
Sample records for barium 114

  1. Barium Sulfate (United States)

    Barium sulfate is used to help doctors examine the esophagus (tube that connects the mouth and stomach), stomach, and ... pictures of the inside of the body). Barium sulfate is in a class of medications called radiopaque ...

  2. Radioisotope analyzer of barium

    International Nuclear Information System (INIS)

    Principle of operation and construction of radioisotope barium sulphate analyzer type MZB-2 for fast determination of barium sulphate content in barite ores and enrichment products are described. The gauge equipped with Am-241 and a scintillation detector enables measurement of barium sulphate content in prepared samples of barite ores in the range 60% - 100% with the accuracy of 1%. The gauge is used in laboratories of barite mine and ore processing plant. 2 refs., 2 figs., 1 tab. (author)

  3. Lower GI Series (Barium Enema) (United States)

    ... barium into a bedpan or nearby toilet. A health care professional may give you an enema to flush out the rest of the barium. An x-ray technician and a radiologist perform a lower gastrointestinal (GI) series at a ...

  4. New barium tantalum sulphides

    International Nuclear Information System (INIS)

    The authors discuss a new barium tantalum sulphide, Ba3Ta2S8, prepared by sulphurization of a mixture of BaCO3 and Ta2O5. The electron and powder X-ray diffraction patterns of the compound are indexed on the basis of a monoclinic cell with lattice constants. A structure model is proposed. The refinement based on the powder X-ray diffraction intensities is performed

  5. On Barium Oxide Solubility in Barium-Containing Chloride Melts (United States)

    Nikolaeva, Elena V.; Zakiryanova, Irina D.; Bovet, Andrey L.; Korzun, Iraida V.


    Oxide solubility in chloride melts depends on temperature and composition of molten solvent. The solubility of barium oxide in the solvents with barium chloride content is essentially higher than that in molten alkali chlorides. Spectral data demonstrate the existence of oxychloride ionic groupings in such melts. This work presents the results of the BaO solubility in two molten BaCl2-NaCl systems with different barium chloride content. The received data together with earlier published results revealed the main regularities of BaO solubility in molten BaO-BaCl2-MCl systems.

  6. MR Colonography with fecal tagging: Barium vs. barium ferumoxsil

    DEFF Research Database (Denmark)

    Achiam, M.P.; Chabanova, E.; Logager, V.B.;


    and Methods. Twenty patients referred to CC underwent dark lumen MRC prior to the colonoscopy. Two groups of patients received two different oral contrast agents (barium sulfate and barium sulfate/ferumoxsil) as a laxative-free fecal tagging prior to the MRC. After MRC, the contrast agent was rated...... qualitatively (with the standard method using contrast-to-wall ratio) and subjectively (using a visual analog scale [VAS]) by three different blinded observers. Results. Evaluated both qualitatively and subjectively, the tagging efficiency of barium sulfate/ferumoxsil was significantly better (P ... barium sulfate alone. The VAS method for evaluating the tagging efficiency of contrast agents showed a high correlation (observer 11, r = 0.91) to the standard method using contrast-to-wall ratio and also a high interclass correlation (observer 11 and III = 0.89/0.85). MRC found I of 22 (5%) polyps

  7. Doped barium titanate nanoparticles

    Indian Academy of Sciences (India)

    T K Kundu; A Jana; P Barik


    We have synthesized nickel (Ni) and iron (Fe) ion doped BaTiO3 nanoparticles through a chemical route using polyvinyl alcohol (PVA). The concentration of dopant varies from 0 to 2 mole% in the specimens. The results from X-ray diffractograms and transmission electron micrographs show that the particle diameters in the specimen lie in the range 24–40 nm. It is seen that the dielectric permittivity in doped specimens is enhanced by an order of magnitude compared to undoped barium titanate ceramics. The dielectric permittivity shows maxima at 0.3 mole% doping of Fe ion and 0.6 mole% of Ni ion. The unusual dielectric behaviour of the specimens is explained in terms of the change in crystalline structure of the specimens.

  8. New barium tantalum sulphides

    International Nuclear Information System (INIS)

    A new barium tantalum sulphide has been synthesized by the reaction of CS2 with a mixture of BaCO3 and Ta2O5. The chemical analysis of the compound was performed for 3 components (Ba, Ta and S), and the chemical composition was found to be BaTa2S5. The powder X-ray diffraction peaks were indexable on the basis of a hexagonal cell with lattices constants of a=3.32A, c=25.13A. However, the electron diffraction measurements show that the structure is more complex than that observed by powder X-ray diffraction. The compound indicates metallic behavior and Pauli paramagnetism

  9. Abundance analysis of barium and mild barium stars

    CERN Document Server

    Smiljanic, R; Silva, L


    High signal to noise, high resolution spectra were obtained for a sample of normal, mild barium, and barium giants. Atmospheric parameters were determined from the FeI and FeII lines. Abundances for Na, Mg, Al, Si, Ca, Sc, Ti, V, Cr, Mn, Fe, Co, Ni, Cu, Zn, Sr, Y, Zr, Ba, La, Ce, Nd, Sm, Eu, and Gd, were determined from equivalent widths and model atmospheres in a differential analysis, with the red giant Eps Vir as the standard star. The different levels of s-process overabundances of barium and mild barium stars were earlier suggested to be related to the stellar metallicity. Contrary to this suggestion, we found in this work no evidence for barium and mild barium to have a different range in metallicity. However, comparing the ratio of abundances of heavy to light s-process elements, we found some evidence that they do not share the same neutron exposure parameter. The exact mechanism controlling this difference is still not clear. As a by-product of this analysis we identify two normal red giants misclass...

  10. Discovery of the Barium Isotopes


    SHORE, A.; A. Fritsch; Ginepro, J. Q.; Heim, M.; Schuh, A.; Thoennessen, M


    Thirty-eight barium isotopes have so far been observed; the discovery of these isotopes is discussed. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  11. Barium light source method and apparatus (United States)

    Curry, John J. (Inventor); MacDonagh-Dumler, Jeffrey (Inventor); Anderson, Heidi M. (Inventor); Lawler, James E. (Inventor)


    Visible light emission is obtained from a plasma containing elemental barium including neutral barium atoms and barium ion species. Neutral barium provides a strong green light emission in the center of the visible spectrum with a highly efficient conversion of electrical energy into visible light. By the selective excitation of barium ionic species, emission of visible light at longer and shorter wavelengths can be obtained simultaneously with the green emission from neutral barium, effectively providing light that is visually perceived as white. A discharge vessel contains the elemental barium and a buffer gas fill therein, and a discharge inducer is utilized to induce a desired discharge temperature and barium vapor pressure therein to produce from the barium vapor a visible light emission. The discharge can be induced utilizing a glow discharge between electrodes in the discharge vessel as well as by inductively or capacitively coupling RF energy into the plasma within the discharge vessel.

  12. Radioisotope barium sulphate gauge MZB-2

    International Nuclear Information System (INIS)

    A method and the gauge for measuring content of barium sulphate are described. The gauge is intended for fast determination of barium sulphate in barite ore and in output products of the enrichment process. The measuring range 60-100% of BaSO4, accuracy ±1% and measuring time 60 s were reached. The barium sulphate gauge is used in barite mine ''Boguszow'' in Poland. (author)

  13. The problem of the barium stars (United States)

    Bohm-Vitense, E.; Nemec, J.; Proffitt, C.


    Ultraviolet observations of barium stars and other cool stars with peculiar element abundances are reported. Those observations attempted to find hot white dwarf companions. Among six real barium stars studied, only Zeta Cap was found to have a white dwarf companion. Among seven mild, or marginal, barium stars studied, at least three were found to have hot subluminous companions. It is likely that all of them have white dwarf companions.

  14. Barium aspiration and alveolarisation of barium in an infant: A case report and review of management

    Directory of Open Access Journals (Sweden)

    Alan F. Isles


    Full Text Available We describe a case of bilateral inhalation and alveolarisation of barium in an infant following a barium swallow for investigation of dusky spells associated with feeds. A bronchoscopy subsequently revealed the presence of a mid-tracheal tracheo-oesophageal cleft. We review the literature on barium aspiration, its consequences and make recommendations for management.


    Institute of Scientific and Technical Information of China (English)

    GE Qin-min; BIAN Fan; WANG Shu-yun; SHEN Sheng-hui


    @@ Most barium poisoning cases were caused by oral intake by mistake. Recent years, barium carbonate poisoning has been rare to be reported. Here we reported a case of acute barium carbonate toxication taken orally on purpose.

  16. Processing science of barium titanate (United States)

    Aygun, Seymen Murat

    Barium titanate and barium strontium titanate thin films were deposited on base metal foils via chemical solution deposition and radio frequency magnetron sputtering. The films were processed at elevated temperatures for densification and crystallization. Two unifying research goals underpin all experiments: (1) To improve our fundamental understanding of complex oxide processing science, and (2) to translate those improvements into materials with superior structural and electrical properties. The relationships linking dielectric response, grain size, and thermal budget for sputtered barium strontium titanate were illustrated. (Ba 0.6Sr0.4)TiO3 films were sputtered on nickel foils at temperatures ranging between 100-400°C. After the top electrode deposition, the films were co-fired at 900°C for densification and crystallization. The dielectric properties were observed to improve with increasing sputter temperature reaching a permittivity of 1800, a tunability of 10:1, and a loss tangent of less than 0.015 for the sample sputtered at 400°C. The data can be understood using a brick wall model incorporating a high permittivity grain interior with low permittivity grain boundary. However, this high permittivity value was achieved at a grain size of 80 nm, which is typically associated with strong suppression of the dielectric response. These results clearly show that conventional models that parameterize permittivity with crystal diameter or film thickness alone are insufficiently sophisticated. Better models are needed that incorporate the influence of microstructure and crystal structure. This thesis next explores the ability to tune microstructure and properties of chemically solution deposited BaTiO3 thin films by modulation of heat treatment thermal profiles and firing atmosphere composition. Barium titanate films were deposited on copper foils using hybrid-chelate chemistries. An in-situ gas analysis process was developed to probe the organic removal and the

  17. Laser cooling and trapping of barium

    NARCIS (Netherlands)

    De, Subhadeep


    Laser cooling and trapping of heavy alkaline-earth element barium have been demonstrated for the first time ever. For any possible cycling transition in barium that could provide strong cooling forces, the excited state has a very large branching probability to metastable states. Additional lasers a

  18. Synthesis of barium titanium oxide from barium sulphate and anatase. Study of equimolar mixtures under different atmospheres

    International Nuclear Information System (INIS)

    To enable the ceramization of a barium sulphate-rich radioactive waste the synthesis of barium titanium oxide is studied by using anatase and barium sulphate. As a function of the calcination atmosphere, helium (or air) and Ar/H2, two reactions are studied. A mechanism of barium titanium oxide synthesis in helium (or in air) is proposed

  19. Double contrast barium meal and acetylcysteine

    International Nuclear Information System (INIS)

    In a prospective double blind study, acetylcysteine, a local and systemic respiratory tract mucolytic agent, or a placebo, were given to 100 patients prior to a double contrast barium meal to decrease the gastric mucus viscosity and to make the mucus layer thinner, in order to permit barium to outline the furrows surrounding the areae gastricae instead of the overlying thick mucus. However, acetylcysteine failed to improve either visualization of the areae gastricae or the general quality of the double contrast barium meal. (orig.)

  20. 21 CFR 163.114 - Lowfat cocoa. (United States)


    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Lowfat cocoa. 163.114 Section 163.114 Food and... CONSUMPTION CACAO PRODUCTS Requirements for Specific Standardized Cacao Products § 163.114 Lowfat cocoa. (a) Description. Lowfat cocoa is the food that conforms to the definition and standard of identity, and is...

  1. 49 CFR 195.114 - Used pipe. (United States)


    ... 49 Transportation 3 2010-10-01 2010-10-01 false Used pipe. 195.114 Section 195.114 Transportation... PIPELINE Design Requirements § 195.114 Used pipe. Any used pipe installed in a pipeline system must comply with § 195.112 (a) and (b) and the following: (a) The pipe must be of a known specification and...

  2. 42 CFR 66.114 - Copyright. (United States)


    ... 42 Public Health 1 2010-10-01 2010-10-01 false Copyright. 66.114 Section 66.114 Public Health... NATIONAL RESEARCH SERVICE AWARDS Direct Awards § 66.114 Copyright. Where the work accomplished under an Award results in a book or other copyrightable material, the author is free to copyright the work,...

  3. 21 CFR 56.114 - Cooperative research. (United States)


    ... 21 Food and Drugs 1 2010-04-01 2010-04-01 false Cooperative research. 56.114 Section 56.114 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL INSTITUTIONAL REVIEW BOARDS IRB Functions and Operations § 56.114 Cooperative research. In complying with...

  4. 7 CFR 1c.114 - Cooperative research. (United States)


    ... 7 Agriculture 1 2010-01-01 2010-01-01 false Cooperative research. 1c.114 Section 1c.114 Agriculture Office of the Secretary of Agriculture PROTECTION OF HUMAN SUBJECTS § 1c.114 Cooperative research. Cooperative research projects are those projects covered by this policy which involve more than...

  5. 29 CFR 780.114 - Wild commodities. (United States)


    ... 29 Labor 3 2010-07-01 2010-07-01 false Wild commodities. 780.114 Section 780.114 Labor Regulations... AGRICULTURAL COMMODITIES, AND RELATED SUBJECTS UNDER THE FAIR LABOR STANDARDS ACT General Scope of Agriculture Agricultural Or Horticultural Commodities § 780.114 Wild commodities. Employees engaged in the gathering...

  6. 7 CFR 1160.114 - Eligible organization. (United States)


    ... 7 Agriculture 9 2010-01-01 2009-01-01 true Eligible organization. 1160.114 Section 1160.114... Order Definitions § 1160.114 Eligible organization. Eligible organization means an organization eligible... organization pursuant to section 501(c) (3), (5), or (6) of the Internal Revenue Code (26 U.S.C. 501(c) (3),...

  7. 7 CFR 1260.114 - Eligible organization. (United States)


    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Eligible organization. 1260.114 Section 1260.114... Promotion and Research Order Definitions § 1260.114 Eligible organization. Eligible organization means any organization which has been certified by the Secretary pursuant to the Act and this part as being eligible...

  8. 32 CFR 219.114 - Cooperative research. (United States)


    ... 32 National Defense 2 2010-07-01 2010-07-01 false Cooperative research. 219.114 Section 219.114...) MISCELLANEOUS PROTECTION OF HUMAN SUBJECTS § 219.114 Cooperative research. Cooperative research projects are... cooperative research projects, each institution is responsible for safeguarding the rights and welfare...

  9. 34 CFR 97.114 - Cooperative research. (United States)


    ... 34 Education 1 2010-07-01 2010-07-01 false Cooperative research. 97.114 Section 97.114 Education... Protection of Human Subjects (Basic ED Policy for Protection of Human Research Subjects) § 97.114 Cooperative research. Cooperative research projects are those projects covered by this policy which involve more...

  10. 10 CFR 745.114 - Cooperative research. (United States)


    ... 10 Energy 4 2010-01-01 2010-01-01 false Cooperative research. 745.114 Section 745.114 Energy DEPARTMENT OF ENERGY PROTECTION OF HUMAN SUBJECTS § 745.114 Cooperative research. Cooperative research... of cooperative research projects, each institution is responsible for safeguarding the rights...

  11. 45 CFR 690.114 - Cooperative research. (United States)


    ... 45 Public Welfare 3 2010-10-01 2010-10-01 false Cooperative research. 690.114 Section 690.114... OF HUMAN SUBJECTS § 690.114 Cooperative research. Cooperative research projects are those projects covered by this policy which involve more than one institution. In the conduct of cooperative...

  12. 45 CFR 46.114 - Cooperative research. (United States)


    ... 45 Public Welfare 1 2010-10-01 2010-10-01 false Cooperative research. 46.114 Section 46.114 Public... HHS Policy for Protection of Human Research Subjects § 46.114 Cooperative research. Cooperative research projects are those projects covered by this policy which involve more than one institution. In...

  13. 34 CFR 101.114 - Expeditious treatment. (United States)


    ... 34 Education 1 2010-07-01 2010-07-01 false Expeditious treatment. 101.114 Section 101.114 Education Regulations of the Offices of the Department of Education OFFICE FOR CIVIL RIGHTS, DEPARTMENT OF... § 101.114 Expeditious treatment. Requests for expeditious treatment of matters pending before...

  14. 45 CFR 81.114 - Expeditious treatment. (United States)


    ... 45 Public Welfare 1 2010-10-01 2010-10-01 false Expeditious treatment. 81.114 Section 81.114... HEARINGS UNDER PART 80 OF THIS TITLE Judicial Standards of Practice § 81.114 Expeditious treatment. Requests for expeditious treatment of matters pending before the responsible Department official or...

  15. Neutral Barium Cloud Evolution at Different Altitudes

    Institute of Scientific and Technical Information of China (English)

    李磊; 徐荣栏


    Considering the joint effects of diffusion, collision, oxidation and photoionization, we study the evolution of the barium cloud at different altitudes in the space plasma active experiment. The results present the variation of the loss rate, number density distribution and brightness of the barium cloud over the range from 120 to 260km.This can be divided into oxidation, oxidation plus photoionization and photoionization regions.

  16. Small barium rail gun for plasma injection. (United States)

    Kiwamoto, Y


    A small rail gun with a barium electrode can be operated at higher than one shot per second to produce more than 2x10(16) barium ions with energy 10-20 eV. The operation of the gun takes advantage of the external magnetic field for cross-field plasma injection into a trap. Up to 7 kG of the magnetic field examined, the gun performance improves with the increased magnetic field strength.

  17. Bacterial Reduction Of Barium Sulphate By Sulphate-Reducing Bacteria

    Directory of Open Access Journals (Sweden)

    Luptáková Alena


    Full Text Available Acid mine drainage (AMD is a worldwide problem leading to contamination of water sources. AMD are characterized by low pH and high content of heavy metals and sulphates. The barium salts application presents one of the methods for the sulphates removing from AMD. Barium chloride, barium hydroxide and barium sulphide are used for the sulphates precipitation in the form of barium sulphate. Because of high investment costs of barium salts, barium sulphide is recycled from barium sulphate precipitates. It can be recycled by thermic or bacterial reduction of barium sulphate. The aim of our study was to verify experimentally the possibility of the bacterial transformation of BaSO4 to BaS by sulphate-reducing bacteria. Applied BaSO4 came from experiments of sulphates removal from Smolnik AMD using BaCl2.

  18. Venous barium embolization, a rare, potentially fatal complication of barium enema: 2 case reports

    International Nuclear Information System (INIS)

    Venous embolization of barium has been recognized for 4 decades as one of the most dreaded complications of barium enema. Fortunately, the condition is extremely rare. In this report, the radiographic findings in 2 cases of venous embolization (one involving the portal vein and one systematic) are described, and ways to decrease the risk of this complication are discussed. (author)

  19. Thermochemical hydrogen production via a cycle using barium and sulfur - Reaction between barium sulfide and water (United States)

    Ota, K.; Conger, W. L.


    The reaction between barium sulfide and water, a reaction found in several sulfur based thermochemical cycles, was investigated kinetically at 653-866 C. Gaseous products were hydrogen and hydrogen sulfide. The rate determining step for hydrogen formation was a surface reaction between barium sulfide and water. An expression was derived for the rate of hydrogen formation.

  20. Synthesis of barium mercaptides and application of antimony/barium mercaptides

    Institute of Scientific and Technical Information of China (English)

    瞿龙; 张露露; 舒万艮


    Mercaptoacetic acid, isooctyl thioglycolate and barium hydroxide used as start materials, barium bis (2-ethylhexyl thioglycolate) (Ba(2EHTG)2), barium thioglycolate (Ba(TG)) and barium bisthioglycolate (Ba(TG)2) were synthesized. Their optimum synthetic techniques were discussed, and some physicochemical data were reported. Infrared spectroscopy and elemental analysis methods were used to identify the structures. They were put into PVC plastic products together with antimony tris (2-ethylhexyl thioglycolate) (Sb(2EHTG)3) under the suitable compounding, and their heat stability to PVC was studied. It is shown that these barium mercaptides have remarkable synergisms with antimony mercaptides and the long-term stabilizing effect of organoantimony stabilizer can be effectively improved, reducing the amount of antimony compounds so as to avoid the decrease of its stabilizing effect.

  1. Chemical abundances and kinematics of barium stars (United States)

    de Castro, D. B.; Pereira, C. B.; Roig, F.; Jilinski, E.; Drake, N. A.; Chavero, C.; Sales Silva, J. V.


    In this paper, we present an homogeneous analysis of photospheric abundances based on high-resolution spectroscopy of a sample of 182 barium stars and candidates. We determined atmospheric parameters, spectroscopic distances, stellar masses, ages, luminosities and scaleheight, radial velocities, abundances of the Na, Al, α-elements, iron-peak elements, and s-process elements Y, Zr, La, Ce, and Nd. We employed the local thermodynamic equilibrium model atmospheres of Kurucz and the spectral analysis code MOOG. We found that the metallicities, the temperatures and the surface gravities for barium stars cannot be represented by a single Gaussian distribution. The abundances of α-elements and iron peak elements are similar to those of field giants with the same metallicity. Sodium presents some degree of enrichment in more evolved stars that could be attributed to the NeNa cycle. As expected, the barium stars show overabundance of the elements created by the s-process. By measuring the mean heavy-element abundance pattern as given by the ratio [s/Fe], we found that the barium stars present several degrees of enrichment. We also obtained the [hs/ls] ratio by measuring the photospheric abundances of the Ba-peak and the Zr-peak elements. Our results indicated that the [s/Fe] and the [hs/ls] ratios are strongly anticorrelated with the metallicity. Our kinematical analysis showed that 90 per cent of the barium stars belong to the thin disc population. Based on their luminosities, none of the barium stars are luminous enough to be an asymptotic giant branch star, nor to become self-enriched in the s-process elements. Finally, we determined that the barium stars also follow an age-metallicity relation.

  2. 32 CFR 842.114 - Attorney fees. (United States)


    ... 32 National Defense 6 2010-07-01 2010-07-01 false Attorney fees. 842.114 Section 842.114 National... CLAIMS Claims Under the National Guard Claims Act (32 U.S.C. 715) § 842.114 Attorney fees. In the settlement of any claim pursuant to 32 U.S.C. 715 and this subpart, attorney fees will not exceed 20...

  3. Coherent Dark Resonances in Atomic Barium

    CERN Document Server

    Dammalapati, U; Jungmann, K; Willmann, L


    The observation of dark-resonances in the two-electron atom barium and their influence on optical cooling is reported. In heavy alkali earth atoms, i.e. barium or radium, optical cooling can be achieved using n^1S_0-n^1P_1 transitions and optical repumping from the low lying n^1D_2 and n^3D_{1,2} states to which the atoms decay with a high branching ratio. The cooling and repumping transition have a common upper state. This leads to dark resonances and hence make optical cooling less inefficient. The experimental observations can be accurately modelled by the optical Bloch equations. Comparison with experimental results allows us to extract relevant parameters for effective laser cooling of barium.

  4. Refractory oxides containing aluminium and barium


    Davies T.J.; Biedermann M.; Q-G. Chen; Emblem H. G.; Al-Douri W. A.


    Oxides containing aluminium and barium, optionally with chromium, are refractory with several possible industrial uses. A gel precursor of an oxide having the formula BaO.n(Al2xCr2yO3), where 1barium salt with a solution of an aluminium salt or a solution of an aluminium salt and a chromium III salt, then forming a gel which was fired to obtain the desired oxide. Filaments may be drawn as the gel is forming or extr...

  5. Electronic structure of nanograin barium titanate ceramics

    Institute of Scientific and Technical Information of China (English)

    DENG Xiangyun; WANG Xiaohui; LI Dejun; LI Longtu


    The density of states and band structure of 20 nm barium titanate(BaTiO3,BT)ceramics are investigated by first-principles calculation.The full potential linearized augmented plane wave(FLAPW)method is used and the exchange correlation effects are treated by the generalized gradient approximation(GGA).The results show that there is substantial hybridization between the Ti 3d and O 2p states in 20 nm BT ceramics and the interaction between barium and oxygen is typically ionic.

  6. Printed Barium Strontium Titanate capacitors on silicon

    Energy Technology Data Exchange (ETDEWEB)

    Sette, Daniele [Univ. Grenoble Alpes, F-38000 Grenoble (France); CEA, LETI, MINATEC Campus, F-38054 Grenoble (France); Luxembourg Institute of Science and Technology LIST, Materials Research and Technology Department, L-4422 Belvaux (Luxembourg); Kovacova, Veronika [Univ. Grenoble Alpes, F-38000 Grenoble (France); CEA, LETI, MINATEC Campus, F-38054 Grenoble (France); Defay, Emmanuel, E-mail: [Univ. Grenoble Alpes, F-38000 Grenoble (France); CEA, LETI, MINATEC Campus, F-38054 Grenoble (France); Luxembourg Institute of Science and Technology LIST, Materials Research and Technology Department, L-4422 Belvaux (Luxembourg)


    In this paper, we show that Barium Strontium Titanate (BST) films can be prepared by inkjet printing of sol–gel precursors on platinized silicon substrate. Moreover, a functional variable capacitor working in the GHz range has been made without any lithography or etching steps. Finally, this technology requires 40 times less precursors than the standard sol–gel spin-coating technique. - Highlights: • Inkjet printing of Barium Strontium Titanate films • Deposition on silicon substrate • Inkjet printed silver top electrode • First ever BST films thinner than 1 μm RF functional variable capacitor that has required no lithography.

  7. Dicty_cDB: SSL114 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSL114 (Link to dictyBase) - - - Contig-U16581-1 SSL114Z (Link... to Original site) - - SSL114Z 305 - - - - Show SSL114 Library SS (Link to library) Clone ID SSL114 (Link Representative seq. ID SSL11...4Z (Link to Original site) Representative DNA sequence >SSL114 (SSL114Q) /CSM/SS/SSL1-A/SSL114Q.Seq.d/ XXXXX...kknf*nspstfwcfc*ANAKVSLSPFALH YSPQAQIISSSTNDAPQVSSGLIHHIPMQLSQMYKQSLTKKNI Transla

  8. 21 CFR 114.10 - Personnel. (United States)


    ... Commissioner for giving instruction in food-handling techniques, food-protection principles, personal hygiene... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Personnel. 114.10 Section 114.10 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR...

  9. 21 CFR 114.100 - Records. (United States)


    ... examinations of raw materials, packaging materials, and finished products, and of suppliers' guarantees or... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Records. 114.100 Section 114.100 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR...

  10. 49 CFR 11.114 - Cooperative research. (United States)


    ... 49 Transportation 1 2010-10-01 2010-10-01 false Cooperative research. 11.114 Section 11.114... research. Cooperative research projects are those projects covered by this policy which involve more than one institution. In the conduct of cooperative research projects, each institution is responsible...

  11. 21 CFR 146.114 - Lemon juice. (United States)


    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Lemon juice. 146.114 Section 146.114 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN CONSUMPTION CANNED FRUIT JUICES Requirements for Specific Standardized Canned Fruit Juices and Beverages §...

  12. 11 CFR 114.1 - Definitions. (United States)


    ... or the National Credit Union Administration, if such loan is made in accordance with 11 CFR 100.82(a... the regulations issued pursuant to that Act, 29 CFR part 541, may serve as a guideline in determining... capital stock or trade association, as described in 11 CFR 114.7 and 114.8, may include some persons...

  13. 15 CFR 27.114 - Cooperative research. (United States)


    ... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Cooperative research. 27.114 Section... § 27.114 Cooperative research. Cooperative research projects are those projects covered by this policy which involve more than one institution. In the conduct of cooperative research projects,...

  14. 22 CFR 225.114 - Cooperative research. (United States)


    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Cooperative research. 225.114 Section 225.114... research. Cooperative research projects are those projects covered by this policy which involve more than one institution. In the conduct of cooperative research projects, each institution is responsible...

  15. 40 CFR 26.114 - Cooperative research. (United States)


    ... 40 Protection of Environment 1 2010-07-01 2010-07-01 false Cooperative research. 26.114 Section 26... Basic EPA Policy for Protection of Subjects in Human Research Conducted or Supported by EPA § 26.114 Cooperative research. Cooperative research projects are those projects covered by this policy which...

  16. 7 CFR 1942.114 - Security. (United States)


    ... 7 Agriculture 13 2010-01-01 2009-01-01 true Security. 1942.114 Section 1942.114 Agriculture... Security. Specific requirements for security for each loan will be included in the letter of conditions. Loans must be secured by the best security position practicable, in a manner which will...

  17. Thermal decomposition of barium valerate in argon

    DEFF Research Database (Denmark)

    Torres, P.; Norby, Poul; Grivel, Jean-Claude


    The thermal decomposition of barium valerate (Ba(C4H9CO2)(2)/Ba-pentanoate) was studied in argon by means of thermogravimetry, differential thermal analysis, IR-spectroscopy, X-ray diffraction and hot-stage optical microscopy. Melting takes place in two different steps, at 200 degrees C and 280...

  18. 75 FR 19657 - Barium Chloride From China (United States)


    ... Commission found that the domestic interested party group response to its notice of institution (74 FR 31757... COMMISSION Barium Chloride From China AGENCY: United States International Trade Commission. ACTION: Notice of... chloride from China. SUMMARY: The Commission hereby gives notice that it will proceed with a full...

  19. 75 FR 20625 - Barium Chloride From China (United States)


    ... established a schedule for the conduct of this review (74 FR 62587, November 30, 2010). Subsequently, counsel... From the Federal Register Online via the Government Publishing Office INTERNATIONAL TRADE COMMISSION Barium Chloride From China AGENCY: United States International Trade Commission. ACTION:...

  20. STS-114: Discovery Crew Arrival (United States)


    George Diller of NASA Public Affairs narrates the STS-114 Crew arrival at Kennedy Space Center aboard a Gulf Stream aircraft. They were greeted by Center Director Jim Kennedy. Commander Eileen Collins introduced each of her crew members and gave a brief description of their roles in the mission. Mission Specialist 3, Andrew Thomas will be the lead crew member on the inspection on flight day 2; he is the intravehicular (IV) crew member that will help and guide Mission Specialists Souichi Noguchi and Stephen Robinson during their spacewalks. Pilot James Kelly will be operating the shuttle systems in flying the Shuttle; he will be flying the space station robotic arm during the second extravehicular activity and he will be assisting Mission Specialist Wendy Lawrence during the other two extravehicular activities; he will be assisting on the rendezvous on flight day three, and landing of the shuttle. Commander Collins also mentioned Pilot Kelly's recent promotion to Colonel by the United States Air Force. Mission Specialist 1, Souichi Noguchi from JAXA (The Japanese Space Agency) will be flying on the flight deck for ascent; he will be doing three spacewalks on day 5, 7, and 9; He will be the photo/TV lead for the different types of cameras on board to document the flight and to send back the information to the ground for both technical and public affairs reasons. Mission Specialist 5, Charles Camada will be doing the inspection on flight day 2 with Mission Specialist Thomas and Pilot Kelly; he will be transferring the logistics off the shuttle and onto the space station and from the space station back to the shuttle; He will help set up eleven lap tops on board. Mission Specialist 4, Wendy Lawrence will lead the transfer of logistics to the space station; she is the space station arm operator during extravehicular activities 1 and 3; she will be carrying the 6,000 pounds of external storage platform from the shuttle payload bay over to the space station; she is also

  1. Barium carbonate as an agent to improve the electrical properties of neodymium-barium-copper system at high temperature

    Energy Technology Data Exchange (ETDEWEB)

    Fernandes, J.P. [Post-Graduate Program in Chemical Engineering, Universidade Federal de Santa Catarina (UFSC), Florianópolis, SC, 88040-900 (Brazil); Duarte, G.W. [Post-Graduate Program in Chemical Engineering, Universidade Federal de Santa Catarina (UFSC), Florianópolis, SC, 88040-900 (Brazil); Research Group in Technology and Information, Centro Universitário Barriga Verde (UNIBAVE), Santa Catarina, SC (Brazil); Caldart, C. [Post-Graduate Program in Science and Materials Engineering, Universidade do Extremo Sul Catarinense (UNESC), Criciúma, SC, 88806-000 (Brazil); Kniess, C.T. [Post-Graduate Program in Professional Master in Management, Universidade Nove de Julho, São Paulo, SP (Brazil); Montedo, O.R.K.; Rocha, M.R. [Post-Graduate Program in Science and Materials Engineering, Universidade do Extremo Sul Catarinense (UNESC), Criciúma, SC, 88806-000 (Brazil); Riella, H.G. [Post-Graduate Program in Chemical Engineering, Universidade Federal de Santa Catarina (UFSC), Florianópolis, SC, 88040-900 (Brazil); Fiori, M.A., E-mail: [Post-Graduate Program in Environmental Science, Universidade Comunitária da Região de Chapecó (UNOCHAPECÓ), Chapecó, SC, 89809-000 (Brazil); Post-Graduate Program in Technology and Management of the Innovation, Universidade Comunitária da Região de Chapecó (UNOCHAPECÓ), Chapecó, SC, 89809-000 (Brazil)


    Specialized ceramics are manufactured under special conditions and contain specific elements. They possess unique electrical and thermal properties and are frequently used by the electronics industry. Ceramics containing neodymium-barium-copper (NBC) exhibit high conductivities at low temperatures. NBC-based ceramics are typically combined with oxides, i.e., NBCo produced from neodymium oxide, barium oxide and copper oxide. This study presents NBC ceramics that were produced with barium carbonate, copper oxide and neodymium oxide (NBCa) as starting materials. These ceramics have good electrical conductivities at room temperature. Their conductivities are temperature dependent and related to the starting amount of barium carbonate (w%). - Highlights: • The new crystalline structure were obtained due presence of the barium carbonate. • The NBCa compound has excellent electrical conductivity at room temperature. • The grain crystalline morphology was modified by presence of the barium carbonate. • New Phases α and β were introduced by carbonate barium in the NBC compound.

  2. 9 CFR 113.114 - Tetanus Toxoid. (United States)


    ... VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Inactivated Bacterial Products § 113.114 Tetanus Toxoid. Tetanus Toxoid shall be produced from a culture of...

  3. 9 CFR 114.16 - Producing subsidiaries. (United States)



  4. Radioactive Barium Ion Trap Based on Metal-Organic Framework for Efficient and Irreversible Removal of Barium from Nuclear Wastewater. (United States)

    Peng, Yaguang; Huang, Hongliang; Liu, Dahuan; Zhong, Chongli


    Highly efficient and irreversible capture of radioactive barium from aqueous media remains a serious task for nuclear waste disposal and environmental protection. To address this task, here we propose a concept of barium ion trap based on metal-organic framework (MOF) with a strong barium-chelating group (sulfate and sulfonic acid group) in the pore structures of MOFs. The functionalized MOF-based ion traps can remove >90% of the barium within the first 5 min, and the removal efficiency reaches 99% after equilibrium. Remarkably, the sulfate-group-functionalized ion trap demonstrates a high barium uptake capacity of 131.1 mg g(-1), which surpasses most of the reported sorbents and can selectively capture barium from nuclear wastewater, whereas the sulfonic-acid-group-functionalized ion trap exhibits ultrafast kinetics with a kinetic rate constant k2 of 27.77 g mg(-1) min(-1), which is 1-3 orders of magnitude higher than existing sorbents. Both of the two MOF-based ion traps can capture barium irreversibly. Our work proposes a new strategy to design barium adsorbent materials and provides a new perspective for removing radioactive barium and other radionuclides from nuclear wastewater for environment remediation. Besides, the concrete mechanisms of barium-sorbent interactions are also demonstrated in this contribution.

  5. Production of translationally cold barium monohalide ions


    DePalatis, M. V.; Chapman, M.S.


    We have produced sympathetically cooled barium monohalide ions BaX$^+$ (X = F, Cl, Br) by reacting trapped, laser cooled Ba$^+$ ions with room temperature gas phase neutral halogen-containing molecules. Reaction rates for two of these (SF$_6$ and CH$_3$Cl) have been measured and are in agreement with classical models. BaX$^+$ ions are promising candidates for cooling to the rovibrational ground state, and our method presents a straightforward way to produce these polar molecular ions.

  6. Chemical abundances and kinematics of barium stars

    CERN Document Server

    de Castro, D B; Roig, F; Jilinski, E; Drake, N A; Chavero, C; Silva, J V Sales


    In this paper we present an homogeneous analysis of photospheric abundances based on high-resolution spectroscopy of a sample of 182 barium stars and candidates. We determined atmospheric parameters, spectroscopic distances, stellar masses, ages, luminosities and scale height, radial velocities, abundances of the Na, Al, $alpha$-elements, iron-peak elements, and s-process elements Y, Zr, La, Ce, and Nd. We employed the local-thermodynamic-equilibrium model atmospheres of Kurucz and the spectral analysis code {\\sc moog}. We found that the metallicities, the temperatures and the surface gravities for barium stars can not be represented by a single gaussian distribution. The abundances of $alpha$-elements and iron peak elements are similar to those of field giants with the same metallicity. Sodium presents some degree of enrichment in more evolved stars that could be attributed to the NeNa cycle. As expected, the barium stars show overabundance of the elements created by the s-process. By measuring the mean heav...

  7. Lanthanide doped strontium-barium cesium halide scintillators

    Energy Technology Data Exchange (ETDEWEB)

    Bizarri, Gregory; Bourret-Courchesne, Edith; Derenzo, Stephen E.; Borade, Ramesh B.; Gundiah, Gautam; Yan, Zewu; Hanrahan, Stephen M.; Chaudhry, Anurag; Canning, Andrew


    The present invention provides for a composition comprising an inorganic scintillator comprising an optionally lanthanide-doped strontium-barium, optionally cesium, halide, useful for detecting nuclear material.

  8. FDAMA Section 114: Why the Renewed Interest? (United States)

    Perfetto, Eleanor M; Burke, Laurie; Oehrlein, Elisabeth M; Gaballah, Mena


    The FDA regulates the use of information by biopharmaceutical companies in their promotional activities. Section 114 of the Food and Drug Administration Modernization Act of 1997 (FDAMA) was specifically designed to allow companies to more readily disseminate health care economic information (HCEI) to those who need it for formulary decision making. However, very little HCEI has been distributed promotionally under this provision over the past 17 years. There are recent discussions by stakeholders regarding the need for updates, revisions, or guidance regarding Section 114.In light of recent renewed interest in Section 114 of the FDAMA, the purpose of this commentary is to equip managed care decision makers with the information they need to understand and respond to industry communications that are governed by Section 114. This commentary reviews and synthesizes the regulatory history and language of the statute and changes to the promotion regulation generated by Section 114. It explores the reasons for the section's limited use to date, for recent renewed interest, and why changes by various stakeholders are suggested at this time. Also discussed is what managed care pharmacists need to know about Section 114, and suggestions are included regarding the active role pharmacists can play in this change process. Renewed interest in FDAMA Section 114 appears to stem largely from the increasingly visible and growing interest in comparative effectiveness research, the emergence of "big data," the expanding range of data sources available for deriving HCEI, and recent court decisions that might indicate a change in the regulatory environment. Various stakeholders are proposing recommendations regarding changes to FDAMA Section 114. Managed care pharmacists should be aware that companies are restricted when communicating HCEI promotional messages; this may mean seeing the use of FDAMA Section 114 as the "competent and reliable" effectiveness standard in promotion. If the

  9. FDAMA Section 114: Why the Renewed Interest? (United States)

    Perfetto, Eleanor M; Burke, Laurie; Oehrlein, Elisabeth M; Gaballah, Mena


    The FDA regulates the use of information by biopharmaceutical companies in their promotional activities. Section 114 of the Food and Drug Administration Modernization Act of 1997 (FDAMA) was specifically designed to allow companies to more readily disseminate health care economic information (HCEI) to those who need it for formulary decision making. However, very little HCEI has been distributed promotionally under this provision over the past 17 years. There are recent discussions by stakeholders regarding the need for updates, revisions, or guidance regarding Section 114.In light of recent renewed interest in Section 114 of the FDAMA, the purpose of this commentary is to equip managed care decision makers with the information they need to understand and respond to industry communications that are governed by Section 114. This commentary reviews and synthesizes the regulatory history and language of the statute and changes to the promotion regulation generated by Section 114. It explores the reasons for the section's limited use to date, for recent renewed interest, and why changes by various stakeholders are suggested at this time. Also discussed is what managed care pharmacists need to know about Section 114, and suggestions are included regarding the active role pharmacists can play in this change process. Renewed interest in FDAMA Section 114 appears to stem largely from the increasingly visible and growing interest in comparative effectiveness research, the emergence of "big data," the expanding range of data sources available for deriving HCEI, and recent court decisions that might indicate a change in the regulatory environment. Various stakeholders are proposing recommendations regarding changes to FDAMA Section 114. Managed care pharmacists should be aware that companies are restricted when communicating HCEI promotional messages; this may mean seeing the use of FDAMA Section 114 as the "competent and reliable" effectiveness standard in promotion. If the

  10. Dicty_cDB: SSC114 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSC114 (Link to dictyBase) - G20810 DDB0168553 Contig-U16129-1 SSC...114Z (Link to Original site) - - SSC114Z 573 - - - - Show SSC114 Library SS (Link to library) Clone ID SSC...riginal site URL ...Representative seq. ID SSC114Z (Link to Original site) Representative DNA sequence >SSC114 (SSC114Q) /CSM/SS/SSC1-A/SSC... alignments: (bits) Value SSC114 (SSC114Q) /CSM/SS/SSC1-A/SSC114Q.Seq.d/ 1094 0.0 SSL108 (SSL108Q) /CSM/SS/S

  11. Europium-doped barium bromide iodide

    Energy Technology Data Exchange (ETDEWEB)

    Gundiah, Gautam; Hanrahan, Stephen M.; Hollander, Fredrick J.; Bourret-Courchesne, Edith D.


    Single crystals of Ba0.96Eu0.04BrI (barium europium bromide iodide) were grown by the Bridgman technique. The title compound adopts the ordered PbCl2 structure [Braekken (1932). Z. Kristallogr. 83, 222-282]. All atoms occupy the fourfold special positions (4c, site symmetry m) of the space group Pnma with a statistical distribution of Ba and Eu. They lie on the mirror planes, perpendicular to the b axis at y = +-0.25. Each cation is coordinated by nine anions in a tricapped trigonal prismatic arrangement.

  12. Barium dithionate as an EPR dosemeter. (United States)

    Baran, M P; Bugay, O A; Kolesnik, S P; Maksimenko, V M; Teslenko, V V; Petrenko, T L; Desrosiers, M F


    Electron paramagnetic resonance (EPR) dosimetry is growing in popularity and this success has encouraged the search for other dosimetric materials. Previous studies of gamma-irradiated barium dithionate (BaS(2)O(6) x 2H(2)O) have shown promise for its use as a radiation dosemeter. This work studies in greater detail several essential attributes of the system. Special attention has been directed to the study of EPR response dependences on microwave power, irradiation temperature, minimum detectable dose and post-irradiation stability. PMID:16565205

  13. Scattering lengths of calcium and barium isotopes


    Dammalapati, U.; Willmann, L.; Knoop, S.


    We have calculated the s-wave scattering length of all the even isotopes of calcium (Ca) and barium (Ba), in order to investigate the prospect of Bose-Einstein condensation (BEC). For Ca we have used an accurate molecular potential based on detailed spectroscopic data. Our calculations show that Ca does not provide other isotopes alternative to the recently Bose condensed 40Ca that suffers strong losses because of a very large scattering length. For Ba we show by using a model potential that ...

  14. Barium enema findings of milk allergy in infants

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Gyoung Ju; Kim, Mi Jeong; Lee, Hee Jung [Keimyung University School of Medicine, Daegu (Korea, Republic of)


    We wanted to evaluate the barium enema findings of milk allergy in infants. Retrospective evaluation of the plain abdominal radiography and barium enema findings was performed in fifteen young infants suffering with milk allergy. The presence of gaseous distension, rectal gas, paralytic ileus and mechanical obstruction was evaluated on the plain radiography. The presence of spasm, a transitional zone, a reversed rectosigmoid index and mucosal irregularity was analyzed on the barium enema; the presence of barium retention was also evaluated on 24-hour-delayed plain radiography. Paralytic ileus was the most common finding on the plain radiography (93%). On the barium enema, continuous spasm of the colon, ranging from the rectum to the descending colon, was revealed in ten infants (67%). A transitional zone was observed in one infant and a reversed rectosigmoid index was revealed in four. Mucosal irregularity was observed in two infants. Barium retention was demonstrated in 11 of fifteen cases: throughout the entire colon (n = 3), from the rectum to the descending colon (n = 7), and up to the transverse colon (n = 1). The most common barium enema finding of milk allergy in infants was spasm of the distal colon. The other findings were a transitional zone, a reversed rectosigmoid index, mucosal irregularity and barium retention.

  15. 28 CFR 46.114 - Cooperative research. (United States)


    ... 28 Judicial Administration 2 2010-07-01 2010-07-01 false Cooperative research. 46.114 Section 46... Cooperative research. Cooperative research projects are those projects covered by this policy which involve more than one institution. In the conduct of cooperative research projects, each institution...

  16. 38 CFR 16.114 - Cooperative research. (United States)


    ... 38 Pensions, Bonuses, and Veterans' Relief 1 2010-07-01 2010-07-01 false Cooperative research. 16... OF HUMAN SUBJECTS § 16.114 Cooperative research. Cooperative research projects are those projects covered by this policy which involve more than one institution. In the conduct of cooperative...

  17. Barium and radium migration in unconsolidated Canadian geological materials

    International Nuclear Information System (INIS)

    This report describes the results of laboratory studies on the distribution coefficients of radium and barium in samples of unconsolidated geologic materials. Graphs of Ksub(d) versus solution concentration for the respective elements showed constant Ksub(d) values in the low concentration range suggesting that, at low concentrations, a distribution coefficient is a valid means of representing the geochemical reactions of both barium and radium. The Ksub(d) values for barium range between 60 and 3500 ml/g. The values appear to be influenced by the amount of barium occurring naturally in the soil materials and thus there is little possiblility of using barium as an analog of radium in laboratory experiments. The Ksub(d) values of radium vary from 50 to 1000 ml/g indicating that a wide range of geological materials have a substantial capacity to retard the migration of radium

  18. Barium appendicitis: A single institution review in Japan (United States)

    Katagiri, Hideki; Lefor, Alan Kawarai; Kubota, Tadao; Mizokami, Ken


    AIM To review clinical experience with barium appendicitis at a single institution. METHODS A retrospective review of patients admitted with a diagnosis of acute appendicitis, from January 1, 2013 to December 31, 2015 was performed. Age, gender, computed tomography (CT) scan findings if available, past history of barium studies, pathology, and the presence of perforation or the development of complications were reviewed. If the CT scan revealed high density material in the appendix, the maximum CT scan radiodensity of the material is measured in Hounsfield units (HU). Barium appendicitis is defined as: (1) patients diagnosed with acute appendicitis; (2) the patient has a history of a prior barium study; and (3) the CT scan shows high density material in the appendix. Patients who meet all three criteria are considered to have barium appendicitis. RESULTS In total, 396 patients were admitted with the diagnosis of acute appendicitis in the study period. Of these, 12 patients (3.0%) met the definition of barium appendicitis. Of these 12 patients, the median CT scan radiodensity of material in the appendix was 10000.8 HU, ranging from 3066 to 23423 HU (± 6288.2). In contrast, the median CT scan radiodensity of fecaliths in the appendix, excluding patients with barium appendicitis, was 393.1 HU, ranging from 98 to 2151 HU (± 382.0). The CT scan radiodensity of material in the appendices of patients with barium appendicitis was significantly higher than in patients with nonbarium fecaliths (P < 0.01). CONCLUSION Barium appendicitis is not rare in Japan. Measurement of the CT scan radiodensity of material in the appendix may differentiate barium appendicitis from routine appendicitis.

  19. High resolution studies of barium Rydberg states

    International Nuclear Information System (INIS)

    The subtle structure of Rydberg states of barium with orbital angular momentum 0, 1, 2 and 3 is investigated. Some aspects of atomic theory for a configuration with two valence electrons are reviewed. The Multi Channel Quantum Defect Theory (MQDT) is concisely introduced as a convenient way to describe interactions between Rydberg series. Three high-resolution UV studies are presented. The first two, presenting results on a transition in indium and europium serve as an illustration of the frequency doubling technique. The third study is of hyperfine structure and isotope shifts in low-lying p states in Sr and Ba. An extensive study of the 6snp and 6snf Rydberg states of barium is presented with particular emphasis on the 6snf states. It is shown that the level structure cannot be fully explained with the model introduced earlier. Rather an effective two-body spin-orbit interaction has to be introduced to account for the observed splittings, illustrating that high resolution studies on Rydberg states offer an unique opportunity to determine the importance of such effects. Finally, the 6sns and 6snd series are considered. The hyperfine induced isotope shift in the simple excitation spectra to 6sns 1S0 is discussed and attention is paid to series perturbers. It is shown that level mixing parameters can easily be extracted from the experimental data. (Auth.)


