA in infected tissue, providing new insights about fungal development and host resistance during the infection process in this pathosystem. The stem rust susceptible 'Steptoe', resistant cultivars containing only Rpg1 ('Beacon', 'Morex', and 'Chevron'), and the resistant line Q21861 containing Rpg1 and the rpg4/Rpg5 complex were evaluated using the traditional 0-to-4 rating scale, fluorescence microscopy, and qPCR. Statistical differences (P<0.05) were observed in fungal development as early as 24 h postinoculation using the qPCR assay. Fungal development observed using fluorescence microscopy displayed the same hierarchal ordering observed using the qPCR assay. The fungal development occurring at 24 and 48 h postinoculation was vastly different than what was expected using the traditional disease phenotyping methodology; with Steptoe appearing more resistant than the barley lines harboring the known Rpg1 and rpg4/Rpg5 resistance complex. These data indicate potential early prehaustorial resistance contributions in a cultivar considered susceptible based on infection type. Moreover, the temporal differences in resistance suggest pre- and post-haustorial resistance mechanisms in the barley-wheat stem rust infection process, indicating potential host genotype contributions related to basal defense during

  13. Effects of UV-B on activities of enzymes of secondary phenolic metabolism in barley primary leaves

    International Nuclear Information System (INIS)

    Barley (Hordeum vulgare L.) was grown in a glasshouse with 13.56 or 8.84 kJ m−2: biologically effective UV-B (280–320 nm: UV-BBE) simulating levels predicted to occur with 25 or 5% ozone depletion at 40°N latitude, with UV-A (320–400 mm), or with no supplemental irradiation. Activities of L-phenylalanine ammonia-lyase (PAL, EC chalcone-flavanone isomerase (CFI, EC and peroxidase (EC were determined from the 5th through the 30th day after planting. PAL regulates diversion of L-phenylalanine into precursors for secondary phenolics. CFI regulates an early step of flavonoid biosynthesis, and peroxidase activates phenolic precursors for cross-linking and rigidifying cell walls. At all ages UV-B decreased soluble protein leaf−1 but had little effect on fresh weight or CFI activity. Exposure to UV-B decreased peroxidase activity only slightly in early growth stages but decreased it about 40% by day 30. PAL activity was highest 5 days after planting under all treatments, decreased thereafter, and was not detectable in control plants after day 10. UV-B prolonged PAL activity through day 15 in plants given the highest level of UV-B. This UV-B prolongation of PAL activity is correlated with, and is a likely underlying mechanism to explain, the UV-B- enhanced accumulation of flavonoids and ferulic acid in barley primary leaves. The results are discussed in terms of barley leaf adaptation to UV-B as developmental response dependent on conditions of plant growth. (author)

  14. Exploitation of nuclear and cytoplasm variability in Hordeum chilense for wheat breeding


    Rodríguez-Suárez, Cristina; Giménez, María J.; Ramírez, Mª Carmen; Martín Ramírez, Azahara Carmen; Gutierrez, Natalia; Ávila, Carmen M.; Martín Muñoz, Antonio Pedro; Atienza, Sergio G


    Hordeum chilense Roem. et Schultz. is a diploid wild barley native to Chile and Argentina. The high crossability of this species with other members of the Triticeae tribe promoted the development of the new species × Tritordeum Ascherson et Graebner. Hexaploid tritordeum was developed from the hybrid derived from the cross between H. chilense (used as female parent) and durum wheat. The interest of H. chilense is based on the presence of traits potentially useful for wheat breeding, including...

  15. Technologie pěstování a hnojení ječmene (Hordeum) s cílem maximální kvality produktu a jeho využití pro výrobu doplňku stravy "zeleného ječmene"


    DARDOVÁ, Magdaléna


    The aim of this thesis was to study the technology of cultivation and fertilization of barley (Hordeum) for the manufacture of food supplements' green barley ". The main active ingredients in green barley enzymes are superoxide dismutase, catalase, peroxidase, cytochrome oxidase and transhydrogenase. Other ingredients are flavonoids saponarin, glykosylisovitexin and lutonarin. In producing research was determined the best technology for cultivation and fertilization of green barley. Most subs...

  16. Functional characterisation of an intron retaining K+ transporter of barley reveals intron-mediated alternate splicing

    KAUST Repository

    Shahzad, K.


    Intron retention in transcripts and the presence of 5 and 3 splice sites within these introns mediate alternate splicing, which is widely observed in animals and plants. Here, functional characterisation of the K+ transporter, HvHKT2;1, with stably retained introns from barley (Hordeum vulgare) in yeast (Saccharomyces cerevisiae), and transcript profiling in yeast and transgenic tobacco (Nicotiana tabacum) is presented. Expression of intron-retaining HvHKT2;1 cDNA (HvHKT2;1-i) in trk1, trk2 yeast strain defective in K+ uptake restored growth in medium containing hygromycin in the presence of different concentrations of K+ and mediated hypersensitivity to Na+. HvHKT2;1-i produces multiple transcripts via alternate splicing of two regular introns and three exons in different compositions. HKT isoforms with retained introns and exon skipping variants were detected in relative expression analysis of (i) HvHKT2;1-i in barley under native conditions, (ii) in transgenic tobacco plants constitutively expressing HvHKT2;1-i, and (iii) in trk1, trk2 yeast expressing HvHKT2;1-i under control of an inducible promoter. Mixed proportions of three HKT transcripts: HvHKT2;1-e (first exon region), HvHKT2;1-i1 (first intron) and HvHKT2;1-i2 (second intron) were observed. The variation in transcript accumulation in response to changing K+ and Na+ concentrations was observed in both heterologous and plant systems. These findings suggest a link between intron-retaining transcripts and different splice variants to ion homeostasis, and their possible role in salt stress.

  17. Marker-trait associations in Virginia Tech winter barley identified using genome-wide mapping. (United States)

    Berger, Gregory L; Liu, Shuyu; Hall, Marla D; Brooks, Wynse S; Chao, Shiaoman; Muehlbauer, Gary J; Baik, B-K; Steffenson, Brian; Griffey, Carl A


    Genome-wide association studies (GWAS) provide an opportunity to examine the genetic architecture of quantitatively inherited traits in breeding populations. The objectives of this study were to use GWAS to identify chromosome regions governing traits of importance in six-rowed winter barley (Hordeum vulgare L.) germplasm and to identify single-nucleotide polymorphisms (SNPs) markers that can be implemented in a marker-assisted breeding program. Advanced hulled and hulless lines (329 total) were screened using 3,072 SNPs as a part of the US. Barley Coordinated Agricultural Project (CAP). Phenotypic data collected over 4 years for agronomic and food quality traits and resistance to leaf rust (caused by Puccinia hordei G. Otth), powdery mildew [caused by Blumeria graminis (DC.) E.O. Speer f. sp. hordei Em. Marchal], net blotch (caused by Pyrenophora teres), and spot blotch [caused by Cochliobolus sativus (Ito and Kuribayashi) Drechsler ex Dastur] were analyzed with SNP genotypic data in a GWAS to determine marker-trait associations. Significant SNPs associated with previously described quantitative trait loci (QTL) or genes were identified for heading date on chromosome 3H, test weight on 2H, yield on 7H, grain protein on 5H, polyphenol oxidase activity on 2H and resistance to leaf rust on 2H and 3H, powdery mildew on 1H, 2H and 4H, net blotch on 5H, and spot blotch on 7H. Novel QTL also were identified for agronomic, quality, and disease resistance traits. These SNP-trait associations provide the opportunity to directly select for QTL contributing to multiple traits in breeding programs. PMID:23139143

  18. Cloning and molecular characterization of a flavin-dependent oxidoreductase gene from barley. (United States)

    Al-Momany, Bayan; Abu-Romman, Saeid


    Oxophytodienoate reductases (OPRs) are a small group of flavin-dependent oxidoreductases in plants. In this study, a new member of the OPR gene family (HvOPR2) was cloned from barley (Hordeum vulgare L.) using reverse transcription polymerase chain reaction (RT-PCR). The full-length cDNA of HvOPR2 was 1,206 bp with an open reading frame of 1,101 bp, encoding a 366 amino acids long polypeptide with a predicted molecular weight of 40.52 and a theoretical isoelectric point of 6.21. The corresponding genomic clone of HvOPR2 was isolated using the PCR amplification technique and was found to consist of five exons and four introns. Bioinformatic analysis revealed that the deduced HvOPR2 has a considerable homology with other plant OPRs and possessed the flavin oxidoreductase/NADH oxidase substrate-binding domain. Phylogenetic analysis showed that HvOPR2 codes for the OPR of subgroup I, which contains enzymes that are not required for jasmonic acid biosynthesis. Time-course transcriptional profiling of HvOPR2 was analyzed in response to a variety of abiotic stresses and hormonal treatments by semi-quantitative RT-PCR. The HvOPR2 gene was induced in response to drought, hydrogen peroxide, and wounding. Moreover, the corresponding mRNA transcripts were increased in response to jasmonic acid and salicylic acid, but not in response to abscisic acid. These results strongly suggested a role for HvOPR2 in barley defense/response to abiotic stresses and signaling molecules. PMID:24961571

  19. Influence of laser beams on the variability of traits in spring barley

    Directory of Open Access Journals (Sweden)

    Rybiński W.


    Full Text Available Laser is one of the sources for inducing a biostimulation effect and genetic changes in higher plants. Lower doses of laser activate plants, resulting in increasing bioenergetical potential of the cell and higher activation their biochemical and physiological processes. Higher doses influence genetical material of the cell leading to genetic changes of plant traits. The seeds of cv. Maresi spring barley (Hordeum vulgare L. were irradiated with different doses of laser beams and additionally treated with chemomutagens. For the experiment, a helium-neon laser (He-Ne with the wavelength of 632.8 nm and power density 1 mW cm-2 was chosen. In the M1 progeny reduction or stimulation of morphological and yield-contributing traits was estimated. The frequency of chlorophyll mutations was analysed in M2 and selection of morphological mutants was started in this generation. In the M4 generation variability of traits in the mutants obtained was estimated. The results showed that in the M1 progeny lower doses of laser beams (1/2 and 1.0 h induced biostimulation effect of the analysed traits. Higher doses (2.0 h induced reduction of the traits value in comparison to the control cv. Maresi. In addition, laser beams were able to induce chlorophyll and morphological mutations in the M2 progeny. In comparison to the initial cv. Maresi, the mutants were characterised by higher variability of morphological and yieldcontributing traits. The mutants with desirable yield structure parameters were selected. The results obtained show that the helium-neon laser with the wavelength of 632.8 nm can be an effective tool for increasing variability of traits in spring barley.

  20. Main: 3CI2 [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 3CI2 大麦 Barley Hordeum vulgare l. Subtilisin-Chymotrypsin Inhibitor-2a Hordeum Vulgare Chymotr ... ucture Of Barley Serine Proteinase Inhibitor 2 And Comparison ... With The Structures In Crystals J.Mol.Biol. V. 222 ...

  1. Main: 1CNS [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1CNS 大麦 Barley Hordeum vulgare l. 26 Kda Endochitinase 2 Precursor Hordeum Vulgare ...1.1; -.|PIR; A29104; A29104.|PIR; A38664; A38664.|PDB; 1CNS; X-ray; A/B=24-266.|PDB; 2BAA; X-ray; @=24-266.|...SSDYCTPSAQWPCAPGKRYYGRGPIQLSHNYNYGPAGRAIGVDLLANPDLVATDATVGFKTAIWFWMTAQPPKPSSHAVIAGQWSPSGADRAAGRVPGFGVITNIINGGIECGHGQDSRVADRIGFYKRYCDILGVGYGNNLDCYSQRPFA barley_1CNS.jpg ...

  2. Yield and grain quality of spring barley as affected by biomass formation at early growth stages

    Czech Academy of Sciences Publication Activity Database

    Křen, J.; Klem, Karel; Svobodová, I.; Míša, P.; Neudert, L.


    Roč. 60, č. 5 (2014), s. 221-227. ISSN 1214-1178 R&D Projects: GA MZe QI111A133 Keywords : Hordeum vulgare L * above-ground biomass * tillering * grain yield formation * grain protein content Subject RIV: EH - Ecology, Behaviour Impact factor: 1.226, year: 2014

  3. Effects of free and chelated iron on in vitro androgenesis in barley and wheat

    Czech Academy of Sciences Publication Activity Database

    Novotný, J.; Vagera, Jiří; Ohnoutková, Ludmila


    Roč. 63, - (2000), s. 35-40. ISSN 0167-6857 R&D Projects: GA ČR GV521/96/K117 Institutional research plan: CEZ:AV0Z5038910 Keywords : ferrous ions * Hordeum vulgare * Triticum aestivum Subject RIV: EF - Botanics Impact factor: 0.444, year: 2000

  4. EVALUACIÓN DE LA PRODUCCIÓN Y CALIDAD DE CEBADA SEMBRADA SOLA Y ASOCIADA A ESPECIES FORRAJERAS PARA LA PRODUCCIÓN DE ENSILAJE An evaluation of the production and quality of barley sown alone or combined with forage species for the production of silage

    Directory of Open Access Journals (Sweden)

    Adrián Catrileo S.