    Directory of Open Access Journals (Sweden)

    GRISHINA Anna Nikolaevna


    Full Text Available Cement concretes are the most used materials in modern civil engineering. Due to that such materials draw great attention both in the Russian Federation and abroad. The possibility to enhance the manufacturability and operational properties of concretes results in significant reduction of overall operating costs. Many enhancement methods have been elaborated. Among them there is one based on introduction of calcium hydrosilicates into construction composition. The authors set up a hypothesis that similarity between properties and structures of different hydrosilicates (for example, alkaline earth metals and metals of the second group will provide similar increased operational characteristics. The specialists of Research and Educational Center «Nanotechnology» are developing cement composites nanomodification methods which include introduction of nanodimensional barium hydrosilicates particles. The synthesis of barium hydrosilicates particles can be done with the use of many technologies, different by energy consumption or performing complexity. Taking into account both these factors, one can assume that low-temperature sol-gel synthesis from diluted water solutions is the proper technology. The present paper shows that this assumption is correct. The selection of certain technology is made by the means of multiobjective optimization, which is in turn is performed by the means of linear scalarization. This method, while not always giving the Pareto optimal solutions, can be easily implemented. The particle size distribution is taken into consideration during selection of objectives and weights. It is shown that selected technology allows manufacturing nanoparticles with median size about 30 nm.

  1. The Novel Formation of Barium Titanate Nanodendrites

    Directory of Open Access Journals (Sweden)

    Chien-Jung Huang


    Full Text Available The barium titanate (BaTiO3 nanoparticles with novel dendrite-like structures have been successfully fabricated via a simple coprecipitation method, the so-called BaTiO3 nanodendrites (BTNDs. This method was remarkable, fast, simple, and scalable. The growth solution is prepared by barium chloride (BaCl2, titanium tetrachloride (TiCl4, and oxalic acid. The shape and size of BaTiO3 depend on the amount of added BaCl2 solvent. To investigate the influence of amount of BaCl2 on BTNDs, the amount of BaCl2 was varied in the range from 3 to 6 mL. The role of BaCl2 is found to have remarkable influence on the morphology, crystallite size, and formation of dendrite-like structures. The thickness and length of the central stem of BTND were ~300 nm and ~20 μm, respectively. The branchings were found to occur at irregular intervals along the main stem. Besides, the formation mechanism of BTND is proposed and discussed.

  2. Coprecipitation of europium with barium sulphate

    International Nuclear Information System (INIS)

    The distribution behaviour of the trivalent europium ion at a micro-component scale, between barium sulphate and aqueous solution, was studied at ambient temperature. Experiments were carried out using radioactive tracers. Results indicate an enrichment of the micro component in the solid phase relative to the solution. The effects of the concentrations of the micro and macro-elements on the coprecipitation have been examined. Europium distribution coefficient DEu increases from 1.1 ± 0.2 to 3.2 ± 0.4 when initial europium concentration decreases from more than 17 x 10-5 to 1.4 x 10-5 M, in sulphuric media with SO42- in excess or CBa2+/CSO42- Eu. The coprecipitation of europium with barium sulphate as a heterovalent solid-solution is described by heterogeneous model obeying the Doerner and Hoskins logarithmic partition law. The weaker partition coefficients lower than unity (λ = 0.25 when CEu(III) ∼ 1.4 x 10-5 M and λ = 0.13 when CBa2+/CSO42- -5 ≤ CEu(III) = 153.5 x 10-5 M) lead to crystals increasingly enriched in the trace element. (orig.)

  3. Strengthening mechanism of steels treated by barium-bearing alloys

    Institute of Scientific and Technical Information of China (English)

    Zhouhua Jiang; Yang Liu


    The deoxidation, desulfurization, dephosphorization, microstructure, and mechanical properties of steels treated by barium-bearing alloys were investigated in laboratory and by industrial tests. The results show that barium takes part in the deoxidation reaction at the beginning of the experiments, generating oxide and sulfide compound inclusions, which easily float up from the molten steel, leading to the rapid reduction of total oxygen content to a very low level. The desulfurization and dephosphorization capabilities of calcium-bearing alloys increase with the addition of barium. The results of OM and SEM observations and mechanical property tests show that the structure of the steel treated by barium-bearing alloys is refined remarkably, the iamellar thickness of pearlitic structure decreases, and the pearlitic morphology shows clustering distribution. Less barium exists in steel substrate and the enrichment of barium-bearing precipitated phase mostly occurs in grain boundary and phase boundary, which can prevent the movement of grain boundary and dislocation during the heat treatment and the deformation processes. Therefore, the strength and toughness of barium-treated steels are improved by the effect of grain-boundary strengthening and nail-prick dislocation.

  4. Designed microstructures in textured barium hexaferrite (United States)

    Hovis, David Brian

    It is a fundamental principle of materials science that the microstructure of a material defines its properties and ultimately its performance for a given application. A prime example of this can be found in the large conch shell Strombus gigas, which has an intricate microstructure extending across five distinct length scales. This microstructure gives extraordinary damage tolerance to the shell. The structure of Strombus gigas cannot be replicated in a modern engineering ceramic with any existing processing technique, so new processing techniques must be developed to apply this structure to a model material. Barium hexaferrite was chosen as a model material to create microstructures reminiscent of Strombus gigas and evaluate its structure-property relations. This work describes novel processing methods to produce textured barium hexaferrite with no coupling between the sample geometry and the texture direction. This technique, combining magnetic field-assisted gelcasting with templated grain growth, also allows multilayer samples to be fabricated with different texture directions in adjacent layers. The effects of adding either B2O3 or excess BaCO 3 on the densification and grain growth of barium hexaferrite was studied. The texture produced using this technique was assessed using orientation imaging microscopy (OIM) at Oak Ridge National Laboratory. These measurements showed peak textures as high as 60 MRD and sharp interfaces between layers cast with different texture directions. The effect of oxygen on the quality of gelcasting is also discussed, and it is shown that with proper mold design, it is possible to gelcast multiple layers with differing texture directions without delamination. Monolithic and multilayer samples were produced and tested in four point bending to measure the strength and work of fracture. Modulus measurements, made with the ultrasonic pulse-echo technique, show clear signs of microcracking in both the isotropic and textured samples

  5. Chemical composition of Eu2+ luminescence in the barium hexaaluminates

    International Nuclear Information System (INIS)

    This paper consists of two parts. In the first part the chemical composition of two kinds of barium hexaaluminate (one poor and one rich in barium) is explained using the local electroneutrality concept. In the second part a reinvestigation of the Eu2+ luminescence in these compounds is reported. The emission spectrum of each of the two compounds shows a blue and a green emission bank. The blue emission bank is ascribed to Eu2+ ions at barium sites, whereas the green emission band is identified with Eu2+ ions incorporated at aluminum sites within spinel blocks of the structure

  6. Barium concentration in grain of Aegilops and Triticum species

    Directory of Open Access Journals (Sweden)

    Denčić Srbislav S.


    Full Text Available The aim of this study was to evaluate the concentration of barium in grain of various Aegilops and Triticum species with different genomes. The studied species differed significantly with respect to the concentration of barium. The grain of wild diploid Aegilops speltoides, the donor of B genome, contained significantly higher Ba concentration than all other analyzed genotypes. Wild and cultivated tetraploid wheats (Triticum diciccoides, Triticum dicoccon, Triticum turgidum and Triticum durum had the lowest Ba concentration in grain. The modern cultivated hexaploid varieties presented substantial variation in grain concentration of barium. The highest Ba concentration (3.42 mg/kg occurred in Serbian winter wheat variety Panonnia.

  7. Structure of barium sodium trimetaphosphate trihydrate

    Energy Technology Data Exchange (ETDEWEB)

    Averbuch-Pouchot, M.T.; Durif, A.


    BaNaP/sub 3/O/sub 9/ . 3H/sub 2/O, M/sub r/=451.29, triclinic, Panti 1, a=7.067(3), b=9.071(3), c=9.906(4) A, ..cap alpha..=116.46(5), ..beta..=95.97(5), ..gamma..=74.03(5)/sup 0/, V=546.4 A/sup 3/, Z=2, D/sub m/ not measured, D/sub x/=2.743 Mg m/sup -3/, lambda(Mo K..cap alpha..)=0.7107 A, mm/sup -1/, F(000)=428, T=293 K, R=0.028 for 3775 independent reflexions. The P/sub 3/O/sub 9/ ring anions and the water molecules build up a three-dimensional network through hydrogen bonds. Inside this network barium and sodium have respectively nine- and sevenfold coordinations.

  8. Analysis of europium doped luminescent barium thioaluminate

    Institute of Scientific and Technical Information of China (English)

    张东璞; 喻志农; 薛唯; 章婷; 丁瞾; 王武育


    Europium-doped barium thioaluminate sputtering target was synthesized by powder sintering method and thin film was deposited by radio frequency(RF) sputtering.X-ray diffractometer(XRD) pattern indicated that the main compound of the target was BaAl4S7.Oxygen was the main impurity which led to the formation of BaAl2O4.It was shown that both BaAl4S7 and BaAl2S4 were contained in the as-grown thin films and a 471.7 nm emission peak in the PL spectra appeared due to a combination of BaAl4S7:Eu2+ and BaAl2S4:Eu2...

  9. Chemical abundance analysis of 19 barium stars

    CERN Document Server

    Yang, G C; Spite, M; Chen, Y Q; Zhao, G; Zhang, B; Liu, G Q; Liu, Y J; Liu, N; Deng, L C; Spite, F; Hill, V; Zhang, C X


    We aim at deriving accurate atmospheric parameters and chemical abundances of 19 barium (Ba) stars, including both strong and mild Ba stars, based on the high signal-to-noise ratio and high resolution Echelle spectra obtained from the 2.16 m telescope at Xinglong station of National Astronomical Observatories, Chinese Academy of Sciences. The chemical abundances of the sample stars were obtained from an LTE, plane-parallel and line-blanketed atmospheric model by inputting the atmospheric parameters (effective temperatures, surface gravities, metallicity and microturbulent velocity) and equivalent widths of stellar absorption lines. These samples of Ba stars are giants indicated by atmospheric parameters, metallicities and kinematic analysis about UVW velocity. Chemical abundances of 17 elements were obtained for these Ba stars. Their light elements (O, Na, Mg, Al, Si, Ca, Sc, Ti, V, Cr, Mn and Ni) are similar to the solar abundances. Our samples of Ba stars show obvious overabundances of neutron-capture (n-ca...

  10. A novel barium polymeric membrane sensor for selective determination of barium and sulphate ions based on the complex ion associate barium(II)-Rose Bengal as neutral ionophore

    Energy Technology Data Exchange (ETDEWEB)

    Othman, A.M. [Genetic Engineering and Biotechnology Research Institute (GEBRI), Minufiya University, Sadat City (Egypt); El-Shahawi, M.S. [Chemistry Department, Faculty of Science at Damiatta, Mansoura University, Damiatta, Dumyat 34517 (Egypt)]. E-mail:; Abdel-Azeem, M. [Chemistry Department, Faculty of Science at Damiatta, Mansoura University, Damiatta, Dumyat 34517 (Egypt)


    A simple, long life, rapid response and sensitive barium(II)-PVC membrane sensor that typically follows Nernstian behavior has been developed for the assay of barium(II) ions. The developed sensor has been made by incorporating the complex ion associate of barium(II)-Rose Bengal (Ba-RB) as an ionophore into a plasticized PVC matrix. The sensor is stable and exhibited fast potential response of 20 s and gave a good linear response with a Nernstian slope of 28.5 {+-} 0.4 mV/decade of activity within the concentration range 5 x 10{sup -5} to 10{sup -1} M over a wide range of pH 4.5-10.0 for barium(II) ions. The developed sensor showed comparatively good selectivity for barium(II) ions with respect to other alkali, alkaline earth, transition and heavy metal ions. The plasticizer o-nitrophenyloctyl ether controlled significantly the calibration slope and the lifetime of the fabricated sensor. The proposed sensor was used successfully for the analysis of barium(II) ions in wastewater samples and in lithophone pigment with excellent recovery percentages in the range 98.9-99.8 {+-} 1.6%. The determination of sulphate in fresh and potable water samples with the developed sensor has been also achieved successfully. The described sensor provides a reliable means with good correlation with the data obtained by atomic absorption spectrometry (AAS) and other spectrophotometric methods for the analysis of trace amounts of barium(II) and/or sulphate ions in different matrices.

  11. A novel barium polymeric membrane sensor for selective determination of barium and sulphate ions based on the complex ion associate barium(II)-Rose Bengal as neutral ionophore

    International Nuclear Information System (INIS)

    A simple, long life, rapid response and sensitive barium(II)-PVC membrane sensor that typically follows Nernstian behavior has been developed for the assay of barium(II) ions. The developed sensor has been made by incorporating the complex ion associate of barium(II)-Rose Bengal (Ba-RB) as an ionophore into a plasticized PVC matrix. The sensor is stable and exhibited fast potential response of 20 s and gave a good linear response with a Nernstian slope of 28.5 ± 0.4 mV/decade of activity within the concentration range 5 x 10-5 to 10-1 M over a wide range of pH 4.5-10.0 for barium(II) ions. The developed sensor showed comparatively good selectivity for barium(II) ions with respect to other alkali, alkaline earth, transition and heavy metal ions. The plasticizer o-nitrophenyloctyl ether controlled significantly the calibration slope and the lifetime of the fabricated sensor. The proposed sensor was used successfully for the analysis of barium(II) ions in wastewater samples and in lithophone pigment with excellent recovery percentages in the range 98.9-99.8 ± 1.6%. The determination of sulphate in fresh and potable water samples with the developed sensor has been also achieved successfully. The described sensor provides a reliable means with good correlation with the data obtained by atomic absorption spectrometry (AAS) and other spectrophotometric methods for the analysis of trace amounts of barium(II) and/or sulphate ions in different matrices

  12. The Karlsruhe 4π barium fluoride detector

    International Nuclear Information System (INIS)

    A new experimental approach has been implemented for accurate measurements of neutron capture cross sections in the energy range from 5 to 200 keV. The Karlsruhe 4π Barium Fluoride Detector consists of 42 crystals shaped as hexagonal and pentagonal truncated pyramids forming a spherical shell with 10 cm inner radius and 15 cm thickness. All crystals are supplied with reflector and photomultiplier, thus representing independent gamma-ray detectors. Each detector module covers the same solid angle with respect to a gamma-ray source located in the centre. The energy resolution of the 4π detector is 14% at 662 keV and 7% at 2.5 MeV gamma-ray energy, the overall time reslution is 500 ps and the peak efficiency 90% at 1 MeV. The detector allows to register capture cascades with 95% probability above a threshold energy of 2.5 MeV in the sum energy spectrum. Neutrons are produced via the 7Li(p,n)7Be reaction using the pulsed proton beam of a Van de Graaff accelerator. The neutron spectrum can be taylored according to the experimental requirements in an energy range from 5 to 200 keV by choosing appropriate proton energies. A collimated neutron beam is passing through the detector and hits the sample in the centre. The energy of captured neutrons is determined via time of flight, the primary flight path being 77 cm. The combination of short primary flight path, a 10 cm inner radius of the spherical BaF2 shell, and the low capture cross section of barium allows to discriminate background due to capture of sample scattered neutrons in the scintillator by time of flight, leaving part of the neutron energy range completely undisturbed. (orig./HSI)

  13. 32 CFR 11.4 - Applicable principles of law. (United States)


    ... Accused's acts. As provided in 32 CFR 9.5(c), the prosecution bears the burden of establishing the Accused... 32 National Defense 1 2010-07-01 2010-07-01 false Applicable principles of law. 11.4 Section 11.4... ELEMENTS FOR TRIALS BY MILITARY COMMISSION § 11.4 Applicable principles of law. (a) General intent....

  14. 9 CFR 114.12 - Expiration date required. (United States)


    ... AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS PRODUCTION REQUIREMENTS FOR BIOLOGICAL PRODUCTS § 114.12 Expiration date required. Each serial or subserial of biological product... requirements provided in § 114.13 or § 114.14. A licensed biological product shall be considered...

  15. 37 CFR 1.14 - Patent applications preserved in confidence. (United States)


    ... in confidence. 1.14 Section 1.14 Patents, Trademarks, and Copyrights UNITED STATES PATENT AND... Records and Files of the Patent and Trademark Office § 1.14 Patent applications preserved in confidence... published under 35 U.S.C. 122(b) are generally preserved in confidence pursuant to 35 U.S.C....

  16. 7 CFR 3550.114 - Repayment agreement (grants only). (United States)


    ... 7 Agriculture 15 2010-01-01 2010-01-01 false Repayment agreement (grants only). 3550.114 Section 3550.114 Agriculture Regulations of the Department of Agriculture (Continued) RURAL HOUSING SERVICE... 306C Water and Waste Disposal Grants § 3550.114 Repayment agreement (grants only). Grant recipients...

  17. 5 CFR 185.114 - Parties to the hearing. (United States)


    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Parties to the hearing. 185.114 Section 185.114 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS PROGRAM FRAUD CIVIL REMEDIES § 185.114 Parties to the hearing. (a) The parties to the hearing shall be...

  18. 42 CFR 480.114 - Limitation on data collection. (United States)


    ... 42 Public Health 4 2010-10-01 2010-10-01 false Limitation on data collection. 480.114 Section 480.114 Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES, DEPARTMENT OF HEALTH AND HUMAN SERVICES... Access to Information § 480.114 Limitation on data collection. A QIO or any agent, organization,...

  19. 19 CFR 114.2 - Customs Conventions and Agreements. (United States)


    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Customs Conventions and Agreements. 114.2 Section 114.2 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY CARNETS General Provisions § 114.2 Customs Conventions and Agreements....

  20. 19 CFR 181.114 - Customs response to request. (United States)


    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Customs response to request. 181.114 Section 181.114 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF... Decisions § 181.114 Customs response to request. (a) Time for response. The port director will issue...

  1. 19 CFR 148.114 - Shipment of unaccompanied articles. (United States)


    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Shipment of unaccompanied articles. 148.114 Section 148.114 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY... States § 148.114 Shipment of unaccompanied articles. One copy of the validated Customs Form 255 shall...

  2. 40 CFR 86.114-94 - Analytical gases. (United States)


    ... 40 Protection of Environment 18 2010-07-01 2010-07-01 false Analytical gases. 86.114-94 Section 86.114-94 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED...-Duty Vehicles; Test Procedures § 86.114-94 Analytical gases. (a) Analyzer gases. (1) Gases for the...

  3. 21 CFR 114.5 - Current good manufacturing practice. (United States)


    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Current good manufacturing practice. 114.5 Section 114.5 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN CONSUMPTION ACIDIFIED FOODS General Provisions § 114.5 Current good...

  4. 7 CFR 11.4 - Other laws and regulations. (United States)


    ... 7 Agriculture 1 2010-01-01 2010-01-01 false Other laws and regulations. 11.4 Section 11.4... Procedures § 11.4 Other laws and regulations. (a) The provisions of the Administrative Procedure Act....C. 504) and its implementing regulations at 7 CFR part 1, subpart J, shall apply to...


    Institute of Scientific and Technical Information of China (English)

    Kang Li; Hongchen Gu; Qun Wei


    In the present work, fine barium ferrite powder has been synthesized through a one-step hydrothermal process in an autoclave at [OH-]/[Cl-] ratio of 2:1 in the temperature range from 180 to 260 ℃ using barium chloride (BaCl2), ferrous chloride (FeCl2) and potassium nitrate (KNO3) as the starting materials. Both particle size and saturation magnetization (Ms) increase with increasing hydrothermal reaction temperature, while the intrinsic coercivity (iHc) peaks at 685 Oe at 230 ℃. Morphology progress from the barium ferrite precursor particles to the barium hexaferrite particles has been monitored with increasing hydrothermal reaction time at 230 ℃ in the autoclave.

  6. Upper gastrointestinal barium evaluation of duodenal pathology: A pictorial review

    Institute of Scientific and Technical Information of China (English)

    Pankaj; Gupta; Uma; Debi; Saroj; Kant; Sinha; Kaushal; Kishor


    Like other parts of the gastrointestinal tract(GIT), duodenum is subject to a variety of lesions both congenital and acquired. However, unlike other parts of the GIT viz. esophagus, rest of the small intestine and large intestine, barium evaluation of duodenal lesions is technically more challenging and hence not frequently reported. With significant advances in computed tomography technology, a thorough evaluation including intraluminal, mural and extramural is feasible in a single non-invasive examination. Notwithstanding, barium evaluation still remains the initial and sometimes the only imaging study in several parts of the world. Hence,a thorough acquaintance with the morphology of various duodenal lesions on upper gastrointestinal barium examination is essential in guiding further evaluation. We reviewed our experience with various common and uncommon barium findings in duodenal abnormalities.

  7. Liquid-phase-deposited barium titanate thin films on silicon

    International Nuclear Information System (INIS)

    Using a mixture of hexafluorotitanic acid, barium nitrate and boric acid, high refractive index (1.54) barium titanate films can be deposited on silicon substrates. The deposited barium titanate films have featureless surfaces. The deposition temperature is near room temperature (800C). However, there are many fluorine and silicon incorporations in the films. The refractive index of the as-deposited film is 1.54. By current-voltage measurement, the leakage current of the as-deposited film with a thickness of 1000 A is about 9.48x10-7 A cm-2 at the electrical field intensity of 0.3 MV cm-1. By capacitance-voltage measurement, the effective oxide charge of the liquid-phase-deposited barium titanate film is 3.06x1011 cm-2 and the static dielectric constant is about 22. (author)

  8. Peritonite por bário Barium peritonitis

    Directory of Open Access Journals (Sweden)

    Gerson Alves Pereira Júnior


    Full Text Available We report a case of a 49 years-old man who underwent a barium meal examination for an epigastric pain. A perforated gastric ulcer with barium extravasation into peritoneal cavity was seen on X-rays. During an emergency laparotomy, a perforated pyloric ulcer was noted, along with barium contamination in the peritoneal cavity. The ulcer was closed with an omental patch and an extensive peritoneal lavage with saline was performed. During the postoperative period, the patient developed signs of peritonitis and underwent a new laparotomy was at the 9th day showing a subfrenic abscess with a large barium contamination. The patient presented septic shock and multiple organ failure. dying on the 21th day.

  9. Electrorheological behavior of rare earth-doped barium titanate suspensions

    Institute of Scientific and Technical Information of China (English)


    Doping Y, La, Ce into barium titanate is found to be able to improve its electrorheological (ER) effect in DC electrical field. The yield stress of a typical doped barium titanate/silicone oil suspension is approximately 3.2 -*7〗kPa at 3.5 -*7〗kV/mm, which is 10 times larger than that of pure barium titanate/silicone oil suspensions. The ER effect increases with the decrease of ionic radius of rare earth (RE) dopant when RE concentration remains constant, and the suspensions exhibit a relatively high shear stress when Y, La, Ce mole fractions are 15%, 10%~15%, and 5%, respectively. Dielectric measurements show that the suitable doping with RE element increases dielectric loss of barium titanate and causes very marked dielectric relaxation at low frequency. By measuring X-ray diffraction patterns of doped barium titanate, it is considered that the occurrence of lattice distortion or defects may be responsible for the change of dielectric properties which results in the improvement of ER effect of barium titanate in DC electrical field.

  10. Lifetime Measurement for 6snp Rydberg States of Barium

    Institute of Scientific and Technical Information of China (English)

    SHEN Li; WANG Lei; YANG Hai-Feng; LIU Xiao-Jun; LIU Hong-Ping


    @@ We present a simple and efficient method for measuring the atomic lifetimes in order of tens of microseconds and demonstrate it in the lifetime determination of barium Rydberg states.This method extracts the lifetime information from the time-of-flight spectrum directly, which is much more efficient than other methods such as the time-delayed field ionization and the traditional laser induced fluorescence.The lifetimes determined with our method for barium Rydberg 6snp(n=37-59)series are well coincident with the values deduced from the absolute oscillator strengths of barium which were given in the literature [J.Phys.B 14(1981)4489, 29(1996)655]on experiments.%We present a simple and efficient method for measuring the atomic lifetimes in order of tens of microseconds and demonstrate it in the lifetime determination of barium Rydberg states. This method extracts the lifetime information from the time-of-flight spectrum directly, which is much more efficient than other methods such as the time-delayed field ionization and the traditional laser induced fluorescence. The lifetimes determined with our method for barium Rydberg 6snp (n=37-59) series are well coincident with the values deduced from the absolute oscillator strengths of barium which were given in the literature [J. Phys. B 14 (1981) 4489, 29 (1996) 655] onexperiments.

  11. STS-114 Flight Day 11 Highlights (United States)


    Flight Day 11 begins with the STS-114 crew of Space Shuttle Discovery (Commander Eileen Collins, Pilot James Kelly, Mission Specialists Soichi Noguchi, Stephen Robinson, Andrew Thomas, Wendy Lawrence, and Charles Camarda) awaking to "Anchors Away," to signify the undocking of the Raffaello Multipurpose Logistics Module (MPLM) from the International Space Station (ISS). Canadarm 2, the Space Station Remote Manipulator System (SSRMS), retrieves the Raffaello Multipurpose Logistics Module (MPLM) from the nadir port of the Unity node of the ISS and returns it to Discovery's payload bay. The Shuttle Remote Manipulator System (SRMS) hands the Orbiter Boom Sensor System (OBSS) to its counterpart, the SSRMS, for rebearthing in the payload bay as well. The rebearthing of the OBSS is shown in detail, including centerline and split-screen views. Collins sends a message to her husband, and talks with Representative Tom DeLay (R-TX). Earth views include the Amalfi coast of Italy. The ISS control room bids farewell to the STS-114 crew and the Expedition 11 crew (Commander Sergei Krikalev and NASA ISS Science Officer and Flight Engineer John Phillips) of the ISS.

  12. Preparation of meta-stable phases of barium titanate by Sol-hydrothermal method

    Energy Technology Data Exchange (ETDEWEB)

    Selvaraj, Mahalakshmi [Department of Physics, R.D. Govt. Arts College, Tamilnadu, Sivaganga - 630561 (India); Department of Material Science, School of Chemistry, Madurai Kamaraj University, Tamilnadu Madurai-625 021 (India); Venkatachalapathy, V. [Department of Physics/Centre for Materials Science and Nanotechnology, University of Oslo, P.O Box 1048 Blindern, NO-0316 Oslo (Norway); Mayandi, J., E-mail:, E-mail: [Department of Material Science, School of Chemistry, Madurai Kamaraj University, Tamilnadu Madurai-625 021 (India); Department of Materials Science & Engineering, Michigan Technological University (United States); Karazhanov, S. [Department of Solar Energy, Institute for Energy Technology, P.O. Box 40, NO-2027 Kjeller (Norway); Pearce, J. M., E-mail:, E-mail: [Department of Materials Science & Engineering, Michigan Technological University (United States); Department of Electrical & Computer Engineering, Michigan Technological University (United States)


    Two low-cost chemical methods of sol–gel and the hydrothermal process have been strategically combined to fabricate barium titanate (BaTiO{sub 3}) nanopowders. This method was tested for various synthesis temperatures (100 °C to 250 °C) employing barium dichloride (BaCl{sub 2}) and titanium tetrachloride (TiCl{sub 4}) as precursors and sodium hydroxide (NaOH) as mineralizer for synthesis of BaTiO{sub 3} nanopowders. The as-prepared BaTiO{sub 3} powders were investigated for structural characteristics using x-ray diffraction (XRD), scanning electron microscopy (SEM) and transmission electron microscopy (TEM). The overall analysis indicates that the hydrothermal conditions create a gentle environment to promote the formation of crystalline phase directly from amorphous phase at the very low processing temperatures investigated. XRD analysis showed phase transitions from cubic - tetragonal - orthorhombic - rhombohedral with increasing synthesis temperature and calculated grain sizes were 34 – 38 nm (using the Scherrer formula). SEM and TEM analysis verified that the BaTiO{sub 3} nanopowders synthesized by this method were spherical in shape and about 114 - 170 nm in size. The particle distribution in both SEM and TEM shows that as the reaction temperature increases from 100 °C to 250 °C, the particles agglomerate. Selective area electron diffraction (SAED) shows that the particles are crystalline in nature. The study shows that choosing suitable precursor and optimizing pressure and temperature; different meta-stable (ferroelectric) phases of undoped BaTiO{sub 3} nanopowders can be stabilized by the sol-hydrothermal method.

  13. Preparation of meta-stable phases of barium titanate by Sol-hydrothermal method

    Directory of Open Access Journals (Sweden)

    Mahalakshmi Selvaraj


    Full Text Available Two low-cost chemical methods of sol–gel and the hydrothermal process have been strategically combined to fabricate barium titanate (BaTiO3 nanopowders. This method was tested for various synthesis temperatures (100 °C to 250 °C employing barium dichloride (BaCl2 and titanium tetrachloride (TiCl4 as precursors and sodium hydroxide (NaOH as mineralizer for synthesis of BaTiO3 nanopowders. The as-prepared BaTiO3 powders were investigated for structural characteristics using x-ray diffraction (XRD, scanning electron microscopy (SEM and transmission electron microscopy (TEM. The overall analysis indicates that the hydrothermal conditions create a gentle environment to promote the formation of crystalline phase directly from amorphous phase at the very low processing temperatures investigated. XRD analysis showed phase transitions from cubic - tetragonal - orthorhombic - rhombohedral with increasing synthesis temperature and calculated grain sizes were 34 – 38 nm (using the Scherrer formula. SEM and TEM analysis verified that the BaTiO3 nanopowders synthesized by this method were spherical in shape and about 114 - 170 nm in size. The particle distribution in both SEM and TEM shows that as the reaction temperature increases from 100 °C to 250 °C, the particles agglomerate. Selective area electron diffraction (SAED shows that the particles are crystalline in nature. The study shows that choosing suitable precursor and optimizing pressure and temperature; different meta-stable (ferroelectric phases of undoped BaTiO3 nanopowders can be stabilized by the sol-hydrothermal method.

  14. Leachability of barium-radium sulphate sludges

    International Nuclear Information System (INIS)

    This paper presents results from the first phase of a research program designed to examine the leachability of radium-226 from barium-radium sulphate sludges. Batch leaching tests were performed. Results showed that liquid:solid contact time was relatively unimportant; radium in the sludge was stable in the presence of deionized water with a slight increase in the amount leached per gram of sludge occurring at higher liquid:solid ratios. Not unexpectedly, low and high values of leachant pH increased radium leaching. Both monovalent and divalent salt solutions also increased leaching; however, dissolved radium-226 activity levels in the leachate decreased as leachant molarity increased. For divalent salts this can be explained by the common ion effect; for monovalent salts it is opposite to results expected from solubility considerations. The interpretation of all results is complicated by the fact that in most tests, the amount of radium-226 present in the leachate was lower than the calculated contribution from the mother liquour present with the sludge. This apparent ability of the sludge to absorb radium from solution may be related to dissolution and reprecipitation of the sludge during the leaching tests

  15. The diagnostic value of barium enema in acute appendicitis

    International Nuclear Information System (INIS)

    Acute appendicitis is the most common acute surgical condition of the abdomen. When the clinical presentation is atypical, barium enema has proven to be safe and useful in confirming the diagnosis and reducing the negative surgical exploration. However, the performance of barium enema in acute appendicitis has known contraindication primarily because of fear of leakage by perforation of the inflamed appendix. This study using barium enema as a diagnostic aid in acute appendicitis with atypical clinical presentation was performed to further support the previously noted efficacy and safety of this procedure. The results were as followings: 1. In case of acute appendicitis with atypical clinical presentation, the use of barium enema as a diagnostic aid increased the accuracy of diagnosis and decreased the negative surgical exploration. In women between 11 to 50 years old age, especially, it played important role differentiating appendicitis from nonsurgical acute abdomen. 2. The results of the study were 92.31% in sensitivity, 7.69% in false positive, 6.9% in false negative, and 10.26% in negative appendectomy. 3. None of case of leakage of barium by perforation of the inflamed appendix was noted, therefore, barium enema was thought to be safe as a diagnostic aid in acute appendicitis. 4. A simple partial or non filling of appendix without other associated positive finding could not exclude appendicitis, therefore, close clinical observation was necessary. 5. The positive findings of barium enema and their sensitivity were as followings: 1. Non filling of appendix: 90% 2. Partial filling of appendix: 91.7% 3. Displacement or a local impression on terminal ileum: 100%

  16. STS-114: Discovery Launch Readiness Press Conference (United States)


    Michael Griffin, NASA Administrator; Wayne Hale, Space Shuttle Deputy Program Manager; Mike Wetmore, Director of Shuttle Processing; and 1st Lieutenant Mindy Chavez, Launch Weather Officer-United States Air Force 45th Weather Squadron are in attendance for this STS-114 Discovery launch readiness press conference. The discussion begins with Wayne Hale bringing to the table a low level sensor device for everyone to view. He talks in detail about all of the extensive tests that were performed on these sensors and the completion of these ambient tests. Chavez presents her weather forecast for the launch day of July 26th 2005. Michael Griffin and Wayne Hale answer questions from the news media pertaining to the sensors and launch readiness. The video ends with footage of Pilot Jim Kelly and Commander Eileen Collins conducting test flights in a Shuttle Training Aircraft (STA) that simulates Space Shuttle landing.

  17. STS-114 Flight Day 5 Highlights (United States)


    Highlights of Day 5 of the STS-114 Return to Flight mission (Commander Eileen Collins, Pilot James Kelly, Mission Specialists Soichi Noguchi, Stephen Robinson, Andrew Thomas, Wendy Lawrence, and Charles Camarda) include video coverage of an extravehiclular activity (EVA) by Noguchi and Robinson. The other crew members of Discovery are seen on the flight deck and mid-deck helping the astronauts to suit-up. The objectives of the EVA are to test repair techniques on sample tiles in the shuttle's payload bay, to repair electrical equipment for a gyroscope on the International Space Station (ISS), and to install a replacement GPS antenna on the ISS. Noguchi and Robinson use a caulk gun and a putty knife to repair the sample tiles. The video contains several Earth views, including one of Baja California.

  18. Asteroseismology of the DBV star CBS 114 (United States)

    Chen, Yan-Hui


    Asteroseismology is a unique and powerful tool to investigate the internal structure of stars. CBS 114 is the sixth known pulsating DBV star. It was observed by Handler, Metcalfe, & Wood at the South African Astronomical Observatory over three weeks in 2001. Then, it was observed by Metcalfe et al. for seven nights (2004 Feb. 19–25) on the 1.8 m telescope at the Bohyunsan Optical Astronomy Observatory and seven nights (2004 Feb. 21–27) on the 2.1 m telescope at the McDonald Observatory. Totally two triplets, four doublets, and five singlets were identified. The frequency splitting values are very different, from 5.2 μHz to 11.9 μHz, which may reflect differential rotations. We evolve grids of white dwarf models by MESA. Cores, added with He/C envelopes, of those white dwarf models are inserted into WDEC to evolve grids of DBV star models. With those DBV star models, we calculate eigenperiods. Those calculated periods are used to fit observed periods. A best-fitting model is selected. The parameters are T eff = 25000 K, M * = 0.740 M ⊙ and log(M He/M *) = —4.5. With the relatively large stellar mass, the effective temperature is close to the previous spectroscopic result. In addition, kinetic energy distributions are calculated for the best-fitting model. We find that the observed modes with large frequency splitting values are fitted by the calculated modes with a large amount of kinetic energy distributed in the C/O core. After preliminary analysis, we suggest that the C/O core may rotate at least two times faster than the helium layer for CBS 114.

  19. Occupational doses in pediatric barium meal procedures

    International Nuclear Information System (INIS)

    Ionizing radiation has become an indispensable tool when it comes to diagnosis and therapy. However, its use should happen in a rational manner, taking into account the risks to which the staff is being exposed. Barium meal (BM), or upper gastrointestinal (GI) studies, using fluoroscopy, are widely used for gastroesophageal reflux disease diagnostic in children and professionals are required to stay inside the examination room to position and immobilize pediatric patients during the procedure. Therefore, it is very important that proffessionals strictly follow the technical standards of radiation protection. According to the ICRP and the NCRP recommendations, the annual limit equivalent doses for eyes, thyroid and hands are, espectively, 20 mSv, 150 mSv and 500 mSv. Based on those data, the aim of the current study is to estimate the annual equivalent dose for eyes, thyroid and hands of professionals who perform BM procedures in children. This was done using properly package LiF:Mg,Cu,P thermoluminescent dosimeters in 37 procedures; 2 pairs were positioned near each staff´s eye, 2 pairs on each professional´s neck (on and under the lead protector) and 2 pairs on both staff´s hands. The range of the estimative annual equivalent doses, for eyes, thyroid and hands, are, respectively: 14 – 36 mSv, 7 – 22 mSv and 14 – 58 mSv. Only the closest staff to the patient exceeded the annual equivalent doses in the eyes (around 80% higher than the limit set by ICRP). However, the results from this study, for hands and thyroid, compared to similar studies, show higher values. Therefore, the optimization implementation is necessary, so that the radiation levels can be reduced. (authors)

  20. Barium titanate thick films prepared by screen printing technique

    Directory of Open Access Journals (Sweden)

    Mirjana M. Vijatović


    Full Text Available The barium titanate (BaTiO3 thick films were prepared by screen printing technique using powders obtained by soft chemical route, modified Pechini process. Three different barium titanate powders were prepared: i pure, ii doped with lanthanum and iii doped with antimony. Pastes for screen printing were prepared using previously obtained powders. The thick films were deposited onto Al2O3 substrates and fired at 850°C together with electrode material (silver/palladium in the moving belt furnace in the air atmosphere. Measurements of thickness and roughness of barium titanate thick films were performed. The electrical properties of thick films such as dielectric constant, dielectric losses, Curie temperature, hysteresis loop were reported. The influence of different factors on electrical properties values was analyzed.

  1. Deoxidation Behavior of Alloys Bearing Barium in Molten Steel

    Institute of Scientific and Technical Information of China (English)

    LI Yang; JIANG Zhou-hua; JIANG Mao-fa; WANG Jun-wen; GU Wen-bing


    The deoxidation behaviors of alloys bearing barium in pipe steel were researched with MgO crucible under argon atmosphere in MoSi2 furnace at 1 873 K. The total oxygen contents of molten steel, the distribution, size and morphology of deoxidation products in the steel were surveyed. The metamorphic mechanism for deoxidation products of alloy bearing barium was also discussed. The results show that applying alloy bearing barium to the pipe steel, very low total oxygen contents can be obtained, and deoxidation products, which easily float up from molten steel, can be changed into globular shape and uniformly distributed in steel. The equilibrium time of total oxygen is about 25 min, and the terminal total oxygen contents range from 0.002 0 % to 0.002 2 % after treating with SiCa wire. The best deoxidizers are SiAlBaCa and SiAlBaCaSr.

  2. Economically dissolving barium sulfate scale with a chelating agent

    Energy Technology Data Exchange (ETDEWEB)

    Richardson, E.A.; Scheuerman, R.E.


    A composition is described for dissolving a barium sulfate scale from a subterranean or other relatively remote location into which fluid can be flowed. Fluid is flow-flowed into the remote location so that a stream of fluid contacts and flows along the surface of the scale. The composition and flow rate of the fluid are adjusted so that (1) the scale is contacted by a stream of aqueous solution in which each portion contains enough dissolved aminopolyacetic acid salt chelating agent to dissolve barium sulfate, and (2) substantially all upstream portions of the scale are contacted by a succession of portions of the aqueous liquid which are substantially unsaturated with respect to dissolved barium-chelant complex. (5 claims)

  3. Radiation dose in mass screening for gastric cancer with high-concentration barium sulphate compared with moderate-concentration barium sulphate

    International Nuclear Information System (INIS)

    Full text: Recently, high-concentration barium sulfate has been developed and is used in many medical facilities. This study compared radiation dose using high-concentration and moderate-concentration barium sulfate. The dose was evaluated with an experimental method using a gastric phantom and with a clinical examination. In the former, the dose and X-ray tube load were measured on the phantom with two concentrations of barium sulfate. In the latter, the fluoroscopic dose-area product (DAP), the radiographic DAP and their sum, the total DAP, were investigated in 150 subjects (112 males, 38 females) treated with both concentrations of barium sulfate. The effective dose was calculated by the software of PCXMC in every case. The results of the experimental evaluation indicated that the effective dose and X-ray tube load were greater with high-concentration barium sulfate than with moderate-concentration barium sulfate (p < 0.05). The results of the clinical evaluation indicated that the fluoroscopic DAP was greater with moderate-concentration barium sulfate than with high-concentration barium sulfate (p < 0.05), but the radiographic DAP was quite the reverse, so the total DAP and effective dose were almost same with both concentrations of barium sulfate. We conclude that high-concentration barium sulfate does not increase radiation dose in mass screening for gastric cancer.

  4. Compact pulse forming line using barium titanate ceramic material. (United States)

    Kumar Sharma, Surender; Deb, P; Shukla, R; Prabaharan, T; Shyam, A


    Ceramic material has very high relative permittivity, so compact pulse forming line can be made using these materials. Barium titanate (BaTiO(3)) has a relative permittivity of 1200 so it is used for making compact pulse forming line (PFL). Barium titanate also has piezoelectric effects so it cracks during high voltages discharges due to stresses developed in it. Barium titanate is mixed with rubber which absorbs the piezoelectric stresses when the PFL is charged and regain its original shape after the discharge. A composite mixture of barium titanate with the neoprene rubber is prepared. The relative permittivity of the composite mixture is measured to be 85. A coaxial pulse forming line of inner diameter 120 mm, outer diameter 240 mm, and length 350 mm is made and the composite mixture of barium titanate and neoprene rubber is filled between the inner and outer cylinders. The PFL is charged up to 120 kV and discharged into 5 Ω load. The voltage pulse of 70 kV, 21 ns is measured across the load. The conventional PFL is made up of oil or plastics dielectrics with the relative permittivity of 2-10 [D. R. Linde, CRC Handbook of Chemistry and Physics, 90th ed. (CRC, 2009); Xia et al., Rev. Sci. Instrum. 79, 086113 (2008); Yang et al., Rev. Sci. Instrum. 81, 43303 (2010)], which increases the length of PFL. We have reported the compactness in length achieved due to increase in relative permittivity of composite mixture by adding barium titanate in neoprene rubber. PMID:22129008

  5. 75 FR 36629 - Barium Chloride From the People's Republic of China: Continuation of Antidumping Duty Order (United States)


    ... International Trade Administration Barium Chloride From the People's Republic of China: Continuation of... China: Final Results of Expedited Third Sunset Review of Antidumping Duty Order, 74 FR 55814 (October 29... Barium Chloride From China, 75 FR 33824 (June 15, 2010), and Barium Chloride from China (Inv. No....

  6. The adhesiometer: a simple device to measure adherence of barium sulfate to intestinal mucosa. (United States)

    Salomonowitz, E; Frick, M P; Cragg, A H; Lund, G


    A simple, inexpensive device assessing barium sulfate adherence to alimentary tract mucosa was tested in an animal study using pigs and dogs. Interaction of gastric, intestinal, and colonic mucosal lining with three different barium preparations was studied. In both pigs and dogs, barium adherence to gastric mucosa was significantly stronger when compared with colonic mucosa. PMID:6608230

  7. Photoionization and Photoelectric Loading of Barium Ion Traps


    Steele, A. V.; Churchill, L. R.; Griffin, P. F.; Chapman, M. S.


    Simple and effective techniques for loading barium ions into linear Paul traps are demonstrated. Two-step photoionization of neutral barium is achieved using a weak intercombination line (6s2 1S0 6s6p 3P1, 791 nm) followed by excitation above the ionization threshold using a nitrogen gas laser (337 nm). Isotopic selectivity is achieved by using a near Doppler-free geometry for excitation of the triplet 6s6p 3P1 state. Additionally, we report a particularly simple and efficient trap loading t...

  8. Equations of state for barium in high-pressure phases

    International Nuclear Information System (INIS)

    The universal equation of state with an arbitrary reference point presented by the author (Fang Zheng-Hua 1998 Phys. Rev. B 50 16 238) is applied successfully to the analysis of the experimental compression data of barium in different structural phases (I, II, and V). The comparison given in this paper shows that this equation suits for the isothermal compression behaviour of barium in the high-pressure phases (II and V) better than the Birch-Murnaghan equation. The applicability of equations of state for solids in high-pressure phases is also discussed. (author)

  9. Kinetics of thermal decomposition of barium zirconyl oxalate

    International Nuclear Information System (INIS)

    Kinetics of the thermal decomposition of anhydrous barium zirconyl oxalate and a carbonate intermediate have been studied. Decomposition of the anhydrous oxalate, though it could be explained based on a contracting-cube model, is quite complex. Kinetics of decomposition of the intermediate carbonate Ba2Zr2O5CO3 is greatly influenced by thermal effects during its formation. (α-t) curves are sigmoidal and obey a power law equation followed by first order decay. Presence of carbon in the vacuum-prepared carbonate has a strong deactivating effect. Decomposition of the carbonate is accompanied by growth in particle size of the product barium zirconate. (Author)

  10. Photoionization and Photoelectric Loading of Barium Ion Traps

    CERN Document Server

    Steele, A V; Churchill, L R; Griffin, P F


    Simple and effective techniques for loading barium ions into linear Paul traps are demonstrated. Two-step photoionization of neutral barium is achieved using a weak intercombination line (6s2 1S0 6s6p 3P1, 791 nm) followed by excitation above the ionization threshold using a nitrogen gas laser (337 nm). Isotopic selectivity is achieved by using a near Doppler-free geometry for excitation of the triplet 6s6p 3P1 state. Additionally, we report a particularly simple and efficient trap loading technique that employs an in-expensive UV epoxy curing lamp to generate photoelectrons.

  11. Esophageal intramural pseudodiverticulosis characterized by barium esophagography: a case report

    LENUS (Irish Health Repository)

    O'Connor, Owen J


    Abstract Introduction Esophageal intramural pseudodiverticulosis is a rare condition characterized by the dilatation of the submucosal glands. Case presentation We present a case of esophageal intramural pseudodiverticulosis in a 72-year-old Caucasian man who presented with dysphagia and with a background history of alcohol abuse. An upper gastrointestinal endoscopy of our patient showed an esophageal stricture with abnormal mucosal appearances, but no malignant cells were seen at biopsy. Appearances on a barium esophagram were pathognomonic for esophageal intramural pseudodiverticulosis. Conclusion We demonstrate the enduring usefulness of barium esophagography in the characterization of abnormal mucosal appearances at endoscopy.

  12. [Report on 114 primary vaginal carcinomas]. (United States)

    Sun, J H; Zhang, W H; Li, A L; Wu, A R


    114 patients with primary carcinoma of the vagina were treated in our hospital from 1958 to 1978. It accounted for 0.83% of all gynecological malignant tumors in the same period. The youngest was 26 years of age, the oldest 75. Patients 40-59 years comprised 61.4%. 33% of patients had wedding age under 17. 63.4% had more than 4 pregnancies and 58.4% gave more than 4 births. 89.69% was diagnosed as squamous cell carcinoma, 7.2% as adenocarcinoma, 2.06% as undifferentiated carcinoma and 1 as embryonic carcinoma. The tumor occurred frequently in the upper third and posterior wall of the vagina (60% and 68%). In this series, there were 21 stage I, 29 stage II, 61 stage III and 3 stage IV lesions. 110 patients were treated by radiotherapy in different schemes. Intracavitary radium or caesium plus 60Co external irradiation by four fields gave better result with a 5 year survival rate of 66.1%. Only 2 out of 12 patients were cured by 60Co rotation alone but if supplemented by intracavitary radium or caesium, the cure rate was increased. The 5 year survival rate was 71.4% for stage I, 62.1% for stage II, 42.6% for stage III and O for stage IV. After the radiotherapy, rectovaginal fistula developed in 1 patient, vesicovaginal fistula in 1. 14% was complicated with rectal bleeding and 8.18% with hematuria. PMID:3452544

  13. Asteroseismology of the DBV star CBS 114

    CERN Document Server

    Chen, Yanhui


    Asteroseismology is an unique and powerful tool to detect the internal structure of stars. CBS 114 is the sixth known pulsating DBV star. It was observed by Handler, Metcalfe, \\& Wood at South African Astronomical Observatory over 3 weeks in 2001. Then, it was observed by Metcalfe et al. at Bohyunsan Optical Astronomy Observatory and McDonald Observatory respectively for 7 nights in 2004. Totally 2 triplets, 4 doublets, and 5 singlets were identified. The frequency splitting values are very different, from 5.2 $\\mu$Hz to 11.9 $\\mu$Hz, which may reflect differential rotations. We evolve grids of white dwarf models by \\texttt{MESA}. Cores, added with He/C envelopes, of those white dwarf models are inserted into \\texttt{WDEC} to evolve grids of DBV star models. With those DBV star models, we calculate eigenperiods. Those calculated periods are used to fit observed periods. A best-fitting model is selected. The parameters are $T_{eff}$ = 25000 K, $M_{*}$ = 0.740 $M_{\\odot}$, and log($M_{He}/M_{*}$) = -4.5. Wi...

  14. STS-114 Flight Day 3 Highlights (United States)


    Video coverage of Day 3 includes highlights of STS-114 during the approach and docking of Discovery with the International Space Station (ISS). The Return to Flight continues with space shuttle crew members (Commander Eileen Collins, Pilot James Kelly, Mission Specialists Soichi Noguchi, Stephen Robinson, Andrew Thomas, Wendy Lawrence, and Charles Camarda) seen in onboard activities on the fore and aft portions of the flight deck during the orbiter's approach. Camarda sends a greeting to his family, and Collins maneuvers Discovery as the ISS appears steadily closer in sequential still video from the centerline camera of the Orbiter Docking System. The approach includes video of Discovery from the ISS during the orbiter's Rendezvous Pitch Maneuver, giving the ISS a clear view of the thermal protection systems underneath the orbiter. Discovery docks with the Destiny Laboratory of the ISS, and the shuttle crew greets the Expedition 11 crew (Commander Sergei Krikalev and NASA ISS Science Officer and Flight Engineer John Phillips) of the ISS onboard the station. Finally, the Space Station Remote Manipulator System hands the Orbiter Boom Sensor System to its counterpart, the Shuttle Remote Manipulator System.

  15. Chemical abundance analysis of 19 barium stars (United States)

    Yang, Guo-Chao; Liang, Yan-Chun; Spite, Monique; Chen, Yu-Qin; Zhao, Gang; Zhang, Bo; Liu, Guo-Qing; Liu, Yu-Juan; Liu, Nian; Deng, Li-Cai; Spite, Francois; Hill, Vanessa; Zhang, Cai-Xia


    We aim at deriving accurate atmospheric parameters and chemical abundances of 19 barium (Ba) stars, including both strong and mild Ba stars, based on the high signal-to-noise ratio and high resolution Echelle spectra obtained from the 2.16 m telescope at Xinglong station of National Astronomical Observatories, Chinese Academy of Sciences. The chemical abundances of the sample stars were obtained from an LTE, plane-parallel and line-blanketed atmospheric model by inputting the atmospheric parameters (effective temperatures Teff, surface gravities log g, metallicity [Fe/H] and microturbulence velocity ξt) and equivalent widths of stellar absorption lines. These samples of Ba stars are giants as indicated by atmospheric parameters, metallicities and kinematic analysis about UVW velocity. Chemical abundances of 17 elements were obtained for these Ba stars. Their Na, Al, α- and iron-peak elements (O, Na, Mg, Al, Si, Ca, Sc, Ti, V, Cr, Mn, Ni) are similar to the solar abundances. Our samples of Ba stars show obvious overabundances of neutron-capture (n-capture) process elements relative to the Sun. Their median abundances of [Ba/Fe], [La/Fe] and [Eu/Fe] are 0.54, 0.65 and 0.40, respectively. The Y I and Zr I abundances are lower than Ba, La and Eu, but higher than the α- and iron-peak elements for the strong Ba stars and similar to the iron-peak elements for the mild stars. There exists a positive correlation between Ba intensity and [Ba/Fe]. For the n-capture elements (Y, Zr, Ba, La), there is an anti-correlation between their [X/Fe] and [Fe/H]. We identify nine of our sample stars as strong Ba stars with [Ba/Fe] >0.6 where seven of them have Ba intensity Ba=2-5, one has Ba=1.5 and another one has Ba=1.0. The remaining ten stars are classified as mild Ba stars with 0.17<[Ba/Fe] <0.54.

  16. 48 CFR 873.114 - Best value pool. (United States)


    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Best value pool. 873.114... SUPPLEMENTARY REGULATIONS SIMPLIFIED ACQUISITION PROCEDURES FOR HEALTH-CARE RESOURCES 873.114 Best value pool... solicitation. These vendors constitute the best value pool. This determination is within the sole discretion...

  17. 9 CFR 114.17 - Rebottling of biological products. (United States)


    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Rebottling of biological products. 114... OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS PRODUCTION REQUIREMENTS FOR BIOLOGICAL PRODUCTS § 114.17 Rebottling of biological products. The Administrator...

  18. 9 CFR 114.6 - Mixing biological products. (United States)


    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Mixing biological products. 114.6... AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS PRODUCTION REQUIREMENTS FOR BIOLOGICAL PRODUCTS § 114.6 Mixing biological products. Each biological product, when in liquid form,...

  19. 7 CFR 900.114 - Designation of arbitrator. (United States)


    ... 7 Agriculture 8 2010-01-01 2010-01-01 false Designation of arbitrator. 900.114 Section 900.114... Designation of arbitrator. The Administrator, after receiving the submission, will designate one or more persons to act as arbitrator....

  20. 21 CFR 814.114 - Timeframes for reviewing an HDE. (United States)


    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Timeframes for reviewing an HDE. 814.114 Section 814.114 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES... Timeframes for reviewing an HDE. Within 75 days after receipt of an HDE that is accepted for filing and...

  1. 42 CFR 411.114 - Determination of nonconformance. (United States)


    ... 411.114 Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES, DEPARTMENT OF HEALTH AND HUMAN SERVICES MEDICARE PROGRAM EXCLUSIONS FROM MEDICARE AND LIMITATIONS ON MEDICARE PAYMENT Limitations on Payment for Services Covered Under Group Health Plans: General Provisions § 411.114 Determination...


    NARCIS (Netherlands)



    We investigate ground-state properties of the superheavy nucleus with N = 184 and Z = 114, (298)114, using conventional relativistic mean-field theory and density-dependent mean-field theory, which reproduces Dirac-Brueckner calculations in nuclear matter. Our calculations provide support for N = 18

  3. 15 CFR 930.114 - Secretarial mediation efforts. (United States)


    ... 15 Commerce and Foreign Trade 3 2010-01-01 2010-01-01 false Secretarial mediation efforts. 930.114... MANAGEMENT FEDERAL CONSISTENCY WITH APPROVED COASTAL MANAGEMENT PROGRAMS Secretarial Mediation § 930.114 Secretarial mediation efforts. (a) Following the close of the hearing, the hearing officer shall transmit...

  4. 21 CFR 133.114 - Cheddar cheese for manufacturing. (United States)


    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Cheddar cheese for manufacturing. 133.114 Section... Standardized Cheese and Related Products § 133.114 Cheddar cheese for manufacturing. Cheddar cheese for manufacturing conforms to the definition and standard of identity prescribed for cheddar cheese by §...

  5. 9 CFR 114.10 - Antibiotics as preservatives. (United States)


    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Antibiotics as preservatives. 114.10... BIOLOGICAL PRODUCTS § 114.10 Antibiotics as preservatives. Antibiotics are authorized for use as preservatives for biological products if used within the limitations as to kinds and amounts prescribed in...

  6. 13 CFR 114.103 - Who may file a claim? (United States)


    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Who may file a claim? 114.103... Tort Claims § 114.103 Who may file a claim? (a) If a claim is based on factors listed in the first... entitled to assert the claim under applicable state law. Loss wholly compensated by an insurer with...

  7. 9 CFR 114.13 - Expiration date determination. (United States)


    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Expiration date determination. 114.13... BIOLOGICAL PRODUCTS § 114.13 Expiration date determination. Unless otherwise provided for in a Standard Requirement of filed Outline of Production, the expiration date for each product shall be computed from...

  8. Synthesis of Nanocrystalline Barium Ferrite in Ethanol/Water Media

    Institute of Scientific and Technical Information of China (English)

    M.Montazeri-Pour; A.Ataie


    Nanocrystalline particles of barium ferrite magnetic material have been prepared by co-precipitation route using aqueous and non-aqueous solutions of iron and barium chlorides with a Fe/Ba molar ratio of 11 and subsequent drying-annealing treatment. Water and ethanol/water mixture with volume ratio of 3:1 were used as solvents in the process. Coprecipitated powders were annealed at various temperatures for 1 h. FTIR (Fourier transform infrared spectroscopy), XRD (X-ray diffraction), DTA/TGA (differential thermal analy-sis/thermogravimetric analysis) and SEM (scanning electron microscopy) techniques were used to evaluate powder particle characteristics. DTA/TGA results confirmed by those obtained from XRD indicated that the formation of barium ferrite occurs in sample synthesized in ethanol/water solution at a relatively low temperature of 631℃. Nano-size particles of barium ferrite with mean particle size of almost 75 and 100 nm were observed in the SEM micrographs of the samples synthesized in ethanol/water solution after annealing at 700 and 800℃ for 1 h, respectively.

  9. CNO and F abundances in the barium star HD 123396

    CERN Document Server

    Alves-Brito, Alan; Yong, David; Meléndez, Jorge; Vásquez, Sergio


    [Abridged] Barium stars are moderately rare chemically peculiar objects which are believed to be the result of the pollution of an otherwise normal star by material from an evolved companion on the asymptotic giant branch (AGB). We aim to derive carbon, nitrogen, oxygen, and fluorine abundances for the first time from infrared spectra of the barium red giant star HD 123396 to quantitatively test AGB nucleosynthesis models for producing barium stars via mass accretion. High-resolution and high S/N infrared spectra were obtained using the Phoenix spectrograph mounted at the Gemini South telescope. The abundances were obtained through spectrum synthesis of individual atomic and molecular lines, using the MOOG stellar line analysis program together with Kurucz's stellar atmosphere models. The analysis was classical, using 1D stellar models and spectral synthesis under the assumption of local thermodynamic equilibrium. We confirm that HD 123396 is a metal-deficient barium star ([Fe/H] = -1.05), with A(C) = 7.88, A...

  10. Removal of barium and radium from groundwater. Environmental research brief

    International Nuclear Information System (INIS)

    A research project was undertaken to investigate processes for removing barium and radium from drinking water. Special emphasis was placed on ion exchange processes that can be used without adding large concentrations of sodium to the water. The wastes from radium and barium removal processes were also characterized, and processes suitable for treatment of ion-exchange brines were evaluated. The report discusses two ion-exchange processes that can be used for barium and radium removal accompanied by either partial or no hardness removal. The calcium-form, strong-acid ion-exchange resin can be used for barium and radium removal without significant change in hardness or the concentration of other salts. This resin can be regenerated with CaC12 brine. The radium-selective complexer (RSC) will remove radium without altering hardness or other salt concentration. The capacity of this resin for waters with low total dissolved solids (TDS) (<1000 to 2000 mg/L TDS) is in excess of 30,000 pCi/dry g; however, if the TDS is increased to about 40,000 mg/L, the capacity drops to 200 to 300 pCi/dry g. Thus using this resin to remove radium from spent brine does not appear feasible

  11. STS-114: Crew Interviews: 1. Jim Kelly 2. Charlie Camarda (United States)


    1) STS-114 Pilot James Kelly mentions his primary job as the Pilot is to back up Commander Eileen Collins all through the flight. James discusses in detail his robotics operations for all of the extravehicular activities and spacewalk work, as well as moving the logistics module back and forth, onto the station and back in the payload bay. He shares his thoughts on the Columbia, the STS-114 mission as a new chapter in space exploration, and the International Space Station. 2) STS-114 Mission Specialist Charlie Camarda discusses his major role in the mission, his feelings for this being his first Space Shuttle flight; shares his thoughts on the Columbia; mentioned that STS-114 is a baby step to what is needed to do for the next step in space exploration, and gave some examples on how the International Space Station can help pave the path to future space exploration.

  12. Design, testing, fabrication and launch support of a liquid chemical barium release payload (utilizing the liquid fluorine-barium salt/hydrazine system) (United States)

    Stokes, C. S.; Smith, E. W.; Murphy, W. J.


    A payload was designed which included a cryogenic oxidizer tank, a fuel tank, and burner section. Release of 30 lb of chemicals was planned to occur in 2 seconds at the optimum oxidizer to fuel ratio. The chemicals consisted of 17 lb of liquid fluorine oxidizer and 13 lb of hydrazine-barium salt fuel mixture. The fuel mixture was 17% barium chloride, 16% barium nitrate, and 67% hydrazine, and contained 2.6 lb of available barium. Two significant problem areas were resolved during the program: explosive valve development and burner operation. The release payload was flight tested, from Wallops Island, Virginia. The release took place at an altitude of approximately 260 km. The release produced a luminous cloud which expanded very rapidly, disappearing to the human eye in about 20 seconds. Barium ion concentration slowly increased over a wide area of sky until measurements were discontinued at sunrise (about 30 minutes).


    Institute of Scientific and Technical Information of China (English)


    Polyaniline-barium titanate (PAn-BaTiO3) ultrafine composite particles were prepared by the oxidative polymerization of aniline with H2O2 while barium titanate nanoparticles were synthesized with a sol-gel method. The infrared spectrogram shows that the polymerization of PAn in the hybrid process of PAn-BaTiO3 is similar with the polymeric process of pure aniline, and there is interaction of PAn and BaTiO3 in the PAn-BaTiO3. SEM and TEM results show that the average diameter of the composite particles is 1.50 μm and the diameters of BaTiO3 nanoparticles are 5-15 nm in the composite particle. The electrical conductivity of the ultrafine composite particles is transformable from 100 to 10-11S/cm by equilibrium doping or dedoping method using various concentration of HCl or NaOH solutions.

  14. The crystal growth of barium flouride in aqueous solution (United States)

    Barone, J. P.; Svrjcek, D.; Nancollas, G. H.


    The kinetics of growth of barium flouride seed crystals were investigated in aqueous solution at 25°C using a constant composition method, in which the supersaturation and ionic strength were maintained constant by the addition of titrants consisting of barium nitrate and potassium flouride solutions. The rates of reaction, studied over a range of supersaturation (σ ≈ 0.4 to 1.0), were interpreted in terms of crystal growth models. A spiral growth mechanism best describes the data, and scanning electron microscopy indicates a three-dimensional growth. In the presence of inorganic additives such as phosphate, however, induction periods precede a morphological two-dimensional crystallization. Coulter Counter results show little crystal agglomeration.

  15. Electromagnetic properties of photodefinable barium ferrite polymer composites

    Directory of Open Access Journals (Sweden)

    Olusegun Sholiyi


    Full Text Available This article reports the magnetic and microwave properties of a Barium ferrite powder suspended in a polymer matrix. The sizes for Barium hexaferrite powder are 3–6 μm for coarse and 0.8–1.0 μm for the fine powder. Ratios 1:1 and 3:1 (by mass of ferrite to SU8 samples were characterized and analyzed for predicting the necessary combinations of these powders with SU8 2000 Negative photoresist. The magnetization properties of these materials were equally determined and were analyzed using Vibrating Sample Magnetometer (VSM. The Thru, Reflect, Line (TRL calibration technique was employed in determining complex relative permittivity and permeability of the powders and composites with SU8 between 26.5 and 40 GHz.

  16. Barium titanate nanoparticles: promising multitasking vectors in nanomedicine (United States)

    Graziana Genchi, Giada; Marino, Attilio; Rocca, Antonella; Mattoli, Virgilio; Ciofani, Gianni


    Ceramic materials based on perovskite-like oxides have traditionally been the object of intense interest for their applicability in electrical and electronic devices. Due to its high dielectric constant and piezoelectric features, barium titanate (BaTiO3) is probably one of the most studied compounds of this family. Recently, an increasing number of studies have been focused on the exploitation of barium titanate nanoparticles (BTNPs) in the biomedical field, owing to the high biocompatibility of BTNPs and their peculiar non-linear optical properties that have encouraged their use as nanocarriers for drug delivery and as label-free imaging probes. In this review, we summarize all the recent findings about these ‘smart’ nanoparticles, including the latest, most promising potential as nanotransducers for cell stimulation.

  17. Electromagnetic properties of carbon black and barium titanate composite materials

    Energy Technology Data Exchange (ETDEWEB)

    Wang Guiqin [School of Material Science and Engineering, Dalian University of Technology, Dalian 116023 (China)], E-mail:; Chen Xiaodong; Duan Yuping; Liu Shunhua [School of Material Science and Engineering, Dalian University of Technology, Dalian 116023 (China)


    Nanocrystalline carbon black/barium titanate compound particle (CP) was synthesized by sol-gel method. The phase structure and morphology of compound particle were investigated by X-ray diffraction (XRD), transmission electron microscope (TEM) and Raman spectrum measurements, the electroconductivity was test by trielectrode arrangement and the precursor powder was followed by differential scanning calorimetric measurements (DSC) and thermal gravimetric analysis (TGA). In addition, the complex relative permittivity and permeability of compound particle were investigated by reflection method. The compound particle/epoxide resin composite (CP/EP) with different contents of CP were measured. The results show barium titanate crystal is tetragonal phase and its grain is oval shape with 80-100 nm which was coated by carbon black film. As electromagnetic (EM) complex permittivity, permeability and reflection loss (RL) shown that the compound particle is mainly a kind of electric and dielectric lossy materials and exhibits excellent microwave absorption performance in the X- and Ku-bands.

  18. Thermophysical properties of americium-containing barium plutonate

    International Nuclear Information System (INIS)

    Polycrystalline specimens of americium-containing barium plutonate have been prepared by mixing the appropriate amounts of (Pu0.91Am0.09)O2 and BaCO3 powders followed by reacting and sintering at 1600 K under the flowing gas atmosphere of dry-air. The sintered specimens had a single phase of orthorhombic perovskite structure and were crack-free. Elastic moduli were determined from longitudinal and shear sound velocities. Debye temperature was also determined from sound velocities and lattice parameter measurements. Thermal conductivity was calculated from measured density at room temperature, literature values of heat capacity and thermal diffusivity measured by laser flash method in vacuum. Thermal conductivity of americium-containing barium plutonate was roughly independent of temperature and registered almost the same magnitude as that of BaPuO3 and BaUO3. (author)

  19. Thermoelectric power of barium up to 8 GPa

    Energy Technology Data Exchange (ETDEWEB)

    Ramani, G.; Divakar, C.; Singh, A.K.


    The present measurements indicate that the thermoelectric power (TEP) of barium at room temperature and pressure is 15 K/sup -1/, and decreases with increasing pressure, reaching about 4 K/sup -1/ just before the bcc..-->..hcp transition. The TEP shows a discontinuous increase at the bcc..-->..hcp transition beyond which it continues to decrease with increasing pressure.

  20. Acute barium intoxication following ingestion of soap water solution

    Directory of Open Access Journals (Sweden)

    Nandita Joshi


    Full Text Available We present a rare case in which a young girl ingested a solution of a hair-removing soap. The ingestion resulted in profound hypokalemia and severe acidosis leading to flaccid paralysis, respiratory arrest and ventricular arrhythmias. Ultimately the patient made complete recovery. The soapwas found to contain barium sulfide. The degree of paralysis and acidosis appeared to be directly related to serum potassium levels.

  1. Barium ferrite powders prepared by milling and annealing

    Directory of Open Access Journals (Sweden)

    R. Nowosielski


    Full Text Available Purpose: Microstructure and magnetic properties analysis of barium ferrite powder obtained by milling and heat treatment.Design/methodology/approach: The milling process was carried out in a vibratory mill, which generated vibrations of the balls and milled material inside the container during which their collisions occur. After milling process the powders were annealed in electric chamber furnace. The X-ray diffraction methods were used for qualitative phase analysis of studied powder samples. The distribution of powder particles was determined by a laser particle analyzer. The magnetic hysteresis loops of examined powder material were measured by resonance vibrating sample magnetometer (R-VSM.Findings: The milling process of iron oxide and barium carbonate mixture causes decrease of the crystallite size of involved phases. The X-ray investigations of tested mixture milled for 30 hours and annealed at 950 °C enabled the identification of hard magnetic BaFe12O19 phase and also the presence of Fe2O3 phase in examined material. The Fe2O3 phase is a rest of BaCO3 dissociation in the presence of Fe2O3, which forms a compound of BaFe12O19. The best coercive force (HC for mixture of powders annealed at 950 °C for 10, 20 and 30 hours is 349 kA/m, 366 kA/m and 364 kA/m, respectively. The arithmetic mean of diameter of Fe2O3 and BaCO3 mixture powders after 30 hours of milling is about 6.0 μm.Practical implications: The barium ferrite powder obtained by milling and annealing can be suitable components to produce sintered and elastic magnets with polymer matrix.Originality/value: The results of tested barium ferrite investigations by different methods confirm their utility in the microstructure and magnetic properties analysis of powder materials.

  2. Role of hexadecapole interaction in proton rich barium isotopes

    International Nuclear Information System (INIS)

    From the systematic analysis of the experimental data on proton rich barium isotopes, it is observed that nuclei in the region z ≥ 50 and N≤82 are the transitional nuclei as they show a shape transition from spherical to deformed shape. An interesting feature of the observed yrast spectra in barium isotopic mass chain is the systematic variation of E2+, E4+ and E6+ excitation energy states from 120Ba to 136Ba. It is observed that these states follow a systematic decreasing trend as move away from 136Ba towards 120Ba. The isotopes 120-128Ba can be taken to be quasi-deformed nuclei having E4+/E2+ ratio larger than 2.7. Based on the systematics of low-lying states and the experimental data of quadrupole moments and B(E2) transition probabilities, the stable barium isotopes range from the approximately spherical 138Ba to l30Ba which is close to the deformed 120-128Ba isotopes. The purpose of the paper is to determine the importance of octupole-octupole and hexadecapole- hexadecapole parts of the two body interaction in reproducing the observed nuclear structure properties of 120-136Ba isotopes

  3. Microwave-hydrothermal synthesis of barium strontium titanate nanoparticles

    International Nuclear Information System (INIS)

    Research highlights: → Barium strontium titanate nanoparticles were obtained by the Hydrothemal microwave technique (HTMW) → This is a genuine technique to obtain nanoparticles at low temperature and short times → Barium strontium titanate free of carbonates with tetragonal structure was grown at 130 oC. - Abstract: Hydrothermal-microwave method (HTMW) was used to synthesize crystalline barium strontium titanate (Ba0.8Sr0.2TiO3) nanoparticles (BST) in the temperature range of 100-130 oC. The crystallization of BST with tetragonal structure was reached at all the synthesis temperatures along with the formation of BaCO3 as a minor impurity at lower syntheses temperatures. Typical FT-IR spectra for tetragonal (BST) nanoparticles presented well defined bands, indicating a substantial short-range order in the system. TG-DTA analyses confirmed the presence of lattice OH- groups, commonly found in materials obtained by HTMW process. FE/SEM revealed that lower syntheses temperatures led to a morphology that consisted of uniform grains while higher syntheses temperature consisted of big grains isolated and embedded in a matrix of small grains. TEM has shown BST nanoparticles with diameters between 40 and 80 nm. These results show that the HTMW synthesis route is rapid, cost effective, and could serve as an alternative to obtain BST nanoparticles.

  4. Preparation of Nanoparticles of Barium Ferrite from Precipitation in Microemulsions

    International Nuclear Information System (INIS)

    Magnetic nanoparticles of barium ferrite (BaFe12O19) have been synthesized using a microemulsion mediated process. The aqueous cores of water-in-oil microemulsions were used as constrained microreactors for the precipitation of precursor carbonate and hydroxide particles. These precursors were then calcined at 925 deg. C for 12 h, during which time they were transformed to the hexagonal ferrite. The pH of reaction was varied between 5 and 12, and it was found that the fraction of non-magnetic hematite (α-Fe2O3) in the particles varied with the pH of reaction, thus affecting the magnetic properties of the particles. The same precursor particles were also prepared by bulk co-precipitation reaction for comparison. It was found that the microemulsion derived nanoparticles of barium ferrite had both higher intrinsic coercivity (Hc) and saturation magnetization (σs) than the particles derived from bulk co-precipitation. Particles were analyzed by electron microscopy, X-ray diffraction, differential thermal analysis (DTA), thermogravimetric analysis (TGA) and vibrating sample magnetometry (VSM). The best barium ferrite particles produced by the microemulsion synthesis method yielded an intrinsic coercivity of 4310 Oe and a saturation magnetization of 60.48 emu/g

  5. Simplified assessment of segmental gastrointestinal transit time with orally small amount of barium

    International Nuclear Information System (INIS)

    Objective: To determine the effectiveness and advantage of small amount of barium in the measurement of gastrointestinal transmission function in comparison with radio-opaque pallets. Methods: Protocal 1: 8 healthy volunteers (male 6, female 2) with average age 40 ± 6.1 were subjected to the examination of radio-opaque pellets and small amount of barium with the interval of 1 week. Protocol 2: 30 healthy volunteers in group 1 (male 8, female 22) with average age 42.5 ± 8.1 and 50 patients with chronic functional constipation in group 2 (male 11, female 39) with average age 45.7 ± 7.8 were subjected to the small amount of barium examination. The small amount of barium was made by 30 g barium dissolved in 200 ml breakfast. After taking breakfast which contains barium, objectives were followed with abdominal X-ray at 4, 8, 12, 24, 48, 72, 96 h until the barium was evacuated totally. Results: Small amount of barium presented actual chyme or stool transit. The transit time of radio-opaque pallets through the whole gastrointestinal tract was significantly shorter than that of barium (37 ± 8 h vs. 47 ± 10 h, P < 0.05) in healthy people. The transit times of barium in constipation patients were markedly prolonged in colon (61.1 ± 22 vs. 37.3 ± 11, P < 0.01) and rectum (10.8 ± 3.7 vs. 2.3 ± 0.8 h, P < 0.01) compared with unconstipated volunteers. Transit times in individual gastrointestinal segments were also recorded by using small amount of barium, which allowed identifying the subtypes of constipation. Conclusion: The small amount barium examination is a convenient and low cost method to provide the most useful and reliable information on the transmission function of different gastrointestinal segments and able to classify the subtypes of slow transit constipation

  6. Barium and Tc-poor S stars: Binary masqueraders among carbon stars


    Jorissen, A; Van Eck, S.


    The current understanding of the origin of barium and S stars is reviewed, based on new orbital elements and binary frequencies. The following questions are addressed: (i) Is binarity a necessary condition to produce a barium star? (ii) What is the mass transfer mode (wind accretion or RLOF?) responsible for their formation? (iii) Do barium stars form as dwarfs or as giants? (iv) Do barium stars evolve into Tc-poor S stars? (v) What is the relative frequency of Tc-rich and Tc-poor S stars?

  7. High Resolution Computed Tomography Appearences of late sequelae of Barium Aspiration in an asymptomatic young child

    International Nuclear Information System (INIS)

    Barium aspiration is a well-known complication of upper gastro-intestinal studies. Consequences of aspiration are generally insignificant and leave no permanent changes in the lung parenchyma. However, large quantities of high density barium, if aspirated, lead to silent interstitial changes and fibrosis. High-resolution computed tomography HRCT appearances of lung changes have been demonstrated in adults; few such reports are available in the pediatric literature. We report a case of a child who aspirated barium 3 months before this presentation. The HRCT appearances of barium aspiration are presented with a review of the literature. (author)

  8. Effects of powdered versus liquid barium on the viscosity of fluids used in modified swallow studies

    Energy Technology Data Exchange (ETDEWEB)

    Baron, J.; Alexander, T. [Univ. of Alberta, Dept. of Radiology, Edmonton, Alberta (Canada)


    To determine if the viscosity of thickened juice mixtures used in modified barium swallow studies significantly changes with the addition of powdered barium. We also describe a test formulation created using liquid barium, which has a negligible effect on juice viscosity. The viscosities of water and standardized honey- and nectar-consistency juices mixed with different amounts of powdered barium were measured by timing the laminar flow of a given initial hydrostatic head of fluid under gravity though an orifice of fixed diameter. Standardized juices were then mixed with a liquid formulation of barium and with measured quantities of water to produce viscosities that more closely equated with those of the standardized juices. With the addition of powdered barium, viscosity increased in all fluids, most markedly with the nectar-consistency juice. Liquid barium formulations maintained the viscosities of the original thickened juices. Rendering juices radio-opaque with barium powder results in dramatic increases in the viscosity of the resulting mixture and compromises diagnostic accuracy. Liquid barium preparations have the advantage that they can be rapidly and accurately dispensed by syringe, and their use does not significantly increase the viscosity of the preparation. (author)


    Noguchi, H; Bronfenbrenner, J


    The so-called syphilitic antibodies can be removed from a serum by means of absorption with barium sulphate. The removal is due either to an adsorption or a mechanical absorption. The activity of the syphilitic antibodies is thereby unimpaired. The readiness with which the absorption is accomplished with barium sulphate varies considerably with different syphilitic sera. That barium sulphate exerts the same absorbing effect upon non-syphilitic serum components is made evident by the interfering property which the latter manifest in the absorption experiment of the syphilitic antibodies. The selective removal of the serum components, other than the syphilitic antibodies, by means of barium sulphate absorption is, therefore, impossible. On the other hand, a partial removal of these components, with but little removal of the syphilitic antibodies, may be effected when the content of a given serum is poor in syphilitic antibodies and comparatively rich in the indifferent serum components. But this is impossible if the conditions are reversed. The main reasons why some negative syphilitic sera may be so modified by the barium sulphate treatment as to give positive reactions, are explained below, but these apply only to those methods in which inactivated serum is employed. The inactivation reduces the antibody content to about one-fourth to one-fifth of the original. When the serum is very rich in antibodies, this does not affect the result of the fixation test. But when the amount of the antibodies is small, the process of inactivation creates conditions quite unexpected. It may produce such a condition that a given amount of the serum contains, after inactivation, only one or two antibody units, while the other serum components remain undiminished. Here one must not lose sight of the vital fact that these apparently indifferent serum constituents are not at all indifferent in the fixation processes. They may possess affinities which are similar to those of complement

  10. Synthesis, characterization and thermochemistry of Cs-, Rb- and Sr-substituted barium aluminium titanate hollandites

    International Nuclear Information System (INIS)

    Highlights: • Cs-, Rb- and Sr-substituted barium titanate hollandites were synthesized using sol–gel methods. • Chemical compositions were determined by electron microprobe analyses. • Crystal structures were analyzed using powder synchrotron X-ray diffraction coupled with Rietveld refinements. • Enthalpies of formation were measured using high temperature oxide melt solution calorimetry. • Stability relations with respect to BaTiO3 and SrTiO3 perovskites and other oxides were determined. - Abstract: Titanate hollandites are of considerable interest for immobilization of radioactive Cs, its daughter product Ba and related radionuclides Rb and Sr. In this study, we synthesized three hollandites, Ba1.18Cs0.21Al2.44Ti5.53O16, Ba1.17Rb0.19Al2.46Ti5.53O16 and Ba1.14Sr0.10Al2.38Ti5.59O16, using sol–gel methods. Rietveld analysis of synchrotron XRD data shows that they adopt the tetragonal structure (space group I4/m), and their cell parameters increase with increasing cation size (Sr2+ → Rb+ → Cs+). Standard enthalpies of formation of these hollandites were determined from drop solution calorimetric measurements with lead borate as the solvent at 973 K. Their formation enthalpies are similar, consistent with the occurrence of extensive cation substitutions in hollandites. Further energetic analysis with respect to BaTiO3 and SrTiO3 perovskites and other oxides reveals decreased thermodynamic stability from Cs- to Rb- to Sr-hollandite. This trend is consistent with the phase assemblage observed in Synroc, where Cs+, Rb+ and Ba2+ enter into hollandite, whereas Sr2+ occurs in perovskite

  11. 铝酸钡与氢氧化钡脱硫过程比较%Comparison of Barium Aluminate and Barium Hydroxide Desulfurization Process

    Institute of Scientific and Technical Information of China (English)

    张念炳; 黎志英; 丁彤


    The seed precipitation liquor was desulfurized with barium aluminate and barium hydroxide respectively. The desulfurization slag was characterized by XRD analysis, and the desulfurization process was compared. The results show that barium hydroxide exceeds barium aluminate with better desulfurization in terms of effect, speed and duration. In the desulfurization process with barium aluminate, 2BaO · Al2O3 · 5H2O is firstly produced in the reaction of barium aluminate with alkali, and then it reacts with sodium sulfate and sodium carbonate. To compare, Ba(OH)2 · 8H2O directly reacts with sodium sulfate and sodium carbonate in the desulfurization process with barium hydroxide. Both of desulfurization reaction processes can be described with "shrinking core model".%用铝酸钡和氢氧化钡对种分母液进行脱硫试验,对脱硫渣进行XRD分析,并比较脱硫过程.结果表明,氢氧化钡的脱硫效果更好,脱硫完成时间更短,速率更快;铝酸钡先与碱液反应生成2BaO·Al2O3·5H2O,再与硫碱和碳碱反应,而氢氧化钡直接与硫碱和碳碱反应,脱硫过程均可用未反应核模型描述.

  12. Nuclear data for cyclotron production of 114mIn/114In and 140Nd/140Pr used in gamma camera monitoring, RIT, ERT and PET

    International Nuclear Information System (INIS)

    Aim of the presented study is to compare the calculated cross sections for the production of 140Nd/140Pr and 114mIn/114In via different reactions with incident particle energy up to 50 MeV as a part of systematic studies on particle-induced activations on metal target, theoretical calculation of production yield, calculation of target thickness requirement and suggestion for optimum reaction to produce Neodymium-140 and Indium-114m. 140Nd/140Pr and 114mIn/114In excitation functions via natCe(3He,xn)140Nd → 140Pr, 141Pr(p,2n)140Nd → 140Pr, 141Pr(d,3n)140Nd → 140Pr, 114Cd(p,n)114mIn → 114In, 114Cd(d,2n)114mIn → 114In and 116Cd(p,3n)114mIn → 114In reactions were calculated by ALICE/91, ALICE/ASH (GDH Model and Hybrid Model) and TALYS-1.2 (Equilibrium and Pre-Equilibrium) codes and compared to existing data. (orig.)

  13. Tungsten and barium transport in the internal plasma of hollow cathodes (United States)

    Polk, James E.; Mikellides, Ioannis G.; Katz, Ira; Capece, Angela M.


    The effect of tungsten erosion, transport, and redeposition on the operation of dispenser hollow cathodes was investigated in detailed examinations of the discharge cathode inserts from 8200 h and 30 352 h ion engine wear tests. Erosion and subsequent redeposition of tungsten in the electron emission zone at the downstream end of the insert reduce the porosity of the tungsten matrix, preventing the flow of barium from the interior. This inhibits the interfacial reactions of the barium-calcium-aluminate impregnant with the tungsten in the pores. A numerical model of barium transport in the internal xenon discharge plasma shows that the barium required to reduce the work function in the emission zone can be supplied from upstream through the gas phase. Barium that flows out of the pores of the tungsten insert is rapidly ionized in the xenon discharge and pushed back to the emitter surface by the electric field and drag from the xenon ion flow. This barium ion flux is sufficient to maintain a barium surface coverage at the downstream end greater than 0.6, even if local barium production at that point is inhibited by tungsten deposits. The model also shows that the neutral barium pressure exceeds the equilibrium vapor pressure of the impregnant decomposition reaction over much of the insert length, so the reactions are suppressed. Only a small region upstream of the zone blocked by tungsten deposits is active and supplies the required barium. These results indicate that hollow cathode failure models based on barium depletion rates in vacuum dispenser cathodes are very conservative.

  14. Anion and cation diffusion in barium titanate and strontium titanate

    International Nuclear Information System (INIS)

    Perovskite oxides show various interesting properties providing several technical applications. In many cases the defect chemistry is the key to understand and influence the material's properties. In this work the defect chemistry of barium titanate and strontium titanate is analysed by anion and cation diffusion experiments and subsequent time-of-flight secondary ion mass spectrometry (ToF-SIMS). The reoxidation equation for barium titanate used in multi-layer ceramic capacitors (MLCCs) is found out by a combination of different isotope exchange experiments and the analysis of the resulting tracer diffusion profiles. It is shown that the incorporation of oxygen from water vapour is faster by orders of magnitude than from molecular oxygen. Chemical analysis shows the samples contain various dopants leading to a complex defect chemistry. Dysprosium is the most important dopant, acting partially as a donor and partially as an acceptor in this effectively acceptor-doped material. TEM and EELS analysis show the inhomogeneous distribution of Dy in a core-shell microstructure. The oxygen partial pressure and temperature dependence of the oxygen tracer diffusion coefficients is analysed and explained by the complex defect chemistry of Dy-doped barium titanate. Additional fast diffusion profiles are attributed to fast diffusion along grain boundaries. In addition to the barium titanate ceramics from an important technical application, oxygen diffusion in cubic, nominally undoped BaTiO3 single crystals has been studied by means of 18O2/16O2 isotope exchange annealing and subsequent determination of the isotope profiles in the solid by ToF-SIMS. It is shown that a correct description of the diffusion profiles requires the analysis of the diffusion through the surface space-charge into the material's bulk. Surface exchange coefficients, space-charge potentials and bulk diffusion coefficients are analysed as a function of oxygen partial pressure and temperature. The data

  15. Microstructure of polymer composite with barium ferrite powder

    Directory of Open Access Journals (Sweden)

    R. Nowosielski


    Full Text Available Purpose: The aim of the paper is the microstructure characterization of commercial BaFe12O19 powder and its composite material in polymer matrix; XRD (X-Ray Diffraction and SEM (Scanning Electron Microscopy methods were applied.Design/methodology/approach: The Rietveld method appeared to be very useful in the verification of the qualitative phase composition and in the determination of phase abundance. Hill and Howard procedure was applied for quantitative phase analysis. The parameters of the individual diffraction line profiles were determined by PRO-FIT Toraya procedure. The morphology of barium ferrite powders and a fracture surface of the examined composite material was analyzed using the scanning electron microscope.Findings: The X-ray diffraction analysis enabled the identification of BaFe12O19 and Fe2O3 phases in examined material. Basing on Rietveld and Toraya methods the determination of lattice parameters, crystallite size and the lattice distortion was performed. Distribution of powders of barium ferrite in polymer matrix is irregular and powder particles are of irregular shapes and different sizes.Research limitations/implications: Maked researches are limited only to characterization the microstructure of commercial material, because obtained results will be helpful to prepare barium ferrite powders by mechanical alloying and subsequent annealing in the future. As prepared BaFe12O19 powders will be used as the starting material for magnets bonded with polymer material.Originality/value: The obtained results of investigations by different methods of structure analysis confirm their useful in the microstructure analysis of powder materials.

  16. Barium Swallow Findings in the Evaluation of Patients with Dysphagia

    Directory of Open Access Journals (Sweden)

    Amirhosein Hashemi Attar


    Full Text Available Background/Objective: Dysphagia is a subjective"nsensation of difficulty in swallowing that has a wide"nrange of etiologies from psychosomatic disorders"nto high grade neoplasms. In this study we evaluated"nbarium swallow findings of patients with dysphagia."nPatients and Methods: We evaluated 200 patients"n(117 men, 83 women; mean age, 49.6 years with"ncomplaint of dysphagia. Fluoroscopic barium"nswallow was done for all the patients and they were"nreviewed for primary peristalsis (presence or absence,"nAbstracts"nS62 Iran J Radiol 2011, 8 (Supp.1"nAbstracts"nimpaired lower esophageal sphincter, esophageal dilatation, delayed emptying of barium, nonperistaltic contractions, stricture and filling defects. Clinical and in some cases endoscopic or manometric follow up was done for all patients."nResults: We had 134 (67% normal barium swallow"nexams with uncomplicated clinical courses. Sixty"nsix patients (33% had abnormal imaging findings"nincluding stricture in 24 patients (12%, filling defect"nin 12 patients (6% and mucosal abnormality in 14"n(7% patients (six cases of mucosal irregularity, three"ncases of mucosal ulceration and five cases of mucosal"nherniation, Bird's beak sign in three patients (1.5%,"ntertiary spasm in six patients (3% and hiatal hernia in"nseven patients (3.5%."nConclusion: In the majority of patients with dysphagia,"nbarium swallow is the only paraclinical study needed"nto plan proper treatment. If radiographic findings are"nequivocal, endoscopy or manometry may be required"nfor more certain diagnosis.

  17. Barium strontium titanate powders prepared by spray pyrolysis

    International Nuclear Information System (INIS)

    Ultasonic spray pyrolysis (SP) has been investigated for the production of the barium strontium titanate (BST) powders from the polymeric precursors. The processing parameters, such as flux of aerosol and temperature profile inside the furnace, were optimized to obtain single phase BST. The powders were characterized by the methods of X-ray diffraction analysis, SEM, EDS and TEM. The obtained powders were submicronic, consisting of spherical, polycrystalline particles, with internal nanocrystalline structure. Crystallite size of 10 nm, calculated using Rietveld refinement, is in a good agreement with results of HRTEM

  18. A barium-rich binary central star in Abell 70

    CERN Document Server

    Boffin, Henri M J; Frew, D J; Acker, A; Köppen, J; Moffat, A F J; Parker, Q A


    We have found the central star of Abell 70 (PN G038.1-25.4, hereafter A 70) to be a binary consisting of a G8 IV-V secondary and a hot white dwarf. The secondary shows enhanced Ba II and Sr II features, firmly classifying it as a barium star. The nebula is found to have Type-I chemical abundances with helium and nitrogen enrichment, which combined with future abundance studies of the central star, will establish A 70 as a unique laboratory for studying s-process AGB nucleosynthesis.

  19. Strain engineered barium strontium titanate for tunable thin film resonators

    Energy Technology Data Exchange (ETDEWEB)

    Khassaf, H.; Khakpash, N. [Department of Materials Science and Engineering and Institute of Materials Science, University of Connecticut, Storrs, Connecticut 06269 (United States); Sun, F. [Department of Physics, University of Connecticut, Storrs, Connecticut 06269 (United States); Sbrockey, N. M.; Tompa, G. S. [Structured Materials Industries, Inc., Piscataway, New Jersey 08854 (United States); Kalkur, T. S. [Department of Electrical and Computer Engineering, University of Colorado at Colorado Springs, Colorado Springs, Colorado 80918 (United States); Alpay, S. P., E-mail: [Department of Materials Science and Engineering and Institute of Materials Science, University of Connecticut, Storrs, Connecticut 06269 (United States); Department of Physics, University of Connecticut, Storrs, Connecticut 06269 (United States)


    Piezoelectric properties of epitaxial (001) barium strontium titanate (BST) films are computed as functions of composition, misfit strain, and temperature using a non-linear thermodynamic model. Results show that through adjusting in-plane strains, a highly adaptive rhombohedral ferroelectric phase can be stabilized at room temperature with outstanding piezoelectric response exceeding those of lead based piezoceramics. Furthermore, by adjusting the composition and the in-plane misfit, an electrically tunable piezoelectric response can be obtained in the paraelectric state. These findings indicate that strain engineered BST films can be utilized in the development of electrically tunable and switchable surface and bulk acoustic wave resonators.

  20. K-shell fluorescence yields of barium and lanthanum

    International Nuclear Information System (INIS)

    K-shell fluorescence yields for barium and lanthanum have been measured adopting simple 2π geometrical configuration and employing a weak 57Co radioactive source. A scintillation spectrometer with an NaI(Tl) detector of dimensions 44.5 mm diameterx50 mm thickness was employed for the detection and measurement of radiation. The results obtained are in good agreement with the best-fitted values of and also with the other experimental values, indicating that our simple method can be extended to determine fluorescence parameters of high Z materials.

  1. The Kerr nonlinearity of the beta-barium borate crystal

    DEFF Research Database (Denmark)

    Bache, Morten; Guo, Hairun; Zhou, Binbin;


    A popular crystal for ultrafast cascading experiments is beta-barium-borate (β-BaB2O4, BBO). It has a decent quadratic nonlinear coefficient, and because the crystal is anisotropie it can be birefringence phase-matched for type I (oo → e) second-harmonic generation (SHG). For femtosecond...... experiments BBO is popular because of low dispersion and a high damage threshold. The main attractive property of ultrafast cascading is that the induced cascading nonlinearity nI 2, casc can be negative, i.e. generate a self-defocusing Kerr-like nonlinearity. However, the material Kerr nonlinearity nI 2...

  2. The Kerr nonlinearity of the beta-barium borate crystal


    Bache, Morten; Guo, Hairun; Zhou, Binbin; Zeng, Xianglong


    A popular crystal for ultrafast cascading experiments is beta-barium-borate (β-BaB2O4, BBO). It has a decent quadratic nonlinear coefficient, and because the crystal is anisotropie it can be birefringence phase-matched for type I (oo → e) second-harmonic generation (SHG). For femtosecond experiments BBO is popular because of low dispersion and a high damage threshold. The main attractive property of ultrafast cascading is that the induced cascading nonlinearity nI 2, casc can be negative, i.e...

  3. Control on Crystal Forms of Ultrafine Barium Carbonate Particles and Study on its Mechanism

    Institute of Scientific and Technical Information of China (English)


    Barium carbonate particles were prepared by using homogeneous precipitation method and co-precipitation method respectively. Through adding different crystalline controlling modifiers, Barium carbonate particles in five different shapes including linear, needle-like, pillarlike, sphere-like and dumbbell-like were synthesized. These particles were characterized by SEM and XRD, and their synthetic mechanism was discussed in this paper.

  4. Investigation on the effects of milling atmosphere on synthesis of barium ferrite/magnetite nanocomposite

    NARCIS (Netherlands)

    Molaei, M.J.; Ataie, A.; Raygan, S.; Picken,n S.J.


    In this research, barium ferrite /magnetite nanocomposites synthesized via a mechano-chemical route. Graphite was used in order to reduce hematite content of barium ferrite to magnetite to produce a magnetic nanocomposite. The effects of processing conditions on the powder characteristics were inves

  5. Acute respiratory failure caused by aspiration of high density barium: A case report

    International Nuclear Information System (INIS)

    Accidental aspiration of barium contrast medium during the upper gastrointestinal study can occur in patients with swallowing disorder, especially in the elderly patients. We experienced a case of respiratory failure followed by death within a few hours in 85 year-old patient after barium aspiration

  6. New efficient catalyst for ammonia synthesis: barium-promoted cobalt on carbon

    DEFF Research Database (Denmark)

    Hagen, Stefan; Barfod, Rasmus; Fehrmann, Rasmus;


    Barium-promoted cobalt catalysts supported on carbon exhibit higher ammonia activities at synthesis temperatures than the commercial, multipromoted iron catalyst and also a lower ammonia......Barium-promoted cobalt catalysts supported on carbon exhibit higher ammonia activities at synthesis temperatures than the commercial, multipromoted iron catalyst and also a lower ammonia...

  7. 11 CFR 114.5 - Separate segregated funds. (United States)


    ... Federal Elections FEDERAL ELECTION COMMISSION GENERAL CORPORATE AND LABOR ORGANIZATION ACTIVITY § 114.5... communication or solicitation than the corporation, labor organization, membership organization, cooperative, or... or corporation is not required to report the cost of any communication to its members or...

  8. 9 CFR 114.11 - Storage and handling. (United States)


    ... AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS PRODUCTION REQUIREMENTS FOR BIOLOGICAL PRODUCTS § 114.11 Storage and handling. Biological products at licensed establishments shall be... filed Outline of Production. All biological products to be shipped or delivered shall be securely packed....

  9. 9 CFR 114.18 - Reprocessing of biological products. (United States)


    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Reprocessing of biological products..., DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS PRODUCTION REQUIREMENTS FOR BIOLOGICAL PRODUCTS § 114.18 Reprocessing of biological products. The Administrator...

  10. 9 CFR 114.4 - Identification of biological products. (United States)


    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Identification of biological products... OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS PRODUCTION REQUIREMENTS FOR BIOLOGICAL PRODUCTS § 114.4 Identification of biological products. Suitable tags or labels...

  11. 9 CFR 11.4 - Inspection and detention of horses. (United States)


    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Inspection and detention of horses. 11... AGRICULTURE ANIMAL WELFARE HORSE PROTECTION REGULATIONS § 11.4 Inspection and detention of horses. For the purpose of effective enforcement of the Act: (a) Each horse owner, exhibitor, trainer, or other...

  12. 33 CFR 183.114 - Test of flotation materials. (United States)


    .../Outdrive Boats, and Airboats § 183.114 Test of flotation materials. (a) Vapor test. The flotation material... gasoline test. The flotation material must not reduce in buoyant force more than 5 percent after being..., see § 183.5). (d) 24-hour oil test. The flotation material must not reduce in buoyant force more...

  13. 40 CFR 180.114 - Ferbam; tolerances for residues. (United States)


    ... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Ferbam; tolerances for residues. 180... PROGRAMS TOLERANCES AND EXEMPTIONS FOR PESTICIDE CHEMICAL RESIDUES IN FOOD Specific Tolerances § 180.114 Ferbam; tolerances for residues. (a) General. Tolerances are established for residues of the...

  14. Anion and cation diffusion in barium titanate and strontium titanate; Anionen- und Kationendiffusion in Barium- und Strontiumtitanat

    Energy Technology Data Exchange (ETDEWEB)

    Kessel, Markus Franz


    Perovskite oxides show various interesting properties providing several technical applications. In many cases the defect chemistry is the key to understand and influence the material's properties. In this work the defect chemistry of barium titanate and strontium titanate is analysed by anion and cation diffusion experiments and subsequent time-of-flight secondary ion mass spectrometry (ToF-SIMS). The reoxidation equation for barium titanate used in multi-layer ceramic capacitors (MLCCs) is found out by a combination of different isotope exchange experiments and the analysis of the resulting tracer diffusion profiles. It is shown that the incorporation of oxygen from water vapour is faster by orders of magnitude than from molecular oxygen. Chemical analysis shows the samples contain various dopants leading to a complex defect chemistry. Dysprosium is the most important dopant, acting partially as a donor and partially as an acceptor in this effectively acceptor-doped material. TEM and EELS analysis show the inhomogeneous distribution of Dy in a core-shell microstructure. The oxygen partial pressure and temperature dependence of the oxygen tracer diffusion coefficients is analysed and explained by the complex defect chemistry of Dy-doped barium titanate. Additional fast diffusion profiles are attributed to fast diffusion along grain boundaries. In addition to the barium titanate ceramics from an important technical application, oxygen diffusion in cubic, nominally undoped BaTiO{sub 3} single crystals has been studied by means of {sup 18}O{sub 2}/{sup 16}O{sub 2} isotope exchange annealing and subsequent determination of the isotope profiles in the solid by ToF-SIMS. It is shown that a correct description of the diffusion profiles requires the analysis of the diffusion through the surface space-charge into the material's bulk. Surface exchange coefficients, space-charge potentials and bulk diffusion coefficients are analysed as a function of oxygen partial

  15. Ruthenium and hafnium abundances in giant and dwarf barium stars

    CERN Document Server

    Allen, D M


    We present abundances for Ru and Hf, compare them to abundances of other heavy elements, and discuss the problems found in determining Ru and Hf abundances with laboratory gf-values in the spectra of barium stars. We determined Ru and Hf abundances in a sample of giant and dwarf barium stars, by the spectral synthesis of two RuI (4080.574A and 4757.856A) and two HfII (4080.437A and 4093.155A) transitions. The stellar spectra were observed with FEROS/ESO, and the stellar atmospheric parameters lie in the range 4300 < Teff/K < 6500, -1.2 < [Fe/H] <= 0 and 1.4 <= log g < 4.6. The HfII 4080A and the RuI 4758A observed transitions result in a unreasonably high solar abundance, given certain known uncertainties, when fitted with laboratory gf-values. For these two transitions we determined empirical gf-values by fitting the observed line profiles of the spectra of the Sun and Arcturus. For the sample stars, this procedure resulted in a good agreement of Ru and Hf abundances given by the two availa...