    Full Text Available Durante la temporada 1999/2000, se evaluó la productividad y calidad de cebada (Hordeum vulgare L. sembrada sola y en asociación con especies forrajeras para ensilaje. El ensayo se realizó en un suelo Ultisol en el secano de la IX Región, en el Centro Regional de Investigación Carillanca del Instituto de Investigaciones Agropecuarias (INIA, 38º41’ lat. Sur, 72º25’long. Oeste, 200 m.s.n.m. Los tratamientos evaluados correspondieron a cebada sembrada sola (T1 y las asociaciones de cebada/trébol rosado (Trifolium pratense (T2, cebada/ballica (Lolium multiflorum de rotación (T3 y cebada/pradera ballica/trébol blanco (Lolium perenne/Trifolium repens (T4. El diseño experimental fue de bloques completos al azar, con tres repeticiones, cortando cada tratamiento en siete estados fenológicos de la cebada. La altura y el contenido de MS de la cebada no presentaron diferencias significativas (P > 0,05 por efecto de los distintos tratamientos y estados de corte evaluados. La cebada asociada con las forrajeras no aumentó la producción de materia seca, salvo en los estados de antésis en progreso y grano acuoso-lechoso (P During the 1999/2000 season, the productivity and quality of barley (Hordeum vulgare L. sown alone or in association with forage species for silage was evaluated. The study was conducted in an Ultisol in the dryland of the IX Region at the Carillanca Regional Research Center of the National Agricultural Research Institute (INIA, 38º41’ S lat, 72º25’W long, 200 m.a.s.l. The treatments evaluated were: barley alone (T1; barley with red clover (Trifolium pratense (T2; barley with rotational ryegrass (Lolium multiflorum (T3; and barley in mixture with perennial ryegrass/white clover (Lolium perenne/Trifolium repens (T4. The experimental design was a randomized complete block design, with three replicates, cutting each treatment at seven phenological stages of the barley crop. The height and DM content of the barley did not

  5. Controle de azevém (Lolium multiflorum L., e gorga (Spergula arvensis L. e seletividade de herbicidas as culturas de trigo, cevada e centeio Control of rye grass (Lolium multiforum L. and corn spurry (Spergula arvensis L., and selectivity of herbicides to wheat, barley, and rye crops

    Directory of Open Access Journals (Sweden)

    J. A. R. O. Velloso


    Full Text Available Foram realizados três experimentos a campo em 1980, no Centro Nacional de Pesquisa de Trigo/EMBRAPA, Passo Fundo, RS, visando conhecer o comportamento dos herbicidas diclofop, dicamba, a associação 2,4 D com dicamba e a mistura diclofop + (2,4 D + dicamba, no controle de azevém (Lolium multiflorum L. e gorga (Spergula arvensis L.. Ao mesmo tempo foi avaliada a seletividade que estes herbicidas apresentam às culturas de trigo (Triticum aestivum L., cevada (Hordeum vulgare L. e centeio (Secale cereale L.. Os resultados da avaliação visual de fitotoxicidade mostra ram que o dicamba causou o maior grau de injúria para as três culturas. Cevada mostrou ser a cultura mais sensível ao dicamba na fase inicial. Trigo, cevada e centeio foram tolerantes ao diclofop. A mistura diclofop + (2,4 D + dicamba não controlou o azevém nas três culturas. Esta mistura apresentou ainda redução no controle de gorga, nas culturas de cevada e centeio. Dicamba ocasionou redução no rendimento de grãos das culturas, mostrando ser pouco seletivo na dose testada. Centeio sofreu uma redução no rendimento de grãos causada por diclofop, enquanto que a mistura diclofop + (2,4 D + dicamba foi seletiva para todas as culturas.Three field experiments were carried out, in 1980, at the National Wheat Research Center/ EMBRAPA, Passo Fundo, RS. They aimed at testnig the responses of herbicides diclofop, dicamba, the association 2,4 D with dicamba, and the mixture diclofop + (2,4 D + dicamba in the control of rye grass (Lolium multiflorum L. and corn spurry (Spergula arvensis L.. Simultaneously, the selectivity of these herbicides to wheat (Triticum aestivum L., barley (Hordeum vulgare L., and rye (Secale cereale L. was evaluated. The results of visual evaluation of phytotoxicity showed that dicamba caused the greatest degree of injury to the three crops studied. Barley was the most sensitive crop to dicamba in the initial growth stage. Wheat, barley, and rye were

  6. Control of α-amylase mRNA accumulation by gibberellic acid and calcium in barley aleurone layers

    International Nuclear Information System (INIS)

    Pulse-labeling of barley (Hordeum vulgare L. cv Himalaya) aleurone layers incubated for 13 hours in 2.5 micromolar gibberellic acid (GA3) with or without 5 millimolar CaCl2 shows that α-amylase isozymes 3 and 4 are not synthesized in vivo in the absence of Ca2+. No difference was observed in α-amylase mRNA levels between layers incubated for 12 hours in 2.5 micromolar GA3 with 5 millimolar CaCl2 and layers incubated in GA3 alone. RNA isolated from layers incubated for 12 hours in GA3 with and without CA2+. A cDNA clone for α-amylase was isolated and used to measure α-amylase mRNA levels in aleurone layers incubated in the presence and absence of Ca2+ was translated in vitro and was found to produce the same complement of translation products regardless of the presence of Ca2+ in the incubation medium. Immunoprecipitation of translation products showed that the RNA for α-amylase synthesized in Ca2+-deprived aleurone layers was translatable. Ca2+ is required for the synthesis of α-amylase isozymes 3 and 4 at a step after mRNA accumulation and processing

  7. Impact of Acacia tortilis ssp. raddiana tree on wheat and barley yield in the south of Tunisia (United States)

    Noumi, Zouhaier; Abdallah, Fathia; Torre, Franck; Michalet, Richard; Touzard, Blaise; Chaieb, Mohamed


    In the past, Acacia tortilis ssp. raddiana (Savi) Brenan colonised thousands of hectares in central and southern Tunisia. Nowadays, the geographical distribution of A. tortilis ssp. raddiana is restricted to the National Park of Bou-Hedma (central Tunisia). The Acacia is of considerable interest for local populations and may be considered as a "foundation species" under arid climate. This study examines the effects of Acacia canopy on soil fertility and cereal productivity. The improvement in soil fertility and microclimate provided by A. tortilis ssp. raddiana is known to facilitate the establishment of new species, but little is known about the interaction between the tree species and the cereals cultivated by local farmers. We studied the effect of A. tortilis ssp. raddiana canopy on the yield of three cereals crops ( Hordeum vulgare L., Triticum sativum L. and Triticum aestivum L.). We seeded 168 plots (15 × 15 m) under the tree canopy and in open areas on four different landform types (glacis, plain, wadis, and jessours) and measured cereal yield over two contrasting years (wet and dry). We found that: (1) precipitation and geomorphology are more important in determining cereal yield than canopy cover, (2) these effects on water availability are species-specific with no effect on the stress-tolerant barley. We finally discuss the potential negative effects of Acacia trees which may have balanced the positive effects found for nutrient in our study.

  8. Effects of sulphur dioxide on the development of fungal diseases of winter barley in an open-air fumigation system

    Energy Technology Data Exchange (ETDEWEB)

    Mansfield, P.J.; Bell, J.N.B.; Wheeler, B.E.J. (Imperial Coll., Ascot (UK)); McLeod, A.R. (National Power Technology and Environmental Centre, Leatherhead (UK))


    The development of fungal diseases was monitored through three consecutive growing seasons (1984-1985, 1985-1986 and 1986-1987) on field plots of winter barley (Hordeum vulgare L.) cv. 'Igri' exposed to sulfur dioxide (SO{sub 2}) concentrations in the range 0.005-0.048 microliter l{sup {minus}1} using an open-air fumigation system. In each season the incidence and severity of powdery mildew (Erysiphe graminis D.C. ex Merat f.sp. hordei Em. Marchal) increased and leaf blotch (Rhynchosporium secalis Oudem J.J. Davis) decreased in plots exposed to elevated levels of SO{sub 2} (0.014-0.048 microliter l{sup {minus}1} SO{sub 2}) compared with control plots exposed to background levels of 0.005-0.009 microliter l{sup {minus}1} SO{sub 2}. The apparent infection rate of powdery mildew was also greater in SO{sub 2}-treated plots. The effects of SO{sub 2} exposure on eyespot (Pseudocercosporella herpotrichoides (Fron) Deighton) and black ear moulds (Cladosporium and Alternaria spp.) were variable. Sharp eyespot (Rhizoctonia cerealis van der Hoeven), Fusarium foot rot, brown rust (Puccinia hordei Otth.), Septoria nodorum Berk., net blotch (Pyrenophora teres Sacc.) and Botrytis spp. infection on the ear were all apparently unaffected by SO{sub 2}. 3 figs., 36 refs., 4 tabs.

  9. Micro-PIXE investigations of apoplastic iron in freeze-dried root cross-sections of soil grown barley

    International Nuclear Information System (INIS)

    Freeze-dried cryo-sections of barley roots (Hordeum vulgare L. cv. Alexis) were used to investigate the possible role of the root apoplast as an iron-storage pool for plants; this possibility has been a matter of controversy. Micro-PIXE analyzes in pixel mode were complemented by the STIM technique. Data were analyzed using the new Heidelberg software package BIOPIXE, which provides true elemental maps of inhomogeneous samples such as freeze-dried cross-sections of roots. The maps clearly show a high heterogeneity of the iron distribution in roots between adjacent cell layers. Accumulations of iron were observed in the cell walls of the outermost cell layers of the roots and at the endodermis. Based on the correlation between iron and soil related elements like titanium, aluminum and silicon, most of the iron located at the root surface could be attributed to soil contamination. It could also be shown that these soil contaminations lead to an overestimation of the apoplastic iron concentrations determined by methods commonly used in the botanical field. Besides this, low accumulations of iron were observed in the cell walls of the outmost cell layers of the roots. This may indicate that the root apoplast may have a minor function in iron nutrition

  10. The barley EST DNA Replication and Repair Database (bEST-DRRD as a tool for the identification of the genes involved in DNA replication and repair

    Directory of Open Access Journals (Sweden)

    Gruszka Damian


    Full Text Available Abstract Background The high level of conservation of genes that regulate DNA replication and repair indicates that they may serve as a source of information on the origin and evolution of the species and makes them a reliable system for the identification of cross-species homologs. Studies that had been conducted to date shed light on the processes of DNA replication and repair in bacteria, yeast and mammals. However, there is still much to be learned about the process of DNA damage repair in plants. Description These studies, which were conducted mainly using bioinformatics tools, enabled the list of genes that participate in various pathways of DNA repair in Arabidopsis thaliana (L. Heynh to be outlined; however, information regarding these mechanisms in crop plants is still very limited. A similar, functional approach is particularly difficult for a species whose complete genomic sequences are still unavailable. One of the solutions is to apply ESTs (Expressed Sequence Tags as the basis for gene identification. For the construction of the barley EST DNA Replication and Repair Database (bEST-DRRD, presented here, the Arabidopsis nucleotide and protein sequences involved in DNA replication and repair were used to browse for and retrieve the deposited sequences, derived from four barley (Hordeum vulgare L. sequence databases, including the “Barley Genome version 0.05” database (encompassing ca. 90% of barley coding sequences and from two databases covering the complete genomes of two monocot models: Oryza sativa L. and Brachypodium distachyon L. in order to identify homologous genes. Sequences of the categorised Arabidopsis queries are used for browsing the repositories, which are located on the ViroBLAST platform. The bEST-DRRD is currently used in our project during the identification and validation of the barley genes involved in DNA repair. Conclusions The presented database provides information about the Arabidopsis genes involved in

  11. Cama de Broiler y Grano de Cebada Entero o Molido en Raciones de Engorda Invernal de Novillos Broiler Litter and Whole or Milled Barley Grain in Winter Steer Fattening Rations

    Directory of Open Access Journals (Sweden)

    Claudio Rojas G


    Full Text Available El estudio tuvo el objetivo de evaluar la respuesta animal al consumo de raciones de engorda formuladas con cama de broiler y grano de cebada (Hordeum vulgare L. entero o molido incorporado al ensilaje de praderas de ballica-trébol blanco (Lolium perenne L.-Trifolium repens L. al momento de su elaboración. Los tratamientos fueron: 1 ensilaje, cama de broiler y grano de cebada molido, mezclados al momento de la alimentación invernal; 2 ensilaje adicionado con cama de broiler al momento de ensilar y grano de cebada molido adicionado al momento de la alimentación invernal; 3 ensilaje adicionado con cama de broiler y grano de cebada molido al momento de ensilar; y 4 ensilaje adicionado con cama de broiler y grano de cebada entero al momento de ensilar. Los incrementos diarios de PV fueron de 1,086; 1,099; 1,074 y 1,111 kg animal-1 (P ≥ 0,05; el consumo de alimentos de 8,7; 8,7; 8,4 y 8,4 kg MS animal-1 y las eficiencias de conversión de alimentos de 8; 7,9; 7,9 y 7,5 kg MS alimento consumido kg-1 incremento PV para los tratamientos 1, 2, 3 y 4, respectivamente. Se concluye que la incorporación de cama de broiler sola o con grano de cebada al ensilaje de praderas, al momento de su confección, no afecta el consumo ni los incrementos de PV de los novillos y la incorporación de grano de cebada entero o molido al momento de realizar el ensilaje, produce respuestas similares en los novillos.The objective of this study was to evaluate the animal response to feeding with fattening rations which included ryegrass-white clover (Lolium perenne L.-Trifolium repens L. pasture silage, broiler litter, and milled or whole barley (Hordeum vulgare L grain.. Treatments were 1 pasture silage based ration with broiler litter and milled barley supplemented at the time of winter feeding; 2 pasture silage based ration with broiler litter incorporated to the silo at the date of conservation and milled barley supplemented at feeding time; 3 pasture silage based

  12. Effect of Silicon on Leaf Ultrastructure,Chlorophyll Content and Photosynthetic Activity of Barley Under Salt Stress

    Institute of Scientific and Technical Information of China (English)



    Two contrasting cultivars of barley(Hordeum vulgare L.):Kepin No.7(salt sensitive),and Jian 4(salt tolerant)were grown in a hydropon ics system with 2 NaCl levels:60 mmol NaCl L-1 and 120 mmol NaCl L-1 ,and 3 Si levels:0 mmol Si L-1 ,0.5 mmol Si L-1 and 1.0 mmol Si L-1 (as silicic acid).Compared with the plants treated with 60 mmol NaCl L-1 alone,the leaf chlorophyll contents of plants rreated with salt and Si increased significantly ofr salt-sensitive cultivar at tillering stage,but for alt-tolerant cultivar,the addition of Si resulted in an obivous increase in the leaf chlorophyll content of plants exposed to 120 mmol NaCl L-1 ,However,this Si-enhancement of leaf chlorophyll content was also observed in the salttolerant plants at joninting stage,but not in the salt-sensitive plants.Moreover,leaf chlorophyll content was consistently higher for the salt-tolerant cultivar than for the salt-sensitive cultivar irrespective of salt and/or Si treatment .Compared with the plants treated with sal alont ,net CO2 assimilation rate in plant leaves increased significantly for both cultivars when treated with salt and Si, Teh addition of Si to the salt teatment was found to improve the cell ultrastructure of leaves.Under salt stress condition,the double membranes of chloroplasts disappeared,but membrane integrity was markedly improved in the salt treatment supplemented with Si.Silicon was also found to ameliorate the damage to the ultrasturcture of chloroplast granae which appeared to be disintegrated and vague in salt treatments without added Si.The results support previous work which showed that Si decreases the permeability of plasma membranes of salt-stressed barley,thus mitigating salt damage.