  16. Study of barium bismuth titanate prepared by mechanochemical synthesis

    Directory of Open Access Journals (Sweden)

    Lazarević Z.Ž.


    Full Text Available Barium-bismuth titanate, BaBi4Ti4O15 (BBT, a member of Aurivillius bismuth-based layer-structure perovskites, was prepared from stoichiometric amounts of barium titanate and bismuth titanate obtained via mechanochemical synthesis. Mechanochemical synthesis was performed in air atmosphere in a planetary ball mill. The reaction mechanism of BaBi4Ti4O15 and the preparation and characteristics of BBT ceramic powders were studied using XRD, Raman spectroscopy, particle analysis and SEM. The Bi-layered perovskite structure of BaBi4Ti4O15 ceramic forms at 1100 °C for 4 h without a pre-calcination step. The microstructure of BaBi4Ti4O15 exhibits plate-like grains typical for the Bi-layered structured material and spherical and polygonal grains. The Ba2+ addition leads to changes in the microstructure development, particularly in the change of the average grain size.

  17. Materials Synthesis Of Barium Hexa ferrite Used Local Natural Resources

    International Nuclear Information System (INIS)

    The magnetic materials of barium hexa ferrites, Ba O.6Fe2O3 successfully synthesized by powder metallurgy method used local natural resources from materials waste of steel fabrication (HSM, CRM), waste of polymer fabrication (LK) as well as iron sands (PBA). These waste as well as iron sands were the main resources of iron oxide, Fe2O3. The barium oxide used in this experiments are from BaCO3 product of Merck, and BaCO4 which is commercially available in the market as barite. Phase identification by x-ray diffraction technique show the synthesized magnetic materials are agreed with the available commercial product, (SUMI). The energy product maximum (BH)max measured by vibrating sample magnetometer (VSM) for the samples used HSM-, CRM- and BaCO3 as basic materials are 1.141 MGOe and 1.136 MGOe while SUMI is 1.142 MGOe. However for the samples made from LK-, PBA- used of BaCO3 or CRM- with barite, the energy product maximum (BH)max are relatively lower than commercial product

  18. Microstructure of composite material with powders of barium ferrite

    Directory of Open Access Journals (Sweden)

    R. Nowosielski


    Full Text Available Purpose: The aim of the present work is the microstructure characterization of commercial powder BaFe12O19 (as-prepared and composite material with BaFe12O19 powders and polymer matrix, using XRD (X-Ray Diffraction and SEM (Scanning Electron Microscopy methods.Design/methodology/approach: The morphology of barium ferrite powders and a fracture surface of the examined composite material was realized by using the scanning electron microscope. The methods of X-ray diffraction were used for the qualitative phase analysis. The parameters of diffraction line profiles were determined by PRO-FIT Toraya procedure.Findings: The X-ray diffraction analysis permitted on identification the BaFe12O19 and Fe2O3 phases in an examined material. Basing on Toraya method is determination of: lattice parameters, crystallite size (D and the lattice distortion (. Distribution of powders of barium ferrite in polymer matrix is irregular and powder particles have irregular shapes and dimensions.Research limitations/implications: For future research the X-ray analysis should be performed by the Rietveld method, which allows to characterization the microstructure of tested material and verification of its qualitative phase composition.Originality/value: The applied Toraya method of structure analysis appeared to be very useful in the microstructure analysis.

  19. Redox processes in highly yttrium-doped barium titanate

    International Nuclear Information System (INIS)

    The changes of microstructure occurring during oxidation of the reduced form of yttrium-doped barium titanate (Ba1-xYx?Ti1-x4+Tix3+O3) have been studied. Samples were sintered under reduction conditions at PO2=10-4Pa and oxidized by annealing at high temperatures (1150 and 1350 deg. C) in air. Depending on yttrium concentration, the oxidation of the reduced form of the yttrium-doped BaTiO3 caused precipitation of the phase Ba6Ti17O40 or the phases Ba6Ti17O40 and Y2Ti2O7. The precipitates had well-defined orientational relationships with the perovskite matrix. Oxidation of the reduced form of doped barium titanate results in formation of the phase Ba1-xYx?Ti1-x/44+(VTi-bar )x/4O3 responsible for increase in the resistance of outer grain layers, which lie between grain boundaries and grain

  20. Thermal expansion behaviour of barium and strontium zirconium phosphates

    Indian Academy of Sciences (India)

    P Srikari Tantri; K Geetha; A M Umarji; Sheela K Ramasesha


    Ba1.5–SrZr4P5SiO24 compounds with = 0, 0.25, 0.5, 0.75, 1.0, 1.25 and 1.5, belonging to the low thermal expansion NZP family were synthesized by the solid state reaction method. The XRD pattern could be completely indexed with respect to R$\\bar{3}$ space group indicating the ordering of vacancy at the divalent cation octahedral sites. The microstructure and bulk thermal expansion coefficient from room temperature to 800°C of the sintered samples have been studied. All the samples show very low coefficient of thermal expansion (CTE), with = 0 samples showing negative expansion. A small substitution of strontium in the pure barium compound changes the sign of CTE. Similarly, = 1.5 sample (pure strontium) shows a positive CTE and a small substitution of barium changes its sign. = 1.0 and 1.25 samples have almost constant CTE over the entire temperature range. The low thermal expansion of these samples can be attributed to the ordering of the ions in the crystal structure of these materials.

  1. Surfactant Distribution in the Clouding of TX114%非离子表面活性剂TX114的浊点分相行为

    Institute of Scientific and Technical Information of China (English)

    秦炜; 黄焱; 丁昱文; 戴猷元


    Distribution of TX114 between coacervate and aqueous phases in clouding of vanous initial114 concentrations was studied.Effects of temperature and salinity(Na2SO4)on the distribution of TX114 concentra-tion were also investigated.Differing from the nonionic surfactant C12E1O,the distribution of TX114 is sensitive to the temperature,and it is observed that the 7X114 concentration in the aqueous phase(Caq)does not depend on the initial TX114 concentration apparently at 45℃,and the Caq decreases with an increase of Na2S04 concentration.Low initial TX114 concentration in unclouded solutions,high Na2S04 concentration,and temperature ale suggested to control the surfactant loss in large-scale cloud point extraction applications.

  2. Bio-based barium alginate film: Preparation, flame retardancy and thermal degradation behavior. (United States)

    Liu, Yun; Zhang, Chuan-Jie; Zhao, Jin-Chao; Guo, Yi; Zhu, Ping; Wang, De-Yi


    A bio-based barium alginate film was prepared via a facile ionic exchange and casting approach. Its flammability, thermal degradation and pyrolysis behaviors, thermal degradation mechanism were studied systemically by limiting oxygen index (LOI), vertical burning (UL-94), microscale combustion calorimetry (MCC), thermogravimetric analysis (TGA) coupled with Fourier transform infrared analysis (FTIR) and pyrolysis-gas chromatography-mass spectrometry (Py-GC-MS). It showed that barium alginate film had much higher LOI value (52.0%) than that of sodium alginate film (24.5%). Moreover, barium alginate film passed the UL-94 V-0 rating, while the sodium alginate film showed no classification. Importantly, peak of heat release rate (PHRR) of barium alginate film in MCC test was much lower than that of sodium alginate film, suggested that introduction of barium ion into alginate film significantly decreased release of combustible gases. TG-FTIR and Py-GC-MS results indicated that barium alginate produced much less flammable products than that of sodium alginate in whole thermal degradation procedure. Finally, a possible degradation mechanism of barium alginate had been proposed. PMID:26794953

  3. Preparation of Barium Titanate Nanopowder through Thermal Decomposition of Peroxide Precursor and Its Formation Mechanism

    Institute of Scientific and Technical Information of China (English)

    PENG, Yangxi; CHEN, Qiyuan; LIU, Shijun


    H_2TiO_3 was dissolved in the mixture of hydrogen formed peroxide and ammonia under the pH range of 8-10 with a transparent yellow solution formed. When an equivalent mole of Ba~(2+) solution was added into the yellow solution, the precipitate produced was the peroxide precursor of barium titanate. The cubic nanopowder of barium titanate was obtained when the precipitate was washed, stoved, and then calcined at 600 ℃ for 1 h. The peroxide precursor of barium titanate and barium titanate nanopowder prepared were characterized to be BaTi(H_2O_2)_2O_3 by TGA-DTA, XRD, TEM, SEM, and XREDS. The peroxide precursor of barium titanate was determined to be BaTi(H_2O_2)_2O_3. The particle size of the barium titanate nanopowder, the calcined product of BaTi(H_2O_2)_2O_3, was in the range of 20-40 nm. A formation mechanism of the barium titanate nanopowder through thermal decomposition of its peroxide precursor was proposed and then validated.

  4. Preparation and properties of yttria doped tetragonal zirconia polycrystal/Sr-doped barium hexaferrite ceramic composites

    International Nuclear Information System (INIS)

    Highlights: • The 3Y-TZP/Sr-doped barium ferrite composites were prepared. • The saturation magnetization was improved by 15% with Sr-doping. • The dispersion coefficient p could reflect the microscopic lattice variation. • The composite with x = 0.5 had the maximum fracture toughness of 8.3 MPa m1/2. - Abstract: The effects of substitution of Ba2+ by Sr2+ on the magnetic property of barium ferrite and addition barium ferrite secondary phase to the 3 mol% yttria-doped tetragonal zirconia polycrystal (3Y-TZP) matrix on the mechanical property of composites were investigated. The Sr-doped barium ferrite (Ba1−xSrxFe12O19, x = 0, 0.25, 0.50 and 0.75) was synthesized by solid-state reaction in advance. Then 3Y-TZP/20 wt% Sr-doped barium ferrite composites were prepared by means of conventional ceramic method. It was found that a moderate amount of Sr added to barium ferrite could boost the saturation magnetization by 15% compared with the composites without Sr-doping. Besides, the composite with x = 0.50 possessed the best mechanical properties, such as 11.5 GPa for Vickers hardness and 8.3 MPa m1/2 for fracture toughness, respectively. It was demonstrated that magnetic and mechanical properties of the composites could be harmonized by the incorporation of barium ferrite secondary phase

  5. Bio-based barium alginate film: Preparation, flame retardancy and thermal degradation behavior. (United States)

    Liu, Yun; Zhang, Chuan-Jie; Zhao, Jin-Chao; Guo, Yi; Zhu, Ping; Wang, De-Yi


    A bio-based barium alginate film was prepared via a facile ionic exchange and casting approach. Its flammability, thermal degradation and pyrolysis behaviors, thermal degradation mechanism were studied systemically by limiting oxygen index (LOI), vertical burning (UL-94), microscale combustion calorimetry (MCC), thermogravimetric analysis (TGA) coupled with Fourier transform infrared analysis (FTIR) and pyrolysis-gas chromatography-mass spectrometry (Py-GC-MS). It showed that barium alginate film had much higher LOI value (52.0%) than that of sodium alginate film (24.5%). Moreover, barium alginate film passed the UL-94 V-0 rating, while the sodium alginate film showed no classification. Importantly, peak of heat release rate (PHRR) of barium alginate film in MCC test was much lower than that of sodium alginate film, suggested that introduction of barium ion into alginate film significantly decreased release of combustible gases. TG-FTIR and Py-GC-MS results indicated that barium alginate produced much less flammable products than that of sodium alginate in whole thermal degradation procedure. Finally, a possible degradation mechanism of barium alginate had been proposed.

  6. STS-114: Discovery Day 8 Mission Status Briefing (United States)


    Paul Hill, STS 114 Lead Shuttle Flight Director, David Wolf, Extravehicular Activity (EVA) Branch Chief, JSC from the Astronaut Office, and Kelly Beck, STS-114 Team 4 Flight Director are seen on the 8th day of the Space Shuttle Discovery Mission. Paul Hill presents and explains charts of the Gap Fillers that Steve Robinson will be pulling off during his EVA. The charts include: 1) Protruding Gap Fillers; 2) Starboard Worksite Access; 3) Protruding Chine Gap Filler; 4) Port Gap Filler Space Shuttle Remote Manipulator System (SSRMS) Position; and 5) Port Gap Filler Close-up View. Kelly Beck talks about how the plan for the gap fillers were arranged, and presents the tools and techniques that Steve Robinson will be using during the EVA. David Wolf demonstrates how the EVA will be performed using forceps and a hacksaw to remove the gap fillers. The presentation ends with a question and answer period from the news media.

  7. Wideband and enhanced microwave absorption performance of doped barium ferrite

    Energy Technology Data Exchange (ETDEWEB)

    Meng, Pingyuan; Xiong, Kun [State Key Laboratory Cultivation Base for Nonmetal Composites and Functional Materials, School of Materials Science and Engineering, Southwest University of Science and Technology, Mianyang 621010 (China); Ju, Kui [Guizhou Institute of Metallurgy and Chemical Engineering, Guiyang 550002 (China); Li, Shengnan [State Key Laboratory Cultivation Base for Nonmetal Composites and Functional Materials, School of Materials Science and Engineering, Southwest University of Science and Technology, Mianyang 621010 (China); Xu, Guangliang, E-mail: [State Key Laboratory Cultivation Base for Nonmetal Composites and Functional Materials, School of Materials Science and Engineering, Southwest University of Science and Technology, Mianyang 621010 (China)


    To achieve stronger microwave attenuation and larger bandwidth in electromagnetic absorber, the nickel ions (Ni{sup 2+}) and manganese ions (Mn{sup 2+}) were employed to partially replace the cobalt ions (Co{sup 2+}) in BaCoTiFe{sub 10}O{sub 19}, and the doped barium hexaferrite (Ba(MnNi){sub 0.2}Co{sub 0.6}TiFe{sub 10}O{sub 19} and Ba(MnNi){sub 0.25}Co{sub 0.5}TiFe{sub 10}O{sub 19}) powders were synthesized via the sol–gel combustion method. Subsequently, the microwave absorbing composites were prepared by mixing the ferrite powders with the paraffin. The X-ray diffraction (XRD) patterns of the doped ferrites confirmed the formation of the M-type barium ferrite, and no other types of barium ferrite could be found. Based on the electromagnetic parameters measured by the vector net-analyzer, it was found that the composite (Ba(MnNi){sub 0.2}Co{sub 0.6}TiFe{sub 10}O{sub 19}) possessed a minimum reflection loss of −52.8 dB at 13.4 GHz with a matching thickness of 1.8 mm and the bandwidth below −15 dB was 5.8 GHz. Moreover, the maximum attenuation of Ba(MnNi){sub 0.25}Co{sub 0.5}TiFe{sub 10}O{sub 19} could reach −69 dB when its thickness was 1.8 mm, and also the bandwidth less than −20 dB was ranging from 13.2 GHz to 18 GHz. Thus, Ba(MnNi){sub 0.2}Co{sub 0.6}TiFe{sub 10}O{sub 19} and Ba(MnNi){sub 0.25}Co{sub 0.5}TiFe{sub 10}O{sub 19} could be the good microwave absorbers, which have great potentials to be applied in the high frequency fields of the microwave absorbing materials. - Highlights: • The Co was first time substituted by Mn–Ni in ferrites. • The substituted ferrites had good microwave absorption. • The doped ferrites had broad bandwidth and low reflection loss.

  8. Barium titanate core – gold shell nanoparticles for hyperthermia treatments

    Directory of Open Access Journals (Sweden)

    FarrokhTakin E


    Full Text Available Elmira FarrokhTakin,1,2 Gianni Ciofani,1 Gian Luigi Puleo,1 Giuseppe de Vito,3,4 Carlo Filippeschi,1 Barbara Mazzolai,1 Vincenzo Piazza,3 Virgilio Mattoli1 1Center for Micro-BioRobotics @SSSA, Fondazione Istituto Italiano di Tecnologia, Pontedera, Pisa, Italy; 2The Biorobotics Institute, Scuola Superiore Sant'Anna, Pontedera, Pisa, Italy; 3Center for Nanotechnology Innovation @NEST, Fondazione Istituto Italiano di Tecnologia, Pisa, Italy; 4NEST, Scuola Normale Superiore, Pisa, Italy Abstract: The development of new tools and devices to aid in treating cancer is a hot topic in biomedical research. The practice of using heat (hyperthermia to treat cancerous lesions has a long history dating back to ancient Greece. With deeper knowledge of the factors that cause cancer and the transmissive window of cells and tissues in the near-infrared region of the electromagnetic spectrum, hyperthermia applications have been able to incorporate the use of lasers. Photothermal therapy has been introduced as a selective and noninvasive treatment for cancer, in which exogenous photothermal agents are exploited to achieve the selective destruction of cancer cells. In this manuscript, we propose applications of barium titanate core–gold shell nanoparticles for hyperthermia treatment against cancer cells. We explored the effect of increasing concentrations of these nanoshells (0–100 µg/mL on human neuroblastoma SH-SY5Y cells, testing the internalization and intrinsic toxicity and validating the hyperthermic functionality of the particles through near infrared (NIR laser-induced thermoablation experiments. No significant changes were observed in cell viability up to nanoparticle concentrations of 50 µg/mL. Experiments upon stimulation with an NIR laser revealed the ability of the nanoshells to destroy human neuroblastoma cells. On the basis of these findings, barium titanate core–gold shell nanoparticles resulted in being suitable for hyperthermia treatment

  9. Cross-Price Elasticities of Demand Across 114 Countries


    Regmi, Anita; Seale, James L. Jr


    This report presents a simple methodology for calculating cross-price elasticities across countries, using the Frisch own-price elasticity. Cross-price elasticities are calculated for 9 major consumption categories from the 1996 International Comparison Program data across 114 countries. The consumption categories are: food, beverage, and tobacco; clothing and footwear; education; gross rent, fuel, and power; house furnishings and operations; medical care; recreation; transport and communicat...

  10. A Comparative Study on Magnetostructural Properties of Barium Hexaferrite Powders Prepared by Polyethylene Glycol

    Directory of Open Access Journals (Sweden)

    Zehra Durmus


    Full Text Available Nanocrystalline particles of barium hexaferrite were synthesized by a sol-gel combustion route using nitrate-citrate gels prepared from metal nitrates and citric acid solutions with Fe/Ba molar ratio 12. The present paper aims to study the effect of addition of polyethylene glycol (PEG solutions with different molecular weights (MW: 400, 2000, and 10.000 g/mol on magnetostructural properties of barium hexaferrite. The formation of the barium hexaferrite was inspected using X-ray diffraction (XRD analysis, Fourier transform infrared (FT-IR analysis, thermogravimetric (TGA analysis, scanning electron microscopy (SEM analysis and vibrating sample magnetometer (VSM analysis for magnetic measurements.

  11. Microscopic insight into nuclear structure properties of proton-rich barium isotopes

    International Nuclear Information System (INIS)

    Variation after projection (VAP) calculations with Hartree-Bogoliubov (HB) Ansatz have been carried out for A=120-136 barium isotopes. In this framework, the yrast spectra with Jmaxπ=10+, B(E2) transition probabilities, quadrupole (β2) and hexadecapole (β4) deformation parameters for even-even barium isotopes have been obtained. The results of the calculation give an indication that it is important to include the hexadecapole-hexadecapole component of the two-body interaction for obtaining various nuclear structure quantities in these barium isotopes. (author)

  12. Application of barium fluoride for sulfur selective extraction at X-ray spectroscopic analysis of steel

    International Nuclear Information System (INIS)

    In order to increase the sensitivity of X-ray spectroscopic identification of sulphur in steels the application of barium fluoride for selective extraction of sulphate ions was proposed by authors of present work. The influence of concentration of sulphate ions, iron, nickel, chromium and titanium cations as well as acidity of solutions on the coefficient of distribution of sulphate ions in the system barium fluoride-water was studied. The distribution coefficients were calculated, the completeness of extraction was calculated as well. It is defined that sulphate ions from solutions containing cations of heavy metals and other anions can be extracted by means of barium fluoride.

  13. Barium ferrite nanoparticles prepared by self-propagating low-temperature combustion method and its characterization

    Indian Academy of Sciences (India)

    P M Prithviraj Swamy; S Basavaraja; Vijayanand Havanoor; N V Srinivas Rao; R Nijagunappa; A Venkataraman


    The barium ferrite particles were prepared using a self-propagating low-temperature combustion method using polyethylene glycol (PEG) as a fuel. The process was investigated with simultaneous thermogravimetric-differential thermal analysis (TG–DTA). The crystalline structure, morphology and the magnetic properties of the barium ferrite particles were studied by means of X-ray diffraction (XRD), scanning electron microscopy (SEM), transmission electron microscopy (TEM) and SQUID susceptometer. The results show that the ignition temperature of PEG is lower compared with other combustion methods and gives nanocrystalline barium ferrite.

  14. Preparation and Characterization of Nano-particle Substituted Barium Hexaferrite

    CERN Document Server

    Atassi, Yomen; Tally, Mohammad


    High density magnetic recording requires high coercivity magnetic media and small particle size. Barium hexaferrite has been considered as a leading candidate material because of its chemical stability, fairly large crystal anisotropy and suitable magnetic characteristics. In this work, we present the preparation of the hexagonal ferrite BaFe12O19 and one of its derivative; the Zn-Sn substituted hexaferrite by the chemical co-precipitation method. The main advantage of this method on the conventional glass-ceramic one, resides in providing a small enough particle size for magnetic recording. We demonstrate using the X-ray diffraction patterns that the particle size decreases when substituting the hexaferrite by the Zn-Sn combination. This may improve the magnetic properties of the hexaferrite as a medium for HD magnetic recording

  15. Stark effect in Rydberg states of helium and barium

    International Nuclear Information System (INIS)

    This thesis, which deals with the effect of an electric field up to moderate field strengths on atoms with two valence electrons outside closed shells, in casu helium and barium, contains chapter in which the linear Stark effect in the 1 snp 1,3p Rydberg states of helium (n around 40) has been studied in a CW laser-atomic beam experiment. The evolution of the angular momentum manifolds into the n-mixing regime was followed and avoided level crossings were observed. Stark manifolds were also calculated by diagonalization of the complete energy matrix in the presence of an electric field. It turned out to be necessary to include up to five n-values in the calculations already at moderate values of the field to reproduce the data within the experimental accuracy (a few MHz), especially in the regime of the avoided crossings. (author). 147 refs.; 30 figs.; 8 tabs

  16. Effect of Nb on barium titanate prepared from citrate solutions

    Directory of Open Access Journals (Sweden)

    Stojanović Biljana D.


    Full Text Available The influence of the addition of dopants on the microstructure development and electrical properties of BaTiO3 doped with 0.2, 0.4, 0.6, 0.8 mol% of Nb and 0.01 mol% of Mn based compounds was studied. Doped barium titanate was prepared using the polymeric precursor method from citrate solutions. The powders calcined at 700°C for 4 hours were analysed by infrared (IR spectroscopy to verify the presence of carbonates, and by X-ray diffraction (XRD for phase formation. The phase composition, microstructure and dielectric properties show a strong dependence on the amount of added niobium.

  17. A buffer gas cooled beam of barium monohydride (United States)

    Iwata, Geoffrey; Tarallo, Marco; Zelevinsky, Tanya


    Significant advances in direct laser cooling of diatomic molecules have opened up a wide array of molecular species to precision studies spanning many-body physics, quantum collisions and ultracold dissociation. We present a cryogenic beam source of barium monohydride (BaH), and study laser ablation of solid precursor targets as well as helium buffer gas cooling dynamics. Additionally, we cover progress towards a molecular magneto-optical trap, with spectroscopic studies of relevant cooling transitions in the B2 Σ <--X2 Σ manifold in laser ablated molecules, including resolution of hyperfine structure and precision measurements of the vibrational Frank-Condon factors. Finally, we examine the feasibility of photo dissociation of trapped BaH molecules to yield optically accessible samples of ultracold hydrogen.

  18. Optical-induced absorption tunability of Barium Strontium Titanate film (United States)

    Luo, Chunya; Ji, Jie; Yue, Jin; Rao, Yunkun; Yao, Gang; Li, Dan; Zeng, Ying; Li, Renkui; Xiao, Longsheng; Liu, Xinxing; Yao, Jianquan; Ling, Furi


    The absorption tunability of 100 nm thickness of ferroelectric Barium Strontium Titanate (Ba0.5Sr0.5TiO3) thin films with different densities of pumped optical field is measured by terahertz time-domain spectroscopy in the range of 0.2 THz - 1.2 THz at 19 °C. Experimental results show that the absorption coefficient of BST film is approximately at 5000 cm-1-20000 cm-1 in the range of 0.2 THz - 1.2 THz and the absorption coefficient reached up to 16% when we applied the optical field up to 600 mW. The theoretical calculations reveal that increasing photoexcitation fluences is responsible for the increasing of transmission change in the conduction current density cause the absorption coefficient varied.

  19. Infrared Spectroscopic Characterization of Calcium and Barium Hydrazone Complexes

    Directory of Open Access Journals (Sweden)

    *A. Adeniyi


    Full Text Available Hydrazones have attracted considerable interest on account of their biological activities. Introduction of calcium and barium metal ions into m- and p-nitrobenzoic hydrazones is expected to modify these biological properties for enhanced activity and versatility. The ligands were synthesized from the parent acids. The complexes have been characterized using C, H and N microanalyses and IR spectrometry. The IR spectral data of the ligands and complexes revealed bonding via the C=O and C=N groups. The suggested metal to ligand stoichiometries are: [M (m-NBHx]Cl2.yH2O, x, y = 1 and 4 for M = Ca; x, y = 2 and 3 for M = Ba respectively. [M(p-NBHx]Cl2.yH2O, x, y = 1 and 12 for M = Ca; x, y = 1 and 3 for M = Ba respectively. The structural deductions are tentative pending future X-ray structural studies.

  20. Nonlinear optical properties of calcium barium niobate epitaxial thin films. (United States)

    Bancelin, Stéphane; Vigne, Sébastien; Hossain, Nadir; Chaker, Mohammed; Légaré, François


    We investigate the potential of epitaxial calcium barium niobate (CBN) thin film grown by pulsed laser deposition for optical frequency conversion. Using second harmonic generation (SHG), we analyze the polarization response of the generated signal to determine the ratios d15 / d32 and d33 / d32 of the three independent components of the second-order nonlinear susceptibility tensor in CBN thin film. In addition, a detailed comparison to the signal intensity obtained in a y-cut quartz allows us to measure the absolute value of these components in CBN thin film: d15 = 5 ± 2 pm / V, d32 = 3.1 ± 0.6 pm / V and d33 = 9 ± 2 pm / V. PMID:27464195

  1. Pulsating aurora induced by upper atmospheric barium releases (United States)

    Deehr, C.; Romick, G.


    The paper reports the apparent generation of pulsating aurora by explosive releases of barium vapor near 250 km altitude. This effect occurred only when the explosions were in the path of precipitating electrons associated with the visible aurora. Each explosive charge was a standard 1.5 kg thermite mixture of Ba and CuO with an excess of Ba metal which was vaporized and dispersed by the thermite explosion. Traces of Sr, Na, and Li were added to some of the charges, and monitoring was achieved by ground-based spectrophotometric observations. On March 28, 1976, an increase in emission at 5577 A and at 4278 A was observed in association with the first two bursts, these emissions pulsating with roughly a 10 sec period for approximately 60 to 100 sec after the burst.

  2. Bronchography in dogs. Comparative study with two barium sulphate solutions

    International Nuclear Information System (INIS)

    Two solutions of barium sulphate, 60 and 30% w/v, were compared with the ''overflow'' Bronchographic method. Two groups of eight healthy adult does of both sexes, weighing 7 to 18 kg were used for the study. The dogs were anaesthetised with thiopentone sodium 2% (20 mg/kg iv). After intubation, each dog received contrast medium by a catheter connected to a syringe, in a 9 mi dose. Two series of two x-rays plates were taken in left lateral recumbent, 3 and 6 min after administering the contrast medium and in ventrodorsal projection, 30 sec. later. The x-ray plates obtained were analysed and compared intra and inter group considering the advance speed of the contrast medium, the radiographic density and outlines. Adverse reactions were controlled

  3. Structural and functional characterization of barium zirconium titanate / epoxy composites

    Directory of Open Access Journals (Sweden)

    Filiberto González Garcia


    Full Text Available The dielectric behavior of composite materials (barium zirconium titanate / epoxy system was analyzed as a function of ceramic concentration. Structure and morphologic behavior of the composites was investigated by X-ray Diffraction (XRD, Fourier transformed infrared spectroscopy (FT-IR, Raman spectroscopy, field emission scanning electron microscopy (FE-SEM and transmission electron microscopy (TEM analyses. Composites were prepared by mixing the components and pouring them into suitable moulds. It was demonstrated that the amount of inorganic phase affects the morphology of the presented composites. XRD revealed the presence of a single phase while Raman scattering confirmed structural transitions as a function of ceramic concentration. Changes in the ceramic concentration affected Raman modes and the distribution of particles along into in epoxy matrix. Dielectric permittivity and dielectric losses were influenced by filler concentration.

  4. Synthesis and optical study of barium magnesium aluminate blue phosphors

    Energy Technology Data Exchange (ETDEWEB)

    Jeet, Suninder, E-mail:; Pandey, O. P., E-mail: [School of Physics and Materials Science, Thapar University, Patiala (147003), Punjab (India); Sharma, Manoj, E-mail: [Department of Nanotechnology, Sri Guru Granth Sahib World University, Fatehgarh Sahib(146406), Punjab (India)


    Europium doped barium magnesium aluminate (BaMgAl{sub 10}O{sub 17}:Eu{sup 2+}) phosphor was prepared via solution combustion method at 550°C using urea as a fuel. Morphological and optical properties of the prepared sample was studied by X-ray diffraction (XRD), Transmission electron microscopy (TEM) and Photoluminescence spectroscopy (PL). XRD result showed the formation of pure phase BaMgAl{sub 10}O{sub 17}(JCPDS 26-0163) along with an additional phase BaAl{sub 2}O{sub 4}(JCPDS 01-082-1350). TEM image indicated the formation of faceted particles with average particle size 40 nm. From PL spectra, a broad emission band obtained at about 450 nm attributes to 4f{sup 6} 5d → 4f{sup 7} transition of Eu{sup 2+} which lies in the blue region of the visible spectrum.

  5. Study on a flexoelectric microphone using barium strontium titanate (United States)

    Kwon, S. R.; Huang, W. B.; Zhang, S. J.; Yuan, F. G.; Jiang, X. N.


    In this study, a flexoelectric microphone was, for the first time, designed and fabricated in a bridge structure using barium strontium titanate (Ba0.65Sr0.35TiO3) ceramic and tested afterwards. The prototyped flexoelectric microphone consists of a 1.5 mm  ×  768 μm  ×  50 μm BST bridge structure and a silicon substrate with a cavity. The sensitivity and resonance frequency were designed to be 0.92 pC/Pa and 98.67 kHz, respectively. The signal to noise ratio was measured to be 74 dB. The results demonstrate that the flexoelectric microphone possesses high sensitivity and a wide working frequency range simultaneously, suggesting that flexoelectricity could be an excellent alternative sensing mechanism for microphone applications.

  6. Barium and carbon fluxes in the Canadian Arctic Archipelago (United States)

    Thomas, Helmuth; Shadwick, Elizabeth; Dehairs, Frank; Lansard, Bruno; Mucci, Alfonso; Navez, Jacques; Gratton, Yves; Prowe, Friederike; Chierici, Melissa; Fransson, Agneta; Papakyriakou, Tim N.; Sternberg, Erika; Miller, Lisa A.; Tremblay, Jean-ÉRic; Monnin, Christophe


    The seasonal and spatial variability of dissolved Barium (Ba) in the Amundsen Gulf, southeastern Beaufort Sea, was monitored over a full year from September 2007 to September 2008. Dissolved Ba displays a nutrient-type behavior: the maximum water column concentration is located below the surface layer. The highest Ba concentrations are typically observed at river mouths, the lowest concentrations are found in water masses of Atlantic origin. Barium concentrations decrease eastward through the Canadian Arctic Archipelago. Barite (BaSO4) saturation is reached at the maximum dissolved Ba concentrations in the subsurface layer, whereas the rest of the water column is undersaturated. A three end-member mixing model comprising freshwater from sea-ice melt and rivers, as well as upper halocline water, is used to establish their relative contributions to the Ba concentrations in the upper water column of the Amundsen Gulf. Based on water column and riverine Ba contributions, we assess the depletion of dissolved Ba by formation and sinking of biologically bound Ba (bio-Ba), from which we derive an estimate of the carbon export production. In the upper 50 m of the water column of the Amundsen Gulf, riverine Ba accounts for up to 15% of the available dissolved Ba inventory, of which up to 20% is depleted by bio-Ba formation and export. Since riverine inputs and Ba export occur concurrently, the seasonal variability of dissolved Ba in the upper water column is moderate. Assuming a fixed organic carbon to bio-Ba flux ratio, carbon export out of the surface layer is estimated at 1.8 ± 0.45 mol C m-2 yr-1. Finally, we propose a climatological carbon budget for the Amundsen Gulf based on recent literature data and our findings, the latter bridging the surface and subsurface water carbon cycles.

  7. Brillouin function characteristics for La-Co substituted barium hexaferrites

    Energy Technology Data Exchange (ETDEWEB)

    Wu, Chuanjian, E-mail:, E-mail:; Yu, Zhong; Sun, Ke, E-mail:, E-mail:; Guo, Rongdi; Jiang, Xiaona; Lan, Zhongwen [State Key Laboratory of Electronic Thin Films and Integrated Devices, University of Electronic Science and Technology of China, Chengdu 610054 (China); Yang, Yan [Department of Communication and Engineering, Chengdu Technological University, Chengdu 611730 (China)


    La-Co substituted barium hexaferrites with the chemical formula of Ba{sub 1−x}La{sub x}Fe{sub 12−x}Co{sub x}O{sub 19} (x = 0.0, 0.1, 0.3, and 0.5), prepared by a conventional ceramic method, were systematically investigated by Raman spectra, X-ray photoelectron spectroscopy, Rietveld refinement of X-ray diffraction patterns, and vibrating sample magnetometer. The result manifests that all the compounds are crystallized in magnetoplumbite hexagonal structure. Trivalent cobalt ions prevailingly occupy the 2a, 4f{sub 1}, and 12k sites. According to Néel model of collinear-spin ferrimagnetism, the molecular-field coefficients ω{sub bf2}, ω{sub kf1}, ω{sub af1}, ω{sub kf2}, and ω{sub bk} of La-Co substituted barium hexaferrites have been calculated using the nonlinear fitting method, and the magnetic moment of five sublattices (2a, 2b, 4f{sub 1}, 4f{sub 2}, and 12k) versus temperature T has been also investigated. The fitting results are coincided well with the experimental data. Moreover, with the increase of La-Co substitution amount x, the molecular-field coefficients ω{sub bf2} and ω{sub af1} decrease constantly, while the molecular-field coefficients ω{sub kf1}, ω{sub kf2}, and ω{sub bk} show a slight change.

  8. Synthesis, characterization and thermochemistry of Cs-, Rb- and Sr-substituted barium aluminium titanate hollandites

    Energy Technology Data Exchange (ETDEWEB)

    Xu, H., E-mail: [Earth and Environmental Sciences Division, Los Alamos National Laboratory, Los Alamos, NM 87545 (United States); Wu, L. [Peter A. Rock Thermochemistry Laboratory and NEAT ORU, University of California at Davis, Davis, CA 95616 (United States); Zhu, J. [Los Alamos Neutron Science Center, Los Alamos National Laboratory, Los Alamos, NM 87545 (United States); Navrotsky, A. [Peter A. Rock Thermochemistry Laboratory and NEAT ORU, University of California at Davis, Davis, CA 95616 (United States)


    Highlights: • Cs-, Rb- and Sr-substituted barium titanate hollandites were synthesized using sol–gel methods. • Chemical compositions were determined by electron microprobe analyses. • Crystal structures were analyzed using powder synchrotron X-ray diffraction coupled with Rietveld refinements. • Enthalpies of formation were measured using high temperature oxide melt solution calorimetry. • Stability relations with respect to BaTiO{sub 3} and SrTiO{sub 3} perovskites and other oxides were determined. - Abstract: Titanate hollandites are of considerable interest for immobilization of radioactive Cs, its daughter product Ba and related radionuclides Rb and Sr. In this study, we synthesized three hollandites, Ba{sub 1.18}Cs{sub 0.21}Al{sub 2.44}Ti{sub 5.53}O{sub 16}, Ba{sub 1.17}Rb{sub 0.19}Al{sub 2.46}Ti{sub 5.53}O{sub 16} and Ba{sub 1.14}Sr{sub 0.10}Al{sub 2.38}Ti{sub 5.59}O{sub 16}, using sol–gel methods. Rietveld analysis of synchrotron XRD data shows that they adopt the tetragonal structure (space group I4/m), and their cell parameters increase with increasing cation size (Sr{sup 2+} → Rb{sup +} → Cs{sup +}). Standard enthalpies of formation of these hollandites were determined from drop solution calorimetric measurements with lead borate as the solvent at 973 K. Their formation enthalpies are similar, consistent with the occurrence of extensive cation substitutions in hollandites. Further energetic analysis with respect to BaTiO{sub 3} and SrTiO{sub 3} perovskites and other oxides reveals decreased thermodynamic stability from Cs- to Rb- to Sr-hollandite. This trend is consistent with the phase assemblage observed in Synroc, where Cs{sup +}, Rb{sup +} and Ba{sup 2+} enter into hollandite, whereas Sr{sup 2+} occurs in perovskite.

  9. Characterization and growth dynamics of barium titanate crystallite on nanometer scale

    Institute of Scientific and Technical Information of China (English)

    Sen Wang; Yue Zhang; Zhen Ji; Yousong Gu; Yunhua Huang; Cheng Zhou


    Barium titanate powder on nanometer scale was synthesized by means of co-precipitation. The thermal mass loss, crystal grain growth and phase transition of the barium titanate nanometer powder were investigated by TG (Thermogravimetric)-DTA (Differential scanning calorimetric) and XRD (X-ray powder diffractometer) at different heat treatment temperatures. The results show that amorphous barium titanate powder can transfer into tetragonal symmetry structure after heat treatment. When the heat treatment temperature is below 900℃, the grains grow rapidly because the activation energy at low temperature is greatly less than that at high temperature. By controlling theheat treatment temperature, the optimization of the barium titanate crystallite size and formation of tetragonal phase can be realized.

  10. A study of magneto-crystalline alignment in sintered barium hexaferrite fabricated by powder injection molding

    Energy Technology Data Exchange (ETDEWEB)

    Zlatkov, B.S. [FOTEC Forschungs- und Technologietransfer GmbH, Viktor Kaplan-Strasse 2, 2700 Wiener Neustadt (Austria); Nikolic, M.V. [Institute for Multidisciplinary Research, Kneza Viseslava 1, 11000 Beograd (Serbia)], E-mail:; Aleksic, O. [Institute for Multidisciplinary Research, Kneza Viseslava 1, 11000 Beograd (Serbia); Danninger, H.; Halwax, E. [Institute of Chemical Technologies and Analytics, Getreidemarkt 9/164, 1060 Wien (Austria)


    Barium hexaferrite permanent magnets were produced by powder injection molding. Starting barium hexaferrite powder was prepared from a Fe{sub 2}O{sub 3} and BaCO{sub 3} powder mixture by calcination followed by milling. The feedstock for powder injection molding was prepared by mixing barium hexaferrite powder with a low viscosity binder. Magnetic alignment was achieved by applying a high intensity magnetic field to the melted feedstock during the injection process. Green samples (with and without magnetic alignment) were subjected to solvent debinding and subsequent thermal debinding followed by sintering. Sintering conditions were optimized in order to achieve a maximum energy product value. Magneto-crystalline aligning in barium hexaferrite was studied on both green and sintered samples using X-ray diffraction, scanning electron microscope (SEM) and magnetic measurements (hysteresisgraphs). All measurements were made both in a parallel and perpendicular direction to the aligning magnetic field. The obtained results confirmed magneto-crystalline alignment.

  11. 48 CFR 18.114 - Contracting with the Small Business Administration (The 8(a) Program). (United States)


    ... Business Administration (The 8(a) Program). 18.114 Section 18.114 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION CONTRACTING METHODS AND CONTRACT TYPES EMERGENCY ACQUISITIONS Available Acquisition Flexibilities 18.114 Contracting with the Small Business Administration (The 8(a)...

  12. 40 CFR 93.114 - Criteria and procedures: Currently conforming transportation plan and TIP. (United States)


    ... conforming transportation plan and TIP. 93.114 Section 93.114 Protection of Environment ENVIRONMENTAL....114 Criteria and procedures: Currently conforming transportation plan and TIP. There must be a currently conforming transportation plan and currently conforming TIP at the time of project approval, or...

  13. 9 CFR 114.5 - Micro-organisms used as seed. (United States)


    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Micro-organisms used as seed. 114.5 Section 114.5 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF... BIOLOGICAL PRODUCTS § 114.5 Micro-organisms used as seed. Micro-organisms used in the preparation...

  14. Study of the immunoisolating effects of barium-alginate microencapsulation on rat islets allograft survival

    Institute of Scientific and Technical Information of China (English)

    Mei Zhang; Chao Liu; Cuiping Liu; Youwen Qin; Zhaosun Zhen


    Objective: To evaluate the immunoisolating effects of barium-alginate microencapsulation on islets allograft survival. Methods: The nonmicroencapsulated and microencapsulated islets were transplanted under the kidney capsule or intraperitoneally into Wistar rat with STZ-induced diabetes. The blood glucose and insulin secretion of grafts were observed. Graft function was tested by oral rats was associated with normal glucose and insulin profiles in response to OGTT. Conclusion: Microencapsulation with barium-alginate membrane can prolong islet survival and protect islets against allorejection.

  15. Kinetics of barium sulphate reaction crystallization in crystallizers with internal circulation


    Koralewska, J.; Piotrowski, K; B. Wierzbowska; A. Matynia


    Kinetic calculation results describing the observed nucleation and growth rates of barium sulphate crystals precipitated in an integrated reaction-crystallization process in a barium sulphate-ammonium chloride-water system are presented and analyzed. The scope of experiments included two continuous model DTM-type crystallizers (Draft Tube Magma) with internal circulation of the suspension forced by a liquid jet-pump device responsible for stable and intensive enough ascending/descending flow ...

  16. Impact of Biofield Treatment on Atomic and Structural Characteristics of Barium Titanate Powder


    Trivedi, Mahendra; Nayak, Gopal


    Barium titanate, perovskite structure is known for its high dielectric constant and piezoelectric properties, which makes it interesting material for fabricating capacitors, transducer, actuator, and sensors. The perovskite crystal structure and lattice vibrations play a crucial role in its piezoelectric and ferroelectric behavior. In the present study, the barium titanate powder was subjected to biofield treatment. Further, the control and treated samples were characterized using X-ray diffr...

  17. STS-114: Multi-Cut Profiles and Mission Overviews (United States)


    Profiles of the seven crewmembers of the STS-114 Discovery are shown. Eileen Collins, Commander, talks about her fascination with flying as a young child and her eagerness to have someone teach her to fly at age 19. Her eagerness and hard work earned her a master's in operations research from Stanford University in 1986 and a master's in space systems management from Webster University in 1989. Jim Kelly, Pilot, talks about his desire to become an astronaut at a very young age. Charles Camarda, Mission Specialist, always wanted to become an astronaut and earned a Bachelor's degree in aerospace engineering from Polytechnic Institute of Brooklyn in 1974, a Master's in engineering Science from George Washington University in 1980 and a doctorate in aerospace engineering from Virginia Polytechnic Institute and State University in 1990. Wendy Lawrence, Mission Specialist decided that she wanted to become an astronaut when she saw the first man to walk on the moon. Soichi Noguchi, Mission Specialist from JAXA expresses that people like scientists, doctors and engineers could fly and he also wanted to venture into spaceflight. Steve Robinson, Mission Specialist says that he was fascinated with things that flew as a child and wanted to make things fly. Australian born Andrew Thomas, Mission Specialist wanted to become an astronaut as a young boy but never realized that he would fulfill his dream. The crewmember profiles end with an overview of the STS-114 Discovery mission. Paul Hill, Lead Flight Director talks about the main goal of the STS-114 mission which is to demonstrate that changes to the Orbiter and flight procedures are good and the second goal is to finish construction of the International Space Station. Sergei Krikalev, Commander talks about increasing the capability of the International Space Station, Jim Kelly discusses the work that is being performed in the external tank, Andy Thomas talks about procedures done to stop foam release and Soichi Noguchi

  18. STS-114: Discovery Crew Post Landing Press Briefing (United States)


    The crew of the STS-114 Discovery is shown during a post landing press briefing. Commander Collins introduces the crew members who consist of Pilot Jim Kelley, Mission Specialist Soichi Noguchi from JAXA, Steve Robinson, Mission Specialist and Charlie Camarda, Mission Specialist. Steve Robinson answers a question from the news media about the repair that he performed in orbit, and his feelings about being back in his hometown of California. Commander Collins talks about the most significant accomplishment of the mission. The briefing ends as each crewmember reflects on the Space Shuttle Columbia tragedy and expresses their personal thoughts and feelings as they re-entered the Earth's atmosphere.

  19. Characterization of a Protease from a Psychrotroph, Pseudomonas fluorescens 114


    Hamamoto, Tetsuo; Kaneda, Motohiro; Horikoshi, Koki; Kudo, Toshiaki


    A psychrotrophic bacterium isolated from river sediment was identified as Pseudomonas fluorescens 114. It grew at 0°C and optimally at 20°C. The bacterium produced a protease with a molecular weight of 47,000, which was stable in the pH range of 5 to 9 and worked optimally between pH 6.5 and 10. Activity was optimal at 35°C and was lost immediately at 50°C and after 5 min at 45°C. At 0, 10, and 20°C, 24, 38, and 57% of optimal activity were observed, respectively.

  20. Synthesis of nonstoichiometric M-type barium ferrite nanobelt by spark plasma sintering method

    Institute of Scientific and Technical Information of China (English)

    ZHAO Wenyu; ZHANG Qingjie; TANG Xinfeng; CHENG Haibin


    This study investigated the feasibility of ultrafast crystallization of M-type barium ferrite when the coprecipitation precursors in stoichiometric proportions as BaFe12O19, Fe(OH)3 and BaCO3 nanoparticles, had been heated by spark plasma sintering (SPS) process. The results show that SPS method may realize the ultrafast crystallization of M-type barium ferrite, absolutely prevent the crystallization of intermediate phase α-Fe2O3, and significantly decrease the crystallization temperature of M-type barium ferrite. The sintered samples obtained at 800℃ by sintering the precursors for 10 minutes are a kind of multiphase ferrites composed of major phase M-type barium ferrite and trace amount of BaFe0.24Fe0.76O2.88. It is discovered that M-type barium ferrites in the holes of the sintered samples are in nanobelt microstructure about 100-300 nm in width and several micrometers in length. These M-type barium ferrite nanobelts are non-stoichiometric and may be expressed as BaFe12+Xo19+1.5x (-4.77≤x≤6.50). Their composistions suggest completely random Fe-rich or Ba-rich domains.

  1. Barium swallow study in routine clinical practice: a prospective study in patients with chronic cough

    Directory of Open Access Journals (Sweden)

    Carlos Shuler Nin


    Full Text Available OBJECTIVE: To assess the routine use of barium swallow study in patients with chronic cough.METHODS: Between October of 2011 and March of 2012, 95 consecutive patients submitted to chest X-ray due to chronic cough (duration > 8 weeks were included in the study. For study purposes, additional images were obtained immediately after the oral administration of 5 mL of a 5% barium sulfate suspension. Two radiologists systematically evaluated all of the images in order to identify any pathological changes. Fisher's exact test and the chi-square test for categorical data were used in the comparisons.RESULTS: The images taken immediately after barium swallow revealed significant pathological conditions that were potentially related to chronic cough in 12 (12.6% of the 95 patients. These conditions, which included diaphragmatic hiatal hernia, esophageal neoplasm, achalasia, esophageal diverticulum, and abnormal esophageal dilatation, were not detected on the images taken without contrast. After appropriate treatment, the symptoms disappeared in 11 (91.6% of the patients, whereas the treatment was ineffective in 1 (8.4%. We observed no complications related to barium swallow, such as contrast aspiration.CONCLUSIONS: Barium swallow improved the detection of significant radiographic findings related to chronic cough in 11.5% of patients. These initial findings suggest that the routine use of barium swallow can significantly increase the sensitivity of chest X-rays in the detection of chronic cough-related etiologies.

  2. Excess Barium as a Paleoproductivity Proxy: A Reevaluation (United States)

    Eagle, M.; Paytan, A.


    Marine barite may serve as a proxy to reconstruct past export production (Dymond, 1992). In most studies sedimentary barite accumulation is not measured directly, instead a parameter termed excess barium (Baexs), also referred to as biogenic barium, is used to estimate the barite content. Baexs is defined as the total Ba concentration in the sediment minus the Ba associated with terrigenous material. Baexs is calculated by normalization to a constant Ba/Al ratio, typically the average shale ratio. This application assumes that (1) all the Ba besides the fraction associated with terrigenous Al is in the form of barite (the phase related to productivity) (2) the Ba/Alshale is constant in space and time (3) all of the Al is associated with terrigenous matter. If these assumptions are invalidated however, this approach lead to significant errors in calculating export production rates. To test the validity of the use of Baexs as a proxy for barite we compared the Baexs in a wide range of core top sediments from different oceanic settings to the barite content in the same cores. We found that Baexs frequently overestimated the Ba fraction associated with barite and in several cases significant Baexs was measured in the cores where no barite was observed. We have also used a sequential leaching protocol (Collier and Edmond 1984) to determine Ba association with organic matter, carbonates, Fe-Mn hydroxides and silicates. While terrigenous Ba remains an important fraction, in our samples 25-95% of non-barite Ba was derived from other fractions, with Fe-Mn oxides contributing the most Ba. In addition we found that the Ba/Al ratio in the silicate fraction of our samples varied considerably from site to site. The above results suggest that at least two of the underlying assumptions for employing Baexs to reconstruct paleoproductivity are not always valid and previously published data from (Murray and Leinen 1993) indicate that the third assumption may also not hold in every

  3. Enthalpy of formation of (In, Gd)-doped barium cerate

    Energy Technology Data Exchange (ETDEWEB)

    Matskevich, N.I., E-mail: [Nikolaev Institute of Inorganic Chemistry, Siberian Branch of the Russian Academy of Sciences, 630090 Novosibirsk (Russian Federation); Karlsruhe Institute of Technology, Institute of Solid State Physics, D-76334 Karlsruhe (Germany); Wolf, Th. [Karlsruhe Institute of Technology, Institute of Solid State Physics, D-76334 Karlsruhe (Germany); Adelmann, P.; Semerikova, A.N.; Anyfrieva, O.I. [Nikolaev Institute of Inorganic Chemistry, Siberian Branch of the Russian Academy of Sciences, 630090 Novosibirsk (Russian Federation)


    Highlights: • BaCe{sub 0.7}Gd{sub 0.2}In{sub 0.1}O{sub 2.85} was prepared by solid-state reaction. • The standard formation enthalpy was determined. • The stabilization energy (Δ{sub st}H°) was calculated. • Δ{sub st}H° of BaCe{sub 0.7}Gd{sub 0.2}In{sub 0.1}O{sub 2.85} is higher than BaCe{sub 0.7}Nd{sub 0.2}In{sub 0.1}O{sub 2.85} and BaCeO{sub 3}. - Abstract: Solution enthalpies of barium cerate doped by gadolinium and indium and a mixture of BaCl{sub 2} + 0.7CeCl{sub 3} + 2GdCl{sub 3} + 0.1InCl{sub 3} have been measured in 1 mol dm{sup −3} HCl with 0.1 mol dm{sup −3} KI. For the first time the standard molar formation enthalpy of BaCe{sub 0.7}Gd{sub 0.2}In{sub 0.1}O{sub 2.85} has been determined by solution calorimetry as follows: Δ{sub f}H° (298.15 K) = −1615.84 ± 9.01 kJ mol{sup −1}. The stabilization energy for above-mentioned compound has been calculated as well. It has been shown that barium cerate doped gadolinium and indium has higher stabilization energy than BaCe{sub 0.7}Nd{sub 0.2}In{sub 0.1}O{sub 2.85} and BaCeO{sub 3}. The reaction enthalpy with CO{sub 2} interaction has been calculated for BaCe{sub 0.7}Gd{sub 0.2}In{sub 0.1}O{sub 2.85}.

  4. Mechanism of Phase Transformation and Formation of Barium Hexaferrite Doped with Rare-Earths in Sol-Gel Process

    Institute of Scientific and Technical Information of China (English)

    甘树才; 洪广言; 张军; 车平; 唐娟


    The phase-transformation in sol-gel preparation of barium hexaferrite and the formation of barium hexaferrite doped with La3+ were studied by chemical phase analysis, X-ray diffraction and infrared spectrometry analysis. The experimental results show that phase transformation reactions of FeCO3, Fe2O3 and BaFe2O4, barium hexaferrite and γ-Fe2O3 take place in the heat treatment of gel. While the doping lanthanide ion replace barium ion, an equivalent quantity of Fe3+ are reduced to Fe2+ to maintain the charge equilibrium.

  5. Barium oxide, calcium oxide, magnesia, and alkali oxide free glass (United States)

    Lu, Peizhen Kathy; Mahapatra, Manoj Kumar


    A glass composition consisting essentially of about 10-45 mole percent of SrO; about 35-75 mole percent SiO.sub.2; one or more compounds from the group of compounds consisting of La.sub.2O.sub.3, Al.sub.2O.sub.3, B.sub.2O.sub.3, and Ni; the La.sub.2O.sub.3 less than about 20 mole percent; the Al.sub.2O.sub.3 less than about 25 mole percent; the B.sub.2O.sub.3 less than about 15 mole percent; and the Ni less than about 5 mole percent. Preferably, the glass is substantially free of barium oxide, calcium oxide, magnesia, and alkali oxide. Preferably, the glass is used as a seal in a solid oxide fuel/electrolyzer cell (SOFC) stack. The SOFC stack comprises a plurality of SOFCs connected by one or more interconnect and manifold materials and sealed by the glass. Preferably, each SOFC comprises an anode, a cathode, and a solid electrolyte.

  6. Removal of uranyl ions from aqueous solutions using barium titanate

    International Nuclear Information System (INIS)

    Remediation of water sources contaminated with radioactive waste products is a major environmental issue that demands new and more efficient technologies. For this purpose, we report a highly efficient ion-exchange material for the removal of radioactive nuclides from aqueous solutions. The kinetic characteristics of adsorption of uranyl ions on the surface of barium titanate were investigated using a spectrophotometric method under a wide range of conditions. By controlling the pH it was possible to exert fine control over the speciation of uranium, and by optimizing the temperature and grain size of the exchanger, almost total removal was achieved in a matter of just hours. The highest efficiency (>90 % removal) was realized at high temperature (80 deg C). Moreover, the effect of competitive ion adsorption from a range of different cations and anions was quantified. Adsorption was found to follow first-order kinetics and both Freundlich and Langmuir isotherms could be applied to this system. The results of a mathematical treatment of the kinetic data combined with the observation that adsorption was independent of stirring speed and dependent on the ion-exchanger grain size, indicate that the dominant mechanism influencing adsorption is particle spreading. The adsorption behavior was not influenced by exposure to high-intensity gamma radiation, indicating potential for use of this ion-exchanger in systems containing radioactive material. These results will be of use in the development of uranium extraction systems for contaminated water sources. (author)

  7. Colonic diverticulosis: evaluation with double contrast barium enema

    International Nuclear Information System (INIS)

    To evaluate the pattern of colonic diverticulosis according to age and sex, and recent trend. The authors retrospectively reviewed 120 cases of colonic diverticulosis in 1,020 patients who had undergone a double contrast barium enema examination between January 1st, 1993, and December 31st, 1995, and analyzed the frequency, size, multiplicity and anatomical site, according to age and sex. Diverticulum size was classified into one of three groups : less than 5mm, 5-10mm, over 10mm in diameter. The overall incidence of colonic diverticulosis was 120 cases among 1,020 patients(11.8%) with an incidence 5.3 times higher in males than in females. Peak incidence was in the fifth decade, with 19 cases (15.8%) among males, and after the sixth decade, with four cases(3.3%) among females. Mean age was 57.7 years. Diverticulum size of 5-10mm in diameter was predominant (2% of cases); average diameter was 5-6mm. The incidence of colonic diverticulosis was 5.1 times more frequent in the right colon (101 cases) than in the left (20 cases). The overall incidence of colonic diverticulosis has continually increased; in addition it has also recently increased slightly in left-sided colon. This is thought to be due to various factors, both congenital and acquired, including longer life with good health care, constipation, irritable bowel syndrome, stress and the tendency of eating patterns to more closely resemble those of the west

  8. Abundance analysis of s-process enhanced barium stars (United States)

    Mahanta, Upakul; Karinkuzhi, Drisya; Goswami, Aruna; Duorah, Kalpana


    Detailed chemical composition studies of stars with enhanced abundances of neutron-capture elements can provide observational constraints for neutron-capture nucleosynthesis studies and clues for understanding their contribution to the Galactic chemical enrichment. We present abundance results from high-resolution spectral analyses of a sample of four chemically peculiar stars characterized by s-process enhancement. High-Resolution spectra (R ˜42000) of these objects spanning a wavelength range from 4000 to 6800 Å, are taken from the ELODIE archive. We have estimated the stellar atmospheric parameters, the effective temperature Teff, the surface gravity log g, and metallicity [Fe/H] from local thermodynamic equilibrium analysis using model atmospheres. We report estimates of elemental abundances for several neutron-capture elements, Sr, Y, Zr, Ba, La, Ce, Pr, Nd, Sm, Eu and Dy. While HD 49641 and HD 58368 show [Ba/Fe] ≥ 1.16 the other two objects HD 119650 and HD 191010 are found to be mild barium stars with [Ba/Fe] ˜ 0.4. The derived abundances of the elements are interpreted on the basis of existing theories for understanding their origin and evolution.

  9. Structural and magnetic properties of barium-gadolinium hexaferrites

    Energy Technology Data Exchange (ETDEWEB)

    Litsardakis, G. [Department of Electrical and Computer Engineering, Aristotle University of Thessaloniki, Thessaloniki 54124 (Greece)]. E-mail:; Manolakis, I. [Department of Electrical and Computer Engineering, Aristotle University of Thessaloniki, Thessaloniki 54124 (Greece); Serletis, C. [Department of Physics, Aristotle University of Thessaloniki, Thessaloniki 54124 (Greece); Efthimiadis, K.G. [Department of Physics, Aristotle University of Thessaloniki, Thessaloniki 54124 (Greece)


    A series of Gd-substituted M-type barium hexaferrites has been prepared by the ceramic route, according to the formula (Ba{sub 1-x}Gd{sub x})O.5.25Fe{sub 2}O{sub 3} (x=0-0.30). XRD analysis revealed that all the samples present primarily an M-type structure. Samples x=0 and x=0.05 are single-phase. Hematite (Fe{sub 2}O{sub 3}) and GdFeO{sub 3} were detected in the remaining samples. Coercivity (H{sub c}) shows remarkably high values, {approx}293kA/m for x=0.20 and 0.30 with a maximum of 322kA/m for x=0.25. Specific saturation magnetization ({sigma}{sub sat}) of the samples presents a small increase up to x=0.10. The microstructure examination indicates that Gd may act as a grain growth inhibitor.

  10. Nanoscale inhomogeneities in yttrium-barium-copper-oxide (YBCO) superconductors (United States)

    Islam, Zahirul; Sinha, S. K.; Lang, J. C.; Liu, X.; Haskel, D.; Moss, S. C.; Srajer, G.; Veal, B. W.; Wermeille, D.; Lee, D. R.; Haeffner, D. R.; Welp, U.; Wochner, P.


    X-ray diffraction studies at the Advanced Photon Source reveal that nanoscale inhomogeneities, electronic or structural in origin, form in yttrium-barium-copper-oxide (YBa_2Cu_3O_6+x) superconductors and coexist with the superconducting (SC) state. Diffuse scattering from these inhomogeneous superstructures is due to atomic displacements with respect to equilibrium lattice sites (Z. Islam et al. Phys. Rev. B 66, 92501 (2002)), that are characterized by a wavevector of the form q=(q_x,0,0), where qx varies with hole doping from 2 unit cells (along shorter Cu-O-Cu direction) for very low doping to 4 unit cells at optimal doping. Interestingly, while these superstructures are 3-dimensionally ordered when the SC state is weakened (e.g., at x=0.4), as the doping increases, they become quasi 1D with correlation lengths comparable to SC coherence lengths in these cuprates. Recent first-principles calculations (D. de Fontaine et al., to be published) for the x=0.63 compound show that atomic displacements consistent with experimental data can be the result of ordering of O vacancies in YBCO. Models for various superstructures and their role in the phase diagram will be discussed.

  11. Properties of barium strontium titanate at millimeter wave frequencies

    Energy Technology Data Exchange (ETDEWEB)

    Osman, Nurul [Department of Physics, Universiti Putra Malaysia (Malaysia); Free, Charles [Department of Engineering and Design, University of Sussex (United Kingdom)


    The trend towards using higher millimetre-wave frequencies for communication systems has created a need for accurate characterization of materials to be used at these frequencies. Barium Strontium Titanate (BST) is a ferroelectric material whose permittivity is known to change as a function of applied electric field and have found varieties of application in electronic and communication field. In this work, new data on the properties of BST characterize using the free space technique at frequencies between 145 GHz and 155 GHz for both thick film and bulk samples are presented. The measurement data provided useful information on effective permittivity and loss tangent for all the BST samples. Data on the material transmission, reflection properties as well as loss will also be presented. The outcome of the work shows through practical measurement, that BST has a high permittivity with moderate losses and the results also shows that BST has suitable properties to be used as RAM for high frequency application.

  12. Properties of barium strontium titanate at millimeter wave frequencies

    International Nuclear Information System (INIS)

    The trend towards using higher millimetre-wave frequencies for communication systems has created a need for accurate characterization of materials to be used at these frequencies. Barium Strontium Titanate (BST) is a ferroelectric material whose permittivity is known to change as a function of applied electric field and have found varieties of application in electronic and communication field. In this work, new data on the properties of BST characterize using the free space technique at frequencies between 145 GHz and 155 GHz for both thick film and bulk samples are presented. The measurement data provided useful information on effective permittivity and loss tangent for all the BST samples. Data on the material transmission, reflection properties as well as loss will also be presented. The outcome of the work shows through practical measurement, that BST has a high permittivity with moderate losses and the results also shows that BST has suitable properties to be used as RAM for high frequency application

  13. Combustion synthesis, characterization and luminescence properties of barium aluminate phosphor

    Institute of Scientific and Technical Information of China (English)

    AH Wako; FB Dejene; HC Swart


    The blue-green emitting Eu2+and Nd3+ doped polycrystalline barium aluminate (BaAl2O4:Eu2+,Nd3+) phosphor, was pre-pared by a solution-combustion method at 500 ºC without a post-annealing process. The characteristic variation in the structural and luminescence properties of the as-prepared samples was evaluated with regards to a change in the Ba/Al molar ratio from 0.1:1 to 1.4:1. The morphologies and the phase structures of the products were characterized by scanning electron microscopy (SEM), transmission electron microscopy (TEM), X-ray diffraction (XRD) and X-ray photoelectron spectroscopy (XPS), while the optical properties were investigated using ultra-violet (UV) and photoluminescence (PL) spectroscopy, respectively. The XRD and TEM results revealed that the average crystallite size of the BaAl2O4:Eu2+,Nd3+ phosphor was about 70 nm. The broad-band UV-excited luminescence of the phosphors was observed atλmax=500 nm due to transitions from the 4f65d1 to the 4f7 configuration of the Eu2+ ion. The PL results indi-cated that the main peaks in the emission and excitation spectrum of phosphor particles slightly shifted to the short wavelength due to the changes in the crystal field due to the structure changes caused by the variation in the quantity of the Ba ions in the host lattice.

  14. Colonic diverticulosis: evaluation with double contrast barium enema

    Energy Technology Data Exchange (ETDEWEB)

    Ko, Jae Kook; Lee, Jong Koo; Yun, Eun Joo; Moon, Hee Jung; Shin, Hyun Ja [Korea Veterans Hospital, Seoul (Korea, Republic of)


    To evaluate the pattern of colonic diverticulosis according to age and sex, and recent trend. The authors retrospectively reviewed 120 cases of colonic diverticulosis in 1,020 patients who had undergone a double contrast barium enema examination between January 1st, 1993, and December 31st, 1995, and analyzed the frequency, size, multiplicity and anatomical site, according to age and sex. Diverticulum size was classified into one of three groups : less than 5mm, 5-10mm, over 10mm in diameter. The overall incidence of colonic diverticulosis was 120 cases among 1,020 patients(11.8%) with an incidence 5.3 times higher in males than in females. Peak incidence was in the fifth decade, with 19 cases (15.8%) among males, and after the sixth decade, with four cases(3.3%) among females. Mean age was 57.7 years. Diverticulum size of 5-10mm in diameter was predominant (2% of cases); average diameter was 5-6mm. The incidence of colonic diverticulosis was 5.1 times more frequent in the right colon (101 cases) than in the left (20 cases). The overall incidence of colonic diverticulosis has continually increased; in addition it has also recently increased slightly in left-sided colon. This is thought to be due to various factors, both congenital and acquired, including longer life with good health care, constipation, irritable bowel syndrome, stress and the tendency of eating patterns to more closely resemble those of the west.

  15. Barium in landscape components of the western Transbaikal region (United States)

    Kashin, V. K.


    Barium concentrations in parent materials, soils, and plants of the forest-steppe, steppe, and dry steppe landscapes of the Transbaikal region have been studied. The average concentration of this element in rocks and soils of this region exceeds its clarke by 1.8-2.1 times. A positive correlation between the contents of Ba in soils, soil-forming rocks, and plants has been found. The concentration of Ba in soils does not correlate with the soil pH and humus content. Distribution patterns of Ba in the soil profiles have been characterized. With respect to the coefficient of the biological uptake by plants, Ba is assigned to the group of low accumulation (0.55-0.65) for mineral soils and of strong accumulation (6.0) for alluvial bog soils. Average concentrations of Ba in the steppe, meadow, and cultivated vegetation of the region are 1.9-2.3 times higher in comparison with the average concentration of this element in plants of the continents. The biological migration of Ba is most active in meadow landscapes, whereas steppe landscapes are characterized by the least active biological migration of this element.

  16. Abundance analysis of s-process enhanced barium stars

    CERN Document Server

    Mahanta, Upakul; Goswami, Aruna; Duorah, Kalpana


    Detailed chemical composition studies of stars with enhanced abundances of neutron-capture elements can provide observational constraints for neutron-capture nucleosynthesis studies and clues for understanding their contribution to the Galactic chemical enrichment. We present abundance results from high-resolution spectral analyses of a sample of four chemically peculiar stars characterized by s-process enhancement. High-Resolution spectra (R ~ 42000) of these objects spanning a wavelength range from 4000 to 6800 A, are taken from the ELODIE archive. We have estimated the stellar atmospheric parameters, the effective temperature T_eff, the surface gravity log g, and metallicity [Fe/H] from local thermodynamic equilibrium analysis using model atmospheres. We report estimates of elemental abundances for several neutron-capture elements, Sr, Y, Zr, Ba, La, Ce, Pr, Nd, Sm, Eu and Dy. While HD 49641 and HD 58368 show [Ba/Fe] > 1.16 the other two objects HD 119650 and HD 191010 are found to be mild barium stars wit...

  17. Gastrointestinal tract labeling for MDCT of abdomen: Comparison of low density barium and low density barium in combination with water

    Energy Technology Data Exchange (ETDEWEB)

    Gulati, Kavita; Shah, Zarine K.; Sainani, Nisha; Uppot, Raul; Sahani, Dushyant V. [Massachusetts General Hospital and Harvard Medical School, Department of Abdominal Imaging and Intervention, Boston, MA (United States)


    The purpose of the study was to compare the quality of stomach and small bowel marking/labeling using 1,350 ml of low-density barium alone (Volumen) with 900 ml of low-density barium and 450 ml of water for 16-MDCT scans of the abdomen and pelvis and assess cost benefits with the two protocols. In this IRB approved study, 80 consecutive patients scheduled for routine CECT (contrast-enhanced CT) of the abdomen-pelvis were studied. Patients were randomized into two groups and were administered either 1,350 ml of VoLumen (two bottles at 20-min intervals, one half bottle at 50 min and the last half on the table) or 900 ml of Volumen (two bottles at 20-min intervals and 450 ml water on the table). Portal venous phase scanning (detector collimation = 0.625 mm, speed = 18.75 mm, thickness = 5 mm) was subsequently performed. Images were reconstructed in axial and coronal plane at the CT console. Two blinded readers used a pre-designed template to assess distension and wall characteristics of the stomach and small bowel on a 5-point scale. Median scores with the two protocols were compared using the Wilcoxon rank sum test. The stomach and small bowel labeling was rated fair to optimal in all patients and did not differ significantly in the two protocols. The mean scores for distension of the small bowel and stomach were comparable. Inter-observer agreement for bowel labeling was found to be excellent (k 0.81). With the use of coronal images there was increased reader confidence in tracing the small bowel with both protocols. Acceptance for two bottles of Volumen and water was greater among patients as compared to three bottles of VoLumen. Use of two bottles of Volumen and water combination cost less than three bottles of Volumen. Stomach and small bowel labeling with administration of 900 ml of Volumen followed by 450 ml of water is cost effective and compares well to 1,350 ml of Volumen alone. (orig.)

  18. Customer Management System of 114 Transformation Business%114转型业务客户管理系统

    Institute of Scientific and Technical Information of China (English)

    林建华; 宋革联


    系统主要解决了政企大客户管理客户资料困难以及电信公司固话保有量下降这两大问题。该系统结合114客户资料库进行客户资料的反查,并利用168平台对每一路通话进行录音,并且具有强大的客户统计分析功能,方便了政企用户,提高了政企用户的办事效率。%This system has mainIy soIved two probIems.One is the Iarge government and enterprise customers is difficuIt to man-age customer data,the other is the China TeIecom company's fixed-Iine users continue to decIine.The system combines 114 customer database for customer information reverse Iookup and use the pIatform 168 to record each way caI .The sys-tem aIso has a strong function of cIient statisticaI anaIysis.The system greatIy faciIitates the government and enterprise users,and improve the efficiency of government and enterprise users.

  19. Skylab-barium alpha and beta L = 6 field-line tracing experiments

    International Nuclear Information System (INIS)

    Events SKYLAB-BARIUM ALPHA (27 November 1973) and BETA (4 December 1973) were shaped-charge barium field-line tracing experiments near L approximately equal to 6, conducted jointly by the Los Alamos Scientific Laboratory and the University of Alaska Geophysical Institute. Image-orthicon and pulsed intensified auroral cameras provided data for triangulating the fast ion streaks. Using the POGO 10-68, epoch 1965.0, field-line model with Mead-Fairfield corrections for the outer field, the triangulated positions of the fast ion streak were projected down to the 100 km altitude northern conjugate surface. The projected positions moved toward magnetic east with a velocity of 725 m/sec for both SKYLAB-BARIUM ALPHA and BETA. Assuming only an E x B/B2 force, this drift velocity is consistent with an electric field toward magnetic south of 39 mV/m. Radiometric analysis of the filtered, intensified auroral camera records gave observed peak radiance values of about 2 x 10-11 watts/cm2-Sr in the 455.4 nm line of Ba+. The barium in the portion of the ion streak for which radiometric data were obtained had initial injection velocities of 9.5 to 13.5 km/sec in both events. This portion of the ion streak for both SKYLAB-BARIUM ALPHA and BETA contained approximately 4 x 1023 ions compared to the 6.4 x 1024 atoms contained in the barium liner. Ion inventory estimates are based on a solution of the statistical equilibrium equations. Corrections have been made in the ion inventory calculations for Doppler shifts of the solar spectrum as received in the rest frame of the high-velocity barium ions

  20. Accelerating the transit time of barium sulphate suspensions in small bowel examinations

    International Nuclear Information System (INIS)

    Purpose: To determine whether hyperosmolar and effervescent agents proven individually to accelerate transit time in the barium small bowel examination have an additive effect when combined, surpassing that of either agent alone. Materials and methods: One hundred and forty-nine patients were randomised to four groups. Three hundred milliliters of barium sulphate alone was given to the first group. Fifteen milliliters of iodinated hyperosmolar contrast agent (Gastrografin, meglumine/sodium diatrizoate, Schering) was given in addition to barium sulphate to the second group while six packets of effervescent granules (Carbex, Ferring) were added for the third group. The final group was given a combination of both additives and barium sulphate. The time taken following ingestion for the contrast column to reach the caecum, as assessed by frequent interval fluoroscopy, was recorded. A subgroup of 32 patients were selected randomly from the four groups, 8 from each and assessed for quality of examination. Statistical assessments were made using Kruskal-Wallis and Mann-Whitney tests. Results: One hundred and nineteen patients were analysed after exclusions. The addition of accelerant to barium sulphate, both individually and in combination significantly reduced the small bowel transit time (p < 0.001). No significant difference existed between the additives when used with barium alone. The combined group had significantly faster transit times compared to the hyperosmolar group (p = 0.02). Differences between combined and effervescent groups tended towards significance (p = 0.09). No significant difference existed between groups when examination quality was assessed. Conclusion: These results suggest that the addition of combined effervescent and hyperosmolar agents to the barium suspension may significantly shorten the small bowel transit time without adversely affecting examination quality. This has implications for patient acceptability of the examination as well as

  1. An 8-year review of barium studies in the diagnosis of gastroparesis

    Energy Technology Data Exchange (ETDEWEB)

    Levin, A.A. [Department of Radiology, Hospital of University of Pennsylvania, Philadelphia, PA (United States); Levine, M.S. [Department of Radiology, Hospital of University of Pennsylvania, Philadelphia, PA (United States)], E-mail:; Rubesin, S.E.; Laufer, I. [Department of Radiology, Hospital of University of Pennsylvania, Philadelphia, PA (United States)


    Aim: To determine the utility of barium studies for diagnosing gastroparesis in patients with nausea, vomiting, or other related symptoms. Materials and methods: Radiology files revealed gastroparesis without gastric outlet obstruction on upper gastrointestinal tract barium studies in 50 patients with nausea, vomiting, and other related symptoms. Original reports and images were reviewed to determine whether gastric peristalsis was decreased/absent and to investigate gastric dilatation, fluid or debris, and delayed emptying of barium. Twenty patients (40%) had nuclear gastric emptying studies. Medical records were reviewed to determine the presentation, treatment, and course. The diagnosis of gastroparesis was considered accurate if patients with gastroparesis on barium studies responded to treatment. Results: Forty-six patients (92%) had predisposing factors for gastroparesis, including narcotics and diabetes. Forty-five patients (90%) presented with nausea or vomiting, and 40 patients (80%) had one or more other symptoms, including bloating, early satiety, postprandial fullness, and abdominal pain. Barium studies revealed decreased gastric peristalsis in 46 (92%) of the 50 patients and absent peristalsis in four (8%); 46 patients (92%) had additional findings, including gastric dilatation in 30 (60%), delayed emptying of barium in 27 (54%), debris in 28 (56%; bezoars in three), and retained fluid in 13 (26%). Thirteen (65%) of 20 patients with nuclear gastric emptying studies had delayed emptying of solids and seven (35%) had normal emptying. Thirty-five (83%) of 42 patients treated for gastroparesis had symptomatic improvement versus two (25%) of eight patients not treated. Conclusion: Patients with nausea, vomiting, or other related symptoms who have gastroparesis without gastric outlet obstruction on barium studies can be treated for this condition on the basis of the clinical and radiographic findings.

  2. Preparation and properties of yttria doped tetragonal zirconia polycrystal/Sr-doped barium hexaferrite ceramic composites

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Shanshan; Zhang, Chao; Guo, Ruisong, E-mail:; Liu, Lan; Yang, Yuexia; Li, Kehang


    Highlights: • The 3Y-TZP/Sr-doped barium ferrite composites were prepared. • The saturation magnetization was improved by 15% with Sr-doping. • The dispersion coefficient p could reflect the microscopic lattice variation. • The composite with x = 0.5 had the maximum fracture toughness of 8.3 MPa m{sup 1/2}. - Abstract: The effects of substitution of Ba{sup 2+} by Sr{sup 2+} on the magnetic property of barium ferrite and addition barium ferrite secondary phase to the 3 mol% yttria-doped tetragonal zirconia polycrystal (3Y-TZP) matrix on the mechanical property of composites were investigated. The Sr-doped barium ferrite (Ba{sub 1−x}Sr{sub x}Fe{sub 12}O{sub 19}, x = 0, 0.25, 0.50 and 0.75) was synthesized by solid-state reaction in advance. Then 3Y-TZP/20 wt% Sr-doped barium ferrite composites were prepared by means of conventional ceramic method. It was found that a moderate amount of Sr added to barium ferrite could boost the saturation magnetization by 15% compared with the composites without Sr-doping. Besides, the composite with x = 0.50 possessed the best mechanical properties, such as 11.5 GPa for Vickers hardness and 8.3 MPa m{sup 1/2} for fracture toughness, respectively. It was demonstrated that magnetic and mechanical properties of the composites could be harmonized by the incorporation of barium ferrite secondary phase.

  3. Obtaining of a barium compound by combustion chemistry and their evaluation as Co adsorbent

    International Nuclear Information System (INIS)

    In this work, barium carbonate synthesized by chemical combustion method using a chemical precursor prepared by the combination of barium nitrate and urea as a fuel, with a 1:1 molar ratio in aqueous solution, the chemical precursor was heated to evaporate excess water, producing a homogeneous viscous liquid, that when heated to 900 centi grades for 5 minutes an exothermic reaction was produced very quickly and abruptly, forming a white powder final product, fine porous, little spongy, dry and crystalline ready to be used as material adsorbent. Additionally, the effect of water on the synthesis by chemical combustion was studied. Simultaneously, and with the purpose of comparing the advantages and disadvantages of the method by chemical combustion, barium carbonate was synthesized by precipitation method using barium nitrate salts and sodium carbonate. Synthesized barium carbonate, was characterized by X-ray diffraction, thermal gravimetric analysis, infrared spectrometry and scanning electron microscopy. We studied the adsorption capacity of Co present in aqueous solution by static tests on materials synthesized at room temperature using the neutron activation analysis. It was found that the synthesis by chemical combustion provides an interesting alternative compared to the synthesis by precipitation because it offers simplicity of synthesis and speed to have a good adsorbent material. It was found that the barium carbonate synthesized by the chemical combustion method using in their synthesis 1.0 ml of water, was the one who achieved the maximum adsorption capacity of 95.6% compared with the barium carbonate prepared by precipitation, which reached a capacity adsorption of 51.48%. (Author)

  4. 氯化钡除杂制取高纯氢氧化钡%Preparation of high purity barium hydroxide by impurity - removed barium chloride

    Institute of Scientific and Technical Information of China (English)

    翁贤芬; 毛逢银; 何琳; 李莉


    Removal technology of strontium and iron from crude barium chloride raw material were studied.Optimization of process conditions of strontium and iron removal were discussed.When crude barium chloride stiring and dissolving the mixture at 60 ℃ for 40 min,impurities of stromtium and calcuim can be removed and mass fraction of strontium in the obatined solid barium chloride was below 1×10-4.Then add oxydol (H2O2) at proportion of 100 g raw materials per 8 mL H2O2,and add active carbon and small quantity of sodium hydroxide.Finally,iron could be get rid of when pH was controlled below 10.Mass fraction of iron in barium hydroxide product was less than 1×10-5 when using the iron - removed barium chaloride as raw material.Therefore,purified barium chloride by this method can be used to produce purity barium hydroxide.%研究了粗氯化钡原料中锶和铁杂质的脱除工艺,探讨了脱除锶和铁的优化工艺条件.在粗氯化钡原料中加入去离子水,液固质量比为0.25: 1,在60 ℃下搅拌溶解40 min,可除去锶和钙杂质,所得氯化钡固体中锶质量分数低于1×10-4.在氯化钡溶液中加入双氧水,每100 g原料中加入双氧水8 mL,加入活性炭和少量氢氧化钠,控制pH低于10时,可除去铁杂质,用除铁后的氯化钡制取氢氧化钡,产品中铁质量分数低于1×10-5.用除杂后的氯化钡可制得高纯氢氧化钡.

  5. Spectroscopic (multi-energy) CT distinguishes iodine and barium contrast material in MICE

    International Nuclear Information System (INIS)

    Spectral CT differs from dual-energy CT by using a conventional X-ray tube and a photon-counting detector. We wished to produce 3D spectroscopic images of mice that distinguished calcium, iodine and barium. We developed a desktop spectral CT, dubbed MARS, based around the Medipix2 photon-counting energy-discriminating detector. The single conventional X-ray tube operated at constant voltage (75 kVp) and constant current (150 μA). We anaesthetised with ketamine six black mice (C57BL/6). We introduced iodinated contrast material and barium sulphate into the vascular system, alimentary tract and respiratory tract as we euthanised them. The mice were preserved in resin and imaged at four detector energy levels from 12 keV to 42 keV to include the K-edges of iodine (33.0 keV) and barium (37.4 keV). Principal component analysis was applied to reconstructed images to identify components with independent energy response, then displayed in 2D and 3D. Iodinated and barium contrast material was spectrally distinct from soft tissue and bone in all six mice. Calcium, iodine and barium were displayed as separate channels on 3D colour images at <55 μm isotropic voxels. Spectral CT distinguishes contrast agents with K-edges only 4 keV apart. Multi-contrast imaging and molecular CT are potential future applications. (orig.)

  6. SALT reveals the barium central star of the planetary nebula Hen 2-39

    CERN Document Server

    Miszalski, B; Jones, D; Karakas, A I; Köppen, J; Tyndall, A A; Mohamed, S S; Rodríguez-Gil, P; Santander-García, M


    Classical barium stars are binary systems which consist of a late-type giant enriched in carbon and slow neutron capture (s-process) elements and an evolved white dwarf (WD) that is invisible at optical wavelengths. The youngest observed barium stars are surrounded by planetary nebulae (PNe), ejected soon after the wind accretion of polluted material when the WD was in its preceeding asymptotic giant branch (AGB) phase. Such systems are rare but powerful laboratories for studying AGB nucleosynthesis as we can measure the chemical abundances of both the polluted star and the nebula ejected by the polluter. Here we present evidence for a barium star in the PN Hen 2-39. The polluted giant is very similar to that found in WeBo 1. It is a cool (Teff=4250 +/- 150 K) giant enhanced in carbon ([C/H]=0.42 +/- 0.02 dex) and barium ([Ba/Fe]=1.50 +/- 0.25 dex). A spectral type of C-R3 C_24 nominally places Hen 2-39 amongst the peculiar early R-type carbon stars, however the barium enhancement and likely binary status mea...

  7. Determination of barium in surface and ground waters at Centro Experimental Aramar area

    Energy Technology Data Exchange (ETDEWEB)

    Matoso, Erika, E-mail: [Centro Tecnologico da Marinha em Sao Paulo (CEA/CTMS), Ipero, SP (Brazil). Centro Experimental Aramar; Cadore, Solange, E-mail: [Universidade Estadual de Campinas (UNICAMP), SP (Brazil). Instituto de Quimica. Departamento de Quimica Analica


    Barium can be found in waters up to 1 mg L{sup -1} and came from natural sources such as sedimentary rocks erosion rich in feldspar and barite. Also anthropogenic activities can release this element such as oil and gas industry, agricultural defensives, chemical industry and waste disposal. At high doses, barium can be harmful to human central nervous system and can also cause high blood pressure, heart problems, fatigue and anxiety. The water potability defined by Brazilian's Ministry of Healthy sets barium concentration up to 0.7 mg L{sup -1} and official regulation defines the same limit of this element to superficial waters (according CONAMA resolution 357/2005) and ground waters (Sao Paulo state regulation). In this work, barium was analyzed monthly in superficial waters from 4 different sampling locations, located in a ratio of 10-km-long from Centro Experimental Aramar (CEA) at Ipanema River, during one year, in order to evaluate the river in different conditions (seasons, temperature and rain period). The ground water was collected every six months. The analytical technique applied was ICP OES and the method conditions were optimized: wavelength, linearity, signal background ratio, detection and quantification limits. Data obtained in this work will contribute to evaluate the presence of barium at CEA region and nearby in order to compare it with current Brazilian regulations. (author)

  8. Spectroscopic (multi-energy) CT distinguishes iodine and barium contrast material in MICE

    Energy Technology Data Exchange (ETDEWEB)

    Anderson, N.G. [University of Otago, Department of Radiology, Christchurch (New Zealand); Butler, A.P. [University of Otago, Department of Radiology, Christchurch (New Zealand); University of Canterbury, Physics and Astronomy, Christchurch (New Zealand); Scott, N.J.A. [University of Otago, Department of Medicine, Christchurch (New Zealand); Cook, N.J. [Christchurch Hospital, Medical Physics and Bioengineering, Christchurch (New Zealand); Butzer, J.S. [Karlsruhe Institute of Technology, Physics Department, Karlsruhe (Germany); Schleich, N. [University of Canterbury, Physics and Astronomy, Christchurch (New Zealand); Christchurch Hospital, Medical Physics and Bioengineering, Christchurch (New Zealand); Firsching, M. [Friedrich Alexander University, Physics Department, Erlangen (Germany); Grasset, R.; Ruiter, N. de [University of Canterbury, Hitlab NZ, Christchurch (New Zealand); Campbell, M. [European Organisation for Nuclear Research, Physics Section, Geneva (Switzerland); Butler, P.H. [University of Canterbury, Physics and Astronomy, Christchurch (New Zealand)


    Spectral CT differs from dual-energy CT by using a conventional X-ray tube and a photon-counting detector. We wished to produce 3D spectroscopic images of mice that distinguished calcium, iodine and barium. We developed a desktop spectral CT, dubbed MARS, based around the Medipix2 photon-counting energy-discriminating detector. The single conventional X-ray tube operated at constant voltage (75 kVp) and constant current (150 {mu}A). We anaesthetised with ketamine six black mice (C57BL/6). We introduced iodinated contrast material and barium sulphate into the vascular system, alimentary tract and respiratory tract as we euthanised them. The mice were preserved in resin and imaged at four detector energy levels from 12 keV to 42 keV to include the K-edges of iodine (33.0 keV) and barium (37.4 keV). Principal component analysis was applied to reconstructed images to identify components with independent energy response, then displayed in 2D and 3D. Iodinated and barium contrast material was spectrally distinct from soft tissue and bone in all six mice. Calcium, iodine and barium were displayed as separate channels on 3D colour images at <55 {mu}m isotropic voxels. Spectral CT distinguishes contrast agents with K-edges only 4 keV apart. Multi-contrast imaging and molecular CT are potential future applications. (orig.)

  9. High pressure–low temperature phase diagram of barium: Simplicity versus complexity

    Energy Technology Data Exchange (ETDEWEB)

    Desgreniers, Serge [Laboratoire de Physique des Solides Denses, Université d' Ottawa, Ottawa, Ontario K1N 6N5 (Canada); Tse, John S., E-mail: [Department of Physics and Engineering Physics, University of Saskatchewan, Saskatoon, Saskatchewan S7N 5B2 (Canada); State Key Laboratory of Superhard Materials, Jilin University, 130012 Changchun (China); Matsuoka, Takahiro [SPring-8/JASRI, 1-1-1 Kouto, Sayo-cho, Sayo-gun, Hyogo 679-5198 (Japan); Department of Electrical, Electronic and Computer Engineering, Gifu University, 1-1 Yanagido, Gifu 501-1193 (Japan); Ohishi, Yasuo [SPring-8/JASRI, 1-1-1 Kouto, Sayo-cho, Sayo-gun, Hyogo 679-5198 (Japan); Li, Quan; Ma, Yanming [State Key Laboratory of Superhard Materials, Jilin University, 130012 Changchun (China)


    Barium holds a distinctive position among all elements studied upon densification. Indeed, it was the first example shown to violate the long-standing notion that high compression of simple metals should preserve or yield close-packed structures. From modest pressure conditions at room temperature, barium transforms at higher pressures from its simple structures to the extraordinarily complex atomic arrangements of the incommensurate and self-hosting Ba-IV phases. By a detailed mapping of the pressure/temperature structures of barium, we demonstrate the existence of another crystalline arrangement of barium, Ba-VI, at low temperature and high pressure. The simple structure of Ba-VI is unlike that of complex Ba-IV, the phase encountered in a similar pressure range at room temperature. First-principles calculations predict Ba-VI to be stable at high pressure and superconductive. The results illustrate the complexity of the low temperature-high pressure phase diagram of barium and the significant effect of temperature on structural phase transformations.


    International Nuclear Information System (INIS)

    Barium II (Ba) stars are chemically peculiar F-, G-, and K-type objects that show enhanced abundances of s-process elements. Since s-process nucleosynthesis is unlikely to take place in stars prior to the advanced asymptotic giant branch (AGB) stage, the prevailing hypothesis is that each present Ba star was contaminated by an AGB companion which is now a white dwarf (WD). Unless the initial mass ratio of such a binary was fairly close to unity, the receiving star is thus at least as likely to be a dwarf as a giant. So although most known Ba stars appear to be giants, the hypothesis requires that Ba dwarfs be comparably plentiful and moreover that they should all have WD companions. However, despite dedicated searches with the IUE satellite, no WD companions have been directly detected to date among the classical Ba dwarfs, even though some 90% of those stars are spectroscopic binaries, so the contamination hypothesis is therefore presently in some jeopardy. In this paper, we analyze recent deep, near-UV and far-UV Galaxy Evolution Explorer (GALEX) exposures of four of the brightest of the class (HD 2454, 15360, 26367, and 221531), together with archived GALEX data for two newly recognized Ba dwarfs: HD 34654 and HD 114520 (which also prove to be spectroscopic binaries). The GALEX observations of the Ba dwarfs as a group show a significant far-UV excess compared to a control sample of normal F-type dwarfs. We suggest that this ensemble far-UV excess constitutes the first direct evidence that Ba dwarfs have WD companions.

  11. Radiation doses to children during modified barium swallow studies

    International Nuclear Information System (INIS)

    There are minimal data on radiation doses to infants and children undergoing a modified barium swallow (MBS) study. To document screening times, dose area product (DAP) and effective doses to children undergoing MBS and to determine factors associated with increased screening times and effective dose. Fluoroscopic data (screening time, DAP, kVp) for 90 consecutive MBS studies using pulse fluoroscopy were prospectively recorded; effective dose was calculated and data were analyzed for effects of behavior, number of swallow presentations, swallowing dysfunction and medical problems. Mean effective dose for the entire group was 0.0826 ± 0.0544 mSv, screening time 2.48 ± 0.81 min, and DAP 28.79 ± 41.72 cGy cm2. Significant differences were found across three age groups (≤1.0, >1.0-3.0 and >3.0 years) for effective dose (mean 0.1188, 0.0651 and 0.0529 mSv, respectively; P < 0.001), but not for screening time or DAP. Effective dose was correlated with screening time (P 0.007), DAP (P < 0.001), number of swallow presentations (P = 0.007), lower age (P = 0.017), female gender (P = 0.004), and height (P < 0.001). Screening time was correlated with total number of swallow presentations (P < 0.001) and DAP (P < 0.001). Screening times, DAP, effective dose, and child and procedural factors associated with higher effective doses are presented for children undergoing MBS studies. (orig.)

  12. Radiation doses to children during modified barium swallow studies

    Energy Technology Data Exchange (ETDEWEB)

    Weir, Kelly A. [University of Queensland, Discipline of Paediatrics and Child Health, School of Medicine, Herston, Queensland (Australia); McMahon, Sandra M. [SpeechNet Speech Pathology Services, Brisbane (Australia); Long, Gillian; Bunch, Judith A. [Royal Children' s Hospital, Department of Medical Imaging, Herston (Australia); Pandeya, Nirmala [Queensland Institute of Medical Research, Herston (Australia); Coakley, Kerry S. [Biomedical Technology Services, Royal Brisbane and Women' s Hospital, Herston (Australia); Chang, Anne B. [Royal Children' s Hospital, Department of Respiratory Medicine, Herston (Australia)


    There are minimal data on radiation doses to infants and children undergoing a modified barium swallow (MBS) study. To document screening times, dose area product (DAP) and effective doses to children undergoing MBS and to determine factors associated with increased screening times and effective dose. Fluoroscopic data (screening time, DAP, kVp) for 90 consecutive MBS studies using pulse fluoroscopy were prospectively recorded; effective dose was calculated and data were analyzed for effects of behavior, number of swallow presentations, swallowing dysfunction and medical problems. Mean effective dose for the entire group was 0.0826 {+-} 0.0544 mSv, screening time 2.48 {+-} 0.81 min, and DAP 28.79 {+-} 41.72 cGy cm{sup 2}. Significant differences were found across three age groups ({<=}1.0, >1.0-3.0 and >3.0 years) for effective dose (mean 0.1188, 0.0651 and 0.0529 mSv, respectively; P < 0.001), but not for screening time or DAP. Effective dose was correlated with screening time (P = 0.007), DAP (P < 0.001), number of swallow presentations (P = 0.007), lower age (P = 0.017), female gender (P = 0.004), and height (P < 0.001). Screening time was correlated with total number of swallow presentations (P < 0.001) and DAP (P < 0.001). Screening times, DAP, effective dose, and child and procedural factors associated with higher effective doses are presented for children undergoing MBS studies. (orig.)

  13. Sputtered Modified Barium Titanate for Thin-Film Capacitor Applications

    Directory of Open Access Journals (Sweden)

    Robert Mamazza


    Full Text Available New apparatus and a new process for the sputter deposition of modified barium titanate thin-films were developed. Films were deposited at temperatures up to 900 °C from a Ba0.96Ca0.04Ti0.82Zr0.18O3 (BCZTO target directly onto Si, Ni and Pt surfaces and characterized by X-ray diffraction (XRD, scanning electron microscopy (SEM and X-ray photoelectron spectroscopy (XPS. Film texture and crystallinity were found to depend on both deposition temperature and substrate: above 600 °C, the as-deposited films consisted of well-facetted crystallites with the cubic perovskite structure. A strongly textured Pt (111 underlayer enhanced the (001 orientation of BCZTO films deposited at 900 °C, 10 mtorr pressure and 10% oxygen in argon. Similar films deposited onto a Pt (111 textured film at 700 °C and directly onto (100 Si wafers showed relatively larger (011 and diminished intensity (00ℓ diffraction peaks. Sputter ambients containing oxygen caused the Ni underlayers to oxidize even at 700 °C: Raising the process temperature produced more diffraction peaks of NiO with increased intensities. Thin-film capacitors were fabricated using ~500 nm thick BCZTO dielectrics and both Pt and Ni top and bottom electrodes. Small signal capacitance measurements were carried out to determine capacitance and parallel resistance at low frequencies and from these data, the relative permittivity (er and resistivity (r of the dielectric films were calculated; values ranged from ~50 to >2,000, and from ~104 to ~1010 Ω∙cm, respectively.

  14. Use of the barium enema in the diagnosis of necrotizing enterocolitis

    Energy Technology Data Exchange (ETDEWEB)

    Uken, P.; Smith, W.; Franken, E.A.; Frey, E.; Sato, Y.; Ellerbroek, C.


    Necrotizing enterocolitis (NEC) is associated with considerable morbidity and mortality in infants. The diagnosis relies heavily upon radiographic and clinical features. Failure to accurately diagnose NEC is associated with a risk of complications and death, however overdiagnosis also causes both morbidity and mortality as well as excessive medical costs. This report documents the use of barium enema to evaluate suspected clinical or radiographic NEC in 31 premature infants with ambiguous clinical and radiographic signs. The enema was normal in 26 infants and no treatment for NEC was given. Only one of these infants developed signs of NEC subsequent to the examination. Five infants had radiographic evidence of colitis including small ulcerations, spasm, intramural extravasation of barium and mucosal irregularity. Two of the five positive cases are pathologically documented. The barium enema can represent a significant improvement in the specificity of the diagnosis of NEC. Its greatest value is in the exclusion of NEC in ambiguous cases.

  15. Highly aligned arrays of high aspect ratio barium titanate nanowires via hydrothermal synthesis

    International Nuclear Information System (INIS)

    We report on the development of a hydrothermal synthesis procedure that results in the growth of highly aligned arrays of high aspect ratio barium titanate nanowires. Using a multiple step, scalable hydrothermal reaction, a textured titanium dioxide film is deposited on titanium foil upon which highly aligned nanowires are grown via homoepitaxy and converted to barium titanate. Scanning electron microscope images clearly illustrate the effect the textured film has on the degree of orientation of the nanowires. The alignment of nanowires is quantified by calculating the Herman's Orientation Factor, which reveals a 58% improvement in orientation as compared to growth in the absence of the textured film. The ferroelectric properties of barium titanate combined with the development of this scalable growth procedure provide a powerful route towards increasing the efficiency and performance of nanowire-based devices in future real-world applications such as sensing and power harvesting

  16. TiO2 ceramic varistor modified with tantalum and barium

    International Nuclear Information System (INIS)

    The non-linear current (I)-voltage (V) characteristics of titanium dioxide doped with small quantities of tantalum and barium (99.9 TiO2 + 0.1 Ta and 99.4 TiO2 + 0.1 Ta + 0.5 Ba, all are in at.%) were investigated. These samples have the non-linear coefficient (α) values of (20-30) with high breakdown voltages (E B ∼ 400-700 V mm-1). The pentavalent tantalum acts as donor and increases the electronic conductivity. The higher electrical conductivity and decrease in the breakdown field strength with barium addition is attributed to higher density. The acceptor like surface states formed by barium ions segregate to grain boundaries due size misfit to thereby modifying the electrical barrier characteristics of grain boundaries

  17. Improved thermal stability and wettability behavior of thermoplastic polyurethane / barium metaborate composites

    Energy Technology Data Exchange (ETDEWEB)

    Baştürka, Emre; Madakbaş, Seyfullah; Kahraman, Memet Vezir, E-mail: [Department of Chemistry, Marmara University, Istanbul (Turkey)


    In this paper, it was targeted to the enhance thermal stability and wettability behavior of thermoplastic polyurethane (TPU) by adding barium metaborate. TPU-Barium metaborate composites were prepared by adding various proportions of barium metaborate to TPU. The chemical structures of the composites were characterised by fourier transform infrared spectroscopy (FTIR) and X-ray diffraction (XRD) analysis. All prepared composites have extremely high Tg and thermal stability as determined from DSC and TGA analysis. All composite materials have the Tg ranging from 15 to 35 °C. The surface morphologies of the composites were investigated by a scanning electron microscopy. Mechanical properties of the samples were characterized with stress-strain test. Hydrophobicity of the samples was determined by the contact angle measurements. The obtained results proved that thermal, hydrophobic and mechanical properties were improved. (author)

  18. Improved thermal stability and wettability behavior of thermoplastic polyurethane / barium metaborate composites

    International Nuclear Information System (INIS)

    In this paper, it was targeted to the enhance thermal stability and wettability behavior of thermoplastic polyurethane (TPU) by adding barium metaborate. TPU-Barium metaborate composites were prepared by adding various proportions of barium metaborate to TPU. The chemical structures of the composites were characterised by fourier transform infrared spectroscopy (FTIR) and X-ray diffraction (XRD) analysis. All prepared composites have extremely high Tg and thermal stability as determined from DSC and TGA analysis. All composite materials have the Tg ranging from 15 to 35 °C. The surface morphologies of the composites were investigated by a scanning electron microscopy. Mechanical properties of the samples were characterized with stress-strain test. Hydrophobicity of the samples was determined by the contact angle measurements. The obtained results proved that thermal, hydrophobic and mechanical properties were improved. (author)

  19. Plasma irregularities caused by cycloid bunching of the CRRES G-2 barium release (United States)

    Bernhardt, P. A.; Huba, J. D.; Pongratz, M. B.; Simons, D. J.; Wolcott, J. H.