  13. Lipoic acid and redox status in barley plants subjected to salinity and elevated CO{sub 2}

    Energy Technology Data Exchange (ETDEWEB)

    Perez-Lopez, U.; Robredo, A.; Mena-Petite, A.; Munoz-Rueda, A. (Univ. del Pais Vasco/EHU, Dept. de Biologia Vegetal y Ecologia, Bilbao (Spain)); Lacuesta, M. (Univ. del Pais Vasco/EHU, Dept. de Biologia Vegetal y Ecologia, Vitoria-Gasteiz (Spain)); Sgherri, C.; Navari-Izzo, F. (Univ. di Pisa, Dipartimento di Chimica e Biotecnologie Agrarie, Pisa (Italy))


    Future environmental conditions will include elevated concentrations of salt in the soil and an elevated concentration of CO{sub 2}in the atmosphere. Because these environmental changes will likely affect reactive oxygen species (ROS) formation and cellular antioxidant metabolism in opposite ways, we analyzed changes in cellular H{sub 2}O{sub 2} and non-enzymatic antioxidant metabolite [lipoic acid (LA), ascorbate (ASA), glutathione (GSH)] content induced by salt stress (0, 80, 160 or 240 mM NaCl) under ambient (350 mumol mol-1) or elevated (700 mumol mol-1) CO{sub 2}concentrations in two barley cultivars (Hordeum vulgare L.) that differ in sensitivity to salinity (cv. Alpha is more sensitive than cv. Iranis). Under non-salinized conditions, elevated CO{sub 2}increased LA content, while ASA and GSH content decreased. Under salinized conditions and ambient CO{sub 2}, ASA increased, while GSH and LA decreased. At 240 mM NaCl, H{sub 2}O{sub 2} increased in Alpha and decreased in Iranis. When salt stress was imposed at elevated CO{sub 2}, less oxidative stress and lower increases in ASA were detected, while LA was constitutively higher. The decrease in oxidative stress could have been because of less ROS formation or to a higher constitutive LA level, which might have improved regulation of ASA and GSH reductions. Iranis had a greater capacity to synthesize ASA de novo and had higher constitutive LA content than did Alpha. Therefore, we conclude that elevated CO{sub 2}protects barley cultivars against oxidative damage. However, the magnitude of the positive effect is cultivar specific. (author)

  14. Metabolism of hydroxypyruvate in a mutant of barley lacking NADH-dependent hydroxypyruvate reductase, an important photorespiratory enzyme activity

    International Nuclear Information System (INIS)

    A mutant of barley (Hordeum vulgare L.), LaPr 88/29, deficient in NADH-dependent hydroxypyruvate reductase (HPR) activity has been isolated. The activities of both NADH (5%) and NADPH-dependent (19%) HPR were severely reduced in this mutant compared to the wild type. Although lacking an enzyme in the main carbon pathway of photorespiration, this mutant was capable of CO2 fixation rates equivalent to 75% of that of the wild type, in normal atmospheres and 50% O2. There also appeared to be little disruption to the photorespiratory metabolism as ammonia release, CO2 efflux and 14CO2 release from L-[U-14C]serine feeding were similar in both mutant and wild-type leaves. When leaves of LaPr 88/29 were fed either [14C]serine or 14CO2, the accumulation of radioactivity was in serine and not in hydroxypyruvate, although the mutant was still able to metabolize over 25% of the supplied [14C]serine into sucrose. After 3 hours in air the soluble amino acid pool was almost totally dominated by serine and glycine. LaPr 88/29 has also been used to show that NADH-glyoxylate reductase and NADH-HPR are probably not catalyzed by the same enzyme in barley and that over 80% of the NADPH-dependent HPR activity is due to the NADH-dependent enzyme. We also suggest that the alternative NADPH activity can metabolize a proportion, but not all, of the hydroxypyruvate produced during photorespiration and may thus form a useful backup to the NADH-dependent enzyme under conditions of maximal photorespiration

  15. Induced Variations in Brassinosteroid Genes Define Barley Height and Sturdiness, and Expand the Green Revolution Genetic Toolkit

    Czech Academy of Sciences Publication Activity Database

    Dockter, C.; Gruszka, D.; Braumann, I.; Druka, A.; Franckowiak, J.; Muller, A.H.; Oklešťková, Jana; Schulz, B.; Zakhrabekova, S.; Hansson, M.


    Roč. 166, č. 4 (2014), s. 1912-1927. ISSN 0032-0889 R&D Projects: GA MŠk LK21306 Institutional support: RVO:61389030 Keywords : HORDEUM-VULGARE L. * GIBBERELLIN-SYNTHESIS * SIGNAL-TRANSDUCTION Subject RIV: EF - Botanics Impact factor: 6.841, year: 2014

  16. Barley germination

    DEFF Research Database (Denmark)

    Daneri-Castro, Sergio N.; Svensson, Birte; Roberts, Thomas H.


    Germination of barley grain is central to the malting industry and is a valuable model for cereal grain germination. Our current understanding of the complexity of germination at the molecular level is facilitated by access to genomic, transcriptomic, proteomic and metabolomic data. Here we review...... recent progress in barley germination research and discuss the factors to be considered when designing 'omics' experiments and interpreting the results. These factors include the structural and functional relationships between the various tissues of the barley caryopsis and the timing of the events...

  17. How Specific is Non-Hypersensitive Host and Nonhost Resistance of Barley to Rust and Mildew Fungi?

    Institute of Scientific and Technical Information of China (English)

    Niks R. E.


    Full nonhost resistance can be deifned as immunity, displayed by an entire plant species against all genotypes of a plant pathogen. Interesting biological questions are, whether the genes responsible for the nonhost status of a plant species have a general or a specific effectiveness to heterologous (“nonhost”) pathogens? Is the nonhost resistance to pathogens of plant species that are related to the nonhost based onR-genes or on other types of genes?We study this question in barley (Hordeum vulgareL.), which is a near-nonhost to several rusts (Puccinia) of cereals and grasses. By crosses and selection we accumulated susceptibility and developed an experimental line, SusPtrit, with high susceptibility to at least nine different heterologous rust taxa such as the wheat andAgropyron leaf rusts (P. triticina andP. persistens, respectively). At the microscopic level there is also some variation among barley accessions in the degree that the heterologous wheat powdery mildew (Blumeria graminisf.sp.tritici) is able to form haustoria in epidermal cells. So, also the genetics of the variation in level of nonhost resistance to heterologous mildew fungi can be studied in barley. Our data obtained on mapping populations involving three regular nonhost-immune accessions (Vada, Cebada Capa and Golden Promise) suggest that nonhost resistance is the joined effect of multiple, quantitative genes (QTLs) and very occasionally a major gene (R-gene?) is involved. Most QTLs have effect to only one or two heterologous rusts, but some have a wider spectrum. This was conifrmed in a set of QTL-NILs. Those QTL-NILs are used to ifne-map the effective genes. In some cases, a QTL region with effectiveness to several heterologous rusts might be a cluster of genes with a more narrow spectrum of effectiveness. Our evidence suggests that nonhost resistance in barley to rust and powdery mildew fungi of related Gramineae is not due toR-genes, but to pathogen species-speciifc quantitative

  18. Phenotypic selection and regulation of reproduction in different environments in wild barley

    NARCIS (Netherlands)

    Volis, S.; Verhoeven, K.J.F.; Mendlinger, S.; Ward, D.


    Plasticity of the phenotypic architecture of wild barley, Hordeum spontaneum, was studied in response to water and nutrient stress. Direct and indirect selection on several vegetative and reproductive traits was estimated and path analysis used to reveal how regulating pathways via maternal investme

  19. Barley uptake of N deposited in the rhizosphere of associated field pea

    DEFF Research Database (Denmark)

    Jensen, E.S.


    N deposited in the rhizosphere of a legume may contribute to the N-nutrition of an intercropped non-legume. The process of deposition and subsequent uptake by a neighbouring plant is often termed N-transfer. The N-transfer from field pea (Pisum sativum L.) to associated spring barley (Hordeum...

  20. Phytosiderophores influence on cadmium mobilization and uptake by wheat and barley plants. (United States)

    Shenker, M; Fan, T W; Crowley, D E


    A constant anthropogenic release of cadmium to the environment has resulted in a continuous buildup of Cd in soils. Uptake and accumulation of Cd in plant tissue and in grains may lead to food chain transfer to humans. Application of synthetic chelates was suggested to increase metal mobilization and facilitate phytoextraction as a means for the remediation of metal-polluted soils. However, most of the chelate-extracted metal may be leached rather than mobilized to plant roots. In contrast to the synthetic chelates added to soils, plant-produced chelators called phytosiderophores (PS) are excreted directly to the rhizosphere. Previous studies have shown that PS facilitate uptake of Zn and Fe by graminaceous plants. In this study, a two-step PS mediation of Cd uptake was hypothesized: (i) extraction and chelation in the soil solution, and (ii) delivery of the chelated Cd to the uptake system of the plant. We examined Cd extraction by PS, the synthetic chelate HEDTA [N-(2-hydroxyethyl)-ethylenediaminetriacetic acid], and a fungal siderophore rhizoferrin from solid-phase Cd phosphate at pH 7.3 with and without Fe competition in the presence of Ca and Mg as additional competing metals. While rhizoferrin did not extract Cd, PS and HEDTA did extract Cd even in the presence of Fe. Yet, uptake of Cd by wheat (Triticum aestivum L.) and barley (Hordeum vulgare L.) plants was not significantly influenced by Fe stress, but instead was controlled primarily by Cd2+ activity in solution. These results suggest that even though Cd may be mobilized by PS, there is no significant uptake of the Cd-PS complex by the plant roots. PMID:11790018

  1. Nitric Oxide and Reactive Oxygen Species Mediate Metabolic Changes in Barley Seed Embryo during Germination. (United States)

    Ma, Zhenguo; Marsolais, Frédéric; Bykova, Natalia V; Igamberdiev, Abir U


    The levels of nitric oxide (NO) and reactive oxygen species (ROS), ATP/ADP ratios, reduction levels of ascorbate and glutathione, expression of the genes encoding proteins involved in metabolism of NO and activities of the enzymes involved in fermentation and in metabolism of NO and ROS were studied in the embryos of germinating seeds of two barley (Hordeum vulgare L.) cultivars differing in dormancy level. The level of NO production continuously increased after imbibition while the level of nitrosylated SH-groups in proteins increased. This corresponded to the decrease of free SH-groups in proteins. At early stage of germination (0-48 h post imbibition) the genes encoding class 1 phytoglobin (the protein scavenging NO) and S-nitrosoglutathione reductase (scavenging S-nitrosoglutathione) were markedly expressed. More dormant cultivar exhibited lower ATP/ADP and ascorbate/dehydroascorbate ratios and lower lactate and alcohol dehydrogenase activities, while the production of NO and nitrosylation of proteins was higher as compared to the non-dormant cultivar. The obtained data indicate that at the onset of germination NO is actively generated causing nitrosylation of SH-groups and a switch from respiration to fermentation. After radicle protrusion the metabolism changes in a more reducing type as recorded by ratio of reduced and oxidized glutathione and ascorbate. The turnover of NO by the scavenging systems (phytoglobin, S-nitrosoglutathione reductase and interaction with ROS) might contribute to the maintenance of redox and energy balance of germinating seeds and lead to alleviation of dormancy. PMID:26909088

  2. From Accumulation to Degradation: Reprogramming Polyamine Metabolism Facilitates Dark-Induced Senescence in Barley Leaf Cells (United States)

    Sobieszczuk-Nowicka, Ewa; Kubala, Szymon; Zmienko, Agnieszka; Małecka, Arleta; Legocka, Jolanta


    The aim of this study was to analyze whether polyamine (PA) metabolism is involved in dark-induced Hordeum vulgare L. ‘Nagrad’ leaf senescence. In the cell, the titer of PAs is relatively constant and is carefully controlled. Senescence-dependent increases in the titer of the free PAs putrescine, spermidine, and spermine occurred when the process was induced, accompanied by the formation of putrescine conjugates. The addition of the anti-senescing agent cytokinin, which delays senescence, to dark-incubated leaves slowed the senescence-dependent PA accumulation. A feature of the senescence process was initial accumulation of PAs at the beginning of the process and their subsequent decrease during the later stages. Indeed, the process was accompanied by both enhanced expression of PA biosynthesis and catabolism genes and an increase in the activity of enzymes involved in the two metabolic pathways. To confirm whether the capacity of the plant to control senescence might be linked to PA, chlorophyll fluorescence parameters, and leaf nitrogen status in senescing barley leaves were measured after PA catabolism inhibition and exogenously applied γ-aminobutyric acid (GABA). The results obtained by blocking putrescine oxidation showed that the senescence process was accelerated. However, when the inhibitor was applied together with GABA, senescence continued without disruption. On the other hand, inhibition of spermidine and spermine oxidation delayed the process. It could be concluded that in dark-induced leaf senescence, the initial accumulation of PAs leads to facilitating their catabolism. Putrescine supports senescence through GABA production and spermidine/spermine supports senescence-dependent degradation processes, is verified by H2O2 generation. PMID:26779231

  3. Yield response of Bere, a Scottish barley landrace, to cultural practices and agricultural inputs

    Directory of Open Access Journals (Sweden)

    Peter J. Martin


    Full Text Available There is very little documented about the response of cereal landraces to modern agricultural practices. Bere is a Scottish barley (Hordeum vulgare L. landrace which is grown in Orkney to supply meal for baking. A recent research programme has improved yields and the security of the Bere harvest, making it possible to supply a new market for grain to produce specialist whiskies. At the start of this research, a survey of Orkney farmers who had grown Bere since the 1980s showed that most had planted it at the traditional time in mid-May, used few inputs and considered the main constraints of the crop to be low yield (2.8 to 3.8 t/ha and susceptibility to lodging. Three years of trials in Orkney between 2003 and 2005 showed very significant increases in grain yield (17-76% and thousand grain weight from planting Bere earlier, in the second half of April. This also had the advantage of an earlier and more secure harvest. Yields showed smaller, but often significant, increases (5-11% from applying mineral fertiliser, growth regulator or fungicide, while combinations of growth regulator and fungicide increased yields from 10- 22%. In spite of usually increasing grain yield, growth regulator did not always control lodging. Although the use of inputs often increased the gross margins of growing Bere, a trial in 2005 showed that early planting was a more cost effective single intervention than either the use of fungicide or growth regulator. By increasing grower profits and reducing harvesting risks, these results have made it viable for more farmers to grow Bere in its region of origin, providing growers and end-users with additional income and contributing to the in situ conservation of this landrace.

  4. Effect of growth temperature on chloroplast structure and activity in barley. (United States)

    Smillie, R M; Critchley, C; Bain, J M; Nott, R


    Seedlings of barley (Hordeum vulgare L. cv. Abyssinian) were grown at constant temperature and light intensity and the properties and structure of chloroplasts in the primary leaf were examined. Seventeen growth temperatures ranging from 2 to 37 C were employed. Three major effects of the growth temperature were seen. (a) At very low and high growth temperatures chloroplast biogenesis was inhibited. This occurred in plants grown at temperatures above 32 C while growth at 2 C resulted in a mixed population of pale yellow, pale green, and green plants. (b) Chloroplasts were produced at all other temperatures tested but growth temperatures within a few degrees of those inhibitory to chloroplast development resulted in chloroplasts with abnormal properties and structure. Chloroplasts in the green plants grown at 2 and 5 C showed a number of structural peculiarities, including a characteristic crimping of granal thylakoids. Photoreductive activity, measured using ferricyanide as the Hill oxidant in the presence of gramicidin D, was high, but this activity in chloroplasts isolated from plants grown at 2 C showed thermal inactivation at temperatures 5 degrees lower than was the case with plants grown at higher temperatures. High growth temperatures (30 to 32 C) yielded chloroplasts with reduced photoreductive activity and a tendency toward the formation of large grana and disorientation of the lamellar systems with respect to one another. Chloroplasts of the most affected plants (grown at 32 C) frequently contained a very large elongated granum, with narrow intrathylakoid spaces. (c) Photoreductive activity was not constant at intermediate growth temperatures but steadily declined with decreasing growth temperatures between 27 and 11 C. Some alterations in chloroplast structure were also observed.The changes in chloroplast activity and structure indicate that acclimation to temperature takes place over the entire temperature range in which chloroplast development is

  5. Mechanisms of Salt Tolerance in Transgenic Arabidopsis thaliana Carrying a Peroxisomal Ascorbate Peroxidase Gene from Barley

    Institute of Scientific and Technical Information of China (English)

    XU Wei-Feng; SHI Wei-Ming; A. UEDA; T. TAKABE


    Ascorbate peroxidases (APX), localized in the cytosol, peroxisome, mitochondria, and chloroplasts of plant cells,catalyze the reduction of H2O2 to water by using ascorbic acid as the specific electron donor. To determine the role of peroxisomal type ascorbate peroxidasc (pAPX), an antioxidant enzyme, in protection against salt-induced oxidative stress, transgenic Arabidopsis thaliana plant carrying a pAPX gene (HvAPX1) from barley (Hordeum vulgare L.) was analyzed. The transgenic line pAPX3 was found to be more tolerant to salt stress than the wild type. Irrespective of salt stress, there were no significant differences in Na+, K+, Ca2+, and Mg2+ contents and the ratio of K+ to Na+ between pAPX3 and the wild type. Clearly, the salt tolerance in pAPX3 was not due to the maintenance and reestablishment of cellular ion homeostasis. However, the degree of H2O2 and lipid peroxidation (measured as the levels of malondialdehyde)accumulation under salt stress was higher in the wild type than in pAPX3. The mechanism of salt tolerance in transgenic pAPX3 can thus be explained by reduction of oxidative stress injury. Under all conditions tested, activities of superoxide,glutathionc reductase, and catalase were not significantly different between pAPX3 and the wild type. In contrast, the activity of APX was significantly higher in the transgcnic plant than in wild type under salt stress. These results suggested that in higher plants, HvAPX1 played an important role in salt tolerance and was a candidate gene for developing salt-tolerant crop plants.