    The Combined Release and Radiation Effects Satellite (CRRES) spacecraft carried a number of barium thermite canisters for release into the upper atmosphere. The barium release labeled G-2 showed evidence of curved irregularities not aligned with the ambient magnetic field B. The newly discovered curved structures can be explained by a process called cycloid bunching. Cycloid bunching occurs when plasma is created by photoionization of a neutral cloud injected at high velocity perpendicular to B. If the injection velocity is much larger than the expansion speed of the cloud, the ion trail will form a cycloid that has irregularities spaced by the product of the perpendicular injection speed and the ion gyroperiod, Images of the solar-illuminated barium ions are compared with the results of a three-dimensional kinetic simulation. Cycloid bunching is shown to be responsible for the rapid generation of both curved and field-aligned irregularities in the CRRES G-2 experiment.

  20. Unexpected finding of barium sulphate on the surface of a microspinal catheter

    International Nuclear Information System (INIS)

    During a study with a scanning electron microscope to evaluate the structure of microspinal catheter after its removal from subarachnoid space, we found an unusual case. The observation with the microscope of the tip of a catheter removed at the end of an operation for hip replacement in a old female showed the presence of grounded particles with a crystal shape covering the outer surface. Further analysis of this material with an Energy-Dispersive Spectrometer (EDS) showed that it was barium. The patient performed a large bowel barium enema 8 months earlier for a painful syndrome to the lower abdomen. Authors rule out the contamination from the skin and suggest two possible mechanisms of passage of barium from blood to cerebrospinal fluid (CSF) and so to the surface of the catheter

  1. Barium sulphate preparations for use in double contrast examination of the upper gastrointestinal tract

    International Nuclear Information System (INIS)

    Physical properties relevant to upper gastrointestinal radiology have been compared for five barium sulphate preparations and related to radiographic results. Evaluation of particles (size and stability) and whole suspension (dispersibility and fluidity) resulted in ranking of the preparations generally in accord with that based on radiological experience in double contrast examinations of the stomach. Experiments with extirpated pig stomach revealed a tendency for large particles in a low viscosity barium sulphate suspension to settle in mucosal grooves. This is believed to contribute to good radiographic definition of both the areae gastricae and small lesions. Particle size is therefore important and susceptibility to flocculation, a possible cause of random change in size during use, was assessed by measuring particle electrophoretic mobility under varying conditions; quantitative differences in suspension flow and dispersibility were also demonstrated. Fluidity and dispersibility together with rapid sedimentation of suitably sized particles resistant to flocculation underlie the successful use of low viscosity high density barium sulphate suspensions. (U.K.)

  2. Barium and strontium sulfate solid solution formation in relation to North Sea scaling problems

    International Nuclear Information System (INIS)

    This paper presents the results of laboratory experiments carried out to investigate barium sulphate and strontium sulphate solid solution formation in multi-pressure tapped cores. Two brines, one barium and strontium rich and the other sulphate rich, were mixed in a core plug. Pressure differentials were measured and the changing permeability distribution along the length of the core calculated. The morphology and chemical analysis of scaling crystals are presented based on Scanning electron Microsocpy (SEM) and Energy Dispersive X-ray Analysis (EDAX). The results show the large extent of permeability damage caused by (Ba, SR) SO/sub 4/ solid solution depositing on the rock pore surface. The rock permeability decline and morphology and size of the scaling crystals indicate the influence of the supersaturations of BaSO/sub 4/ and SrSO/sub 4/ as well as the concentration ratio of barium ions to strontium ions

  3. Therapeutic barium enema for bleeding colonic diverticula:Four case series and review of the literature

    Institute of Scientific and Technical Information of China (English)

    Jun-ichi Iwamoto; Yuji Mizokami; Koichi Shimokobe; Takeshi Matsuoka; Yasushi Matsuzaki


    The prevalence of diverticular diseases of the colon, including severe and persistent bleeding in Eastern countries, has increased in the last decades. The bleeding from colonic diverticula is the most common cause of acute lower gastrointestinal bleeding. Herein, we report four cases of severe and persistent bleeding of colonic diverticular disease that could be treated with a high concentration barium enema. These four cases showed a similar pattern of bleeding whose source could not be identified. Colonoscopy revealed fresh blood in the entire colon and many diverticula were noted throughout the colon. No active bleeding source was identified, but large adherent clots in some diverticula were noted. After endoscopic and angiographic therapies failed, therapeutic barium enema stopped the severe bleeding. These patients remained free of re-bleeding in the follow-up period (range 17-35 mo) after the therapy. We report the four case series of therapeutic barium enema and reviewed the literature pertinent to this procedure.

  4. Individual-specific transgenerational marking of fish populations based on a barium dual-isotope procedure. (United States)

    Huelga-Suarez, Gonzalo; Moldovan, Mariella; Garcia-Valiente, America; Garcia-Vazquez, Eva; Alonso, J Ignacio Garcia


    The present study focuses on the development and evaluation of an individual-specific transgenerational marking procedure using two enriched barium isotopes, (135)Ba and (137)Ba, mixed at a given and selectable molar ratio. The method is based on the deconvolution of the isotope patterns found in the sample into four molar contribution factors: natural xenon (Xe nat), natural barium (Ba nat), Ba135, and Ba137. The ratio of molar contributions between Ba137 and Ba135 is constant and independent of the contribution of natural barium in the sample. This procedure was tested in brown trout ( Salmo trutta ) kept in captivity. Trout were injected with three different Ba137/Ba135 isotopic signatures ca. 7 months and 7 days before spawning to compare the efficiency of the marking procedure at long and short term, respectively. The barium isotopic profiles were measured in the offspring by means of inductively coupled plasma mass spectrometry. Each of the three different isotopic signatures was unequivocally identified in the offspring in both whole eggs and larvae. For 9 month old offspring, the characteristic barium isotope signatures could also be detected in the otoliths even in the presence of a high and variable amount of barium of natural isotope abundance. In conclusion, it can be stated that the proposed dual-isotope marking is inheritable and can be detected after both long-term and short-term marking. Furthermore, the dual-isotope marking can be made individual-specific, so that it allows identification of offspring from a single individual or a group of individuals within a given fish group.

  5. Barium hydrogen phosphate/gelatin composites versus gelatin-free barium hydrogen phosphate: synthesis and characterization of properties. (United States)

    Gashti, Mazeyar Parvinzadeh; Burgener, Matthias; Stir, Manuela; Hulliger, Jürg


    Recently, attention has been spent on crystal growth of phosphate compounds in gels for studying the mechanism of in vitro crystallization processes. Here, we present a gel-based approach for the synthesis of barium hydrogen phosphate (BHP) crystals using single and double diffusion techniques in gelatin. The composite crystals were compared with analytical grade BHP powder, single and polycrystalline BHP materials using Fourier transform infrared spectroscopy (FTIR), scanning electron microscopy (SEM), scanning pyroelectric microscopy (SPEM), optical microscopy (OM), thermal gravimetric analysis (TGA) and X-ray diffraction (XRD). FTIR spectra showed surface adsorption of gelatin molecules by using BHP stacked sheets due to CH2 stretching, CH2 bending and amide I vibrations are found in a gelatin content of about 2% determined by dissolution. SEM shows various crystal morphologies of the BHP/gelatin composites forming bundled micro-flakes to irregular bundled needles and spheres different from gel-free crystals. The variety in morphology depends on the ion concentration, pH of gel as well as the method of crystal growth. SPEM investigation of BHP/gelatin aggregates revealed polar domains showing alteration of the polarization. Moreover, BHP/gelatin composite crystals showed a higher thermal stability in comparison with analytical grade BHP or/and BHP single crystals due to strong interactions between gelatin and BHP. The XRD diffraction analysis demonstrated that the single and double diffusion techniques in gelatin led to the formation of orthorhombic BHP. This study demonstrates that gelatin is a useful high molecular weight biomacromolecule for controlling the crystallization of a composite material by producing a variety of morphological forms. PMID:24996024

  6. Calcium barium niobate as a functional material for broadband optical frequency conversion. (United States)

    Sheng, Yan; Chen, Xin; Lukasiewicz, Tadeusz; Swirkowicz, Marek; Koynov, Kaloian; Krolikowski, Wieslaw


    We demonstrate the application of as-grown calcium barium niobate (CBN) crystal with random-sized ferroelectric domains as a broadband frequency converter. The frequency conversion process is similar to broadband harmonic generation in commonly used strontium barium niobate (SBN) crystal, but results in higher conversion efficiency reflecting a larger effective nonlinear coefficient of the CBN crystal. We also analyzed the polarization properties of the emitted radiation and determined the ratio of d32 and d33 components of the second-order susceptibility tensor of the CBN crystal. PMID:24690779

  7. Study of the microstructural transformations of borate glass and barium metaborate crystals induced by femtosecond laser

    Institute of Scientific and Technical Information of China (English)

    Chen Bin; Yu Bing-Kun; Yan Xiao-Na; Qiu Jian-Rong; Jiang Xiong-Wei; Zhu Cong-Shan


    This paper describes the microstructural transformations of borate glass and barium metaborate crystals induced by femtosecond laser. Such structural transformations were verified by Raman spectroscopy. The borate glass is transformed into low temperature (LT) phase of barium metaborate (BaB2O4) crystals after being irradiated for 10 min by a femtosecond laser. In addition, after 20 min of irradiation, high temperature (HT) phase of BaB2O4 crystals is also produced. Further studies demonstrate that LT phase BaB2O4 crystals are formed in the HT phase BaB2O4 crystals after femtosecond laser irradiation for 10 s.

  8. Temperature-Dependent Raman Spectra and Microstructure of Barium Metaborate Crystals and Its Melts

    Institute of Scientific and Technical Information of China (English)

    尤静林; 蒋国昌; 侯怀宇; 吴永全; 陈辉; 徐匡迪


    We have measured the Raman spectra of β- and α-barium metaborate in crystal and liquid states from room temperature to 1873K, with a semiconductor laser as the laser source, coupled with a time-resolved detection system to eliminate the dense thermal emission background when temperature was considerably high.Temperature-dependent Raman spectra can clearly indicate that the phase transformation from β- to α-barium metaborate has been completed during 1273 - 1300 K. Variations of different kinds of microstructure units with temperature are identified and discussed.

  9. Synthesis, characterization and thermostability of barium β-diketonate with tetraethylenepentamine ligand

    Institute of Scientific and Technical Information of China (English)


    The metal-organic chemical vapor deposition (MOCVD) technique is a promising process for high-temperature superconductor YBa2Cu3O7-δ(YBCO) preparation. In this technique, it is a challenge to obtain barium precursors with high volatility. In addition, the purity, evaporation characteristics and thermostability of adopted precursors in the whole process would decide the quality and reproducible results of YBCO film. In the present report, the barium precursor containing 2,2,6,6-tetramethylheptane-3,5-dionate...

  10. Chemical composition of nanomodified composite binder with nano- and microsized barium silicate

    Directory of Open Access Journals (Sweden)

    KOROLEV Evgenij Valerjevich


    Full Text Available There are several possibilities to improve cement-based binders. In particular, many properties of cement stone can be enhanced by means of micro- and nanoscale modification. In a number of previous works we had shown that application of barium hydrosilicates leads to such improvement. The present article is devoted to the investigation of the chemical composition of the cement stone which is modified by means of addition of barium hydrosilicates. The modification was performed on different scales: micro- and nanoscale; the results of simultaneous multi-scale modification are also presented. The examination was carried out with help of different modern research techniques – FT IR spectroscopy, differential thermal analysis and X-ray phase analysis. Identification of the new phases and comparative quantitative assessment of their content are performed. It is found that the use of nano- and micro-sized barium hydrosilicates as additives leads to reduction of portlandite by 27...28%; by means of multi-scale modification it is possible to reduce the content of portlandite much more (by 83.3%. Due to addition of nano- and micro-sized barium-based modifiers both the amount of calcium hydrosilicates in reaction products is enlarged, and structure of the mentioned hydrosilicates is changed (the formation of a fine-grained structure of hydration products takes place. Micro-sized barium hydrosilicates are chemically active additives and promote the formation of an additional quantity of calcium hydrosilicates of type CSH (I. The use of nanoscale barium hydrosilicates promotes the formation of CSH (I and CSH (II calcium hydrosilicates, and also both riversidite and xonotlite. As a result of simultaneous application of nano- and micro-sized barium hydrosilicates the content of CSH (II increases. This can be confirmed by means of differential thermal and X-ray analysis. The amount of CSH (I, riversidite and various tobermorites is also increases. It is

  11. Physical states and properties of barium titanate films in a plane electric field (United States)

    Shirokov, V. B.; Kalinchuk, V. V.; Shakhovoi, R. A.; Yuzyuk, Yu. I.


    The influence of a plane electric field on the phase states of barium titanate thin films under the conditions of forced deformation has been studied. The field dependence of a complete set of material constants has been taken in the region of the c-phase, where polarization losses are absent. The material constants are calculated using equations of the piezoelectric effect derived by linearizing the nonlinear equations of state from the phenomenological; theory for barium titanate. It has been shown that there is a critical value of the field at which the electromechanical coupling coefficient reaches a maximum.

  12. Barium meal examination of infants under four months of age presenting with vomiting

    Energy Technology Data Exchange (ETDEWEB)

    Arthur, R.J.; Ziervogel, M.A.; Azmy, A.F.


    One hundred barium meal examinations performed on infants of less than 4 months of age are reviewed. All the infants presented with vomiting as a major symptom and the diagnosis remained in doubt following the initial clinical assessment. Fifty seven per cent of the examinations showed an abnormality of which 45% were throught to be significant. Hypertrophic pyloric stenosis was demonstrated in 23 infants. Other abnormalities included hiatus hernia, gastrooesophageal reflux, and duodenal abnormalities. The value of barium meal examinations in this group of infants is emphasised.

  13. Magnetic properties of barium ferrite dispersed within polystyrene-butadiene-styrene block copolymers. (United States)

    Chipara, M; Skomski, R; Ali, N; Hui, D; Sellmyer, D J


    Magnetic properties of nanocomposite materials obtained by dispersing barium ferrite nanoparticles within polystyrene-butadiene-styrene block copolymer, in the temperature range, 300 to 500 K are reported. The temperature dependence of the magnetization at saturation, averaged uniaxial magnetocrystalline anisotropy, and coercive field of thick films are analyzed. A "matrix effect" was noticed within the glass transition range of the hard component (polystyrene) of the polymeric matrix. The reported modifications of the magnetic properties were assigned to the competition between the magnetic and mechanical reorientation of nanoparticles within the polymeric matrix. Such modifications were not observed in barium ferrite dispersed in cement. PMID:19504902

  14. Effects of oleic acid on the high threshold barium current in seabass Dicentrarchus labrax ventricular myocytes


    Chatelier, Aurelien; Imbert, Nathalie; Zambonino, Jose-luis; McKenzie, David; Bois, P.


    The present study employed a patch clamp technique in isolated seabass ventricular myocytes to investigate the hypothesis that oleic acid (OA), a mono-unsaturated fatty acid, can exert direct effects upon whole-cell barium currents. Acute application of free OA caused a dose-dependent depression of the whole-cell barium current that was evoked by a voltage step to 0 mV from a holding potential of -80 mV. The derived 50% inhibitory concentration (IC50) was 12.49 +/- 0.27 mu mol l(-1). At a con...

  15. The structural and magnetic properties of barium ferrite powders prepared by the sol-gel method

    Institute of Scientific and Technical Information of China (English)

    Li Jie; Zhang Huai-Wu; Li Yuan-Xun; Liu Ying-Li; Ma Yan-Bing


    In this paper,M-type hexagonal barium ferrite powders are synthesized using the sol-gel method.A dried precursor heated in air is analyzed in the temperature range from 50 to 1200 ℃ using thermo-gravimetric analysis and differential scanning calorimetry. The effects of the additives and the cacinating temperature on the magnetic properties are investigated,and the results show that single-phase barium ferrite powders can be formed. After heat-treating at 950 ℃ for 4h with 3 wt% additive,the coercivity and saturation magnetization are found to be 440 Oe and 57.9 emu/g,respectively.

  16. Dielectric properties of piezoelectric 3–0 composites of lithium ferrite/barium titanate

    Indian Academy of Sciences (India)

    P Sarah; S V Suryanarayana


    Piezoelectric 3–0 composite ceramics are prepared from a mixture of barium titanate and lithium ferrite phase constituents. Dielectric properties of composites are affected by a number of parameters that include electrical properties, size, shape and amount of constituent phases. The frequency dependent measurements can provide additional insight into mechanisms controlling electrical response. Frequency dependence of dielectric constant plots of lithium ferrite/barium titanate composites will be given and the relevance of trends seen in them will be discussed. Connectivity in composites developed is studied.

  17. Features of Raman amplification in KGW and barium nitrate crystals at excitation by femtosecond pulses

    International Nuclear Information System (INIS)

    Measurements of Raman amplification in KGd(WO4)2 (KGW) and barium nitrate crystals at femtosecond excitation demonstrate spectral transformation of amplification band with change of pump parameters. The half-height amplification bandwidth of up to 45 nm (650 cm-1) what is 5 times larger than the pumping pulse spectral band 8.5 nm (130 cm-1) was observed for KGW crystal. Implementation of impulsive excitation for the low-frequency vibrations allows estimations of the dephasing times and linewidths for the 87 and 83 cm-1 Raman lines in KGW and barium nitrate

  18. CT-Guided Percutaneous Transthoracic Localization of Pulmonary Nodules Prior to Video-Assisted Thoracoscopic Surgery Using Barium Suspension

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Nyoung Keun; Park, Chang Min; Kang, Chang Hyun; Jeon, Yoon Kyung; Choo, Ji Yung; Lee, Hyun Ju; Goo, Jin Mo [Seoul National University College of Medicine, Seoul (Korea, Republic of)


    To describe our initial experience with CT-guided percutaneous barium marking for the localization of small pulmonary nodules prior to video-assisted thoracoscopic surgery (VATS). From October 2010 to April 2011, 10 consecutive patients (4 men and 6 women; mean age, 60 years) underwent CT-guided percutaneous barium marking for the localization of 10 small pulmonary nodules (mean size, 7.6 mm; range, 3-14 mm): 6 pure ground-glass nodules, 3 part-solid nodules, and 1 solid nodule. A 140% barium sulfate suspension (mean amount, 0.2 mL; range, 0.15-0.25 mL) was injected around the nodules with a 21-gauge needle. The technical details, surgical findings and pathologic features associated with barium localizations were evaluated. All nodules were marked within 3 mm (mean distance, 1.1 mm; range, 0-3 mm) from the barium ball (mean diameter, 9.6 mm; range, 8-16 mm) formed by the injected barium suspension. Pneumothorax occurred in two cases, for which one needed aspiration. However, there were no other complications. All barium balls were palpable during VATS and visible on intraoperative fluoroscopy, and were completely resected. Both the whitish barium balls and target nodules were identifiable in the frozen specimens. Pathology revealed one invasive adenocarcinoma, five adenocarcinoma-in-situ, two atypical adenomatous hyperplasias, and two benign lesions. In all cases, there were acute inflammations around the barium balls which did not hamper the histological diagnosis of the nodules. CT-guided percutaneous barium marking can be an effective, convenient and safe pre-operative localization procedure prior to VATS, enabling accurate resection and diagnosis of small or faint pulmonary nodules.

  19. STS-114: Crew Interviews 1. Andy Thomas 2. Steve Robinson (United States)


    STS-114 Mission Specialists, Andy Thomas and Steve Robinson, are seen in this pre-flight interview. Andy Thomas begins by talking about his interest in spaceflight as a young boy growing up in Australia. He expresses that the chances of an Australian boy studying to eventually become an astronaut was very remote. His Mechanical Engineering Degree in Australia and a Doctorate enabled him to acquire unique skills to come to the United States to work for Lockheed Martin. On the topic of return to flight, he reflects on experiences that he had working with the Michael Anderson and Kalpana Chawla of the ill-fated Space Shuttle Columbia. He also talks about the safety of the Space Shuttle Discovery and repairs to its Thermal Protection system. He explains in detail the Logistics Flight (LF) 1, spacewalks, Multipurpose Logistics Module (MPLM) and the External Stowage Platform (ESP)-2. Steve Robinson expresses that he had many interests as a child and becoming an astronaut was one of them. He was fascinated with things that fly and wanted to find out how they flew. He also designed hang gliders as a teenager. He expresses how his family feels about the risky business of spaceflight. He talks about how the space shuttle discovery crew will remember the Columbia crew by including seven stars on their patch so that they can bring them into orbit and then back home. Robinson also talks about his primary job, and the spacewalks that he and Soichi Noguchi will be performing.

  20. Pneumonia: high-resolution CT findings in 114 patients

    International Nuclear Information System (INIS)

    The objective of the present study was to assess the high-resolution CT appearances of different types of pneumonia. The high-resolution CT scans obtained in 114 patients (58 immunocompetent, 59 immunocompromised) with bacterial, Mycoplasma pneumoniae, viral, fungal, and Pneumocystis carinii pneumonias were analyzed retrospectively by two independent observers for presence, pattern, and distribution of abnormalities. Areas of air-space consolidation were not detected in patients with viral pneumonia and were less frequently seen in patients with Pneumocystis carinii pneumonia (2 of 22 patients, 9%) than in bacterial (30 of 35, 85%), Mycoplasma pneumoniae (22 of 28, 79%), and fungal pneumonias (15 of 20, 75%; p<0.01). There was no significant difference in the prevalence or distribution of consolidation between bacterial, Mycoplasma pneumoniae, and fungal pneumonias. Extensive symmetric bilateral areas of ground-glass attenuation were present in 21 of 22 (95%) patients with Pneumocystis carinii pneumonia and were not seen in other pneumonias except in association with areas of consolidation and nodules. Centrilobular nodules were present less commonly in bacterial pneumonia (6 of 35 patients, 17%) than in Mycoplasma pneumoniae (24 of 28, 96%), viral (7 of 9, 78%), or fungal (12 of 20, 92%) pneumonia (p<0.01). Except for Pneumocystis carinii pneumonia and Mycoplasma pneumoniae pneumonia, which often have a characteristic appearance, high-resolution CT is of limited value in the differential diagnosis of the various types of infective pneumonia. (orig.)

  1. Growth rate controlled barium partitioning in calcite and aragonite (United States)

    Goetschl, Katja Elisabeth; Mavromatis, Vasileios; Baldermann, Andre; Purgstaller, Bettina; Dietzel, Martin


    The barium (Ba) content and the Ba/Ca molar ratios in biogenic and abiotic carbonates have been widely used from the scientific community as a geochemical proxy especially in marine and early diagenetic settings. The Ba content of carbonate minerals has been earlier associated to changes in oceanic circulation that may have been caused by upwelling, changes in weathering regimes and river-runoff as well as melt water discharge. The physicochemical controls of Ba ion incorporation in the two most abundant CaCO3 polymorphs found in Earth's surface environments, i.e. calcite and aragonite, have adequately been studied only for calcite. These earlier studies (i.e. [1]) suggest that at increasing growth rate, Ba partitioning in calcite is increasing as well. In contrast, to date the effect of growth rate on the partitioning of Ba in aragonite remains questionable, despite the fact that this mineral phase is the predominant carbonate-forming polymorph in shallow marine environments. To shed light on the mechanisms controlling Ba ion uptake in carbonates in this study we performed steady-state Ba co-precipitation experiments with calcite and aragonite at 25°C. The obtained results for the partitioning of Ba in calcite are in good agreement with those reported earlier by [1], whereas those for aragonite indicate a reduction of Ba partitioning at elevated aragonite growth rates, with the partitioning coefficient value between solid and fluid to be approaching the unity. This finding is good agreement with the formation of a solid solution in the aragonite-witherite system, owing to the isostructural crystallography of the two mineral phases. Moreover, our data set provides new insights that are required for reconstructing the evolution of the Ba content of pristine marine versus diagenetically altered carbonate minerals commonly occurring in marine subfloor settings, as the thermodynamically less stable aragonite will transform to calcite enriched in Ba, whilst affecting

  2. Regeneration of barium carbonate from barium sulphide in a pilot-scale bubbling column reactor and utilization for acid mine drainage. (United States)

    Mulopo, J; Zvimba, J N; Swanepoel, H; Bologo, L T; Maree, J


    Batch regeneration of barium carbonate (BaCO(3)) from barium sulphide (BaS) slurries by passing CO(2) gas into a pilot-scale bubbling column reactor under ambient conditions was used to assess the technical feasibility of BaCO(3) recovery in the Alkali Barium Calcium (ABC) desalination process and its use for sulphate removal from high sulphate Acid Mine Drainage (AMD). The effect of key process parameters, such as BaS slurry concentration and CO(2) flow rate on the carbonation, as well as the extent of sulphate removal from AMD using the recovered BaCO(3) were investigated. It was observed that the carbonation reaction rate for BaCO(3) regeneration in a bubbling column reactor significantly increased with increase in carbon dioxide (CO(2)) flow rate whereas the BaS slurry content within the range 5-10% slurry content did not significantly affect the carbonation rate. The CO(2) flow rate also had an impact on the BaCO(3) morphology. The BaCO(3) recovered from the pilot-scale bubbling column reactor demonstrated effective sulphate removal ability during AMD treatment compared with commercial BaCO(3). PMID:22233912

  3. 40 CFR 264.114 - Disposal or decontamination of equipment, structures and soils. (United States)


    ... equipment, structures and soils. 264.114 Section 264.114 Protection of Environment ENVIRONMENTAL PROTECTION... of equipment, structures and soils. During the partial and final closure periods, all contaminated equipment, structures and soils must be properly disposed of or decontaminated unless otherwise specified...

  4. 40 CFR 265.114 - Disposal or decontamination of equipment, structures and soils. (United States)


    ... equipment, structures and soils. 265.114 Section 265.114 Protection of Environment ENVIRONMENTAL PROTECTION... decontamination of equipment, structures and soils. During the partial and final closure periods, all contaminated equipment, structures and soil must be properly disposed of, or decontaminated unless specified otherwise...

  5. 11 CFR 114.10 - Nonprofit corporations exempt from the prohibitions on making independent expenditures and... (United States)


    ... candidates. (4) The term shareholder has the same meaning as the term stockholder, as defined in 11 CFR 114.1... 11 CFR 114.2. It sets out the procedures for demonstrating qualified nonprofit corporation status... communications. (1) A qualified nonprofit corporation may make independent expenditures, as defined in 11 CFR...

  6. 29 CFR 1980.114 - District Court jurisdiction of discrimination complaints. (United States)


    ... 29 Labor 9 2010-07-01 2010-07-01 false District Court jurisdiction of discrimination complaints. 1980.114 Section 1980.114 Labor Regulations Relating to Labor (Continued) OCCUPATIONAL SAFETY AND HEALTH ADMINISTRATION, DEPARTMENT OF LABOR (CONTINUED) PROCEDURES FOR THE HANDLING OF...

  7. 40 CFR 92.114 - Exhaust gas and particulate sampling and analytical system. (United States)


    ... sampling of the particulate material may take place (Figure B114-3 of this section) at this point. (i)(A... 40 Protection of Environment 20 2010-07-01 2010-07-01 false Exhaust gas and particulate sampling... Procedures § 92.114 Exhaust gas and particulate sampling and analytical system. (a) General. (1)...

  8. 7 CFR 1710.114 - TIER, DSC, OTIER and ODSC requirements. (United States)


    ... substantially in their entirety are in 7 CFR 1717.155. (4) If a distribution borrower has in service or under... 7 Agriculture 11 2010-01-01 2010-01-01 false TIER, DSC, OTIER and ODSC requirements. 1710.114... AND GUARANTEES Loan Purposes and Basic Policies § 1710.114 TIER, DSC, OTIER and ODSC requirements....

  9. 40 CFR 65.114 - Standards: Open-ended valves or lines. (United States)


    ... 40 Protection of Environment 15 2010-07-01 2010-07-01 false Standards: Open-ended valves or lines. 65.114 Section 65.114 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR... shall seal the open end at all times except during operations requiring process fluid flow through...

  10. 42 CFR 56.114 - Applicability of 45 CFR part 74. (United States)


    ... MIGRANT HEALTH SERVICES General Provisions § 56.114 Applicability of 45 CFR part 74. The provisions of 45 CFR part 74, establishing uniform administrative requirements and cost principles, shall apply to all... 42 Public Health 1 2010-10-01 2010-10-01 false Applicability of 45 CFR part 74. 56.114 Section...

  11. Synthesis and characterization of barium titanate, doped with europium and neodymium

    International Nuclear Information System (INIS)

    This work aims at synthesize and characterize mixed oxides in Barium Titanium matrix in doping with Neodymium and Europium analyzing thermogravimetric curves, characteristic bands at infrared region of the polymer complex, which are intermediates to mixed oxides, and identify the formation thereof, and the crystallinity using XRD analysis

  12. Seasonal variability in the input of lead, barium and indium to Law Dome, Antarctica

    DEFF Research Database (Denmark)

    Burn-Nunes...[], L.J.; Vallelonga, Paul Travis; Loss, R.D.;


    Lead (Pb) isotopic compositions and concentrations, and barium (Ba) and indium (In) concentrations have been determined at monthly resolution in five Law Dome (coastal Eastern Antarctica) ice core sections dated from similar to 1757 AD to similar to 1898 AD. 'Natural' background Pb concentrations...

  13. A plasmonic modulator based on metal-insulator-metal waveguide with barium titanate core

    DEFF Research Database (Denmark)

    Babicheva, Viktoriia; Lavrinenko, Andrei


    We design a plasmonic modulator which can be utilized as a compact active device in photonic integrated circuits. The active material, barium titanate (BaTiO3), is sandwiched between metal plates and changes its refractive index under applied voltage. Some degree of switching of ferroelectric...

  14. Diffuse X-ray scattering and far infrared absorption of barium and lead β" aluminas

    DEFF Research Database (Denmark)

    Hayes, W.; Kjær, Kristian; Pratt, F. L.;


    The authors have carried out high-momentum-resolution studies in diffuse X-ray scattering of barium and lead B" aluminas in the temperature range 20-700 degrees C. They have also measured the vibrational spectra of these compounds between 2K and 300K in the energy range 10-100 cm-1. The results...

  15. The Precipitation Process of Liquid Wastes Containing Contaminant Am withBarium Sulfate

    International Nuclear Information System (INIS)

    The investigated of the reduction volume liquid wastes containing ofAmericium nuclide contaminant has been done. The reduction volume was done byadding barium sulfate coagulant. The experimental procedure that has beendone by adding regent of barium nitrate and natrium sulfate to the wasteswith its preadjusted pH, then by utilizing the jar test equipment was carriedout the fast stirring speed for 5 minutes and the gentle agitation for 30minutes, therefor its floc and supernatant will be formed. The resultedbarium sulfate floc will trap radionuclide in the wastes. The Variableinvestigated were: the concentration of barium sulfate, pH of the wastes, theflash mixing rate, the gentle agitation rate. The investigated barium sulfateconcentration variable was started from 100 ppm up to 800 ppm. Theinvestigated pH variable was started from pH 7 up to pH 13. The investigatedflash mixing rate were 75, 100, 125, 150, 175, 200, 225, 250 rpm. Theinvestigated gentle agitation variable were 20, 30, 40, 50 rpm. The bestresult which was represented by decontaminating factor (DF) was found frombarium sulfate concentration of 300 ppm and pH 11, and the flash mixing rateof 200 rpm and the gentle agitation rate of 20 rpm, with the separationefficiency = 97.2 %. (author)

  16. Study of structural, ferromagnetic and ferroelectric properties of nanostructured barium doped Bismuth Ferrite

    International Nuclear Information System (INIS)

    Nanostructured multiferroic Bi(1−x)BaxFeO3x=0.0, 0.1, 0.2 were prepared by hydrothermal technique. All samples belonged to the rhombohedrally distorted perovskite structure. The morphology of the particles changed with the doping of barium. Effect of barium doping on the dielectric constant was studied over a wide frequency range of 1000 Hz–1 MHz. The activation energy due to relaxation and due to conduction was measured from the Cole Cole plot and the AC conductivity versus frequency plot respectively. The activation energy estimated from both the studies was close to each other. The activation energy also enhanced with the increase in the barium content. The magnetization at the highest available field (∼1.6 T) increased from 0.05 emu/g for the sample with x=0.0–12 emu/g for the sample with x=0.2. The magnetic measurements show a significant increase in magnetization around 400 °C. Remnant polarization for x=0.0 was negligible and it increased to 0.06 µC/cm2 for x=0.2. - Highlights: • Bismuth Ferrite nanostructures were synthesized by the hydrothermal technique. • Barium was doped in Bismuth site. • Morphology changed with doping. • Ferromagnetic, Ferroelectric and Dielectric properties enhanced with doping. • An unreported magnetic transition due to spin canting was observed near 550 °C

  17. Adsorption of Pb(II) present in aqueous solution on calcium, strontium and barium hydroxy apatites

    International Nuclear Information System (INIS)

    Calcium, strontium and barium hydroxy apatites were successfully synthesized by chemical precipitation method, the obtained powders were characterized by the techniques of X-ray diffraction (XRD), scanning electron microscopy (Sem), semi-quantitative elemental analysis (EDS), infrared spectroscopy (IR), and N2 physisorption studies, complementary to these analytical techniques, was determined the surface fractal dimension (Df), and the amount of surface active sites of the materials, in order to know application as ceramic for water remediation. The ability of Pb(II) ion adsorption present in aqueous solution on the hydroxy apatites synthesized by batch type experiments was studied as a function of contact time, concentration of the adsorbate and temperature. The maximum lead adsorption efficiencies obtained were 0.31, 0.32 and 0.26 mg/g for calcium, strontium and barium hydroxy apatites respectively, achieved an equilibrium time of 20 minutes in the three solid-liquid systems studied. Experimental data were adequately adjusted at the adsorption kinetic model pseudo-second order, for the three cases. Moreover, experimental data of the strontium and calcium hydroxy apatites were adjusted to the Langmuir adsorption isotherm, indicating that the adsorption was through a monolayer, whereas barium hydroxyapatite was adjusted to the Freundlich adsorption isotherm, indicating a multilayer adsorption. The thermodynamic parameters obtained during adsorption studies as a function of temperature showed physisorption, exothermic and spontaneous processes respectively. The results showed that the calcium hydroxyapatite, strontium and barium are an alternative for the Pb(II) ion adsorption present in wastewaters. (Author)

  18. A comparison of radiographer and radiologist reports on radiographer conducted barium enemas

    International Nuclear Information System (INIS)

    Purpose: To compare radiographer and radiologist reports on radiographer conducted barium enemas. Method: Two specially trained, experienced radiographers performed barium enemas and prepared provisional reports without consulting radiologists. Later, formal radiologist reports were issued. The reports of each were compared and correlated with clinical findings derived from case note review. Results:Seven hundred and eighty eight patients had barium enemas. Males numbered 295 (37.5%) and females 493 (62.5%). Patients ages ranged from 17 to 95 years (mean 62). The radiologist reported 244 as normal, 432 as diverticular change, 70 with polyps (31 of which had co-existent diverticular disease), 31 with carcinomas and 12 with colitis (three of which had co-existent diverticular disease). Taking the radiologist reports as gold-standard radiographer reports were concordant in 753 (95.5%). There were 35 (4.5%) discordant radiographer reports of these 19 were false-positive diagnoses of polyps and six false positive diagnoses of diverticular change. There were seven false-negative diagnoses of polyps (only one of these was found to have a polyp at follow-up endoscopy). There was one false-negative diagnosis of colitis and two false-negative reports of diverticular change. On follow up there were no false negative diagnoses of carcinoma by either radiographer or radiologist. There was one concordant false-positive diagnosis of carcinoma. Conclusion:Radiographers with specialized training can report barium enemas to a high standard

  19. Spectroscopic (multi-energy) CT distinguishes iodine and barium contrast material in MICE

    CERN Document Server

    Anderson, NG; Firsching, M; de Ruiter, N; Schleich, N; Butzer, J S; Cook, N J; Grasset, R; Campbell, M; Scott, N J A; Anderson, N G


    Spectral CT differs from dual-energy CT by using a conventional X-ray tube and a photon-counting detector. We wished to produce 3D spectroscopic images of mice that distinguished calcium, iodine and barium. We developed a desktop spectral CT, dubbed MARS, based around the Medipix2 photon-counting energy-discriminating detector. The single conventional X-ray tube operated at constant voltage (75 kVp) and constant current (150 A mu A). We anaesthetised with ketamine six black mice (C57BL/6). We introduced iodinated contrast material and barium sulphate into the vascular system, alimentary tract and respiratory tract as we euthanised them. The mice were preserved in resin and imaged at four detector energy levels from 12 keV to 42 keV to include the K-edges of iodine (33.0 keV) and barium (37.4 keV). Principal component analysis was applied to reconstructed images to identify components with independent energy response, then displayed in 2D and 3D. Iodinated and barium contrast material was spectrally distinct f...

  20. Physical and biological dosimetry at the barium sulphate-culture medium interface

    International Nuclear Information System (INIS)

    The present study suggests that a thin layer of Barium sulphate suspension forms an interface with tissues which results in high dose regions on both sides of the BSS-tissue interface when irradiated with 250 kVp X rays. The magnitude of dose increase depends on the density of the BSS. (U.K.)

  1. Assessment of barium sulphate formation and inhibition at surfaces with synchrotron X-ray diffraction (SXRD)

    International Nuclear Information System (INIS)

    The precipitation of barium sulphate from aqueous supersaturated solutions is a well-known problem in the oil industry often referred to as 'scaling'. The formation and growth of barite on surfaces during the oil extraction process can result in malfunctions within the oil facilities and serious damage to the equipment. The formation of barium sulphate at surfaces remains an important topic of research with the focus being on understanding the mechanisms of formation and means of control. In situ synchrotron X-ray diffraction (SXRD) was used to investigate the formation of barium sulphate on a stainless steel surface. The effect of Poly-phosphinocarboxylic acid (PPCA) and Diethylenetriamine-penta-methylenephosphonic acid (DETPMP) which are two commercial inhibitors for barium sulphate was examined. The in situ SXRD measurements allowed the identification of the crystal faces of the deposited barite in the absence and presence of the two inhibitors. The preferential effect of the inhibitors on some crystal planes is reported and the practical significance discussed.

  2. Performance of cement solidification with barium for high activity liquid waste including sulphate

    International Nuclear Information System (INIS)

    The target liquid waste to be solidified is generated from PWR primary loop spent resin treatment with sulphate acid, so, its main constituent is sodium sulphate and the activity of this liquid is relatively high. Waste form of this liquid waste is considered to be a candidate for the subsurface disposal. The disposed waste including sulphate is anticipated to rise a concentration of sulphate ion in the ground water around the disposal facility and it may cause degradation of materials such as cement and bentonite layer and comprise the disposal facility. There could be two approaches to avoid this problem, the strong design of the disposal facility and the minimization of sulphaste ion migration from the solidified waste. In this study, the latter approach was examined. In order to keep the low concentration of sulphate ion in the ground water, it is effective to make barium sulphate by adding barium compound into the liquid waste in solidification. However, adding equivalent amount of barium compound with sulphate ion causes difficulty of mixing, because production of barium sulphate causes high viscosity. In this study, mixing condition after and before adding cement into the liquid waste was estimated. The mixing condition was set with consideration to keep anion concentration low in the ground water and of mixing easily enough in practical operation. Long term leaching behavior of the simulated solidified waste was also analyzed by PHREEQC. And the concentration of the constitution affected to the disposal facility was estimated be low enough in the ground water. (author)

  3. Study of structural, ferromagnetic and ferroelectric properties of nanostructured barium doped Bismuth Ferrite

    Energy Technology Data Exchange (ETDEWEB)

    Chaudhuri, A., E-mail: [Department of Applied Science, Haldia Institute of Technology, Dist.- Purba Medinipur, Haldia- 721657, West Bengal (India); Department of Condensed Matter Physics and Material Science, S.N. Bose National Center for Basic Sciences, Block JD, Salt Lake, Kolkata 700098 (India); Mandal, K. [Department of Applied Science, Haldia Institute of Technology, Dist.- Purba Medinipur, Haldia- 721657, West Bengal (India); Department of Condensed Matter Physics and Material Science, S.N. Bose National Center for Basic Sciences, Block JD, Salt Lake, Kolkata 700098 (India)


    Nanostructured multiferroic Bi{sub (1−x)}Ba{sub x}FeO{sub 3}x=0.0, 0.1, 0.2 were prepared by hydrothermal technique. All samples belonged to the rhombohedrally distorted perovskite structure. The morphology of the particles changed with the doping of barium. Effect of barium doping on the dielectric constant was studied over a wide frequency range of 1000 Hz–1 MHz. The activation energy due to relaxation and due to conduction was measured from the Cole Cole plot and the AC conductivity versus frequency plot respectively. The activation energy estimated from both the studies was close to each other. The activation energy also enhanced with the increase in the barium content. The magnetization at the highest available field (∼1.6 T) increased from 0.05 emu/g for the sample with x=0.0–12 emu/g for the sample with x=0.2. The magnetic measurements show a significant increase in magnetization around 400 °C. Remnant polarization for x=0.0 was negligible and it increased to 0.06 µC/cm{sup 2} for x=0.2. - Highlights: • Bismuth Ferrite nanostructures were synthesized by the hydrothermal technique. • Barium was doped in Bismuth site. • Morphology changed with doping. • Ferromagnetic, Ferroelectric and Dielectric properties enhanced with doping. • An unreported magnetic transition due to spin canting was observed near 550 °C.

  4. Barium versus Nonbarium Stimuli: Differences in Taste Intensity, Chemesthesis, and Swallowing Behavior in Healthy Adult Women (United States)

    Nagy, Ahmed; Steele, Catriona M.; Pelletier, Cathy A.


    Purpose: The authors examined the impact of barium on the perceived taste intensity of 7 different liquid tastant stimuli and the modulatory effect that these differences in perceived taste intensity have on swallowing behaviors. Method: Participants were 80 healthy women, stratified by age group (60) and genetic taste status…

  5. Low temperature phase barium borate: A new optical limiter in continuous wave and nano pulsed regime (United States)

    Babeela, C.; Girisun, T. C. Sabari


    Low temperature phase barium borate was synthesized by hydrothermal method. XRD analysis confirms the formation of γ-BBO or hydrated barium polyborate (Ba3B6O9(OH)6) which crystallizes in monoclinic system in the P2/c space group. The molecular structure analysis shows the presence of dominant BO4 unit and the hydrated nature of material. γ-BBO exhibits sharp absorption edge at 202 nm and highly transparency in the UV-Visible-NIR region. The peak at 347 nm in the emission spectrum is due to the presence of self-trapped exciton. The third order nonlinear optical properties and limiting behavior of low temperature barium borate in both pulsed and continuous wave regime were studied. The effective 2PA absorption coefficient of γ-BBO under ns pulse excitation is estimated to be 0.38 × 10-10 m/W. The nonlinear absorption coefficient, refractive index and optical susceptibility of the material in cw regime were found to be in the order of 10-5 m W-1, 10-12 m2 W-1, 10-6 esu respectively. In both regimes, low temperature phase barium borate exhibits better optical limiting properties than high temperature phase β-BBO.

  6. Barium borosilicate glass as a matrix for the uptake of dyes

    International Nuclear Information System (INIS)

    Barium borosilicate (BBS) and sodium borosilicate (SBS) glass samples, prepared by the conventional melt-quench method, were used for the uptake of Rhodamine 6G dye from aqueous solution. The experimental conditions were optimized to get maximum uptake and was found to be 0.4 mg of dye per gram of BBS glass sample. For the same network former to modifier ratio, barium borosilicate glasses are found to have improved extent of uptake for the dye molecules from aqueous solutions compared to sodium borosilicate glasses. Based on 29Si MAS NMR studies on these glasses, it is inferred that significantly higher number of non-bridging oxygen atoms present in barium borosilicate glasses compared to sodium borosilicate glasses is responsible for its improved uptake of Rhodamine 6G dye. 11B MAS NMR studies have confirmed the simultaneous existence of boron in BO3 and BO4 configurations in both barium borosilicate and sodium borosilicate glasses. The luminescence studies have established that the dye molecule is incorporated into the glass matrix through ion exchange mechanism by replacing the exchangeable ions like Na+/Ba2+ attached with the non-bridging oxygen atoms present in the glass.

  7. Possible discovery of the r-process characteristics in the abundances of metal-rich barium stars

    CERN Document Server

    Cui, W Y; Shi, J R; Zhao, G; Wang, W J; Niu, P


    We study the abundance distributions of a sample of metal-rich barium stars provided by Pereira et al. (2011) to investigate the s- and r-process nucleosynthesis in the metal-rich environment. We compared the theoretical results predicted by a parametric model with the observed abundances of the metal-rich barium stars. We found that six barium stars have a significant r-process characteristic, and we divided the barium stars into two groups: the r-rich barium stars ($C_r>5.0$, [La/Nd]\\,$<0$) and normal barium stars. The behavior of the r-rich barium stars seems more like that of the metal-poor r-rich and CEMP-r/s stars. We suggest that the most possible formation mechanism for these stars is the s-process pollution, although their abundance patterns can be fitted very well when the pre-enrichment hypothesis is included. The fact that we can not explain them well using the s-process nucleosynthesis alone may be due to our incomplete knowledge on the production of Nd, Eu, and other relevant elements by the ...

  8. Nuclear data for cyclotron production of {sup 114m}In/{sup 114}In and {sup 140}Nd/{sup 140}Pr used in gamma camera monitoring, RIT, ERT and PET

    Energy Technology Data Exchange (ETDEWEB)

    Sadeghi, Mahdi [Nuclear Science and Technology Research Institute, Karaj (Iran, Islamic Republic of). Agricultural, Medical and Industrial Research School; Ghanbarzadeh, Ali; Enferadi, Milad [Islamic Azad Univ., Tehran (Iran, Islamic Republic of). Research and Science Branch


    Aim of the presented study is to compare the calculated cross sections for the production of {sup 140}Nd/{sup 140}Pr and {sup 114m}In/{sup 114}In via different reactions with incident particle energy up to 50 MeV as a part of systematic studies on particle-induced activations on metal target, theoretical calculation of production yield, calculation of target thickness requirement and suggestion for optimum reaction to produce Neodymium-140 and Indium-114m. {sup 140}Nd/{sup 140}Pr and {sup 114m}In/{sup 114}In excitation functions via {sup nat}Ce({sup 3}He,xn){sup 140}Nd {yields} {sup 140}Pr, 141Pr(p,2n){sup 140}Nd {yields} {sup 140}Pr, 141Pr(d,3n){sup 140}Nd {yields} {sup 140}Pr, {sup 114}Cd(p,n){sup 114m}In {yields} {sup 114}In, {sup 114}Cd(d,2n){sup 114m}In {yields} {sup 114}In and 116Cd(p,3n){sup 114m}In {yields} {sup 114}In reactions were calculated by ALICE/91, ALICE/ASH (GDH Model and Hybrid Model) and TALYS-1.2 (Equilibrium and Pre-Equilibrium) codes and compared to existing data. (orig.)

  9. Influence of barium substitution on bioactivity, thermal and physico-mechanical properties of bioactive glass

    Energy Technology Data Exchange (ETDEWEB)

    Arepalli, Sampath Kumar, E-mail:; Tripathi, Himanshu; Vyas, Vikash Kumar; Jain, Shubham; Suman, Shyam Kumar; Pyare, Ram; Singh, S.P., E-mail:


    Barium with low concentration in the glasses acts as a muscle stimulant and is found in human teeth. We have made a primary study by substituting barium in the bioactive glass. The chemical composition containing (46.1 − X) SiO{sub 2−}–24.3 Na{sub 2}O–26.9 CaO–2.6 P{sub 2}O{sub 5}, where X = 0, 0.4, 0.8, 1.2 and 1.6 mol% of BaO was chosen and melted in an electric furnace at 1400 ± 5 °C. The glasses were characterized to determine their use in biomedical applications. The nucleation and crystallization regimes were determined by DTA and the controlled crystallization was carried out by suitable heat treatment. The crystalline phase formed was identified by using XRD technique. Bioactivity of these glasses was assessed by immersion in simulated body fluid (SBF) for various time periods. The formation of hydroxy carbonate apatite (HCA) layer was identified by FTIR spectrometry, scanning electron microscope (SEM) and XRD which showed the presence of HCA as the main phase in all tested bioactive glass samples. Flexural strength and densities of bioactive glasses have been measured and found to increase with increasing the barium content. The human blood compatibility of the samples was evaluated and found to be pertinent. - Highlights: • In vitro bioactivity of soda-lime–baria-phospho-silicate glass was investigated. • HCA formed on surface of glasses was confirmed by XRD, SEM and FTIR spectrometry. • Mechanical properties of glasses were found to increase with barium addition. • Hemolysis showed that 1.2 mol% BaO bioactive glass exhibited better biocompatibility. • Barium substituted bioactive glasses can be used as bone implants.

  10. A study of the microchemistry of nanocrystalline barium titanate with tetragonal and pseudocubic room temperature symmetries (United States)

    Lacey, Robert A.

    The investigation of possible effects of undesired surface species on barium titanate, one of the most utilized ferroelectric ceramics, constitutes the focus of this work. Six commercial barium titanate powders from three manufacturers representing two different synthesis processes, with average particle sizes from 40 nm to 470 nm, were analyzed in this study. Four of the nanopowders exhibited pseudocubic room temperature symmetry. Diffuse Reflectance Infrared Fourier Transform (DRIFT) spectroscopic analysis of the nanopowders was conducted in ambient atmosphere at room temperature. High temperature DRIFT followed incorporating four avenues of analysis: moisture adsorption studies, deuterium oxide exchange studies, carbon dioxide adsorption studies, and high temperature analysis under dry air and UHP nitrogen atmospheres. At the highest temperature used in this study, 1173K, moisture and the accompanying incorporated protonic impurities were still present. The powders readily readsorbed moisture during rapid cooling, 170K/minute, to room temperature. The smallest powder, as received, formed spherical agglomerates up to 10 mum diameter. These sintered as separate units attaining diameters up to 60 mum during intermediate stage sintering. X-ray photoelectron spectroscopy indicated a surface contamination layer of 10 A to 18 A; 50--70% of which was barium carbonate, the balance being atmospheric adsorbed species. Samples cooled at 3K/minute after an 1173K calcine retained cubic symmetry as indicated with high temperature X-ray diffraction. However, spectral evidence was obtained indicating that upon the rapid cooling from the 1173K calcine, a reorientation to the room temperature tetragonal symmetry was observed. Further, SEM and TEM supported this finding with visual evidence of interfacial rearrangement including corroborating electron diffraction analysis. This data, therefore, substantiated the hypothesis that the cause of the room temperature pseudocubic

  11. AFM studies of swift heavy ion and electron irradiated mixed barium strontium borate nonlinear optical crystal

    International Nuclear Information System (INIS)

    Single crystals of novel nonlinear optical material of mixed barium strontium borate is grown in our laboratory by employing the low-temperature solution technique. Equal proportion (1:1 molar ratio) of AR grade barium borate and strontium borate are mixed together in double distilled water to prepare a supersaturated solution. The solution is allowed to evaporate at constant temperature (30 deg. C) in a Petri dish for about a week which resulted in the formation of seed crystals. These seed crystals are used to grow larger crystals by suspending them using fine silk thread in the supersaturated mother solution. The solution is allowed to evaporate at constant temperature. This resulted in the growth of good transparent crystals of dimension 15 mmx10 mmx1 mm after about one month. These crystals show good second harmonic generation (SHG) efficiency. The mixed barium strontium borate crystal is found to be a promising nonlinear optical crystal, which possibly can be used for fabrication of photonic devices. The single crystals of mixed barium strontium borate are irradiated by 120 MeV Ag+13 swift heavy ions (SHI) of fluence 5x1011 ions/cm2 at Nuclear Science Centre, New Delhi and also by electrons of 8 MeV energy with a fluence 5.7x109/cm2 using Microtron accelerator at Mangalore University. Surface morphology studies of these crystals are carried out using atomic force microscope. The AFM topographical images of these SHI/electron irradiated single crystals of mixed barium strontium borate are obtained from different frames of the sample taken at different magnifications using atomic force microscope. An attempt is made to explain the surface damage caused due to SHI/electron irradiation using the observed AFM images

  12. Clinical analysis of 114 cases of dermatomyositis%皮肌炎114例临床分析

    Institute of Scientific and Technical Information of China (English)

    丁峰; 张芳; 刘花香; 李兴福


    Objective To investigate the clinic characteristic of dermatomyositis (DM).Method One hundred and fourteen cases of DM were collected from the Qi Lu Hospital of Shandong University from 1994 to 1997.The criteria for the diagnosis of DM were based on the report of Bohan and Peter in 1975.Results The disease can be seen in all ages.Women are affected more frequently than men.Muscle weakness of low limb was observed in 80% cases at the onset.The abnormity of biopsy was seen in all cases.The muscle enzymes including lactic dehydrogenase (LDH),creatine kinase (CK),alanine aminotransferase (ALT) and aspartate aminotransferase (AST) all went up;positive rates were 97%,93%,57% and 54% respectively.There were 26 out of 26 DM patients (100%) with abnormal biopsy;66 out of 69 (95.6%) positive electromyography (EMG);5 out of 114 complicated with malignancy,15 died of pulmonary infection,tumor or heart failure.Conclusion The onset of DM isn′t typical.Early diagnosis should take muscle weakness,muscle enzymes,EMG and biopsy into account.Poor prognostic factors in DM were malignancy,pulmonary infection and heart failure.%目的探讨皮肌炎的临床特点。方法对114例皮肌炎患者进行临床分析。结果该病可见于各个年龄组,女性略多于男性,80%患者以下肢无力症状为首发。通过对26例患者肌肉活检,阳性率达100%。对乳酸脱氢酶(LDH)、肌酸激酶(CK)、丙氨酸转氨酶(ALT)、天冬氨酸转氨酶(AST)等肌肉酶学的检查,其阳性率分别为97%、93%、57%、54%。肌电图检查的阳性率为95.6%,主要表现为肌源性损害。15%患者有肺部炎症表现,4%患者合并肿瘤,年龄均在40岁以上。15例死亡,死因分别为感染、肿瘤及心力衰竭。结论首发症状不典型,对于不明原因的皮损患者,应注意有无四肢近端无痛性肌无力的表现,结合肌肉酶学、肌电图及肌肉活检等检查,早期诊断并不困难。对于40岁以上的患


    Institute of Scientific and Technical Information of China (English)

    张克立; 袁继兵; 袁良杰; 孙聚堂


    Barium benzoate was synthesized in semi-solid phase reaction. The complex was characterized by elemental analysis, IR, X-ray powder diffraction. It is layered structure, monoclinic system. The mechanism of thermal decomposition for barium benzoate was studied by using TG, DTA, IR and gas chromatography-mass spectrometer. The thermal decompositon of barium benzoate in nitrogen proceeded in one stage: it decomposed to form BaCO3 and organic compounds. The organic compounds obtained from decomposition reaction are mainly benzophenone, triphenylmethane and so on.

  14. CT colonography: optimisation, diagnostic performance and patient acceptability of reduced-laxative regimens using barium-based faecal tagging


    Stuart A Taylor; Slater, Andrew; Burling, David N.; Tam, Emily; Greenhalgh, Rebecca; Gartner, Louise; Scarth, Julia; Pearce, Robert; Bassett, Paul; Halligan, Steve


    To establish the optimum barium-based reduced-laxative tagging regimen prior to CT colonography (CTC). Ninety-five subjects underwent reduced-laxative (13 g senna/18 g magnesium citrate) CTC prior to same-day colonoscopy and were randomised to one of four tagging regimens using 20 ml 40%w/v barium sulphate: regimen A: four doses, B: three doses, C: three doses plus 220 ml 2.1% barium sulphate, or D: three doses plus 15 ml diatriazoate megluamine. Patient experience was assessed immediately af...

  15. Functions of Ceramide Synthase Paralogs YPR114w and YJR116w of Saccharomyces cerevisiae.

    Directory of Open Access Journals (Sweden)

    Shamroop K Mallela

    Full Text Available Ceramide is synthesized in yeast by two redundant acyl-CoA dependent synthases, Lag1 and Lac1. In lag1∆ lac1∆ cells, free fatty acids and sphingoid bases are elevated, and ceramides are produced through the redundant alkaline ceramidases Ypc1 and Ydc1, working backwards. Even with all four of these genes deleted, cells are surviving and continue to contain small amounts of complex sphingolipids. Here we show that these residual sphingolipids are not synthesized by YPR114w or YJR116w, proteins of unknown function showing a high degree of homology to Lag1 and Lac1. Indeed, the hextuple lag1∆ lac1∆ ypc1∆ ydc1∆ ypr114w∆ yjr116w∆ mutant still contains ceramides and complex sphingolipids. Yjr116w∆ exhibit an oxygen-dependent hypersensitivity to Cu2+ due to an increased mitochondrial production of reactive oxygen species (ROS and a mitochondrially orchestrated programmed cell death in presence of copper, but also a general copper hypersensitivity that cannot be counteracted by the antioxidant N-acetyl-cysteine (NAC. Myriocin efficiently represses the synthesis of sphingoid bases of ypr114w∆, but not its growth. Both yjr116w∆ and ypr114w∆ have fragmented vacuoles and produce less ROS than wild type, before and after diauxic shift. Ypr114w∆/ypr114w∆ have an increased chronological life span. Thus, Yjr116w and Ypr114w are related, but not functionally redundant.

  16. Effects of barium on the nonlinear electrical characteristics and dielectric properties of SnO2-based varistors

    Institute of Scientific and Technical Information of China (English)

    Wang Chun-Ming; Wang Jin-Feng; Wang Chun-Lei; Chen Hong-Cun; Su Wen-Bin; Zang Guo-Zhong; Qi Peng; Zhao Ming-Lei; Ming Bao-Quan


    The effects of barium on electrical and dielectric properties of the SnO2·Co2Oa.Ta2O5 varistor system sintered at 1250℃ for 60min were investigated. It is found that barium significantly improves the nonlinear properties. The breakdown electrical field increases from 378.0 to 2834.5V/mm, relative dielectric constant (at 1kHz) falls from 1206 to 161 and the resistivity (at 1kHz) rises from 60.3 to 1146.5kΩ·cm with an increase of BaCO3 concentration from 0mol%to 1.00mol%. The sample with 1.00mol% barium has the best nonlinear electrical property and the highest nonlinear coefficient (α=29.2). A modified defect barrier model is introduced to illustrate the grain-boundary barrier formation of barium-doped SnO2-based varistors.

  17. Enhanced sintering and conductivity study of cobalt or nickel doped solid solution of barium cerate and zirconate

    DEFF Research Database (Denmark)

    Ricote, Sandrine; Bonanos, Nikolaos


    atmospheres and compared to the undoped compounds. The ionic and p-type conductivities have been determined, as well as the activation energy in wet reducing atmospheres, in which protonic conduction is dominant. A decrease of the ionic conductivity is noticeable for the cobalt or nickel doped barium...... zirconate (x = 0), while not for cobalt or nickel solid solution of barium cerate and zirconate (x = 0.2)....

  18. Yeast Interacting Proteins Database: YHR114W, YJL180C [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available YHR114W BZZ1 SH3 domain protein implicated in the regulation of actin polymerization, able to recruit actin... polymerization machinery through its SH3 domains, colocalizes with cortical actin p...YHR114W Bait gene name BZZ1 Bait description SH3 domain protein implicated in the regulation of actin polyme...rization, able to recruit actin polymerization machinery through its SH3 domains, colocalizes with cortical actin

  19. Intra-individual comparison of patient acceptability of multidetector-row CT colonography and double-contrast barium enema

    International Nuclear Information System (INIS)

    AIMS: To compare the subjective acceptability of CT colonography in comparison with barium enema in older symptomatic patients, and to ascertain preferences for future colonic investigation. MATERIALS AND METHODS: The study population comprised 78 persons aged 60 years or over with symptoms suggestive of colorectal neoplasia, who underwent CT colonography followed the same day by barium enema. A 25-point questionnaire was administered after each procedure and an additional follow-up questionnaire a week later. Responses were compared using Wilcoxon matched pairs testing, Mann-Whitney test statistics and binomial exact testing. RESULTS: Participants suffered less physical discomfort during CT colonography (p=0.03) and overall satisfaction was greater compared with barium enema (p=0.03). On follow-up, respondents reported significantly better tolerance of CT colonography (p=0.002), and were less prepared to undergo barium enema again (p<0.001). Of 52 subjects expressing an opinion, all preferred CT to barium enema. CONCLUSION: Patient satisfaction was higher with CT colonography than barium enema. CT colonography caused significantly less physical discomfort and was overwhelmingly preferred by patients

  20. Site-selective spectroscopy of the solid-state defect chemistry in erbium-doped barium titanate. (United States)

    Bak, John D; Wright, John C


    Erbium-doped barium titanate crystals were studied by laser-induced fluorescence spectroscopy. Thirteen spectroscopically distinct erbium ion sites were found. The relative concentrations of the different sites changed as a function of the crystal and its preparation and treatment. One major site was present in all crystals. The site distribution was changed either by growing codoped crystals with donor (La3+) and acceptor (Sc3+) ions or by changing the temperature and partial pressure of the oxygen in the annealing atmosphere. Equilibrium calculations were done to simulate the defect distributions that result from the charge compensation of the erbium ions. Comparison with the observed dependence of the site spectral intensities indicated that the erbium enters the lattice on barium sites. We assigned the dominant site to an erbium ion on a barium site that is locally compensated by a barium vacancy, whereas the other lower-intensity sites corresponded to erbium ions that are locally compensated by an electron and a more complex center of an erbium, a barium vacancy, and a hole. The spectra of one sample showed that its defects were different and were characteristic of a sample that had not equilibrated. The new sites in this sample were assigned to erbium entering the lattice on a titanium site, which was then locally compensated by an oxygen vacancy or a hole. Heating equilibrated the sample and changed the erbium to a barium site. PMID:16853368

  1. Use of Different Barium Salts to Inhibit the Thaumasite Form of Sulfate Attack in Cement-based Materials

    Institute of Scientific and Technical Information of China (English)

    SU Ying; WEI Xiaochao; HUANG Jian; WANG Yingbin; HE Xingyang; WANG Xiongjue; MA Baoguo


    We investigated the effects of different barium compounds on the thaumasite form of sulphate attack (TSA) resistance of cement-based materials when they were used as admixtures in mortars. Moreover, we analyzed the inhibition mechanisms within different types of barium salts, namely BaCO3 and Ba(OH)2, on the thaumasite formation. The control cement mortar and mortars with barium salts to cement and limestone weight ratios of 0.5%, 1.0%, and 1.5% were immersed in 5% (by weight) MgSO4 solution at 5℃ to mimic TSA. Appearance, mass, and compressive strength of the mortar samples were monitored and measured to assess the general degradation extent of these samples. The products of sulphate attack were further analyzed by XRD, FTIR, and SEM, respectively. Experimental results show that different degradation extent is evident in all mortars cured in MgSO4 solution. However, barium salts can greatly inhibit such degradation. Barium in hydroxide form has better effectiveness in protection against TSA than carbonate form, which may be due to their solubility difference in alkaline cement pore solution, and the presence of these barium compounds can reduce the degree of TSA by comparison with the almost completely decomposed control samples.

  2. Study on the preparation and formation mechanism of barium sulphate nanoparticles modified by different organic acids

    Indian Academy of Sciences (India)

    Yuhua Shen; Chuanhao Li; Xuemei Zhu; Anjian Xie; Lingguang Qiu; Jinmiao Zhu


    This paper reports a simple method to prepare barium sulphate nanoparticles by use of tetradecanoic acid, hexadecanoic acid and stearic acid as modifier. The barium sulphate nanoparticles obtained are characterized by using Fourier transform infra-red spectroscopy (FT-IR), powder X-ray diffraction (XRD), transmission electron microscopy (TEM), dynamic laser light scatter (DLLS) and thermogravimetric analysis (TGA), respectively. The results show that the BaSO4 particles are all spherical and in the nano-scale. Our method has a better dispersion and controllable diameter dependent on the length of the chain of organic acid and the pH value of the system. A possible mechanism is also discussed.

  3. Barium enema carried out by digital luminescent radiography (DLR) and conventional screen-film system combinations

    International Nuclear Information System (INIS)

    120 double-contrast barium enemas were obtained by both digital luminescent radiography (DLR) and conventional screen-film systems, the digital exposure dose being 50% of the conventional one. In DLR two differently post processed images were obtained from one X-ray exposure: a display with low spatial frequency enhancement was processed to look like a conventional radiograph and was complemented by a display with high spatial frequency enhancement. Analysing the results statistically DLR proved to be diagnostically equivalent to conventional radiography despite the reduction in exposure dose and a slightly diminished image quality. High spatial frequency enhancement did not provide further diagnostic information and is therefore superfluous in barium enemas. (orig.)

  4. Elastic properties investigation of gamma-radiated barium lead borosilicate glass using ultrasonic technique

    International Nuclear Information System (INIS)

    Highlights: → Change in acoustical parameter due to composition effect and irradiation effect. → Changes in the structure of the glass (BO3 → BO4) due to the effect of radiation. → Structural changes in the BO3 to BO4 have a more compactness structure. - Abstract: The ultrasonic velocities were measured in barium lead borosilicate glass samples of different compositions before and after irradiation with γ-rays. Measurements were carried out at room temperature and 4 MHz frequency using ultrasonic technique. The ultrasonic velocities data of glass samples have been used to find the elastic modulus and micro-hardness. Densities of glass samples were measured by Archimedes's principle using n-hexane as immersion liquid. It was found that ultrasonic velocity, elastic modulus and micro-hardness increase with increasing barium oxide content and increasing γ-radiation dose.

  5. Synthesis and Fluorescence of Europium-Doped Barium Fluoride Cubic Nanocolumns

    Institute of Scientific and Technical Information of China (English)

    连洪州; 刘洁; 叶泽人; 石春山


    Europium-doped barium fluoride cubic nanocolumns were synthesized from the quaternary water in oil reverse microemulsions. In this process, the aqueous cores of water/cetyl trimethyl ammonium bromide(CTAB)/n-butanol/n-octane reverse microemulsions were used as microreactors for the precipitation of europium doped barium fluoride. XRD analysis shows that under the dopant concentration of 0.06%(molar fraction), the products are single phase. The result products are cubic column-like with about 30~50 nm edge length of cross section, and about 200 nm of length obtained from the transmission electron microscopy(TEM), and atomic force microscopy(AFM). Under the 0.06%(molar fraction) of dopant concentration, the fluorescence of Eu2+ and Eu3+ under the 589 of excitation wavelength is observed.

  6. Barium phosphate conversion coating on die-cast AZ91D magnesium alloy

    Institute of Scientific and Technical Information of China (English)


    Poor corrosion resistance limits the application of magnesium alloys.Conversion coating is widely used to protect magnesium alloys because of easy operation and low cost.A novel conversion coating on die.cast AZ91D magnesium alloy containing barium salts was studied.The optimum concentrations of Ba(NO3)2,Mn(NO3)2 and NH4H2PO4 are 25 g/L,15 mL/L and 20 g/L,respectively,based on orthogonal test resulm.The treating time,solution temperature and PH value are settled to be 5-30 min,50-70℃and 2.35-3.0.respectively.The corrosion resistance of barium conversion coating is better than that of manganese-based phosphate conversion coating by immersion test.The coating is composed of Ba,P, O,Mg,Zn,Mn and Al by EDX analysis.

  7. Absolute Te$_2$ reference for barium ion at $455.4~$nm

    CERN Document Server

    Dutta, T; Mukherjee, M


    Precision atomic spectroscopy is presently the work horse in quantum information technology, metrology, trace analysis and even for fundamental tests in physics. Stable lasers are inherent part of precision spectroscopy which in turn requires absolute wavelength markers suitably placed corresponding to the atomic species being probed. Here we present, new lines of tellurium (Te$_2$) which allows locking of external cavity diode laser (ECDL) for precision spectroscopy of singly charged barium ions. In addition, we have developed an ECDL with over 100 GHz mod-hop-free tuning range using commercially available diode from $\\textit{Nichia}$. These two developments allow nearly drift-free operation of a barium ion trap set-up with one single reference cell thereby reducing the complexity of the experiment.

  8. Efficient photoionization for barium ion trapping using a dipole-allowed resonant two-photon transition

    CERN Document Server

    Leschhorn, G; Schaetz, T


    Two efficient and isotope-selective resonant two-photon ionization techniques for loading barium ions into radio-frequency (RF)-traps are demonstrated. The scheme of using a strong dipole-allowed transition at \\lambda=553 nm as a first step towards ionization is compared to the established technique of using a weak intercombination line (\\lambda=413 nm). An increase of two orders of magnitude in the ionization efficiency is found favoring the transition at 553 nm. This technique can be implemented using commercial all-solid-state laser systems and is expected to be advantageous compared to other narrowband photoionization schemes of barium in cases where highest efficiency and isotope-selectivity are required.

  9. Scaled-energy spectroscopy of a |M|=1 Rydberg barium atom in an electric field

    Institute of Scientific and Technical Information of China (English)

    Wang Lei; Quan Wei; Shen Li; Yang Hai-Feng; Shi Ting-Yun; Liu Xiao-Jun; Liu Hong-Ping; Zhan Ming-Sheng


    We observe strong energy-dependent quantum defects in the scaled-energy Stark spectra for |M|=1 Rydberg states of barium atoms at three scaled energies: ε= -2.000, ε= -2.500 and ε=-3.000. In an attempt to explain the observations, theoretical calculations of closed orbit theory based on a model potential including core effect are performed for non-hydrogenic atoms. While such a potential has been uniformly successful for alkali atoms with a single valence electron, it fails to match experimental results for barium atoms in the 6snp Rydberg states with two valence electrons. Our study points out that this discrepancy is due to the strong perturbation from the 5d8p state, which voids the simple approximation for constant quantum defects of principle quantum number n.

  10. Laser plasma channel formation in barium vapor based on superelastic heating of electrons

    International Nuclear Information System (INIS)

    Computational study of plasma channel formation kinetics in optically dense barium vapor irradiated by pulsed laser light tuned to the Ba I resonance transition at λ = 553.5 nm has been performed. Seed electrons are produced due to the mechanism of atoms associative ionization, which then gain energy in superelastic collisions and initiate the avalanche ionization of atoms by electron impact. We have studied the influence of radiative transfer effects in cylindrically symmetric gas volume on the excitation kinetics of multilevel barium atoms, dynamics of absorption of laser radiation, and the plasma channel expansion in the form of a halo in condition of competition between the ionizing and quenching electron collisions with excited atoms. (paper)

  11. Effect of CaF2 addition on optical properties of barium phosphate glasses (United States)

    Kumar, N. Manoj; Rao, G. Venkateswara; Akhila, B. E.; Shashikala, H. D.


    Ternary barium phosphate glasses, (50-X)BaO-XCaF2-50P2O5 have been prepared by adding 0-10 mol% of CaF2 to binary barium phosphate glasses. The amorphous nature of the prepared glasses was confirmed by X-ray diffraction technique. The UV-Visible absorption spectra have been recorded, optical band gap energy Eopt and Urbach energy Etail were determined. Shift in Eopt and Etail with increase in concentration of CaF2 is noted. FTIR analysis was carried out to investigate the short and intermediate-range orders in glasses. Shift of (P-O-P) band to higher wave number with the substitution of BaO with CaF2 shows the shortening of the phosphate chains. Hardness and density of glass samples were measured and correlated with the composition of glasses.

  12. Removal of hexavalent chromium from aqueous solution by barium ion cross-linked alginate beads

    Directory of Open Access Journals (Sweden)

    Uzaşçı Sesil


    Full Text Available Barium ion cross-linked alginate beads have shown great affinity to toxic hexavalent chromium ions in aqueous solution, contrary to the traditional calcium alginate beads. The adsorption experiments were carried out by the batch contact method. The optimal pH for removal was found to be pH 4. The equilibrium was established in 4 h and the removal efficiency of chromium (VI was found as 95%. The adsorption data fit well with Langmuir and Freundlich isotherms. The maximum chromium (VI adsorption capacity determined from Langmuir isotherm was 36.5 mg/g dry alginate beads. Our study suggests that barium alginate beads can be used as cost-effective and efficient adsorbents for the removal of chromium (VI from contaminated waters.

  13. Single-step synthesis of well-crystallized and pure barium titanate nanoparticles in supercritical fluids (United States)

    Reverón, Helen; Aymonier, Cyril; Loppinet-Serani, Anne; Elissalde, Catherine; Maglione, Mario; Cansell, François


    Single-step synthesis of ultra-fine barium titanate powder with a crystallinity as high as 90% and without barium carbonate contamination has been successfully performed under supercritical conditions using a continuous-flow reactor in the temperature range 150-380 °C at 16 MPa. To synthesize this bimetallic oxide, alkoxides, ethanol and water were used. The influence of the synthesis parameters on the BaTiO3 powder characteristics was investigated. The results show that the water to alkoxide precursor ratio, the reactor temperature and the Ba:Ti molar ratio of alkoxide precursor play a major role in the crystallization of pure and well-crystallized BaTiO3 nanoparticles. The continuous mode of operation without post-treatments for powder washing, drying or crystallization increase the industrial interest.

  14. Barium hexaferrite/graphene oxide: controlled synthesis and characterization and investigation of its magnetic properties (United States)

    Maddahfar, Mahnaz; Ramezani, Majid; Mostafa Hosseinpour-Mashkani, S.


    In the present study, barium hexaferrite nanocrystals (BaFe12O19) were successfully synthesized through the two-step sol-gel method in an aqueous solution in the presence of barium nitrate and iron (III) nitrate. Besides, the effect of the molar ratio of graphene oxide on the particle size and magnetic properties of final product was investigated. In this research, glucose plays a role as capping and chelating agent in the synthesis of BaFe12O19/graphene oxide. Moreover, it was found that the size, morphology, and magnetic properties of the final products could be greatly influenced by the molar ratio of graphene oxide. BaFe12O19/graphene oxide was characterized by using X-ray diffraction, scanning electron microscope, Fourier transform infrared spectroscopy, vibrating sample magnetometer, and energy-dispersive spectrometry.

  15. Magnetic and dielectric properties of 3Y-TZP/strontium doped barium ferrite composite (United States)

    Zhang, Chao; Wang, Shan-Shan; Guo, Rui-Song; Cai, Guang-Lan; Guo, Wei-Na; Wu, Chen


    Magnetic and dielectric properties of 3Y-TZP/20 wt.% Ba1-xSrxFe12O19 (x = 0, 0.25, 0.5, 0.75) composites prepared by solid state reaction method are investigated. The magnetic properties are improved in the composites with the strontium doped barium ferrite. When x = 0.25, the saturation magnetization of the ferrite reaches the maximum. This is due to the migration of Fe3+ induced by the Sr2+ doping. The dielectric properties are also improved in the composite with the strontium doped barium ferrite. When x = 0.5, the dielectric constant and dielectric loss possess the maximum. This is caused by the lattice distortion resulting from the Sr2+ doping. The dielectric properties are analyzed by the universal relaxation law.

  16. The CAMEO barium release - E/parallel/ fields over the polar cap (United States)

    Heppner, J. P.; Miller, M. L.; Pongratz, M. B.; Smith, G. M.; Smith, L. L.; Mende, S. B.; Nath, N. R.


    Four successive thermite barium releases at an altitude of 965 km over polar cap invariant latitudes 84 to 76 deg near magnetic midnight were conducted from the orbiting second stage of the vehicle that launched Nimbus 7; the releases were made as part of the CAMEO (Chemically Active Material Ejected in Orbit) program. This was the first opportunity to observe the behavior of conventional barium release when conducted at orbital velocity in the near-earth magnetic field. The principal unexpected characteristic in the release dynamics was the high, 1.4 to 2.6 km/s, initial Ba(+) expansion velocity relative to an expected velocity of 0.9 km/s. Attention is also given to neutral cloud expansion, initial ion cloud expansion, convective motion, and the characteristics of field-aligned motion. The possibility of measuring parallel electric fields over the polar cap by observing perturbations in the motion of the visible ions is assessed.

  17. Examination of colon with diluted barium contrast medium by the irrigoscopic (irrigographic) method

    International Nuclear Information System (INIS)

    By analogy with the work of C.Tavernier et al. (1974), who examined the eosophagus, stomach and duodenum with diluted 23% barium sulphate solution, the authors examined 58 patients by irrigoscopy (irrigography) with 20% barium sulphate solution. The rationality and the advantages of the method over the standard one were demonstrated. Early lesions measuring 3 or 4 mm were detected; the mucosal relief was very well presented. The injurious effect of tannic acid on the liver parenchyma was avoided by the use of low 0.15% tannin solution. In comparison with the method of Fischer (with double contrast) the examination time was shortened and the radiation load to the patients and attending personal reduced. The method is technically easy to perform. (author)

  18. Isolation and characterisation of barium sulphate and titanium oxides in monument crusts

    International Nuclear Information System (INIS)

    Black crusts from historical ornamental materials contain Ba and Ti. These elements are in low proportion, making their determination difficult and especially the characterisation of the phases in which they are present. For this reason, works on the mineralogical composition of the two elements in black crusts is scarce. Thus the isolation, previous to their characterisation, is important for the study of the surface layer in altered monuments. An acid attack for the isolation of barium sulphate and titanium oxides in black crusts from polluted areas has been used. The acid employed is a mixture of HF, HNO3 and HClO4. The residue isolated by acid attack was analysed by energy dispersive X-ray fluorescence and X-ray diffraction. It was characterised, and the percentages of barite (barium sulphate), anatase (titanium oxide), and rutile (titanium oxide) phases present in the surface layers were calculated

  19. The removal of radiostrontium by means of barium sulphate precipitation, ch. 4

    International Nuclear Information System (INIS)

    The barium sulphate precipitation method which is less-commonly used for the purification of radioactive wastewater is examined. In batch experiments, source variables influencing the process are studied. Results are tested in continuous processes. It was shown that the addition of stoichiometric amounts of precipitants at the same time rendered no more than 60% removal of radiostrontium; the addition of excess sulphate ions resulted in 99.7% removal. This can also be achieved by slow addition of a stoichiometric amount of barium ions to a solution containing sulphate ions and the radioisotope. The binding process is multilayer occlusion, but when more than the stoichiometric amount is added the continuing process is normal adsorption. The process is pH-independent; there is little interference of foreign ions. The method was also tested for the removal of ruthenium-106 and cobalt-60 and was successfully applied in the case of ruthenium

  20. Effects of barium sulfate as a contrast medium to enterocutaneous fistulas

    International Nuclear Information System (INIS)

    Fistulation following thoracic and epigastric interventions are conservatively treated, as a rule, because of the high rate of complications expected from reoperation. With properly functioning anastomotic transit, insufficiencies usually undergo spontaneous healing, within four to six weeks. Enterocutaneous fistulae developed in 29 of 271 patients with intrathoracic oesophagastric or oesophagojejunal anastomosis. Syringeal ramification into pleural or abdominal cavities were eliminated by means of an absorbable contrast medium, before barium sulphate was orally administered to all patients. Thoracic fistulae were closed after 21.8 days on average, while 20.3 days was the average period required for closure of epigastric fistulae. Barium sulphate was found to stimulate fistular tissue granulation, so that obliteration of the fistular system occurred much sooner, as compared to conservative treatment. The patient's quality of life can thus be improved, and hospitalisation can be shortened. Neither locally delimited nor systemic complications were observed in any of the cases described. (author)

  1. Gamma-ray shielding and structural properties of barium-bismuth-borosilicate glasses (United States)

    Bootjomchai, Cherdsak; Laopaiboon, Jintana; Yenchai, Chadet; Laopaiboon, Raewat


    The attenuation coefficients of barium-bismuth-borosilicate glasses have been measured for gamma-ray photon energies of 662, 1173 and 1332 keV using a narrow beam transmission geometry. These coefficients were then used to obtain the values of mass attenuation coefficients, effective atomic number, effective electron density and mean free path. Good agreement has been observed between experimental and theoretical values of these parameters. From the obtained results it is reported here that from the barium-bismuth-borosilicate glasses are better shields to gamma-radiations in comparison to the standard radiation shielding concretes from the shielding point of view. The molar volume, FTIR and acoustic investigations have been used to study the structural properties of the prepared glass system. The obtained results reveal that the formation of non-bridging oxygens occurs at higher concentration of Bi2O3.

  2. Correlated Strontium and Barium Isotopic Compositions of Acid-Cleaned Single Silicon Carbides from Murchison

    CERN Document Server

    Liu, Nan; Gallino, Roberto; Davis, Andrew M; Bisterzo, Sara; Gyngard, Frank; Kaeppeler, Franz; Cristallo, Sergio; Dauphas, Nicolas; Pellin, Michael J; Dillmann, Iris


    We present strontium, barium, carbon, and silicon isotopic compositions of 61 acid-cleaned presolar SiC grains from Murchison. Comparison with previous data shows that acid washing is highly effective in removing both strontium and barium contamination. For the first time, by using correlated $^{88}Sr$/$^{86}Sr$ and $^{138}Ba$/$^{136}Ba$ ratios in mainstream SiC grains, we are able to resolve the effect of $^{13}C$ concentration from that of $^{13}C$-pocket mass on s-process nucleosynthesis, which points towards the existence of large $^{13}C$-pockets with low $^{13}C$ concentration in AGB stars. The presence of such large $^{13}$R-pockets with a variety of relatively low $^{13}C$ concentrations seems to require multiple mixing processes in parent AGB stars of mainstream SiC grains.

  3. Effect of Mg-Zr substitution and microwave processing on magnetic properties of barium hexaferrite (United States)

    Sharma, Manju; Kashyap, Subhash C.; Gupta, H. C.


    The effect of substitution of Mg-Zr for Fe in M-type barium hexaferrite (BHF) and of processing technique on the magnetic properties and microstructure has been reported in the present paper. Significant changes in magnetic properties have been observed on substituting Fe ions by Mg and Zr ions in M-type barium hexaferrite, i.e. BaFe12O19 as well as by single mode microwave processing. The single mode microwave processing of the undoped sample reduced the coercivity to nearly 25% of the value for the sintered sample along with the enhancement in magnetization, thereby making it suitable for memory devices. The improvement in magnetic properties is explained on the basis of microstructure. The addition of substituents, though assisted in the formation of single phase, it, however, degraded the magnetization besides decreasing the coercivity, possibly due to substitution at the octahedral sites.

  4. Neutron beam test of barium fluoride crystal for dark matter direct detection (United States)

    Guo, C.; Ma, X. H.; Wang, Z. M.; Bao, J.; Dai, C. J.; Guan, M. Y.; Liu, J. C.; Li, Z. H.; Ren, J.; Ruan, X. C.; Yang, C. G.; Yu, Z. Y.; Zhong, W. L.


    In order to test the capabilities of Barium Fluoride (BaF2) crystal for dark matter direct detection, nuclear recoils are studied with mono-energetic neutron beam. The energy spectra of nuclear recoils, quenching factors for elastic scattering neutrons and discrimination capability between neutron inelastic scattering events and γ events are obtained for various recoil energies of the F content in BaF2.

  5. Barium strontium titanate thin film varactors for room-temperature microwave device applications

    International Nuclear Information System (INIS)

    Recent progress in the development of barium strontium titanate thin film varactors for room temperature tunable microwave devices applications is reviewed, with emphasis on efforts towards the improvement in the quality of BST thin films and the fabrication issues crucial for the performance of microwave devices based on BST varactors. The paper provides examples of tunable microwave devices employing BST varactors. Other thin film materials currently competing with BST thin films are discussed. Topics which deserve further investigation are suggested. (topical review)

  6. Radiographer and radiologist perception error in reporting double contrast barium enemas: A pilot study

    International Nuclear Information System (INIS)

    Purpose: The practice of radiographers performing double contrast barium enemas (DCBE) is now widespread and in many centres the radiographer's opinion is, at least, contributing to a dual reporting system [Bewell J, Chapman AH. Radiographer performed barium enemas - results of a survey to assess progress. Radiography 1996;2:199-205; Leslie A, Virjee JP. Detection of colorectal carcinoma on double contrast barium enema when double reporting is routinely performed: an audit of current practice. Clin Radiol 2001;57:184-7; Culpan DG, Mitchell AJ, Hughes S, Nutman M, Chapman AH. Double contrast barium enema sensitivity: a comparison of studies by radiographers and radiologists. Clin Radiol 2002;57:604-7]. To ensure this change in practice does not lead to an increase in reporting errors, this study aimed to compare the perception abilities of radiographers with those of radiologists. Methods: Three gastro-intestinal (GI) radiographers and three consultant radiologists independently reported on a selection of 50 DCBE examinations, including the level of certainty in their comments for each examination. A blinded comparison of the results with an independent 'standard report' was recorded. Results: The results demonstrate there was no significant difference in perception error for any of the levels of certainty, for single reporting, for double reading by a radiographer/radiologist or by two radiologists. Conclusions: The study shows that radiographers can perceive abnormalities on DCBE at similar sensitivities and specificities as radiologists. While the participants in the study may be typical of a district general hospital, the nature of the study gives it limited external validity. As a pilot, the results demonstrate that, with slight modification, the methodology could be used for a larger study

  7. High Performance, Low Temperature Solution-Processed Barium and Strontium Doped Oxide Thin Film Transistors


    Banger, Kulbinder K.; Peterson, Rebecca L.; Mori, Kiyotaka; Yamashita, Yoshihisa; Leedham, Timothy; Sirringhaus, Henning


    Amorphous mixed metal oxides are emerging as high performance semiconductors for thin film transistor (TFT) applications, with indium gallium zinc oxide, InGaZnO (IGZO), being one of the most widely studied and best performing systems. Here, we investigate alkaline earth (barium or strontium) doped InBa(Sr)ZnO as alternative, semiconducting channel layers and compare their performance of the electrical stress stability with IGZO. In films fabricated by solution-processing from metal alkoxide ...

  8. Phase conjugation, isotropic and anisotropic higher order diffraction generation, and image correlation using photorefractive barium titanate (United States)

    Buranasiri, Prathan


    Using barium titanate as the photorefractive material, we demonstrate phase conjugation, beam coupling, higher diffraction order generation. At small incident angles less than 0.015 radian, both codirectional isotropic self-diffraction (CODIS) and contradirectional isotropic self-diffraction (CONDIS) are generated simultaneously. At bigger incident angles approximately more than 0.2094 radian, only codirectional anisotropic-self diffraction (CODAS) are generated. On going imaging correlation is also showing.

  9. Barium ferrite/epoxy resin nanocomposite system: Fabrication, dielectric, magnetic and hydration studies


    A. Kanapitsas; C. Tsonos; G. C. Psarras; S. Kripotou


    Composite systems of epoxy resin and barium ferrite nanoparticles have been prepared, and studied varying the content of the inclusions. Morphology of prepared samples has been examined via scanning electron microscopy and X-ray diffraction spectra, while electrical and magnetic properties were investigated by means of broadband dielectric spectroscopy, and magnetization tests respectively. Finally, water vapor sorption measurements were conducted in order to study the water sorption dynamics...

  10. Neutron Beam Tests of Barium Fluoride Crystal for Dark Matter Direct Detection

    CERN Document Server

    Guo, Cong; Wang, Zhimin; Bao, Jie; Dai, Changjiang; Guan, Mengyun; Liu, Jinchang; Li, Zuhao; Ren, Jie; Ruan, Xichao; Yang, Changgen; Yu, Zeyuan; Zhong, Weili


    In order to test the capabilities of Barium Fluoride (BaF2) Crystal for dark matter direct detection, nuclear recoils are studied with mono-energetic neutron beam. The energy spectra of nuclear recoils, quenching factors for elastic scattering neutrons and discrimination capability between neutron inelastic scattering events and {\\gamma} events are obtained for various recoil energies of the F content in BaF2.

  11. Effect of boric acid sintering aid on densification of barium ferrite

    Indian Academy of Sciences (India)

    S S Vidyawathi; R Amaresh; L N Satapathy


    Boric acid has been added in 0.1–0.6% range for studying the densification characteristics of solid state sintered barium hexaferrite. Sintering studies have been carried out at three different temperatures. Physical properties like density and porosity have been studied for all compositions. The phase identification and microstructural investigation on the fractured surface have been carried out to understand the effect of sintering aid on the densification characteristics.

  12. Modification of gray iron produced by induction melting with barium strontium (United States)

    Modzelevskaya, G.; Feoktistov, A. V.; Selyanin, I. F.; Kutsenko, A. I.; Kutsenko, A. A.


    The article provides analysis of results of gray iron experimental melts in induction furnace and the following melt modification with barium-strontium carbonate (BSC-2). It is shown that modification positively affects mechanical and casting properties and as-cast iron structure. It was established that BSC-2 granulated immediately prior to use has greater impact on melt than BSC-2 of the same faction, supplied by the manufacturer.

  13. Electrical Properties of Thin-Film Capacitors Fabricated Using High Temperature Sputtered Modified Barium Titanate


    Robert Mamazza; Heinz Felzer; Martin Dubs; Glyn J. Reynolds; Martin Kratzer


    Simple thin-film capacitor stacks were fabricated from sputter-deposited doped barium titanate dielectric films with sputtered Pt and/or Ni electrodes and characterized electrically. Here, we report small signal, low frequency capacitance and parallel resistance data measured as a function of applied DC bias, polarization versus applied electric field strength and DC load/unload experiments. These capacitors exhibited significant leakage (in the range 8–210 μA/cm2) and dielectric loss. Measur...

  14. The use of radioanalytical methods in nucleation and crystal growth studies. The barium sulphate system

    International Nuclear Information System (INIS)

    The spontaneous precipitation of barium sulphate in aqueous solutions was followed by counting the 131Ba specific activity in the aqueous phase. The main advantages of this method were the increased sensitivity and the possibility of monitoring the process to a larger extent in comparison with other techniques. Kinetics parameters including the size of the critical nucleus and the surface energy of the precipitating solid were estimated according to the model for polynuclear growth. (Author)

  15. Establishment of a protocol for determining gastrointestinal transit time in mice using barium and radiopaque markers

    Energy Technology Data Exchange (ETDEWEB)

    Myagmarjaibuu, Bilomaa; Moon, Myeong Ju; Heo, Suk Hee; Jeong, Seo In; Jeong, Yong Yeon; Kang, Heoung Keun [Dept. of Radiology, Chonnam National University Hwasun Hospital, Chonnam National University Medical School, Hwasun (Korea, Republic of); Park, Jong Seong [Dept. of Physiology, Chonnam National University Medical School, Gwangju (Korea, Republic of); Jun, Jae Yeoul [Dept. of Physiology, College of Medicine, Chosun University, Gwangju (Korea, Republic of)


    The purpose of this study was to establish a minimally invasive and reproducible protocol for estimating the gastrointestinal (GI) transit time in mice using barium and radiopaque markers. Twenty 5- to 6-week-old Balb/C female mice weighing 19-21 g were used. The animals were divided into three groups: two groups that received loperamide and a control group. The control group (n = 10) animals were administered physiological saline (1.5 mL/kg) orally. The loperamide group I (n = 10) and group II (n = 10) animals were administered 5 mg/kg and 10 mg/kg loperamide orally, respectively. Thirty minutes after receiving the saline or loperamide, the mice was administered 80 μL of barium solution and six iron balls (0.5 mm) via the mouth and the upper esophagus by gavage, respectively. Afterwards, the mice were continuously monitored with fluoroscopic imaging in order to evaluate the swallowing of the barium solution and markers. Serial fluoroscopic images were obtained at 5- or 10-min intervals until all markers had been excreted from the anal canal. For analysis, the GI transit times were subdivided into intestinal transit times (ITTs) and colon transit times (CTTs). The mean ITT was significantly longer in the loperamide groups than in the control group (p < 0.05). The mean ITT in loperamide group II (174.5 ± 32.3) was significantly longer than in loperamide group I (133.2 ± 24.2 minute) (p < 0.05). The mean CTT was significantly longer in loperamide group II than in the control group (p < 0.05). Also, no animal succumbed to death after the experimental procedure. The protocol for our study using radiopaque markers and barium is reproducible and minimally invasive in determining the GI transit time of the mouse model.

  16. Hybrid Nd-Fe-B/barium ferrite magnetic materials with epoxy matrix


    Stajčić Aleksandar P.; Stajić-Trošić Jasna T.; Aleksić Radoslav R.; Žák Tomáš; Lazić Nada L.; Stijepović Mirko Z.; Grujić Aleksandar S.


    Lately a great attention has been paid to the research of bonded hybrid composites with improved dynamic mechanical capacities capable of replacing bonded Nd-Fe-B magnetic materials, by using the cheaper (ferrite) materials instead of the Nd-Fe-B powder while retaining the satisfying values of the maximal magnetic energy. The objective of this study is to assess how different contents of Nd-Fe-B and/or barium ferrite particles can affect morphological, dynamic mechanical and magnetic pr...

  17. Transfer of cadmium and barium from soil to crops grown in tropical soils


    Leônidas Carrijo Azevedo Melo; Evandro Barbosa da Silva; Luís Reynaldo Ferracciú Alleoni


    Phytotoxicity and transfer of potentially toxic elements, such as cadmium (Cd) or barium (Ba), depend on the availability of these elements in soils and on the plant species exposed to them. With this study, we aimed to evaluate the effect of Cd and Ba application rates on yields of pea (Pisum sativum L.), sorghum (Sorghum bicolor L.), soybean (Glycine max L.), and maize (Zea mays L.) grown under greenhouse conditions in an Oxisol and an Entisol with contrasting physical and chemical properti...

  18. Growth and study of barium oxalate single crystals in agar gel

    Indian Academy of Sciences (India)

    P V Dalal; K B Saraf


    Barium oxalate was grown in agar gel at ambient temperature. The effect of various parameters like gel concentration, gel setting time and concentration of the reactants on the growth of these crystals was studied. Prismatic platy shaped spherulites and dendrites were obtained. The grown crystals were characterized by X-ray powder diffractometry, infrared spectroscopy, thermogravimetric and differential thermal analysis. An attempt is made to explain the spherulitic growth mechanism.

  19. Randomized clinical trial on the use of antispasmodic drugs in barium enema: impact on radiological practice

    International Nuclear Information System (INIS)

    Purpose: To assess the willingness of radiologists to change their practice when the results of a randomized clinical trial (RCT) on the use of antispasmodic drugs in barium enema are presented. Materials and Methods: During the years 1994 and 1995 two postal questionnaires were sent to 481 practicing radiologists who were all members of the Netherlands Society of Radiology. In the first questionnaire the respondents were asked to give the characteristics of their practices in performing daily barium enema. The data from this questionnaire was used as a reference. The second questionnaire was sent to the respondents together with an abstract on the randomized clinical trial supporting the use of antispasmodic drugs in barium enema. We also indicated a preference for Buscopan over Glucagon as the antispasmodic drug. The willingness to change prescription habits was measured by comparing the data of the two questionnaires. Results: Of 481 practicing radiologists, 312 responded to the first questionnaire and gave information of their prescription habits (response rate 64%). These 312 responders were sent an abstract of the RCT and were asked to fill out a second questionnaire to determine their willingness to change their practice. Two hundred and sixty-seven radiologists responded (response rate 86%). A significant number of 119 (51%) were willing to increase the use of antispasmodic drugs. A significant number of 128 (55%) chose to increase the use of Buscopan, while a significant number of 81 (32%) were willing to decrease the use of Glucagon. Conclusion: Direct exposure to the results of an RCT recommending the use of antispasmodic drugs in barium enema, especially Buscopan, is likely to increase its use by practicing radiologists

  20. Yield and ion distribution for the barium cloud at 31,000 kilometers, September 21, 1971. (United States)

    Manring, E. R.; Patty, R. R.


    The photon flux density associated with the 4554-A resonance radiation for Ba II was measured at Mount Hopkins, Arizona, and Cerro Morado, Chile, and was determined to be 36,000 photon/sq cm sec outside the atmosphere; this measurement was made when the cloud was optically thin at 120 sec after release. Using this and a photon scattering efficiency of 0.66 photon/ion sec we estimate a 1.7-kg yield of barium ions that are formed from the initially released atomic barium and are thus associated with the main core of the cloud. Photographic and photometric data are combined to obtain preliminary values for the brightness throughout the cloud for two photographs, and isobrightness plots are presented. These plots indicate that the cloud is quite narrow, that a considerable portion of the ionized barium is outside the main core after a few minutes, and that the striations contain only a small fraction of the total material.

  1. Luminescence of Er3+ Doped Titanium Barium Glass Microsphere under 514 nm Excitation

    Institute of Scientific and Technical Information of China (English)


    The titanium barium glass microspheres doped with Er2O3 were designed and prepared. The components of the glass sample were 25TiO2-27BaCO3-8Ba(NO3)2-5ZnO2-10CaCO3-5H3BO3-10SiO2-7water glass-3Er2O3 (%, mass fraction). The emission spectra of titanium barium glass matrix and the titanium barium glass microsphere under 514 nm excitation were measured with micro-Raman spectrometer. Whispering gallery modes in the emission spectra from a 31 μm glass microsphere were observed. Many regularly spaced, sharp peaks appeared in the emission spectra of the Er2O3-doped glass microsphere. The wavelength separation between the two adjacent peaks is 1.92 nm for the 31 μm microsphere. According to the Lorenz-Mie formula, the calculated value of the wavelength separation between the two adjacent peaks is 1.95 nm. The observed resonances could be assigned by using the well-known Lorenz-Mie formula.