  6. Comparative induction of nitrate reductase by nitrate and nitrite in barley leaves (United States)

    Aslam, M.; Rosichan, J. L.; Huffaker, R. C.


    The comparative induction of nitrate reductase (NR) by ambient NO3- and NO2- as a function of influx, reduction (as NR was induced) and accumulation in detached leaves of 8-day-old barley (Hordeum vulgare L.) seedlings was determined. The dynamic interaction of NO3- influx, reduction and accumulation on NR induction was shown. The activity of NR, as it was induced, influenced its further induction by affecting the internal concentration of NO3-. As the ambient concentration of NO3- increased, the relative influences imposed by influx and reduction on NO3- accumulation changed with influx becoming a more predominant regulant. Significant levels of NO3- accumulated in NO2(-)-fed leaves. When the leaves were supplied cycloheximide or tungstate along with NO2-, about 60% more NO3- accumulated in the leaves than in the absence of the inhibitors. In NO3(-)-supplied leaves NR induction was observed at an ambient concentration of as low as 0.02 mM. No NR induction occurred in leaves supplied with NO2- until the ambient NO2- concentration was 0.5 mM. In fact, NR induction from NO2- solutions was not seen until NO3- was detected in the leaves. The amount of NO3- accumulating in NO2(-)-fed leaves induced similar levels of NR as did equivalent amounts of NO3- accumulating from NO3(-)-fed leaves. In all cases the internal concentration of NO3-, but not NO2-, was highly correlated with the amount of NR induced. The evidence indicated that NO3- was a more likely inducer of NR than was NO2-.

  7. Research Progress in Extraction Metheds and Functions of Barley Polyphenols%大麦多酚的提取工艺及功能研究进展

    Institute of Scientific and Technical Information of China (English)

    张玉红; 柴玉琼; 陈建澍; 韩凝; 朱睦元


    As secondary metabolites commonly existent in plants, polyphenols have a variety of special physiological functions such as anti-oxidation, anti-cancer, anti-aging, reducing blood sugar and blood lipid levels, and preventing cardiovascular diseases. Barley ( Hordeum vulgare) has been used as a significant source of natural antioxidants, due to its high contents of phenolic compounds such as catechin and proanthocyanidins . The total polyphenol content in barley can be up to 1200~1500 mg/kg. Based on the documented researches, this article summarized the varieties and contents of barely polyphenols, their extraction and determination methods, as well as the research progress in their application to animal feed, brewing beer and human health.%多酚是一类植物中普遍存在的次级代谢物质,在抗氧化、抗癌、抗衰老、降血糖、降血脂、预防心血管疾病等方面具有一定独特生理功效。大麦是多酚含量较高的谷物之一,总酚含量高达1200~1500 mg/kg,包含儿茶酸、原花青素聚合物等多种酚类化合物,已成为天然抗氧化剂开发的重要来源之一。本文结合研究工作,综述了大麦多酚的种类和含量,提取和测定方法,以及大麦多酚的抗氧化性能在动物饲料、啤酒酿造、人类健康等方面的应用研究进展。

  8. Nitrate (13NO3-) flux studies and response to tungstate treatments in wild type barley and in an NR-deficient mutant

    International Nuclear Information System (INIS)

    Hydroponic experiments were conducted with seedlings of barley (Hordeum vulgare L.), comparing the wild type and an NR-deficient mutant (AZ 12/70), to monitor the NO3- influx/efflux relations and the response to tungstate treatment using 13N-labelling. Upon treatment with the arginyl-residue-binding inhibitor phenylglyoxal both genotypes responded with an immediate depression of NO3- influx. At low external NO3- concentrations efflux was small (5-15% of the influx) and did not differ substantially between the two genotypes. Although the mutant was distinguished from the wild type by a thinner root system and a reduced shoot length, the total N distribution between roots and shoots and the N concentrations in the root and shoot tissues were fairly comparable. Substantially higher extractable NO3- concentration in the shoots (but not roots) of the mutant may indicate that the capacity to reduce NO3- was restricted due to the very low but still detectable NR activity in the root and shoot tissue. Nevertheless, the mutant must have had supplementary means of assimilating considerable amounts of NO3- over the experimental growth period. At the induced stage, both barley genotypes responded to tungstate treatments with a comparable but not complete depression of the NO3- influx. Part of the NO3- influx appears to be independent of the function of NR since an acceleration of the NO3- uptake capacity to almost half the level of the controls occurred in both cultivars upon induction in spite of pretreatment with 150 micromolar WO42- in a molybdenum-free solution prior to NO3- induction. However, 600 micromolar tungstate treatment during the induction phase reduced NO3- influx further (below 20%), but the plants of both cultivars were still able to recover almost completely. (author)

  9. Changes in vertical distribution of spectral reflectance within Spring barley canopy as an indicator of nitrogen nutrition, canopy structure and yield parametrs

    Czech Academy of Sciences Publication Activity Database

    Klem, Karel; Rajsnerová, Petra; Novotná, Kateřina; Míša, P.; Křen, J.


    Roč. 60, č. 2 (2014), s. 50-59. ISSN 0551-3677 R&D Projects: GA MZe QI111A133; GA TA ČR TA02010780 Institutional support: RVO:67179843 Keywords : Hordeum vulgare * spectral reflectance * vertical gradient * vegetation indices * nitrogen * grain yield * protein content Subject RIV: GC - Agronomy

  10. EVALUACIÓN DE \tENSILAJE DE CEBADA EN TRES ESTADOS DE CORTE EN LA ENGORDA INVERNAL DE NOVILLOS Evaluation of three cuttings periods of whole crop barley silage in winter finishing steers

    Directory of Open Access Journals (Sweden)

    Claudio Rojas G.


    Full Text Available En el Centro Regional de Investigación Carillanca, del Instituto de Investigaciones Agropecuarias, ubicado en Temuco, durante 84 días de la temporada invernal de 1996, se utilizaron 28 novillos Hereford de 20 meses de edad y 342 kg de peso vivo promedio, con el objetivo de evaluar el ensilaje de cebada (Hordeum vulgare en tres estados de corte en comparación al de maíz (Zea mayz, en raciones de engorda, sobre algunas variables productivas. Los tratamientos estuvieron constituidos por 1 ensilaje de maíz; 2 ensilaje de cebada con grano lechoso; 3 ensilaje de cebada con grano harinoso; y 4 ensilaje de cebada con grano harinoso duro. Los ensilajes se entregaron a discreción, complementándolos con cantidades diarias fijas de concentrados, equivalentes al 0,9% del peso vivo de los animales, base materia seca. Los concentrados se formularon, para cada ensilaje, con grano de avena (Avena sativa, grano de lupino australiano (Lupinus angustifolius y sales minerales comerciales, de forma tal que la oferta de alimentos fuera isoproteica al 13%, asumiéndose un consumo total de materia seca equivalente al 2,5% del peso vivo de los animales. El diseño experimental fue de bloques completos al azar, con 7 repeticiones. Los incrementos de peso vivo fueron de 1,069a; 0,883b; 1,024a y 0,742c kg d-1 (POver a period of 84 days of the winter of 1996, 28 Hereford steers of 20 months of age and 342 kg live weight, were fattened in order to evaluate whole barley silage (Hordeum vulgare at three cutting periods in comparison to maize silage (Zea mayz in the Carillanca Regional Investigation Center of the National Agricultural Research Institute (INIA. Treatments were T1: maize silage; T2 : barley silage at the milky state ; T3 : barley silage at the starchy state; and T4 : barley silage at the hard starchy state. The silages were offered ad libitum and supplemented daily with concentrates equivalent to 0.9% of the animal live weight on a dry matter basis. The

  11. Main: 1BGP [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1BGP 大麦 Barley Hordeum vulgare l. Peroxidase Bp 1 Precursor. Name=Prx5; Hordeum Vulgare Molecu ... vity; IEA.|GO; GO:0006979; P:response to oxidative stress ; IEA.|InterPro; IPR002016; Peroxidase.|InterPro; I ...

  12. Physiological effects and transport of 24-epibrassinolide in heat-stressed barley

    Czech Academy of Sciences Publication Activity Database

    Janeczko, A.; Oklešťková, Jana; Pociecha, E.; Koscielniak, J.; Mirek, M.


    Roč. 33, č. 4 (2011), s. 1249-1259. ISSN 0137-5881 R&D Projects: GA AV ČR IAA400550801; GA ČR GA301/08/1649 Institutional research plan: CEZ:AV0Z50380511 Keywords : Brassinosteroid transport * Dark respiration * Hordeum vulgare L * PSII efficiency * Metabolic activity Subject RIV: EF - Botanics Impact factor: 1.639, year: 2011

  13. Coupling amplified DNA from flow-sorted chromosomes to high-density SNP mapping in barley

    Czech Academy of Sciences Publication Activity Database

    Šimková, Hana; Svensson, J.T.; Condamine, P.; Hřibová, Eva; Suchánková, Pavla; Bhat, P.R.; Bartoš, Jan; Šafář, Jan; Close, T.J.; Doležel, Jaroslav


    Roč. 9, č. 294 (2008), s. 1-9. ISSN 1471-2164 R&D Projects: GA ČR GD521/05/H013; GA MŠk ME 884; GA MŠk(CZ) LC06004 Institutional research plan: CEZ:AV0Z50380511 Keywords : Flow cytometry * DNA amplification * Hordeum vulgare L. Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.926, year: 2008

  14. Changes of Root Hydraulic Conductivity and Root/Shoot Ratio of Durum Wheat and Barley in Relation to Nitrogen Availability and Mercury Exposure

    Directory of Open Access Journals (Sweden)

    Giovanna Angelino


    Full Text Available The aim of this research was to verify, on whole plant level and during all the plant cycle, the hypothesis that nitrogen deficiency reduces root hydraulic conductivity through the water channels (aquaporins activity, and that the plant reacts by changing root/shoot ratio. Root hydraulic conductivity, plant growth, root/shoot ratio and plant water status were assessed for durum wheat (Triticum durum Desf. and barley (Hordeum vulgare L., as influenced by nitrogen availability and HgCl2 treatment. On both species during the plant cycle, nitrogen deficiency induced lower root hydraulic conductivity (-49 and -66% respectively for barley and wheat and lower plant growth. On wheat was also observed cycle delay, lower plant nitrogen content, but not lower leaf turgor pressure and epidermic cell dimension. The lower plant growth was due to lower plant dimension and lower tillering. Root /shoot ratio was always higher for nitrogen stressed plants, whether on dry matter or on surface basis. This was due to lower effect of nitrogen stress on root growth than on shoot growth. On wheat HgCl2 treatment determined lower plant growth, and more than nitrogen stress, cycle delay and higher root/shoot ratio. The mercury, also, induced leaf rolling, lower turgor pressure, lower NAR, higher root cell wall lignification and lower epidermic cell number per surface unity. In nitrogen fertilized plants root hydraulic conductivity was always reduced by HgCl2 treatment (-61 and 38%, respectively for wheat and barley, but in nitrogen unfertilized plants this effect was observed only during the first plant stages. This effect was higher during shooting and caryopsis formation, lower during tillering. It is concluded that barley and durum wheat react to nitrogen deficiency and HgCl2 treatment by increasing the root/shoot ratio, to compensate water stress due to lower water root conductivity probably induced by lower aquaporin synthesis or inactivation. However, this

  15. Comparative effects of selenite and selenate on nitrate assimilation in barley seedlings (United States)

    Aslam, M.; Harbit, K. B.; Huffaker, R. C.


    The effect of SeO3= and SeO4= on NO3- assimilation in 8-d-old barley (Hordeum vulgare L.) seedlings was studied over a 24-h period. Selenite at 0.1 mol m-3 in the uptake solutions severely inhibited the induction of NO3- uptake and active nitrate reductases. Selenate, at 1.0 mol m-3 in the nutrient solution, had little effect on induction of activities of these systems until after 12 h; however, when the seedlings were pretreated with 1.0 mol m-3 SeO4= for 24 h, subsequent NO3- uptake from SeO4(=) -free solutions was inhibited about 60%. Sulphate partially alleviated the inhibitory effect of SeO3= when supplied together in the ambient solutions, but had no effect in seedlings pretreated with SeO3=. By contrast, SO4= partially alleviated the inhibitory effect of SeO4= even in seedlings pretreated with SeO4=. Since uptake of NO3- by intact seedlings was also inhibited by SO3=, the percentage of the absorbed NO3- that was reduced was not affected. By contrast, SeO4=, which affected NO3- uptake much less, inhibited the percentage reduced of that absorbed. However, when supplied to detached leaves, both SeO3= and SeO4= inhibited the in vivo reduction of NO3- as well as induction of nitrate reductase and nitrite reductase activities. Selenite was more inhibitory than SeO4= ; approximately a five to 10 times higher concentration of SeO4= than SeO3= was required to achieve similar inhibition. In detached leaves, the inhibitory effect of both SeO3= and SeO4= on in vivo NO3- reduction as well as on the induction of nitrate reductase activity was partially alleviated by SO4=. The inhibitory effects of Se salts on the induction of the nitrite reductase were, however, completely alleviated by SO4=. The results show that in barley seedlings SeO3= is more toxic than SeO4=. The reduction of SeO4= to SeO3= may be a rate limiting step in causing Se toxicity.

  16. Cytological study of Hordeum bulbosum L. in Iran

    Directory of Open Access Journals (Sweden)

    Hamed Khodayari


    Full Text Available Hordeum bulbosum L. (Poaceae is considered to be sources of useful alleles which can be used in cereal improvement. Thirty two native Iranian H. bulbosum were collected from different localities and were studied by karyotype analysis. We assessed the karyotype asymmetry of the Iranian bulbous barley populations and analyzed the data to look for their geographic distribution correlations. All of the studied populations were tetraploid (2n=4x=28 and the analysed parameters of karyotype of H. bulbosum support the autopolyploidy origin of the species with nearly symmetric karyotype. The results showed the most asymmetric karyotypes within northeast (Golestan and northwest (Gardane-e Heiran populations and the most symmetric karyotyps in populations from the west of Iran. Therefore, it can be assumed that the oldest populations are in the slopes of Zagros Mountains and the youngest germplasms occur in the northeast of this country. It can be concluded that the species originated from the west of Iran and distributed towards east and northeast.

  17. Effect of gibberellin and heat shock on the lipid composition of endoplasmic reticulum in barley aleurone layers

    International Nuclear Information System (INIS)

    The heat-shock responses of barley (Hordeum vulgare L. cv Himalaya) aleurone layers incubated with or without gibberellic acid (GA3) were compared. Sodium dodecyl sulfate-polyacrylamide gel electrophoresis revealed that heat shock blocked the synthesis and secretion of secretory proteins from GA3-treated layers but not untreated layers. This suppression of secretory protein synthesis has been correlated with changes in endoplasmic reticulum (ER) membranes (F.C. Belanger, M.R. Brodl, T.-h.D. Ho [1986] Proc Natl Acad Sci USA 83: 1354-1358; L. Sticher, A.K. Biswas, D.S. Bush, R.L. Jones [1990] Plant Physiol 92: 506-513). Our secretion data suggested that the ER membranes of aleurone layers incubated without GA3 may be more heat shock tolerant. To investigate this, the lipid profiles of membrane extracts in aleurone layers labeled with [14C]glycerol were examined. Heat shock markedly increased [14C]glycerol incorporation into phosphatidylcholine (PC), and gas chromatography revealed an increase in the amount of saturated fatty acids associated with thin layer chromatography-purified PC in GA3-treated layers. In contrast, aleurone layers incubated without GA3 at normal temperature contained PC-associated fatty acids with a greater degree of saturation than GA3-treated layers. Heat shock modestly increased the degree of fatty acid saturation in untreated aleurone layers. This same trend was noted in fatty acids isolated from ER membranes purified by continuous sucrose density centrifugation. We propose that increased fatty acid saturation may help sustain ER membrane function in heat-shocked aleurone layers incubated in the absence of GA3

  18. Effect of pH and calcium on short-term NO3- fluxes in roots of barley seedlings (United States)

    Aslam, M.; Travis, R. L.; Huffaker, R. C.


    The effect of pH and Ca2+ on net NO3- uptake, influx, and efflux by intact roots of barley (Hordeum vulgare L.) seedlings was studied. Seedlings were induced with NO3- or NO2-. Net NO3- uptake and efflux, respectively, were determined by following its depletion from, and accumulation in, the external solution. Since roots of both uninduced and NO2(-)-induced seedlings contain little internal NO3- initial net uptake rates are equivalent to influx (M. Aslam, R.L. Travis, R.C. Huffaker [1994] Plant Physiol 106: 1293-1301). NO3-, uptake (influx) by these roots was little affected at acidic pH. In contrast, in NO3(-)-induced roots, which accumulate NO3-, net uptake rates decreased in response to acidic pH. Under these conditions, NO3- efflux was stimulated and was a function of root NO3- concentration. Conversely, at basic pH, NO3- uptake by NO3- and NO2(-)-induced and uninduced roots decreased, apparently because of the inhibition of influx. Calcium had little effect on NO3- uptake (influx) by NO2(-)-induced roots at either pH 3 or 6. However, in NO3(-)-induced roots, lack of Ca2+ at pH 3 significantly decreased net NO3- uptake and stimulated efflux. The results indicate that at acidic pH the decrease in net NO3- uptake is due to the stimulation of efflux, whereas at basic pH, it is due to the inhibition of influx.

  19. The oxidative stress caused by salinity in two barley cultivars is mitigated by elevated CO{sub 2}

    Energy Technology Data Exchange (ETDEWEB)

    Perez-Lopez, U.; Robredo, A.; Munoz-Rueda, A.; Mena-Petite, A. (Univ. del Pais Vasco/EHU. Dep. de Biologia Vegetal y Ecologia. Facultad de Ciencia y Technologia, Bilbao (Spain)); Lacuesta, M. (Univ. del Pais Vasco/EHU. Dep. de Biologia Vegetal y Ecologia. Facultad de Farmacia, Vitoria-Gasteiz (Spain)); Sgherri, C.; Navari-Izzo, F. (Univ. di Pisa, Dip. di Chimica e Biotechnologie Agrarie (Italy))


    Changes in antioxidant metabolism because of the effect of salinity stress (0, 80, 160 or 240 mM NaCl) on protective enzyme activities under ambient (350 mmol mol-1) and elevated (700 mmol mol-1) CO{sub 2} concentrations were investigated in two barley cultivars (Hordeum vulgare L., cvs Alpha and Iranis). Electrolyte leakage, peroxidation, antioxidant enzyme activities [superoxide dismutase (SOD), EC; ascorbate peroxidase (APX), EC; catalase (CAT), EC; dehydroascorbate reductase (DHAR), EC; monodehydroascorbate reductase (MDHAR), EC; glutathione reductase (GR), EC] and their isoenzymatic profiles were determined. Under salinity and ambient CO{sub 2}, upregulation of antioxidant enzymes such as SOD, APX, CAT, DHAR and GR occurred. However, this upregulation was not enough to counteract all ROS formation as both ion leakage and lipid peroxidation came into play. The higher constitutive SOD and CAT activities together with a higher contribution of Cu,Zn-SOD 1 detected in Iranis might possibly contribute and make this cultivar more salt-tolerant than Alpha. Elevated CO{sub 2} alone had no effect on the constitutive levels of antioxidant enzymes in Iranis, whereas in Alpha it induced an increase in SOD, CAT and MDHAR together with a decrease of DHAR and GR. Under combined conditions of elevated CO{sub 2} and salinity the oxidative damage recorded was lower, above all in Alpha, together with a lower upregulation of the antioxidant system. So it can be concluded that elevated CO{sub 2} mitigates the oxidative stress caused by salinity, involving lower ROS generation and a better maintenance of redox homeostasis as a consequence of higher assimilation rates and lower photorespiration, being the response dependent on the cultivar analysed. (au)

  20. Assessment of Genetic Diversity in Tibetan Hulless Barley Germplasm (Hordeum vulgare L.var.nudum HK.f.) by SSR Primers%利用SSR引物分析西藏青稞种质资源的遗传多样性

    Institute of Scientific and Technical Information of China (English)

    曾兴权; 王玉林; 徐齐君; 原红军; 扎西罗布; 尼玛扎西



  1. Comparative study of the inhibition produced by CMU (3-p-chlorophenyl-1. 1-dimethyl-urea) in barley leaves, on the photophosphorilation, photocarboxilation and hill reaction; Estudio comparativo de la inhibicion que produce el CMU sobre la fotogosforilacion, totocarboxilacion y reaccion de hill en cebada. (Hordeum vulgare L.)

    Energy Technology Data Exchange (ETDEWEB)

    Fernandez, J.; Sancho, C.


    The effect of different concentrations of CMU (from 10 {sup -}8 M to 10{sup -}3 H) on the photophosphorilation, photocarboxilation and Hill reaction was studied. CMU (Carbon-H labelled) was utilized to determine the concentration of CMU in leaf parenchyma. Photocarboxilation and photophosphorolation was sensible to concentrations less than 10{sup -}7 M. Hill reaction in isolated chloroplasts was sensible from concentrations of the order of 10{sup -}8 M. (Author) 50 refs.

  2. Gibberellic Acid-Induced Aleurone Layers Responding to Heat Shock or Tunicamycin Provide Insight into the N-Glycoproteome, Protein Secretion, and Endoplasmic Reticulum Stress

    DEFF Research Database (Denmark)

    Barba Espin, Gregorio; Dedvisitsakul, Plaipol; Hägglund, Per;


    The growing relevance of plants for the production of recombinant proteins makes understanding the secretory machinery, including the identification of glycosylation sites in secreted proteins, an important goal of plant proteomics. Barley (Hordeum vulgare) aleurone layers maintained in vitro res...

  3. Quantitative Trait Loci and Inter-Organ Partitioning for Essential Metal and Toxic Analogue Accumulation in Barley


    Reuscher, Stefan; Kolter, Andreas; Hoffmann, Astrid; Pillen, Klaus; Krämer, Ute


    The concentrations of both essential nutrients and chemically similar toxic analogues accumulated in cereal grains have a major impact on the nutritional quality and safety of crops. Naturally occurring genetic diversity can be exploited for the breeding of improved varieties through introgression lines (ILs). In this study, multi-element analysis was conducted on vegetative leaves, senesced flag leaves and mature grains of a set of 54 ILs of the wild ancestral Hordeum vulgare ssp. spontaneum...

  4. Transport, Kompartimentierung und Abbau von glutathionhaltigen Fremdstoffmetaboliten in Gerste (Hordeum vulgare L.)


    Scheer, Christian Ernst


    Mit den in dieser Arbeit erzielten Ergebnissen lassen sich wichtige Fragen im glutathionabhängigen Entgiftungsstoffwechsel von Pflanzen beantworten. In mikroskopischen Studien zum interzellulären Transport konnte erstmalig die Mobilität von Glutathionkonjugaten in vivo gezeigt werden. Danach werden Glutathionkonjugate in der Wurzel akropetal im Phloem und im Kurzstreckentransport innerhalb des Parenchyms über Plasmodesmata transportiert. Außerdem wurde eine Verlagerung der Konjugate in den Ap...

  5. Rhizodeposition and biotic interactions in the rhizosphere of Phaseolus vulgaris L. and Hordeum vulgare L.


    Haase, Susan


    Biochemical processes at the soil-plant interface are largely regulated by organic and inorganic compounds released by roots and microorganisms. Several abiotic and biotic factors are suspected to stimulate rhizodeposition and, thus, contribute to enriching of the rhizosphere with plant-derived compounds. This thesis focused on the effects of two factors, (i) the elevation of atmospheric CO2 concentration accompanied by nutrient limitation in the soil and (ii) low-level root infestation by pl...

  6. Desenvolvimento de populações duplo-haplóides de cevada cervejeira associadas à atividade das enzimas (1-3, 1-4-β-glucanases Development of doubled-haploids populations in malting barley associated to activity of enzymes (1-3, 1-4-β-glucanases

    Directory of Open Access Journals (Sweden)

    Janaína Endres Georg-Kraemer


    Full Text Available Populações duplo-haplóides apresentam especial vantagem para análises genéticas, uma vez que a informação que elas oferecem pode ser maximizada, devido ao fato que todos os locos encontram-se em homozigose. O objetivo deste trabalho foi o desenvolvimento de duas populações duplo-haplóides (DHs de cevada (Hordeum vulgare ssp. vulgare L. segregantes para a atividade das enzimas (1-3, 1-4-β-glucanases, através da técnica de cultura de anteras. Foram realizados dois cruzamentos com cultivares contrastantes para esta característica. As cultivares parentais selecionadas foram 'MN 698' e 'CEV 97047', para o desenvolvimento da população "malte verde" (MV, e 'Embrapa 127' e 'CEV 96025' para o desenvolvimento da população "malte seco" (MS. Foram cultivadas 10.734 anteras da população MS e 4.139 anteras da população MV. A população MV produziu 50% mais plântulas verdes quando comparada à população MS, refletindo a importância do genótipo na resposta à cultura de anteras e na regeneração. A maioria das plantas adultas duplo-haplóides foi obtida através da duplicação espontânea in vitro do genoma haplóide, ocorrendo em 66% das plantas da população MS e 76% das plantas da população MV. Também foram observadas, em menor frequência, plantas haplóides, triplóides e tetraplóides. Através da técnica de cultura de anteras, foram desenvolvidas 204 linhagens duplo-haplóides, das quais 72 linhagens são da população "malte seco" e 132 linhagens são da população "malte verde". Este material constitui um importante germoplasma para o melhoramento genético da cevada.Doubled haploid populations offer special advantages in genetic analyses, since the information they provide may be maximized due to the fact that all loci are homozygous. The aim of this study was to develop two barley (Hordeum vulgare ssp.vulgare L. doubled-haploid (DHs populations segregating to (1-3, 1-4-β-glucanases activity, utilizing the anther

  7. DNA polymorphisms and haplotype patterns of transcription factors involved in barley endosperm development are associated with key agronomic traits

    Directory of Open Access Journals (Sweden)

    Stracke Silke


    Full Text Available Abstract Background Association mapping is receiving considerable attention in plant genetics for its potential to fine map quantitative trait loci (QTL, validate candidate genes, and identify alleles of interest. In the present study association mapping in barley (Hordeum vulgare L. is investigated by associating DNA polymorphisms with variation in grain quality traits, plant height, and flowering time to gain further understanding of gene functions involved in the control of these traits. We focused on the four loci BLZ1, BLZ2, BPBF and HvGAMYB that play a role in the regulation of B-hordein expression, the major fraction of the barley storage protein. The association was tested in a collection of 224 spring barley accessions using a two-stage mixed model approach. Results Within the sequenced fragments of four candidate genes we observed different levels of nucleotide diversity. The effect of selection on the candidate genes was tested by Tajima's D which revealed significant values for BLZ1, BLZ2, and BPBF in the subset of two-rowed barleys. Pair-wise LD estimates between the detected SNPs within each candidate gene revealed different intra-genic linkage patterns. On the basis of a more extensive examination of genomic regions surrounding the four candidate genes we found a sharp decrease of LD (r2 Significant marker-trait associations between SNP sites within BLZ1 and flowering time, BPBF and crude protein content and BPBF and starch content were detected. Most haplotypes occurred at frequencies BPBF was associated to crude protein content and starch content, BLZ2 showed association to thousand-grain weight and BLZ1 was found to be associated with flowering time and plant height. Conclusions Differences in nucleotide diversity and LD pattern within the candidate genes BLZ1, BLZ2, BPBF, and HvGAMYB reflect the impact of selection on the nucleotide sequence of the four candidate loci. Despite significant associations, the analysed candidate

  8. On the origin of Spanish two-rowed barleys. (United States)

    Moralejo, M; Romagosa, I; Salcedo, G; Sánchez-Monge, R; Molina-Cano, J L


    To investigate the phylogenetic origin of Spanish two-rowed barleys, we studied 44 accessions of old land-races both morphologically and biochemically to ascertain their similarity with 51 entries of old cultivars and land-races of widespread origin across Europe. They were also compared with 20 accessions of Hordeum spontaneum from the Mediterranean basin and other regions of its distribution range, 14 accessions of Moroccan cultivated six-rowed barley land-races, and different six-rowed Spanish and two-and six-rowed European cultivars. CM-(trypsin inhibitors and subunits of the barley tetrameric α-amylase inhibitor) proteins and hordeins, all of which are endosperm proteins, were used as biochemical markers. The appearance of separate clusters of the Spanish barleys in the numerical classifications for both protein systems as a result of the existence of characteristic gene combinations that do not exist in entries from other origins permitted us to postulate the existence of local ancestors for most of the Spanish two-rowed barleys studied, and, therefore, a possible in situ domestication. PMID:24190469

  9. Initial kinetics of 15N-nitrate labelling of root and shoot N fractions of barley cultured at different relative addition rates of nitrate-N

    International Nuclear Information System (INIS)

    The reduction of absorbed nitrate in the root and N transport to the shoot were studied in young barley (Hordeum vulgare L.) plants growing at low external nitrate levels. Plants were grown at three relative addition rates (RA) of nitrate: 0.04, 0.09, and 0.14 d-1, which represent different degrees of growth limiting nitrate supply. Root nitrate reduction and N transport in situ were estimated using 15N labelled nitrate exposures ranging from 5 to 60 min. With increasing RA, nitrate uptake in absolute terms increased, but the proportion of absorbed 15N-nitrate that was reduced in the root decreased markedly. After 10-20 min of exposure to the label, 75, 49 and 27 % of the 15N taken up was recovered as reduced 15N in the root at RAs 0.04, 0.09, and 0.14 d-1, respectively. The response pattern was supported by root nitrate reductase activities and xylem sap nitrate measurements. The decreasing proportion of reduced 15N in the root with higher nitrate supply rates was matched by a relative increase in 15N-nitrate storage and, to some extent, an increase in N transport to the shoot. Although small amounts of 15N were rapidly transported to the shoot, the accumulation of label in the shoot at the end of the 60 min period remained a relatively small proportion of total 15N uptake, which indicates delayed movement of 15N out of the root. The results clearly indicate that differing degrees of adjustment occur in important nitrate assimilation processes throughout the N deficiency range. (author)

  10. Conditioning of Roots with Hypoxia Increases Aluminum and Acid Stress Tolerance by Mitigating Activation of K+ Efflux Channels by ROS in Barley: Insights into Cross-Tolerance Mechanisms. (United States)

    Ma, Yanling; Zhu, Min; Shabala, Lana; Zhou, Meixue; Shabala, Sergey


    Aluminum (Al) is prevalent in soils, but Al toxicity is manifested only under acid conditions. It causes severe damages to the root system. Short-term waterlogging stress can occur simultaneously with Al toxicity in areas with high rainfall or an inappropriate irrigation pattern. Barley (Hordeum vulgare L.) is one of the most Al-sensitive small-grained cereals. In this work, we have investigated effects of short-term treatments with hypoxia and phenolic acid (two major constraints in waterlogged soils) on root sensitivity to low-pH and Al stresses. We showed that hypoxia-primed roots maintained higher cell viability when exposed to low-pH/Al stress, in both elongation and mature root zones, and possessed superior ability to retain K(+) in response to low-pH/Al stresses. These priming effects were not related to higher H(+)-ATPase activity and better membrane potential maintenance, and could not be explained by the increased expression levels of HvHAK1, which mediates high-affinity K(+) uptake in roots. Instead, hypoxia-conditioned roots were significantly less sensitive to H2O2 treatment, indicated by the 10-fold reduction in the magnitude of K(+) efflux changes. This suggested that roots pre-treated with hypoxia desensitized reactive oxygen species (ROS)-inducible K(+) efflux channels in root epidermis, most probably via enhanced antioxidative capacity. A possible role for Ca(2+) in stress-induced ROS signaling pathways is also discussed. Overall, our results report, for the first time, the phenomenon of cross-protection between hypoxia and low-pH/Al stresses, and causally link it to the cell's ability to maintain cytosolic K(+) homeostasis. PMID:26581863

  11. Grain protein concentration and harvestable protein under future climate conditions. A study of 108 spring barley accessions

    DEFF Research Database (Denmark)

    Ingvordsen, Cathrine Heinz; Gislum, René; Jørgensen, Johannes Ravn;


    In the present study a set of 108 spring barley (H. vulgare L.) accessions were cultivated under predicted future levels of temperature and [CO2] as single factors and in combination (IPCC, AR5, RCP8.5). Across all genotypes, elevated [CO2] (700 ppm day/night) slightly decreased protein...

  12. Betaine accumulation and (/sup 14/C)formate metabolism in water-stressed barley leaves

    Energy Technology Data Exchange (ETDEWEB)

    Hanson, A.D.; Nelsen, C.E.


    Barley (Hordeum vulgare L.) plants at the three-leaf stage were water-stressed by flooding the rooting medium with polyethylene glycol 6000 with an osmotic potential of -19 bars, or by withholding water. While leaf water potential fell and leaf kill progressed, the betaine (trimethylglycine) content of the second leaf blade rose from about 0.4 micromole to about 1.5 micromoles in 4 days. The time course of betaine accumulation resembled that of proline. Choline levels in unstressed second leaf blades were low (<0.1 micromole per blade) and remained low during water stress. Upon relief of stress, betaine-like proline-remained at a high concentration in drought-killed leaf zones, but betaine did not disappear as rapidly as proline during recovery. When (methyl-/sup 14/C)choline was applied to second leaf blades of intact plants in the growth chamber, water-stressed plants metabolized 5 to 10 times more /sup 14/C label to betaine than control plants during 22 hours. When infiltrated with tracer quantities of (/sup 14/C)formate and incubated for various times in darkness or light, segments cut from water-stressed leaf blades incorporated about 2- to 10-fold more /sup 14/C into betaine than did segments from unstressed leaves. In segments from stressed leaves incubated with (/sup 14/C)formate for about 18 hours in darkness, betaine was always the principal /sup 14/C-labeled soluble metabolite. This /sup 14/C label was located exclusively in the N-methyl groups of betaine; thus, reducing equivalents were available in stressed leaves for the reductive steps of methyl group biosynthesis from formate. Incorporation of /sup 14/C from formate into choline was also increased in stressed leaf tissue, but choline was not a major product formed from (/sup 14/C)formate. These results are consistent with a net de novo synthesis of betaine from 1- and 2-carbon precursors during water stress and indicate that the betaine so accumulated may be a metabolically inert end product.

  13. Betaine Accumulation and [C]Formate Metabolism in Water-stressed Barley Leaves. (United States)

    Hanson, A D; Nelsen, C E


    Barley (Hordeum vulgare L.) plants at the three-leaf stage were water-stressed by flooding the rooting medium with polyethylene glycol 6000 with an osmotic potential of -19 bars, or by withholding water. While leaf water potential fell and leaf kill progressed, the betaine (trimethylglycine) content of the second leaf blade rose from about 0.4 micromole to about 1.5 micromoles in 4 days. The time course of betaine accumulation resembled that of proline accumulation. Choline levels in unstressed second leaf blades were low (<0.1 micromole per blade) and remained low during water stress. Upon relief of stress, betaine-like proline-remained at a high concentration in drought-killed leaf zones, but betaine did not disappear as rapidly as proline from viable leaf tissue during recovery.When [methyl-(14)C]choline was applied to second leaf blades of intact plants in the growth chamber, water-stressed plants metabolized 5 to 10 times more (14)C label to betaine than control plants during 22 hours. When infiltrated with tracer quantities of [(14)C]formate and incubated for various times in darkness or light, segments cut from water-stressed leaf blades incorporated about 2- to 10-fold more (14)C into betaine than did segments from unstressed leaves. In segments from stressed leaves incubated with [(14)C]formate for about 18 hours in darkness, betaine was always the principal (14)C-labeled soluble metabolite. This (14)C label was located exclusively in the N-methyl groups of betaine, demonstrating that reducing equivalents were available in stressed leaves for the reductive steps of methyl group biosynthesis from formate. Incorporation of (14)C from formate into choline was also increased in stressed leaf tissue, but choline was not a major product formed from [(14)C]formate.These results are consistent with a net de novo synthesis of betaine from 1- and 2-carbon precursors during water stress, and indicate that the betaine so accumulated may be a metabolically inert end


    Czech Academy of Sciences Publication Activity Database

    Rayapuram, C.; Hemzalová, Vendula; Lyngkjaer, M. E.


    Roč. 93, č. 3 (2011), s. 613-625. ISSN 1125-4653 R&D Projects: GA MZe QH72117 Institutional research plan: CEZ:AV0Z50380511 Keywords : Blumeria graminis f. sp hordei * Hordeum vulgare * hypersensitive response Subject RIV: GF - Plant Pathology, Vermin, Weed, Plant Protection Impact factor: 0.912, year: 2011

  15. High-level expression of the native barley alpha-amylase/subtilisin inhibitor in Pichia pastoris

    DEFF Research Database (Denmark)

    Micheelsen, Pernille Ollendorff; Ostergaard, Peter Rahbek; Lange, Lene;


    An expression system for high-level expression of the native Hordeum vulgare alpha-amylase/subtilisin inhibitor (BASI) has been developed in Pichia pastoris, using the methanol inducible alcohol oxidase 1 (AOX1) promoter. To optimize expression, two codon-optimized coding regions have been designed...... and expressed alongside the wild-type coding region. To ensure secretion of the native mature protein, a truncated version of the alpha mating factor secretion signal from Saccharomyces cerevisiae was used. In order to be able to compare expression levels from different clones, single insertion...

  16. Localization of powdery mildew resistance gene Ml-ra on barley chromosome 5

    DEFF Research Database (Denmark)

    Doll, Hans; Jensen, Hans Peter


    Evidence is presented that the powdery mildew resistance gene called Ml-(41/145) represents a unique, unnamed locus, which we suggest to be designated Ml-ra with reference to variety 'Ragusa b' [Hordeum vulgare]. Ml-ra is located on the short arm of chormosome 5 near powdery mildew resistance locus...... Ml-a and the seed storage protein loci Hor1 and Hor2. The most likely order of the loci is Hor1, Ml-a, Ml-ra, and Hor2....

  17. Main: 1AMY [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1AMY 大麦 Barley Hordeum vulgare l. Alpha-Amylase Type B Isozyme Precursor Name=Amy1.2; Hordeum ... ; X-ray; @=25-427.|InterPro; IPR006047; Alpha_amyl_cat .|InterPro; IPR006589; Alp_amyl_cat _sub.|InterPro; ...


    Directory of Open Access Journals (Sweden)

    Arturo Campos M.


    Full Text Available En Chile la producción de cebada (Hordeum vulgare L., se destina principalmente a la fabricación de malta y cerveza. En 1978, el Instituto de Investigaciones Agropecuarias (INIA y la Compañía Cervecerías Unidas (CCU, la más importante empresa productora de cerveza del país, firmaron un convenio de investigación con el propósito de iniciar trabajos de mejoramiento genético para producir variedades de cebada con altos rendimientos y elevada calidad maltera. Las nuevas variedades creadas a través de este convenio han sido entregadas por CCU a los productores bajo un sistema de contrato de producción. Desde 1978 hasta 1999, INIA introdujo la variedad Aramir y creó las variedades Granifén INIA/CCU, Libra INIA/CCU y Acuario INIA/CCU, que han sido cultivadas en el centro y sur del país, demostrando buena adaptación, rendimiento y calidad, comparadas Aramir. De acuerdo a los resultados, la tasa interna de retorno para este convenio alcanzó a 51,98%, cuando las elasticidades precio de la demanda y la oferta calculadas fueron - 0,54 y 1,06 respectivamente. El beneficio social neto calculado alcanzó a 5.359 millones de pesos, en donde el excedente del productor fue equivalente a 64,9% de los beneficios sociales netos de la investigación en mejoramiento genético de la cebada en Chile.In Chile barley (Hordeum vulgare L. is produced mainly for beer production. In 1976, the Chilean Agricultural Research Institute (INIA and the Compañía Cervecerías Unidas (CCU, the most important beer producer in the country, signed an agreement to initiate breeding research to produce both high yield and high quality malting cultivars in order to be distributed under contract to barley producers. The new varieties created under this agreement have been distributed to the producers under a system of contract production. From 1978 to 1999, INIA introduced the Aramir variety and created three new varieties, Granifen INIA/CCU, Acuario INIA/CCU and Libra INIA

  19. Physiological tests for drought tolerance in barley and durum wheat

    International Nuclear Information System (INIS)

    Physiological tests for characterizing drought tolerance in barley (H. vulgare L.) and durum wheat (T. durum L.) were evaluated. These tests involved: 1) germination in osmotic solution (-13 atm by d-mannitol); 2) thermal stress on seedlings (42 deg. C for 5 hours); 3) stability of the cellular membrane under osmotic stress (PEG 6000 at 43%). For both species genotypic variability which was associated with drought tolerance in the field was identified by the laboratory evaluation techniques. Based on these procedures, the two-row barley types were more drought tolerant than six-row types. In durum wheat, only some local populations and some varieties, bred in drought environments, showed high laboratory test values. Weak and not significant correlations were found between the physiological tests indicating that the genetic mechanisms which control these traits may be independent and process-specific. Yield trials, in barley, have been carried out in environments with drought conditions and the correlation between grain and physiological tests were significant. Of the three procedures evaluated in this study, the dry matter increase after a period of thermal stress and electrolyte leakage seemed to be most reliable and potentially useful for screening for drought tolerance in barley and durum wheat. (author). 13 refs, 6 tabs

  20. Genetic diversity at the Dhn3 locus in Turkish Hordeum spontaneum populations with comparative structural analyses. (United States)

    Uçarlı, Cüneyt; McGuffin, Liam J; Çaputlu, Süleyman; Aravena, Andres; Gürel, Filiz


    We analysed Hordeum spontaneum accessions from 21 different locations to understand the genetic diversity of HsDhn3 alleles and effects of single base mutations on the intrinsically disordered structure of the resulting polypeptide (HsDHN3). HsDHN3 was found to be YSK2-type with a low-frequency 6-aa deletion in the beginning of Exon 1. There is relatively high diversity in the intron region of HsDhn3 compared to the two exon regions. We have found subtle differences in K segments led to changes in amino acids chemical properties. Predictions for protein interaction profiles suggest the presence of a protein-binding site in HsDHN3 that coincides with the K1 segment. Comparison of DHN3 to closely related cereals showed that all of them contain a nuclear localization signal sequence flanking to the K1 segment and a novel conserved region located between the S and K1 segments [E(D/T)DGMGGR]. We found that H. vulgare, H. spontaneum, and Triticum urartu DHN3s have a greater number of phosphorylation sites for protein kinase C than other cereal species, which may be related to stress adaptation. Our results show that the nature and extent of mutations in the conserved segments of K1 and K2 are likely to be key factors in protection of cells. PMID:26869072

  1. Main: 1LQ2 [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1LQ2 大麦 Barley Hordeum vulgare l. Beta-D-Glucan Exohydrolase Isoenzyme Exoi. Hordeum Vulgare M ... hydrolase Isoenzyme Exo1) M.Hrmova, R.De Gori, B.J.Smith , A.Vasella, J.N.Varghese, G.B.Fincher M.Hrmova, R. ... De Gori, B.J.Smith , A.Vasella, J.N.Varghese, G.B.Fincher Three-Dimens ...

  2. Main: 1IEW [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1IEW 大麦 Barley Hordeum vulgare l. Beta-D-Glucan Exohydrolase Isoenzyme Exoi. Hordeum Vulgare M ... oenzyme Exo1) M.Hrmova, R.Degori, G.B.Fincher, B.J.Smith , J.N.Varghese M.Hrmova, J.N.Varghese, R.Degori, B. ... J.Smith , H.Driguez, G.B.Fincher Catalytic Mechanisms And R ...

  3. Main: 1IEQ [RPSD[Archive

    Lifescience Database Archive (English)


  4. Main: AMYBOX1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available AMYBOX1 S000020 17-May-1998 (last modified) kehi amylase box; Conserved sequence found in 5'-ups ... tream region of alpha-amylase gene of rice, wheat , barley; amylase; seed; barley (Hordeum vulgare); ... rice (Oryza sativa); wheat ... (Triticum aestivum) TAACARA ...

  5. Main: GARE2 [PLACE

    Lifescience Database Archive (English)

    Full Text Available ent; Consensus sequence of GA inducible alpha-amylase genes from rice, barley and wheat; gibberellin; GARE; ...seed; rice (Oryza sativa); barley (Hordeum vulgare); wheat (Triticum aestivum); RTAACARANTCYGG ... ...GARE2 S000165 17-May-1998 (last modified) kehi Putative gibberellin responsive elem


    Lifescience Database Archive (English)

    Full Text Available GAREHVAMY1 S000038 17-May-1998 (last modified) kehi GARE (gibberellic acid responsive element) of bar...ley (H.v.) alpha-amylase gene (Amy 1/6-4); GA3; gibberellic acid; GA; GA3; amylase; Amy1/6-4; GARE; barley (Hordeum vulgare) GGCCGATAACAAACTCCGGCC ...


    Lifescience Database Archive (English)

    Full Text Available GARE4HVEPB1 S000297 10-Feb-2000 (last modified) seki GARE-4 found in the barley (H....tive binding site of transcription factor, GAMyB; See S000298; EPB; cysteine proteinase; GA; ABA; GARE; pyrimidine box; seed; aleurone; barley (Hordeum vulgare) GTAACAGAATGCTGG ...

  8. Biochemical and molecular analyses of the biosynthesis pathway of the indole derivatives in Piriformospora indica


    Hilbert, Magdalena


    The mutualistic root endophyte Piriformospora indica has the ability to colonize a wide range of plants including the monocot barley (Hordeum vulgare) and the dicot model plant Arabidopsis thaliana. The colonization of both, Arabidopsis and barley is characterized by a biphasic colonization strategy with an initial biotrophic interaction followed by a cell death associated phase. During both phases fungal inter- and intracellular ...


    NARCIS (Netherlands)



    Cereal crop plants at Asikli Hayuk included einkorn wheat (Triticum monococcum), emmer wheat (T. dicoccum), free-threshing wheat (T. cf. durum), hulled two-rowed barley (Hordeum distichum) and naked barley (H. vulgare var. nudum). As for pulses, bitter vetch (Vicia ervilia), lentil (Lens culinaris)

  10. Main: IDE1HVIDS2 [PLACE

    Lifescience Database Archive (English)

    Full Text Available IDE1HVIDS2 S000463 24-April-2005 (last modified) kehi IDE1 (iron -deficiency-responsive element 1 ... ) found at -153/-136 of barley IDS2 (iron ... deficiency specific clone 2) gene promoter; See al ... so S000464; iron ; root; Hordeum vulgare (barley) ATCAAGCATGCTTCTTGC ...

  11. Main: IDE2HVIDS2 [PLACE

    Lifescience Database Archive (English)

    Full Text Available IDE2HVIDS2 S000464 24-April-2005 (last modified) kehi IDE2 (iron -deficiency-responsive element 2 ... ) found at -262/-236 of barley IDS2 (iron ... deficiency specific clone 2) gene promoter; See al ... so S000463; iron ; root; Hordeum vulgare (barley) TTGAACGGCAAGTTTCAC ...

  12. Main: LTRE1HVBLT49 [PLACE

    Lifescience Database Archive (English)

    Full Text Available nsive element) in barley (H.v.) blt4.9 gene promoter; A new LTRE; A previously known LTRE is CCGAC; low temperature; LTRE; barley (Hordeum vulgare) CCGAAA ... ...LTRE1HVBLT49 S000250 11-Oct-1999 (last modified) kehi LTRE-1 (low-temperature-respo

  13. Expansão de lesão por manchas foliares em cevada e sua interação com a aplicação foliar de fungicidas Lesion expansion by barley leaf spots and its interaction with fungicidal sprays

    Directory of Open Access Journals (Sweden)

    Ana P. Menegon


    Full Text Available A mancha-marrom (MM e a mancha-reticular (MR, causadas pelos fungos Bipolaris sorokiniana e Pyrenophora teres, respectivamente, são as principais doenças foliares da cevada (Hordeum vulgare. A taxa de expansão da lesão pode ser um componente importante do progresso destas doenças. Em casa de vegetação e em campo, avaliou-se a expansão de lesão em cultivares de cevada, diante da aplicação preventiva ou curativa de um fungicida triazol (ciproconazole + propiconazole e uma estrobilurina (azoxistrobim. O tamanho médio das lesões (MM aumentou de 2,2 a 4,9 mm², com maior incremento entre 14 e 30 dias após a inoculação. As cultivares MN 698 e EMB 128 apresentaram taxas de expansão de lesão maiores que os demais. O tratamento preventivo com fungicida protegeu as plantas de infecção por B. sorokiniana por até 21 dias. Aplicações curativas, realizadas um, dois, quatro, seis, oito, dez ou 12 dias após a inoculação, determinaram lesões iniciais maiores (até 0,68 mm² e mais numerosas (até 3,9 por folha, com ação apenas sobre a esporulação do fungo. Em campo, somente as primeiras aplicações, iniciadas entre 46 e 60 dias após a emergência das plantas, reduziram o tamanho das lesões de MR e a área abaixo da curva de progresso da doença (AACPD, com aumento no rendimento de grãos. Como os fungicidas apresentaram pouco ou nenhum efeito curativo sobre a expansão da lesão, sugere-se reavaliar as recomendações de controle baseadas em severidade de doença.Brown spot and net blotch, caused by the fungi Bipolaris sorokiniana and Pyrenophora teres, respectively, are the main leaf spots of barley (Hordeum vulgare. The rate of lesion expansion is an important epidemiological component of leaf spots and should be taken into account for disease management. Through greenhouse and field trials, lesion expansion was assessed in barley cultivars, under preventive and curative sprays of triazol (cyproconazole + propiconazole and

  14. Effects of Soil Aluminum on Early Arbuscular Mycorrhizal Colonization of Wheat an Barley Cultivars Growing in an Andisol Efecto del Aluminio del Suelo en la Colonización Temprana por Micorrizas Arbusculares en Cultivares de Trigo y Cebada Creciendo en un Andisol

    Directory of Open Access Journals (Sweden)

    Alex Seguel


    Full Text Available Aluminum phytotoxicity in acid soils is an important environmental stress that negatively affects crop production, but arbuscular mycorrhizal (AM fungi performance would allow plants to better withstand this environmental condition. This study aimed to analyze the effect of soil Al on early AM colonization of wheat (Triticum aestivum L. and barley (Hordeum vulgare L. cultivars. Near-isogenic Crac, Invento, and Porfiado wheat cultivars and Sebastián and Aurora barley cultivars were sown in pots in an acid soil at three Al saturation levels (60, 34, and 11%. At 20 d after sowing (DAS 'Crac' presented higher AM colonization (27% than other cultivars. However, 'Invento' had the fastest colonization at 41 DAS, which was inhibited in short term at lower Al-saturation. Moreover, roots of 'Aurora' were colonized 28 and 51% at 20 and 66 DAS, respectively, and also decreased at lower Al-saturation. In soil with 60% Al-saturation a great spore production was observed at 41 DAS, 'Aurora' had the highest spore density at 66 DAS. At 20 DAS a negative relationship (r = -0.37; p La fitotoxicidad por Al en suelos ácidos es un importante estrés que afecta negativamente la producción de cultivos, pero la actividad de hongos micorrícicos arbusculares (MA permitiría que las plantas soporten mejor esta condición ambiental. Este estudio tuvo como objetivo analizar el efecto del Al en la colonización MA temprana de cultivares de trigo (Triticum aestivum L. y cebada (Hordeum vulgare L.. Cultivares de trigo Crac, Invento, y Porfiado, y de cebada Sebastián y Aurora fueron sembrados en macetas en un suelo ácido con tres niveles de saturación de Al (60, 34, y 11%. A los 20 días después de la siembra (DDS 'Crac' presentó la mayor colonización MA (27%; sin embargo, 'Invento' tuvo la más rápida colonización a los 41 DDS, la cual fue inhibida a corto plazo a una menor saturación de Al. Por otra parte, las raíces de 'Aurora' fueron colonizadas 28 y 51% a los

  15. Whole-genome analysis with SNPs from BOPA1 shows clearly defined groupings of Western Mediterranean, Ethiopian, and Fertile Crescent barleys


    Igartua Arregui, Ernesto; Moralejo, María Ángeles; Casas Cendoya, Ana María; Torres, Lluis; Molina-Cano, José Luis


    The discovery of Hordeum spontaneum C. Koch, a wild ancestor of cultivated barley, in Morocco in 1978 led to the proposal of a multicentric origin for this crop, as an alternative to the widely accepted theory of a single centre of domestication in the Fertile Crescent. Since this discovery, we have tested this hypothesis using the most advanced genetic techniques available at the time, from CM-proteins to RFLP and DNA-chloroplast markers. Nowadays, the availability of single nucleotide polym...

  16. Isolation of Aspergillus flavus from stored food commodities and Thymus vulgaris (L.) essential oil used as a safe plant based preservative


    Atul Kumar Singh; Chandrabhan Seniya; Shriram Prasad


    Grain samples of Cicer arietinum (Chickpea), Zea mays (Maize), Cajanus cajan (Pigeon pea), Hordeum vulgare (Barley), Oryza sativa (Rice) and Sorghum vulgare (Millet) were procured from various retailers of market were subjected to their mould profile. During mycoflora analysis, 1297 fungal isolates were recorded from the food commodities. The least number of fungal isolates (189) were detected from H. vulgare while highest (244) from Z. mays. The genus Aspergillus was found to be most dominan...

  17. Taxonomy, Variation, and Relationships in the Hordeum parodii Group (Poaceae)

    DEFF Research Database (Denmark)

    Von Bothmer, R.; Jacobsen, N.; Bagger Jørgensen, Rikke


    The Hordeum parodii group contains three species, viz. H. parodii Covas (6x), H. tetraploidum Covas (4x), and H. fuegianum Bothmer, Jacobsen, et Jorgensen, sp. nov. (4x). The former two species mainly occur in C and S Argentina, while H. fuegianum is native to Tierra del Fuego. All three species...

  18. Giemsa C-banded karyotypes of Hordeum secalinum, H. capense and their interspecific hybrids with H. vulgare

    DEFF Research Database (Denmark)

    Linde-Laursen, Ib; Bothmer, R. von; Jacobsen, N.


    The European H. secalinum (2n = 4x = 48) and the South African H. capense (2n = 4x = 28) had similar karyotypes with ten pairs of metacentrics, three of submetacentrics, and one of SAT-chromosomes. The C-banded karyotypes of H. secalinum from northern Europe were characterized by banding patterns...

  19. Giemsa C-banded karyotypes of Hordeum secalinum, H. capense and their interspecific hybrids with H. vulgare

    DEFF Research Database (Denmark)

    Linde-Laursen, Ib; Bothmer, R. von; Jacobsen, N.


    The European H. secalinum (2n = 4x = 48) and the South African H. capense (2n = 4x = 28) had similar karyotypes with ten pairs of metacentrics, three of submetacentrics, and one of SAT-chromosomes. The C-banded karyotypes of H. secalinum from northern Europe were characterized by banding patterns...... reproductive system. No banding pattern polymorphism was present within plants of H. secalinum from Spain and H. capense, suggesting self-pollination. In both species banding pattern polymorphism was prevalent among plants. Together with other evidence the fairly similar basic C-banded karyotypes of the two...

  20. Molecular Variability in Barley Structural Mutants Produced by Gamma Irradiation

    International Nuclear Information System (INIS)

    Single Sequence Repeat (SSR) and Amplified Fragment Length Polymorphism (AFLP) markers were used to survey gamma ray induced genetic variation in a set of 13 originally produced structural barley (H. vulgare L.) mutants from cv. Freya; including 8 single translocation lines, 3 double translocation lines and 2 multiple reconstructed karyotypes. Both marker systems contributed to the evaluation of the radiation induced DNA alterations and revealed in general 0.49% polymorphisms in the studied genotypes. AFLPs were observed with 3 out of 10 PstI/MseI primer combinations. Transmissible microsatellite instability at loci with perfect (AT)n repeats located in the introns of the rubisco activase and waxy was documented in three mutant lines. The results emphasize that in addition to point mutations, small indels (2bp) form the major group of the gamma induced DNA alterations. (author)

  1. Main: 1GHR [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1GHR 大麦 Barley Hordeum vulgare l. Lichenase Ii Precursor Hordeum Vulgare 1,3-1,4-Be... T.P.J.Garrett J.N.Varghese, T.P.J.Garrett, P.M.Colman, L.Chen, P.J.Hoj, G.B.Fincher The Three-Dimensional S...cities Proc.Nat.Acad.Sci.Usa V. 91 2785 1994 EMBL; M13237; AAA32962.1; -.|PIR; A25455; A25455.|PDB; 1AQ0; X-...YGYQNLFDTTVDAFYTAMGKHGGSSVKLVVSESGWPSGGGTAATPANARFYNQHLINHVGRGTPRHPGAIETYIFAMFNENQKDSGVEQNWGLFYPNMQHVYPINF barley_1GHR.jpg ...

  2. Improvement of Barley and Chenopodium species in the Andean region by induced mutations

    International Nuclear Information System (INIS)

    Experiments on the genetic improvement of barley (H. vulgare), quinoa (Chenopodium quinoa), and canahua (C. pallidicaule) were conducted in the field and greenhouse at the Centro de Investigaciones Nucleares at Viacha, using different concentrations and treatment durations of sodium azide (NaN3) to induce beneficial mutations. Greenhouse tests were conducted to establish the concentration and treatment duration for sodium azide. The treatments were applied and field evaluations were carried out in different generations to improve the germplasm available in the country, particularly in respect to environmental stresses such as frost, hail, and drought, which severely restrict yields. (author). 3 tabs

  3. Albinism in barley androgenesis


    Makowska, Katarzyna; Oleszczuk, Sylwia


    Androgenesis is highly useful for plant breeding, significantly reducing breeding cycle times, as well as in a wide range of biological research. However, for widespread use this process must be efficient. Despite several decades of research on the phenomenon of androgenesis, many processes involved are obscure and there is much to be understood about androgenesis. One of the problems inherent in androgenesis, and reducing its efficiency, is albinism. This article reviews albinism in barley a...


    Directory of Open Access Journals (Sweden)

    Akula Annapurna


    Full Text Available Prevalence of lifestyle diseases is increasing day by day. Mostly the younger generation do not have much awareness about healthy nutritional supplements. One such important cereal grain not used mostly by youngsters is barley It is a good old grain with so many health benefits like weight reduction, decreasing blood pressure, blood cholesterol, blood glucose in Type 2 diabetes and preventing colon cancer. It is easily available and cheap grain. It contains both soluble and insoluble fiber, protein, vitamins B and E, minerals selenium, magnesium and iron, copper, flavonoids and anthocynins. Barley contains soluble fiber, beta glucan binds to bile acids in the intestines and thereby decreasing plasma cholesterol levels. Absorbed soluble fiber decreases cholesterol synthesis by liver and cleansing blood vessels. Insoluble fiber provides bulkiness in the intestines, thereby satiety. decreased appetite. It promotes intestinal movements relieving constipation, cleansing colonic harmful bacteria and reduced incidence of colonic cancer. It is a good source of niacin ,reducing LDL levels and increasing HDL levels. Selenium and vitamin E providing beneficial antioxidant effects. Magnesium, a cofactor for many carbohydrate metabolism enzymes and high fiber content contributes for its blood glucose reducing effect in Type 2 diabetes. It is having good diuretic activity and is useful in urinary tract infections. Barley contains gluten, contraindicated in celiac disease.

  5. Research on modeling germination response to salinity of barley seeds%大麦种子对盐的发芽响应模型

    Institute of Scientific and Technical Information of China (English)

    张红香; 田雨; 周道玮; 郑伟; 王敏玲


    salinities. Methods Two varieties of barley {Hordeum vulgare) seeds ('Cask' and 'County') were cultured in five binate iso-osmotic polyethylene glycol (PEG) and NaCl solutions (-0.45, -0.88, -1.32, -1.76 and -2.20 MPa, distilled water as the control) at four constant temperatures of 5, 12, 20 and 27 ℃. Germination time courses were recorded and germination rates (the reciprocal of germination time) were calculated. The hydrotime model and the new salinity model were used to calculate the parameters and test which was the better fit. Important findings Results indicated that not only were seeds in saline conditions able to germinate at lower osmotic potentials than seeds germinating in an isotonic PEG-6000 solution, but that they were also able to do so faster. The hydrotime parameters of the NaCl treatments had great differences with the isotonic PEG treatments, which indicated the hydrotime model cannot describe salt effects on seed germination well. Barley seed germination rates in salt solutions were negatively linear with salinity. We proposed a salinity model to quantify germination response to salt. The germination time calculated from the salinity model approached the real data, compared to that calculated from the hydrotime model. Differences of germination rates in NaCl and the isotonic PEG treatments increased and then decreased with decreasing water potential. We suggest three situations of function mode by the osmotic and ion effects of salt. First, at low salinities the osmotic effect acts as the main negative role. Second, at medium salinities the two effects act together, with the positive ion effect stronger than the negative osmotic effect. Third, at high salinities the ion effect begins to harm the germination process.

  6. Effect of fennel (Foeniculum vulgare on

    Directory of Open Access Journals (Sweden)

    Eman G.E. Helal,Fatma Ahmed Eid and Amira M. Salah EL-Din Ahmed El


    Full Text Available Hyperlipidemia (mainly increased level of total cholesterol (TC, triglycerides (TG and low-density lipoprotein(LDL cholesterol with a decrease in high-density lipoprotein(HDL- cholesterol is the predictor of coronary artery disease (CAD. Hyperlipidemia is an important risk factor in the initiation and progression of atherosclerotic impasse. Aim of the work: Many people have fast food that contains large amount of lipids and leads to the formation of free radicals which cause hyperlipidemia. The present study demonstrate the effect of the fennel (Foeniculum vulgare in the treatment of hyperlipidemia. Material and methods: Six groups (5rat/group of female albino rats (Rattus albinus were used. The 1st group used as control, in the 2nd group hyperlipidemia (25% fat and 2% cholesterol was induced for 3 weeks only then sacrified , the 3rd group was hyperlipidemic rats for 3 weeks then left for a further 3 weeks without any additional treatment as a recovery period, the 4th group served as hyperlipidemic group for 3 weeks then treated with Foeniculum vulgare for another 3 weeks (10 mg/100 gm b. wt., the 5th group was hyperlipidemic (25% fat and 2% cholesterol for 6 weeks and the 6th group served as hyperlipidemic rats for 6 weeks, and at the same time given Foeniculum vulgare (10 mg/100 gm b. wt. by oral administration. Results: The biochemical parameters showed highly significant increase in the body weight, serum glucose, ASAT, ALAT, GGT, LDH, total protein, albumin and total lipids in liver .Many histopathological and histochemical changes were detected in liver tissue of the hyperlipidemic rats. Meanwhile, the treatment with fennel ameliorated the biochemical parameters, histological and histochemical results. Conclusion: It is recommend to use fennel in diets for hyperlipidemic patients or those people who have hyperlipidemic family history.

  7. Acometimento oral no pênfigo vulgar


    Miziara Ivan Dieb; Ximenes Filho João Aragão; Ribeiro Fernando César; Brandão Ana Laura


    O Pênfigo Vulgar (PV) é uma doença vesicobolhosa caracterizada pela presença de auto-anticorpos contra moléculas de adesão intraepidérmicas. OBJETIVO: Identificar as características do PV em cada sexo, formas de apresentação, idade de acometimento, métodos de diagnóstico e tratamento utilizado. FORMA DE ESTUDO: coorte histórica. CASUÍSTICA E MÉTODO: Pacientes com PV acompanhados no Ambulatório de Otorrinolaringologia do HC-FMUSP entre 1990 e 2001. RESULTADOS: Dos 23 pacientes, 91,3% foram mul...

  8. Caracterización morfológica de almidones de los géneros Triticum y Hordeum en la Península Ibérica

    Directory of Open Access Journals (Sweden)

    López Sáez, José Antonio


    Full Text Available Starch grains are increasingly used in archaeobotanical studies as markers of diet, plant domestication, tool use and site organization in archaeological research, because their morphology and features provide a means to identify the plant that produced them. In this paper we characterize morphometrically the starch grains of five species of the genus Triticum and three varieties of Hordeum vulgare. In addition there is an assessment of the studies of starch grains made in the Prehistory of the Iberian Peninsula, indicating the achievements, the weaknesses and future directions to promote this type of bioarchaeological analysis; especially, there is a need to rely on wide reference collections, as well as apply statistical analyses and carry out experimental studies to control the processes of alteration of the starch grains.Los granos de almidón son cada vez más utilizados en los estudios arqueobotánicos como marcadores de la dieta, la domesticación de plantas, el uso de herramientas y la organización microespacial de los yacimientos arqueológicos, debido a que su morfología y características permiten identificar las plantas que los produjeron. En el presente trabajo se caracterizan morfométricamente los granos de almidón de cinco especies del género Triticum y tres variedades de Hordeum vulgare. Además se hace un balance de los estudios de almidones realizados en la Prehistoria de la Península Ibérica, señalando los logros, las debilidades y futuras directrices para potenciar este tipo de análisis bioarqueológico; especialmente la necesidad de contar con amplias colecciones de referencia, la aplicación de análisis estadísticos paralelos, y la realización de estudios experimentales para controlar los procesos de alteración de los almidones.

  9. Main: 1HT6 [RPSD[Archive

    Lifescience Database Archive (English)


  10. Nitrogen accumulation and residual effects of nitrogen catch crops

    DEFF Research Database (Denmark)

    Jensen, E.S.


    The nitrogen accumulation in Italian ryegrass (Lolium multiflorum Lam.), perennial ryegrass (Lolium perenne L.), white mustard (Sinapis alba L.) and tansy phacelia (Phacelia tanacetifolia L.), under- or aftersown as nitrogen catch crops to spring barley (Hordeum vulgare L.) and field pea (Pisum s...

  11. 21 CFR 184.1445 - Malt syrup (malt extract). (United States)


    ... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Malt syrup (malt extract). 184.1445 Section 184... Listing of Specific Substances Affirmed as GRAS § 184.1445 Malt syrup (malt extract). (a) Malt is the product of barley (Hordeum vulgare L.) germinated under controlled conditions. Malt syrup and malt...

  12. Long-term rotation and tillage effects on soil structure and crop yield

    DEFF Research Database (Denmark)

    Munkholm, Lars Juhl; Heck, R; Deen, B


    long-term rotation and tillage treatment experiment on a Canadian silt loam soil. Topsoil measurements were carried out for three different rotations: R1, (C–C–C–C) continuous corn (Zea mays L.), R6, (C–C–O(RC), B(RC)) corn, corn, oats (Avena fatua L.) and spring barley (Hordeum vulgare L.) and R8, (C...

  13. Long-Term Effects of Rotational Tillage On Visual Evaluation of Soil Structure, Soil Quality and Crop Yield

    DEFF Research Database (Denmark)

    Munkholm, Lars Juhl; Heck, Richard; Deen, Bill

    year old long-term rotation and tillage treatment experiment on a Canadian silt loam soil. Measurements were carried out in the topsoil for three different rotations: R1 (C-C-C-C) continuous corn (Zea mays L.), R6. (C-C-O(RC), B(RC)) corn, corn, oats (Avena fatua L.) and spring barley (Hordeum vulgare...

  14. Nitrogen mineralization and denitrification as influenced by crop residue particle size

    DEFF Research Database (Denmark)

    Ambus, P.; Jensen, E.S.


    Managing the crop residue particle size has the potential to affect N conservation in agricultural systems. We investigated the influence of barley (Hordeum vulgare) and pea (Pisum sativum) crop residue particle size on N mineralization and denitrification in two laboratory experiments. Experiment...

  15. Reference: LTRE1HVBLT49 [PLACE

    Lifescience Database Archive (English)

    Full Text Available LTRE1HVBLT49 Dunn MA, White AJ, Vural S, Hughes MA Identification of promoter eleme...nts in a low-temperature-responsive gene (blt4.9) from barley (Hordeum vulgare L.) Plant Mol Biol 38:551-564 (1998) PubMed: 9747801; ...

  16. Genomic Prediction in Barley

    DEFF Research Database (Denmark)

    Edriss, Vahid; Cericola, Fabio; Jensen, Jens D;

    Genomic prediction uses markers (SNPs) across the whole genome to predict individual breeding values at an early growth stage potentially before large scale phenotyping. One of the applications of genomic prediction in plant breeding is to identify the best individual candidate lines to contribute...... to next generation. The main goal of this study was to see the potential of using genomic prediction in a commercial Barley breeding program. The data used in this study was from Nordic Seed company which is located in Denmark. Around 350 advanced lines were genotyped with 9K Barely chip from...... Illumina. Traits used in this study were grain yield, plant height and heading date. Heading date is number days it takes after 1st June for plant to head. Heritabilities were 0.33, 0.44 and 0.48 for yield, height and heading, respectively for the average of nine plots. The GBLUP model was used for genomic...

  17. Genomic Prediction in Barley

    DEFF Research Database (Denmark)

    Edriss, Vahid; Cericola, Fabio; Jensen, Jens D;


    Genomic prediction uses markers (SNPs) across the whole genome to predict individual breeding values at an early growth stage potentially before large scale phenotyping. One of the applications of genomic prediction in plant breeding is to identify the best individual candidate lines to contribute...... to next generation. The main goal of this study was to see the potential of using genomic prediction in a commercial Barley breeding program. The data used in this study was from Nordic Seed company which is located in Denmark. Around 350 advanced lines were genotyped with 9K Barely chip from...... Illumina. Traits used in this study were grain yield, plant height and heading date. Heading date is number days it takes after 1st June for plant to head. Heritabilities were 0.33, 0.44 and 0.48 for yield, height and heading, respectively for the average of nine plots. The GBLUP model was used for genomic...

  18. Chemical Composition of Essential Oil from Marrubium Vulgare L. Leaves


    Bayir, Burcu; Gündüz, Hatice; Usta, Tuba; Şahin, Esma; Özdemir, Zeynep; Kayır, Ömer; Sen, Özkan; Akşit, Hüseyin; Elmastaş, Mahfuz; Erenler, Ramazan


    – The essential oils are significant for pharmaceutical, food and cosmetic industries. Marrubium vulgare L. has been used as a traditional medicine to treat the various illnesses. The chemical composition of the essential oil from leaves of Marrubium vulgare L.was obtained by steam distillation using the Clevenger apparatus. The oil was analyzed by gas chromatography and mass spectrometry (GC-MS). The main constituent of the oil was α-pinene (28.85%)

  19. Contrasting phosphate acquisition of mycorrhizal fungi with that of root hairs using the root hairless barley mutant

    DEFF Research Database (Denmark)

    Jakobsen, I.; Chen, B.D.; Munkvold, L.;


    dependency of a spontaneous root hairless mutant, brb, in Hordeum vulgare cv Pallas and its wild type. Both brb and wild type were grown at different soil P levels in association with different mycorrhizal fungi. P uptake of brb and wild type was similar at high P levels, but P uptake by non-mycorrhizal brb......Comparisons between plant species or cultivars differing in root hair length have indicated a major impact of root hairs on the mycorrhizal dependency of plants with respect to phosphate (P) uptake. The current study aimed to investigate this relationship by comparing directly the mycorrhizal...... plants at low P levels was substantially lower than that of the non-mycorrhizal wild-type plants. However, P uptake of the mutant was much increased by mycorrhizas and with one fungus, the additional P uptake was effectively translated into increased plant growth. Roots of the mutant contained typical...

  20. The Swedish mutant barley collection

    International Nuclear Information System (INIS)

    Full text: The Swedish mutation research programme in barley began about 50 years ago and has mainly been carried out at Svaloev in co-operation with the institute of Genetics at the University of Lund. The collection has been produced from different Swedish high-yielding spring barley varieties, using the following mutagens: X-rays, neutrons, several organic chemical compounds such as ethyleneimine, several sulfonate derivatives and the inorganic chemical mutagen sodium azide. Nearly 10,000 barley mutants are stored in the Nordic Gene Bank and documented in databases developed by Udda Lundquist, Svaloev AB. The collection consists of the following nine categories with 94 different types of mutants: 1. Mutants with changes in the spike and spikelets; 2. Changes in culm length and culm composition; 3. Changes in growth types; 4. Physiological mutants; 5. Changes in awns; 6. Changes in seed size and shape; 7. Changes in leaf blades; 8. Changes in anthocyanin and colour; 9. Resistance to barley powdery mildew. Barley is one of the most thoroughly investigated crops in terms of induction of mutations and mutation genetics. So far, about half of the mutants stored at the Nordic Gene Bank, have been analysed genetically; They constitute, however, only a minority of the 94 different mutant types. The genetic analyses have given valuable insights into the mutation process but also into the genetic architecture of various characters. A number of mutants of two-row barley have been registered and commercially released. One of the earliest released, Mari, an early maturing, daylength neutral, straw stiff mutant, is still grown in Iceland. The Swedish mutation material has been used in Sweden, but also in other countries, such as Denmark, Germany, and USA, for various studies providing a better understanding of the barley genome. The collection will be immensely valuable for future molecular genetical analyses of clone mutant genes. (author)