  2. An effective quantum defect theory for the diamagnetic spectrum of a barium Rydberg atom

    Institute of Scientific and Technical Information of China (English)

    Li Bo; Liu Hong-Ping


    A theoretical calculation is carried out to investigate the spectrum of a barium Rydberg atom in an external magnetic field.Using an effective approach incorporating quantum defect into the centrifugal term in the Hamiltonian,we reexamine the reported spectrum of the barium Rydberg atom in a magnetic field of 2.89 T [J.Phys.B 28 L537 (1995)].Our calculation employs B-spline basis expansion and complex coordinate rotation techniques.For single photon absorption from the ground 6s2 to 6snp Rydberg states,the spectrum is not influenced by quantum defects of channels ns and nd.The calculation is in agreement with the experimental observations until the energy reaches E =-60 cm-1.Beyond this energy,closer to the threshold,the calculated and experimental results do not agree with each other.Possible reasons for their discrepancies are discussed.Our study affirms an energy range where the diamagnetic spectrum of the barium atom can be explained thoroughly using a hydrogen model potential.

  3. Effects of Dysprosium Oxide Doping on Microstructure and Properties of Barium Titanate Ceramic

    Institute of Scientific and Technical Information of China (English)

    Pu Yongping; Ren Huijun; Chen Wei; Chen Shoutian


    Different amounts of dysprosium oxide were incorporated into barium titanate powders synthesized by hydrothermal method. Relations of substitution behaviors and lattice parameters with solid-solubility were studied. Furthermore, the influences of dysprosium oxide doping fraction on grain size and dielectric properties of barium titanate ceramic, including dielectric constant and breakdown electric field strength, were investigated via scanning electron microscope, X-ray diffraction and electric property tester. The results show that dysprosium oxide can restrain abnormal grain growth during sintering and that fine-grained and high density of barium titanate ceramic can result in excellent dielectric properties. As mass fraction of dysprosium oxide is 0.6%, the lattice parameters of grain increase to the maximum because of the lowest vacancy concentration. The electric property parameters are cited as following: dielectric constant (25 ℃) reaches 4100, the change in relative dielectric constant with temperature is -10% to 10% within the range of -15~100 ℃, breakdown electric field strength (alternating current) achieves 3.2 kV·mm-1, which can be used in manufacturing high voltage ceramic capacitors.

  4. Er3+-substituted W-type barium ferrite: preparation and electromagnetic properties

    Institute of Scientific and Technical Information of China (English)



    Er3+-substituted W-type barium ferrites Ba1-xErx(Zn0.3Co0.7)2Fe16O27(x=0.00,0.05,0.10,0.15,0.20)were synthesized by polymer adsorbent combustion method.Samples were characterized by X-ray diffraction analysis(XRD),X-ray fluorescence(XRF),scanning electron microscopy(SEM)and network analyzer to investigate the relationships among Er3+concentration,crystal structure,surface mcrphology and electromagnetic properties.All the XRD patterns showed pure phase of W-type barium ferrite when x≤0.15,while the impurity phase of ErFeO3 appeared when x=0.20.The pure W-type barium ferrite showed a hexagonal flake shape.In addition,the microwave electromagnetic properties of samples were analyzed in the frequency range of 2-18 GHz.It was indicated that the electromagnetic properties were significantly improved when Er3+doping content was 0.10.The reasons were also discussed using electromagnetic theory.The optimized ferrite exhibited excellent microwave absoption performance.The maximum of reflection loss(RL)reached about-27.4 dB and RL was below-10dB at the frequency range from 8.4 GHz to 18 GHz,when the thickness was 2.6 mm.

  5. A barium central star binary in the Type-I diamond ring planetary nebula Abell 70

    CERN Document Server

    Miszalski, B; Frew, D J; Acker, A; Köppen, J; Moffat, A F J; Parker, Q A


    Abell 70 (PN G038.1-25.4, hereafter A 70) is a planetary nebula (PN) known for its diamond ring appearance due a superposition with a background galaxy. The previously unstudied central star is found to be a binary consisting of a G8IV-V secondary at optical wavelengths and a hot white dwarf (WD) at UV wavelengths. The secondary shows Ba II and Sr II features enhanced for its spectral type that, combined with the chromospheric Halpha emission and possible 20-30 km/s radial velocity amplitude, firmly classifies the binary as a Barium star. The proposed origin of Barium stars is intimately linked to PNe whereby wind accretion pollutes the companion with dredged-up material rich in carbon and s-process elements when the primary is experiencing thermal pulses on the Asymptotic Giant Branch (AGB). A 70 provides further evidence for this scenario together with the other very few examples of Barium central stars. The nebula is found to have Type-I chemical abundances with helium and nitrogen enrichment, which when c...

  6. Hydrothermal Synthesis and Characterization of Europium-dop ed Barium Titanate Nano crys-tallites

    Institute of Scientific and Technical Information of China (English)

    Margarita Garca-Hernandez; Genevieve Chadeyron; Damien Boyer; Antonieta Garca-Murillo; Felipe Carrillo-Romo; Rachid Mahiou


    Barium titanate nanocrystallites were synthesized by a hydrothermal technique from barium chlo-ride and tetrabutyl titanate. Single-crystalline cubic perovskite BaTiO3 consisting of spherical particles with diameters ranging from 10 to 30 nm was easily achieved by this route. In order to study the influence of the syn-thesis process on the morphology and the optical properties, barium titanate was also prepared by a solid-state reaction. In this case, only the tetragonal phase which crystallizes above 900℃ was observed. High-temperature X-ray diffraction measurements were performed to investigate the crystallization temperatures as well as the particle sizes via the Scherrer formula. The lattice vibrations were evidenced by infrared spectroscopy. Eu3+was used as a structural probe, and the luminescence properties recorded from BaTiO3:Eu3+and elaborated by a solid-state reaction and hydrothermal process were compared. The reddish emission of the europium is increased by the nanometric particles.

  7. Studies of the processes of incorporation of calcium, strontium, barium and radium into bone tissue

    International Nuclear Information System (INIS)

    Alkaline earth elements incorporation into bone tissue are investigated. The study is aimed at collecting the data on improvement of metabolism model of these elements. The study includes kinetics of calcium, strontium, barium and radium - carried out on 120 rats of Wistar strain: incorporation processes of light and heavy alkaline earth elements (strontium and barium) as a function of age of the organism - carried out on 30 rabbits of Chinchilla strain in different age groups, as well as the rate of incorporation of calcium and barium into different bone tissue areas - carried out on 68 rabbits of the same strain in one age group. The main investigative techniques are: radiochemical methods, whole-body counting technique, quantitative autoradiography and microradiography, ''tetracycline test'', computer calculation methods. The following conclusions are reached: incorporation of alkaline earth elements into bone tissue is differentiated and depends on whether or not it is a light element (Ca, Sr) or heavy one (Ba, Ra), it depends also on the area of bone tissue in which the incorporation occurs

  8. A Preliminary Trial on the Use of Barium Chloride for Pregnancy Diagnosis in Sows

    Directory of Open Access Journals (Sweden)

    Ndu, A.


    Full Text Available Urine was collected twice daily (once in the morning and once in the afternoon for 5 days from 80 Yorkshire x Landrace crossbred gilts/sows made up of 40 non-pregnant and 40 pregnant pigs in an investigation to determine the possibility of using 1 % barium chloride solution for pregnancy diagnosis in pigs based on a previous report that addition of a few drops of 1 % barium chloride solution to bovine urine caused a white precipitate with non-pregnant but not with pregnant cows. The pregnant pigs were in various stages of gestation. Urine reaction to 1 % barium chloride was highly (P <0.01 dependent on the pregnancy status of the sows, the test being 100 % and 81 % effective in identifying non-pregnant and pregnant sows respectively. The sensitivity of the test in the gravid sows was significantly (P <0.05 influenced by and tended to increa-se with the stage of gestation, with 59 % of the sows in their first stage of gestation (<38 days post-coitum being correctly diagnosed as pregnant, and 95-100 % of those in their latter stages of gestation being so correctly diagnosed. Parity and time of day of performance of the test had no effect on urine reaction. It was concluded that the test was at least 95 % accurate when used as from about 39 days after breeding for pregnancy diagnosis in sows.

  9. Electric fields and plasma waves resulting from a barium injection experiment

    International Nuclear Information System (INIS)

    A shaped-charge, barium plasma injection experiment was performed in June 1976 from the DOE Kauai test facility. The rocket payload contained seven shaped charges, a sevenfold larger package than the typical payloads employed in previous barium plasma injections conducted in this program. An attitude control system oriented the injection perpendicular to the local geomagnetic field. The injection altitude was 450 km. The second-stage motor section contained a payload to measure dc and ac electric fields using a 5-m-long, tip-to-tip dual spherical probe antenna. The ac electric field frequency response was from 100 Hz to 12 kHz. The dc channel responds up to 160 Hz. Shortly after the detonation, the dc electric field was parallel to the geomagnetic field. A few seconds later the measured electric field was the v x B field induced by the motion of the antenna through the plasma. A variety of plasma waves were detected for approximately 20 s following the injection. The initial impulse in the dc channel was measured to be 115 mV/m. The injection generated barium cyclotron waves at 3.4, 7.2, and 10.6 Hz. The barium gyrofrequency at the altitude of the injection was 3.3 Hz. The initial amplitude at 3.4 Hz was 25 mV/m peak-to-peak. These waves were evident in the data for approximately 6 s. Between 3 and 8 after the explosion, band-limited noise was intermittently present between 1.6 and 3.2 kHz. These emissions were lower-hybrid-resonance emissions in a barium plasma. The instability responsible for these emissions is tentatively identified as the modified two-stream instability. Wide-band noise with a decreasing intensity as a function of frequency in the band from 100 Hz to 5 kHz was present from 4 to 30 s following the explosion. The intensity maximized when the antenna was most nearly parallel to the geomagnetic field. This suggests that the waves were ion acoustic waves. Highly structured emission occurred between 500 Hz for several seconds after the explosion

  10. Mobility and fluorescence of barium ions in xenon gas for the exo experiment (United States)

    Benitez Medina, Julio Cesar

    The Enriched Xenon Observatory (EXO) is an experiment which aims to observe the neutrinoless double beta decay of 136Xe. The measurement of this decay would give information about the absolute neutrino mass and whether or not the neutrino is its own antiparticle. Since this is a very rare decay, the ability to reject background events by detecting the barium ion daughter from the double beta decay would be a major advantage. EXO is currently operating a detector with 200 kg of enriched liquid xenon, and there are plans to build a ton scale xenon detector. Measurements of the purity of liquid xenon in our liquid xenon test cell are reported. These results are relevant to the research on detection of single barium ions by our research group at Colorado State University. Details of the operation of the purity monitor are described. The effects of using a purifier, recirculation and laser ablation on the purity of liquid xenon are discussed. Mobility measurements of barium in xenon gas are reported for the first time. The variation of mobility with xenon gas pressure suggests that a significant fraction of molecular ions are formed when barium ions interact with xenon gas at high pressures. The measured mobility of Ba+ in Xe gas at different pressures is compared with the predicted theoretical value, and deviations are explained by a model that describes the fraction of molecular ions in Xe gas as a function of pressure. The results are useful for the analysis of experiments of fluorescence of Ba+ in xenon gas. It is also important to know the mobility of the ions in order to calculate the time they interact with an excitation laser in fluorescence experiments and in proposed 136 Ba+ daughter detection schemes. This thesis presents results of detection of laser induced fluorescence of Ba+ ions in Xe gas. Measurements of the pressure broadening of the excitation spectra of Ba+ in xenon gas are presented. Nonradiative decays due to gas collisions and optical pumping

  11. Comparison of Barium and Arsenic Concentrations in Well Drinking Water and in Human Body Samples and a Novel Remediation System for These Elements in Well Drinking Water (United States)

    Kato, Masashi; Kumasaka, Mayuko Y.; Ohnuma, Shoko; Furuta, Akio; Kato, Yoko; Shekhar, Hossain U.; Kojima, Michiyo; Koike, Yasuko; Dinh Thang, Nguyen; Ohgami, Nobutaka; Ly, Thuy Bich; Jia, Xiaofang; Yetti, Husna; Naito, Hisao; Ichihara, Gaku; Yajima, Ichiro


    Health risk for well drinking water is a worldwide problem. Our recent studies showed increased toxicity by exposure to barium alone (≤700 µg/L) and coexposure to barium (137 µg/L) and arsenic (225 µg/L). The present edition of WHO health-based guidelines for drinking water revised in 2011 has maintained the values of arsenic (10 µg/L) and barium (700 µg/L), but not elements such as manganese, iron and zinc. Nevertheless, there have been very few studies on barium in drinking water and human samples. This study showed significant correlations between levels of arsenic and barium, but not its homologous elements (magnesium, calcium and strontium), in urine, toenail and hair samples obtained from residents of Jessore, Bangladesh. Significant correlation between levels of arsenic and barium in well drinking water and levels in human urine, toenail and hair samples were also observed. Based on these results, a high-performance and low-cost adsorbent composed of a hydrotalcite-like compound for barium and arsenic was developed. The adsorbent reduced levels of barium and arsenic from well water in Bangladesh and Vietnam to <7 µg/L within 1 min. Thus, we have showed levels of arsenic and barium in humans and propose a novel remediation system. PMID:23805262

  12. Comparison of Barium and Arsenic Concentrations in Well Drinking Water and in Human Body Samples and a Novel Remediation System for These Elements in Well Drinking Water.

    Directory of Open Access Journals (Sweden)

    Masashi Kato

    Full Text Available Health risk for well drinking water is a worldwide problem. Our recent studies showed increased toxicity by exposure to barium alone (≤700 µg/L and coexposure to barium (137 µg/L and arsenic (225 µg/L. The present edition of WHO health-based guidelines for drinking water revised in 2011 has maintained the values of arsenic (10 µg/L and barium (700 µg/L, but not elements such as manganese, iron and zinc. Nevertheless, there have been very few studies on barium in drinking water and human samples. This study showed significant correlations between levels of arsenic and barium, but not its homologous elements (magnesium, calcium and strontium, in urine, toenail and hair samples obtained from residents of Jessore, Bangladesh. Significant correlation between levels of arsenic and barium in well drinking water and levels in human urine, toenail and hair samples were also observed. Based on these results, a high-performance and low-cost adsorbent composed of a hydrotalcite-like compound for barium and arsenic was developed. The adsorbent reduced levels of barium and arsenic from well water in Bangladesh and Vietnam to <7 µg/L within 1 min. Thus, we have showed levels of arsenic and barium in humans and propose a novel remediation system.

  13. WASP-113b and WASP-114b, two inflated hot Jupiters with contrasting densities (United States)

    Barros, S. C. C.; Brown, D. J. A.; Hébrard, G.; Gómez Maqueo Chew, Y.; Anderson, D. R.; Boumis, P.; Delrez, L.; Hay, K. L.; Lam, K. W. F.; Llama, J.; Lendl, M.; McCormac, J.; Skiff, B.; Smalley, B.; Turner, O.; Vanhuysse, M.; Armstrong, D. J.; Boisse, I.; Bouchy, F.; Collier Cameron, A.; Faedi, F.; Gillon, M.; Hellier, C.; Jehin, E.; Liakos, A.; Meaburn, J.; Osborn, H. P.; Pepe, F.; Plauchu-Frayn, I.; Pollacco, D.; Queloz, D.; Rey, J.; Spake, J.; Ségransan, D.; Triaud, A. H. M.; Udry, S.; Walker, S. R.; Watson, C. A.; West, R. G.; Wheatley, P. J.


    Aims: We present the discovery and characterisation of the exoplanets WASP-113b and WASP-114b by the WASP surveys, SOPHIE and CORALIE. Methods: The planetary nature of the systems was established by performing follow-up photometric and spectroscopic observations. The follow-up data were combined with the WASP-photometry and analysed with an MCMC code to obtain system parameters. Results: The host stars WASP-113 and WASP-114 are very similar. They are both early G-type stars with an effective temperature of ~5900 K, [Fe/H] ~ 0.12, and log g~ 4.1 dex. However, WASP-113 is older than WASP-114. Although the planetary companions have similar radii, WASP-114b is almost four times heavier than WASP-113b. WASP-113b has a mass of 0.48 MJup and an orbital period of ~4.5 days; WASP-114b has a mass of 1.77 MJup and an orbital period of ~1.5 days. Both planets have inflated radii, in particular WASP-113 with a radius anomaly of ℜ = 0.35. The high scale height of WASP-113b (~950 km) makes it a good target for follow-up atmospheric observations.

  14. TX-114+TBAB体系中非电解质对CP的影响%Nonelectrolyte-Induced CP Variation of TX-114+TBAB System

    Institute of Scientific and Technical Information of China (English)

    KABIR-UD-DIN; KHATOON Suraiya; NAQVI Andleeb Z.


    The effects of nonelectrolytes(ureas,amino acids,sugars)on the cloud point(CP)of nonionic surfactantTriton X-114(TX-114)and tetra-n-butylammonium bromide(TBAB)system were studied.Ureas as well as thioureasincreased the CP.Behaviors of amino acids depended upon their nature.Nonpolar and uncharged polar anlino acidswere less effective in changing the CP.However,tryptophan and phenylalanine increased the CP sharply.Acidicamino acid(aspartic acid)and sugars decreased the CP.The results were explained in terms of their effect on waterstructure.Amino acids got solubilized either in the micellar interior or in the bulk phase.

  15. 数据访问JSR 114比拼ADO.NET

    Institute of Scientific and Technical Information of China (English)



    作为未来J2SE 5类库的一部分,JSR 114的主要贡献在于对原有JDBC数据库访问技术的完善和改进。JSR 114旨在定义一个JDBC RowSet模型的标准实现,其正式名称为“JDBC RowSet Implementations Specification”。本文所论及的便是笔者对JSR 114的一点粗浅印象,同时还将对比.NET Framework中的ADO.NET技术。

  16. Effect of heat treatment on the phase composition, structure and magnetic properties of M-type barium hexaferrite

    International Nuclear Information System (INIS)

    Effect of the heat treatment of carbonate-hydroxide precipitates on the phase composition, structure and magnetic properties of M-type barium hexaferrite has been investigated using the Mőssbauer spectroscopy, X-ray phase analysis and magnetic measurements. The distribution of Fe3+ ions over structural sites of barium hexaferrite with different degree of ferritizations has been defined. The conditions of single-domain behavior of barium hexaferrite nanoparticles in the magnetic field have been discussed. Obtained results explain the formation of magnetic structure during the synthesis of barium hexaferrite. This information could further be used for optimizing conditions for synthesis of nanosized barium hexaferrite with high-level properties. - Highlights: • In the T=973–1273 K range, BaFe12O19 (BHF) phase are formed from precipitates. • Fe3+ ions prefer to occupy 12k,2a,2b (at 1073 K) and 4f1,4f2 (at 1273 K) sites. • The most favorable magnetic structure for high Ms forms at T=1073 K. • The presence of 5–10% of α-Fe2O3 phase can improve magnetic properties of BHF

  17. High-Jc YBCO films using precursors with barium concentration gradient in film thickness by TFA-MOD process

    International Nuclear Information System (INIS)

    YBa2Cu3O7-δ (YBCO) films were grown by using precursor films with barium concentration gradient in film thickness by an advanced metal organic deposition process using trifluoroacetates (TFA-MOD). We have reported previously that a lot of non-reacted particles such as Y- and Cu-oxides were remained for the YBCO film surface grown by the precursors using a starting solution with barium-poor (cation ratio as Y:Ba:Cu 1:1.5:3). Then, the barium concentration was increased in the film surface to complete the reaction among these Y and Cu residues and Ba and to increase the Y123 growth thickness for realizing higher Jc performance. Transmission electron microscopy (TEM) observation showed the increase of film thickness of YBCO grown by the precursors with barium concentration gradient in film thickness, indicating that the reaction between these Y and Cu-oxides and Ba proceeded to form Y123 phase. Consequently, higher Jc was obtained for the YBCO film by the precursors mentioned above than that of the YBCO film by the precursors with a constant concentration. Effects of barium concentration gradient in the precursors on the superconducting properties and microstructures in the YBCO film were discussed.

  18. A study of the Arrhenius behavior of the co-precipitation of radium, barium and strontium sulfate

    International Nuclear Information System (INIS)

    Co-precipitation of radium, barium and strontium is an important process in many contexts, such as uranium mining, oil extraction and in the safety assessment of a final repository for used nuclear fuel. Co-precipitation to a solid solution is possible since radium, barium and strontium act as chemical analogues. In this work the co-precipitation of radium, barium and strontium was studied and the kinetic behavior of the co-precipitation process was investigated. It was shown that radium, barium and strontium co-precipitate congruently and that the precipitation followed an Arrhenius behavior and the Arrhenius parameters for the systems was determined. When studying the differences of the Arrhenius constants by using a student t test (95 % confidence interval) it was observed that the only significant difference in the activation energy, Ea, is between radium and barium and between radium and strontium respectively, the pure strontium having the larger activation energy in comparison. This is most likely coupled to the metal ion size; since the hydration waters are more strongly bound, which leads to them having a slower exchange rate, which in turn effects the rate of co-precipitation to the metal these reactions will be slower. (author)

  19. Barium meal follow through with pneumocolon: Screening test for chronic bowel pain

    Institute of Scientific and Technical Information of China (English)

    Sandeep Nijhawan; Saket Kumpawat; P Mallikarjun; RP Bansal; Dinesh Singla; Prachis Ashdhir; Amit Mathur; Ramesh Roop Rai


    AIM:To study the sensitivity,specificity and cost effectiveness of barium meal follow through with pneumocolon (BMFTP) used as a screening modality for patients with chronic abdominal pain of luminal origin in developing countries.METHODS:Fifty patients attending the Gastroenterology Unit,SMS Hospital,whose clinical evaluation revealed chronic abdominal pain of bowel origin were included in the study.After routine testing,BMFT,BMFTP,contrast enhanced computed tomography (CECT) of the abdomen,barium enema and colonoscopy were performed.The sensitivity,specificity and cost effectiveness of these imaging modalities in the detection of small and/or large bowel lesions were compared.RESULTS:Out of fifty patients,structural pathology was found in ten.Nine out of these ten patients had small bowel involvement while seven had colonic involvement alone or in combination with small bowel involvement.The sensitivity of BMFTP was 100% compared to 88.89% with BMFT when detecting small bowel involvement (BMFTP detected one additional patient with ileocecal involvement).The sensitivity and specificity of BMFTP for the detection of colonic pathology were 85.71% and 95.35%(41/43),respectively.Screening a patient with chronic abdominal pain (bowel origin) using a combination of BMFT and barium enema cost significantly more than BMFTP while their sensitivity was almost comparable.CONCLUSION:BMFTP should be included in the investigative workup of patients with chronic abdominal pain of luminal origin,where either multiple sites (small and large intestine) of involvement are suspected or the site is unclear on clinical grounds.BMFTP is an economical,quick and comfortable procedure which obviates the need for colonoscopy in the majority of patients.

  20. Microstructure and magnetic properties of Al-doped barium ferrite with sodium citrate as chelate agent

    Energy Technology Data Exchange (ETDEWEB)

    Chen, Daming, E-mail: [State Key Laboratory of Electronic Films and Integrated Devices, University of Electronic Science and Technology of China, Chengdu 610054 (China); Liu, Yingli, E-mail: [State Key Laboratory of Electronic Films and Integrated Devices, University of Electronic Science and Technology of China, Chengdu 610054 (China); Li, Yuanxun; Yang, Kai; Zhang, Huaiwu [State Key Laboratory of Electronic Films and Integrated Devices, University of Electronic Science and Technology of China, Chengdu 610054 (China)


    In this paper, M-type Al-doped barium ferrites were successfully synthesized using sodium citrate (SC) as the chelate agent by a chemical process complemented by a suitable thermal treatment of the precursor. It was found in TGA/DTA and XRD analysis that the crystallization and formation of single phase BaM had completed before 860 °C. The XRD data also confirmed Al substituting into Fe sites. Meanwhile, it can be seen from the SEM images that the particle size and morphology were not affected by Al doping. However, Al substitution played an important role on the magnetic properties. The saturation magnetization (M{sub s}) of BaAl{sub x}Fe{sub 12−x}O{sub 19} decreased from 51.43 emu/g for the sample with x=0 to 28.32 emu/g at x=1.5. The anisotropy field (H{sub a}), however, increased from 16.21 kOe to 25.01 kOe. In addition, M{sub s} increased with enhancing the ratio of SC/Ba{sup 2+}(molar ratio), reaching a maximum when SC/Ba{sup 2+} was 13. - Highlights: ► Doped barium ferrite was successfully synthesized using sodium citrate as chelate agent. ► Sodium citrate allows the mixing of metal cations in the as-synthesized barium ferrite. ► The radio of Sodium citrate/Ba{sup 2+} pay an important effect on magnetic properties.

  1. Curie temperature and magnetic properties of aluminum doped barium ferrite particles prepared by ball mill method

    Energy Technology Data Exchange (ETDEWEB)

    Chen, Daming [Center for Magnetism and Magnetic Nanostructures, University of Colorado at Colorado Springs, 1420 Austin Bluffs Pkwy, Colorado Springs, Colorado 80918 (United States); College of Materials and Chemical Engineering, Hainan University, Haikou 570228, Hainan (China); Harward, Ian; Baptist, Joshua; Goldman, Sara; Celinski, Zbigniew [Center for Magnetism and Magnetic Nanostructures, University of Colorado at Colorado Springs, 1420 Austin Bluffs Pkwy, Colorado Springs, Colorado 80918 (United States)


    Barium ferrite has attracted considerable interest in the fields of permanent magnets and perpendicular magnetic recording due to its strong uniaxial anisotropy and high Curie temperature (T{sub c}). We prepared aluminum doped barium ferrite ceramics (BaAl{sub x}Fe{sub 12−x}O{sub 19}, 0≤x≤6) by the ball mill method. The powder was milled for 96 h, and after forming pellets, annealed for 48 h in air at 1000 °C. The X-ray diffraction (XRD) data show that there are only single hexagonal phases in the samples without any impurity phase. The crystal lattice constants, a and c, were calculated by Cohen's method. Both a and c decrease with increasing x, ranging from 0.588 nm and 2.318 nm to 0.573 nm and 2.294 nm, respectively. A Vibrating Sample Magnetometer (VSM) and Superconducting Quantum Interference Device (SQUID) were used to investigate T{sub c} and magnetic properties of BaFe{sub 12−x}Al{sub x}O{sub 19}. It is found that T{sub c} decreases with increasing x, from 425 °C to 298 °C. It is also found that the saturated magnetization (4πM{sub s}) decreases with increasing x, while the coercivity (H{sub c}) increases with the increase in x. The anisotropy field was also determined from the SQUID measurement. - Highlights: • The Curie temperature and magnetic properties of aluminum doped barium ferrite particles were studied systemically. • The relation between 4πM{sub s} and composition x at 50 K (both experimental value and theoretical calculation) was revealed. • Occupation number for spin up and spin down as a function of temperature was shown. • The relation between 4πM{sub s} and composition x from 50 K to room temperature was revealed.

  2. Hydrothermal Synthesis and Processing of Barium Titanate Nanoparticles Embedded in Polymer Films. (United States)

    Toomey, Michael D; Gao, Kai; Mendis, Gamini P; Slamovich, Elliott B; Howarter, John A


    Barium titanate nanoparticles embedded in flexible polymer films were synthesized using hydrothermal processing methods. The resulting films were characterized with respect to material composition, size distribution of nanoparticles, and spatial location of particles within the polymer film. Synthesis conditions were varied based on the mechanical properties of the polymer films, ratio of polymer to barium titanate precursors, and length of aging time between initial formulations of the solution to final processing of nanoparticles. Block copolymers of poly(styrene-co-maleic anhydride) (SMAh) were used to spatially separate titanium precursors based on specific chemical interactions with the maleic anhydride moiety. However, the glassy nature of this copolymer restricted mobility of the titanium precursors during hydrothermal processing. The addition of rubbery butadiene moieties, through mixing of the SMAh with poly(styrene-butadiene-styrene) (SBS) copolymer, increased the nanoparticle dispersion as a result of greater diffusivity of the titanium precursor via higher mobility of the polymer matrix. Additionally, an aminosilane was used as a means to retard cross-linking in polymer-metalorganic solutions, as the titanium precursor molecules were shown to react and form networks prior to hydrothermal processing. By adding small amounts of competing aminosilane, excessive cross-linking was prevented without significantly impacting the quality and composition of the final barium titanate nanoparticles. X-ray diffraction and X-ray photoelectron spectroscopy were used to verify nanoparticle compositions. Particle sizes within the polymer films were measured to be 108 ± 5 nm, 100 ± 6 nm, and 60 ± 5 nm under different synthetic conditions using electron microscopy. Flexibility of the films was assessed through measurement of the glass transition temperature using dynamic mechanical analysis. Dielectric permittivity was measured using an impedance analyzer. PMID

  3. Intermediate milling energy optimization to enhance the characteristics of barium hexaferrite magnetic nanoparticles

    Energy Technology Data Exchange (ETDEWEB)

    Hodaei, A.; Ataie, A., E-mail:; Mostafavi, E.


    Highlights: • Nano-sized BaFe{sub 12}O{sub 19} was successfully synthesized via a solid-state reaction. • Intermediate milling energy was optimized to improve BaFe{sub 12}O{sub 19} properties. • Minimum total energy of 93.7 kJ/g was necessary for formation of BaFe{sub 12}O{sub 19}. • Deviation from the optimum milling energy deteriorates the magnetic properties. - Abstract: Nano-sized barium hexaferrite particles were synthesized by mechanical activation of BaCO{sub 3} and Fe{sub 2}O{sub 3} powders mixture as starting materials. The effects of mechanical milling energy on the phase composition, morphology, thermal behavior and magnetic properties of the samples were systematically investigated by employing X-ray diffractometer, field emission scanning electron microscopy, differential thermal/thermo gravimetry analysis and vibrating sample magnetometer, respectively. The milling energy was calculated at five different levels using collision model. It was found that there is an optimum milling energy value for obtaining barium hexaferrite phase. The results revealed that applying a minimum total milling energy of 93.7 kJ/g was necessary for formation of almost single barium hexaferrite at a relatively low calcination temperature of 800 °C. FESEM micrograph of the above sample exhibited nano-size particles with a mean particle size of 80 nm. Further increase in milling energy leads to dramatic decrease in phase purity as well as magnetic characteristics of the samples. By increasing the milling energy from 93.7 to 671.9 kJ/g, saturation magnetization (M{sub s}) decreased from 22.5 to 0.39 emu/g, and also coercivity (H{sub c}) decreased from 4.28 to 1.46 kOe.

  4. Intermediate milling energy optimization to enhance the characteristics of barium hexaferrite magnetic nanoparticles

    International Nuclear Information System (INIS)

    Highlights: • Nano-sized BaFe12O19 was successfully synthesized via a solid-state reaction. • Intermediate milling energy was optimized to improve BaFe12O19 properties. • Minimum total energy of 93.7 kJ/g was necessary for formation of BaFe12O19. • Deviation from the optimum milling energy deteriorates the magnetic properties. - Abstract: Nano-sized barium hexaferrite particles were synthesized by mechanical activation of BaCO3 and Fe2O3 powders mixture as starting materials. The effects of mechanical milling energy on the phase composition, morphology, thermal behavior and magnetic properties of the samples were systematically investigated by employing X-ray diffractometer, field emission scanning electron microscopy, differential thermal/thermo gravimetry analysis and vibrating sample magnetometer, respectively. The milling energy was calculated at five different levels using collision model. It was found that there is an optimum milling energy value for obtaining barium hexaferrite phase. The results revealed that applying a minimum total milling energy of 93.7 kJ/g was necessary for formation of almost single barium hexaferrite at a relatively low calcination temperature of 800 °C. FESEM micrograph of the above sample exhibited nano-size particles with a mean particle size of 80 nm. Further increase in milling energy leads to dramatic decrease in phase purity as well as magnetic characteristics of the samples. By increasing the milling energy from 93.7 to 671.9 kJ/g, saturation magnetization (Ms) decreased from 22.5 to 0.39 emu/g, and also coercivity (Hc) decreased from 4.28 to 1.46 kOe

  5. Small-scale fluctuations in barium drifts at high latitudes and associated Joule heating effects (United States)

    Hurd, L. D.; Larsen, M. F.


    Most previous estimates of Joule heating rates, especially the contribution of small-scale structure in the high-latitude ionosphere, have been based on incoherent scatter or coherent scatter radar measurements. An alternative estimate can be found from the plasma drifts obtained from ionized barium clouds released from sounding rockets. We have used barium drift data from three experiments to estimate Joule heating rates in the high-latitude E region for different magnetic activity levels. In particular, we are interested in the contribution of small-scale plasma drift fluctuations, corresponding to equivalent electric field fluctuations, to the local Joule heating rate on scales smaller than those typically resolved by radar or other measurements. Since Joule heating is a Lagrangian quantity, the inherently Lagrangian estimates provided by the chemical tracer measurements are a full description of the effects of electric field variance and neutral winds on the heating, differing from the Eulerian estimates of the type provided by ground-based measurements. Results suggest that the small-scale contributions to the heating can be more than a factor of 2 greater than the mean field contribution regardless of geomagnetic conditions, and at times the small-scale contribution is even larger. The high-resolution barium drift measurements, moreover, show that the fine structure in the electric field can be more variable than previous studies have reported for similar conditions. The neutral winds also affect the heating, altering the height-integrated Joule heating rates by as much as 12%, for the cases studied here, and modifying the height distribution of the heating profile as well.

  6. Nanosized barium hexaferrite in novolac phenolic resin as microwave absorber for X-band application

    Energy Technology Data Exchange (ETDEWEB)

    Ozah, S.; Bhattacharyya, N.S., E-mail:


    Nanosized barium ferrite (BaFe{sub 12}O{sub 19}) with Novolac phenolic resin (NPR) is developed as a magnetic absorber for application in the frequency range 8.2–12.4 GHz. The absorption is studied by modifying the microstructural properties of the ferrite inclusion with annealing temperature and its content in the composite. Transmission electron microscopy and X-ray diffraction pattern confirms the formation of hexagonal structure of barium ferrite. The crystallite size of the barium ferrite particles is in nano-range and increases with annealing temperature. The BaFe{sub 12}O{sub 19}/NPR composite is prepared with different weight percentage of ferrite inclusions. The complex permittivity and complex permeability is measured at X-band and found to increase with annealing temperature and contents of ferrite inclusion. Theoretical study of reflection loss gives that 2 mm absorber samples are showing the best results for X-band application. Reflection loss measurement of the samples shows absorption peak of −24.61 dB at 10.26 GHz for 30 wt%, −28.39 dB at 9.98 GHz for 40 wt% and −37.06 dB at 9.5 GHz for 50 wt% of BaFe{sub 12}O{sub 19} in NPR matrix. - Highlights: • BaFe{sub 12}O{sub 19}/NPR composite is developed as microwave absorbing material. • The maximal absorption is optimized with thickness using TLM. • Calculated reflection loss of 50 wt% for 2 mm thickness is 41.05 dB at 9.95 GHz. • Measured reflection loss of 50 wt% for 2 mm thickness is 37.06 dB at 9.5 GHz.

  7. Curie temperature and magnetic properties of aluminum doped barium ferrite particles prepared by ball mill method

    International Nuclear Information System (INIS)

    Barium ferrite has attracted considerable interest in the fields of permanent magnets and perpendicular magnetic recording due to its strong uniaxial anisotropy and high Curie temperature (Tc). We prepared aluminum doped barium ferrite ceramics (BaAlxFe12−xO19, 0≤x≤6) by the ball mill method. The powder was milled for 96 h, and after forming pellets, annealed for 48 h in air at 1000 °C. The X-ray diffraction (XRD) data show that there are only single hexagonal phases in the samples without any impurity phase. The crystal lattice constants, a and c, were calculated by Cohen's method. Both a and c decrease with increasing x, ranging from 0.588 nm and 2.318 nm to 0.573 nm and 2.294 nm, respectively. A Vibrating Sample Magnetometer (VSM) and Superconducting Quantum Interference Device (SQUID) were used to investigate Tc and magnetic properties of BaFe12−xAlxO19. It is found that Tc decreases with increasing x, from 425 °C to 298 °C. It is also found that the saturated magnetization (4πMs) decreases with increasing x, while the coercivity (Hc) increases with the increase in x. The anisotropy field was also determined from the SQUID measurement. - Highlights: • The Curie temperature and magnetic properties of aluminum doped barium ferrite particles were studied systemically. • The relation between 4πMs and composition x at 50 K (both experimental value and theoretical calculation) was revealed. • Occupation number for spin up and spin down as a function of temperature was shown. • The relation between 4πMs and composition x from 50 K to room temperature was revealed

  8. Synthesis and characterization of highly-ordered barium-strontium titanate nanotube arrays fabricated by sol-gel method

    Institute of Scientific and Technical Information of China (English)

    Chen Yu; Chen Wei; Guo Feng; Li Mei-Ya; Liu Wei; Zhao Xing-Zhong


    Highly uniformed barium-strontium titanate nanotube arrays were fabricated using a porous anodic aluminum oxide template from a barium-strontium titanate sol-gel solution. Electron microscope results showed that nanotubes with uniform length and diameter were obtained. The diameters and lengths of these nanotubes were dependent on the pore diameter and the thickness of the applied anodic aluminum oxide template. High resolution transmission electron microscopy and the selected-area electron diffraction pattern investigations demonstrated the perovskite structure and the polycrystaltine of the fabricated barium-strontium titanate nanotubes. The characterization of the electrical and dielectric properties had also been made. Compared to thin film material,the intrinsic leakage current density is almost the same. Besides,at 30 ℃,the dielectric constant and dielectric loss of the fabricated nanotube is 80 and 0.027 at 1 MHz respectively.

  9. Early manifestation of Yersinia colitis demonstrated by the double-contrast barium enema

    Energy Technology Data Exchange (ETDEWEB)

    Aspestrand, F.


    A 19-year old female with a bloody, diarrheal illness of acute onset where Crohn's disease primarly was suspected is presented. The double-contrast barium enema revealed multiple, diffusely scattered aphthous erosions of the colonic mucosa: the rectum was scarcely affected. Biopsies taken by endoscopy demonstrated nonspecific inflammatory changes of the mucous membrane. However, routinely taken stool cultures revealed an infectious colitis due to Yersinia enterocolitica. Our case demonstrates the necessity to consider Yersinia enterocolitis in the radiographic differential diagnosis when the diagnosis of Crohn's disease or ulcerative colitis seems obvious.

  10. Spectroscopic studies of Nb- and Hf-doped barium titanate crystals

    International Nuclear Information System (INIS)

    One studied the absorption spectra of barium titanate single crystals doped with niobium and hafnium, as well as, those of pure BaTiO3 single crystal. One detected peculiarities both under ferro-paraelectric phase transition at 120 deg C and in paraelectric phase within 150-170 deg C. One observed increase of intensity of λmax = 700 nm band within beyond 150-170 deg C range that was adequate to the increase of number of F-centres

  11. Investigation of neutron-deficient isotopes in the barium-region

    International Nuclear Information System (INIS)

    Bombarding targets of 106Cd, 108Cd and 110Cd with 16O ions of 52.5-66.0 MeV neutron deficient barium, cesium and xenon isotopes were produced and have been studied using excitation functions and neutron-gamma, proton-gamma, alpha-gamma and gamma-gamma coincidence measurements. Partial level schemes for 123Ba and 121Ba were proposed. A number of gamma transitions was assigned to the different product nuclei. The measured particle emission probabilities from the compound nuclei are compared with different evaporation models. The models mostly underestimate neutron emission and often overestimate the emission of alpha particles. (orig.)

  12. Capacitively coupled electrolyte-conductivity sensor based on high-k material of barium strontium titanate


    Huck, C.; Poghossian, A; Baecker, M; Chaudhuri, S.; Zander, W; Schubert, J.; Begoyan, V. K.; Buniatyan, V. V.; Wagner, Patrick Hermann; Schoening, M. J


    A miniaturized capacitively coupled contactless conductivity detection (C4D) sensor based on high-kperovskite oxide of barium strontium titanate (BST) has been implemented for the first time. The BST films(∼120 nm thick) of Ba0.25Sr0.75TiO3composition were prepared on a p-Si-SiO2-Pt structure by pulsed laserdeposition technique using BST targets fabricated by the self-propagating high-temperature synthesismethod. The Pt electrodes were buried into the SiO2layer to obtain a planar structure. F...

  13. EDTA-type Polymer Based on Diazacrown Ether as the Solubilizer of Barium Sulfate to Water

    Institute of Scientific and Technical Information of China (English)

    Bo ZHOU; Jian Zhang LI; Chun Hong HE; Sheng Ying QIN


    The EDTA dianhydride reacted with diazacrown ethers to obtain the water-soluble EDTA-diazacrown ether polymers 1~3. The effects of crown ether ring in the polymer chains including its cavity size on the solubilization of barium sulfate to water were investigated by comparison with the crown ring-free analogue 4. The result shows that the polymer 2 is the efficient solubilizer of BaSO4 and the highest solubilization efficiency of the BaSO4 to water is up to 72.5%.

  14. Synthesis of Barium Lithium Fluoride Nanocrystals Using Reverse Micelles as Microemulsion

    Institute of Scientific and Technical Information of China (English)

    Rui Nian HUA; De Min XIE; Chun Shan SHI


    Barium lithium fluoride nanocrystals were synthesized in cetyltrimethylammonium bromide (CTAB)/ 2-octanol/ water microemulsion systems. The impurity peaks in XRD patterns were not determined. The result of SEM confirmed that the average sizes and shape of the BaLiF3 nanocrystals. The formation of BaLiF3 and particles size were strongly affected by water content. With increasing water content and reaction times, the size of the particle increases. Meanwhile, the solvent was also found to play a key role in the synthesis of the BaLiF3 nanocrystals.

  15. Investigation of thermal evolution of nanodomain structures in nonlinear barium sodium niobate crystals

    Institute of Scientific and Technical Information of China (English)



    By the 90°elastic light scattering investigation and far field observation in the range of 20-800℃,the relation between behavior of light scattering anomalies and evolution of nanodomain structures in lattice of barium sodium niobate(Ba2NaNb5O15,BSN)crystal was clarified.The correlation between anomalies on the temperature curves of the elastic light scattering intensity and temperature transformations of nanodomains was studied by X-ray and electron microscope methods.Phase transition near 500℃ and movement in field of scattering light could be explained by appearance of a new incommensurate phase.

  16. The ac Stark shifts of the terahertz clock transitions of barium

    Institute of Scientific and Technical Information of China (English)

    余庚华; 耿鹰鸽; 李隆; 周超; 段丞博; 柴瑞鹏; 杨永明


    Wavelength-dependent AC Stark shifts and magic wavelengths of the terahertz clock transitions between the metastable triplet states 6s5d 3D1 and 6s5d 3D2 are investigated with considering the optical lattice trapping of barium atoms with the linearly polarized laser. The trap depths and the slopes of light shift difference with distinct magic wave-lengths of the optical lattices are also discussed in detail. Several potentially suitable working points for the optical lattice trapping laser are recommended and selected from these magic wavelengths.

  17. The use of barium meal to evaluate total gastric emptying time in the dog

    International Nuclear Information System (INIS)

    Total gastric emptying time was determined in nine mongrel dogs using a barium meal contrast procedure. Within the group, total gastric emptying time ranged from 7.0-15.0 hours. Comparison of the population mean showed a statistical difference (p = 0.01) from previously published values. Individual dogs showed consistent total gastric emptying time over three trials. The technique can be used to test the effect of a procedure on total gastric emptying time when a normal value has been established for the dog. Due to the wide range of normal values observed, evaluation of clinical patients could be difficult unless there is a gross abnormality in function

  18. Improvement of the thermal properties of a polystyrene via inclusion of barium hexaferrite particles (United States)

    Hemeda, O. M.; El-Sayed, Adly H.; Tawfik, A.; Hamad, Mahmoud A.


    M-type barium hexaferrite (BaM) particles-polystyrene (PS) composite has been successfully synthesized. Fourier transform infrared spectra confirm the synthesis of the BaM-PS composite. Scanning electron microscopy shows that BaM particles are attached rather well to the PS matrix and have variable sizes and shapes. Differential and thermogravimetric analysis indicate that PS chains are well coupled within the BaM powder and the thermal stability of PS is enhanced by incorporating BaM in the PS matrix.

  19. Development of a metrology method for composition and thickness of barium strontium titanate thin films

    International Nuclear Information System (INIS)

    Thin films of barium strontium titanate (BST) are being investigated as the charge storage dielectric in advanced memory devices, due to their promise for high dielectric constant. Since the capacitance of BST films is a function of both stoichiometry and thickness, implementation into manufacturing requires precise metrology methods to monitor both of these properties. This is no small challenge, considering the BST film thicknesses are 60 nm or less. A metrology method was developed based on X-ray Fluorescence and applied to the measurement of stoichiometry and thickness of BST thin films in a variety of applications

  20. Lead-barium fluoroborate glass ceramics doped with Nd3+ or Er3+ (United States)

    Petrova, O. B.; Sevostjanova, T. S.; Anurova, M. O.; Khomyakov, A. V.


    Lead-barium fluoroborate glasses in the PbF2-BaF2-B2O3, PbF2-BaO-B2O3, and PbO- BaF2-B2O3 systems doped with rare-earth ions (Nd3+ or Er3+) are synthesized and studied. It is shown that, based on these glasses, it is possible to produce transparent glass ceramics with fluoride crystalline phases, including ceramics with one crystalline phase of the fluorite structure. The spectral and luminescent properties of the doped glasses, glass ceramics, and polycrystalline complex fluorides containing Pb, Ba, and rare ions are studied.

  1. DANCE : a 4[pi] barium fluoride detector for measuring neutron capture on unstable nuclei /.

    Energy Technology Data Exchange (ETDEWEB)

    Ullmann, J. L. (John L.); Haight, Robert C.; Hunt, L. F. (Lloyd F.); Reifarth, R. (Rene); Rundberg, R. S. (Robert S.); Bredeweg, T. A. (Todd A); Fowler, Malcolm M.; Miller, G. G. (Geoffrey G.); Heil, M.; Käppeler, F. (Franz); Chamberlin, E. P. (Edwin P.)


    Measurements of neutron capture on unstable nuclei are important for studies of s-process nucleosynthesis, nuclear waste transmutation, and stewardship science. A 160-element, 4{pi} barium fluoride detector array, and associated neutron flight path, is being constructed to make capture measurements at the moderated neutron spallation source at LANSCE. Measurements can be made on as little as 1 mg of sample material over energies from near thermal to near 100 keV. The design of the DANCE array is described and neutron flux measurements from flight path commissioning are shown. The array is expected to be complete by the end of 2002.

  2. Femtosecond index grating in barium flouride: efficient self-diffraction and enhancement of surface SHG (United States)

    Schneider, Th; Wolfframm, D.; Mitzner, R.; Reif, J.


    A transient refractive index grating is formed in barium fluoride crystals under irradiation with femtosecond laser pulses from two non-collinear beams. At low intensities energy coupling takes place. At high intensities, a typical self-diffraction pattern is obtained with a diffraction efficiency better than 10%. Simultaneously, an enhancement of the SHG signal from the surface, as well as the generation and diffraction of the third harmonic is observable. For all effects the nonlinear Kerr-effect is responsible, with the response time being limited only by the temporal pulse shape.

  3. Direct writing of ferroelectric domains on strontium barium niobate crystals using focused ultraviolet laser light

    Energy Technology Data Exchange (ETDEWEB)

    Boes, Andreas; Crasto, Tristan; Steigerwald, Hendrik; Mitchell, Arnan [School of Electrical and Computer Engineering and ARC Center for Ultra-High Bandwidth Devices for Optical Systems (CUDOS), RMIT University, Melbourne, Victoria 3001 (Australia); Wade, Scott [Faculty of Engineering and Industrial Sciences, Swinburne University of Technology, Hawthorn, Victoria 3122 (Australia); Frohnhaus, Jakob; Soergel, Elisabeth [Institute of Physics, University of Bonn, Wegelerstr. 8, 53115 Bonn (Germany)


    We report ferroelectric domain inversion in strontium barium niobate (SBN) single crystals by irradiating the surface locally with a strongly focused ultraviolet (UV) laser beam. The generated domains are investigated using piezoresponse force microscopy. We propose a simple model that allows predicting the domain width as a function of the irradiation intensity, which indeed applies for both SBN and LiNbO{sub 3}. Evidently, though fundamentally different, the domain structure of both SBN and LiNbO{sub 3} can be engineered through similar UV irradiation.

  4. Efficient photoionization for barium ion trapping using a dipole-allowed resonant two-photon transition


    Leschhorn G.; Hasegawa T.; Schaetz T.


    Two efficient and isotope-selective resonant two-photon ionization techniques for loading barium ions into radio-frequency (RF)-traps are demonstrated. The scheme of using a strong dipole-allowed transition at \\lambda=553 nm as a first step towards ionization is compared to the established technique of using a weak intercombination line (\\lambda=413 nm). An increase of two orders of magnitude in the ionization efficiency is found favoring the transition at 553 nm. This technique can be implem...

  5. Barium fluoride whispering-gallery-mode disk-resonator with one billion quality-factor


    Lin, Guoping; Diallo, Souleymane; Henriet, Rémi; Jacquot, Maxime; Chembo, Yanne K.


    We demonstrate a monolithic optical whispering gallery mode resonator fabricated with barium fluoride (BaF$_2$) with an ultra-high quality ($Q$) factor above $10^9$ at $1550$ nm, and measured with both the linewidth and cavity-ring-down methods. Vertical scanning optical profilometry shows that the root mean square surface roughness of $2$ nm is achieved for our mm-size disk. To the best of our knowledge, we show for the first time that one billion $Q$-factor is achievable by precision polish...

  6. Low temperature preparation of nanocrystalline solid solution of strontium barium niobate by chemical process

    Indian Academy of Sciences (India)

    Asit B Panda; Amita Pathak; Panchanan Pramanik


    SrBa1–Nb2O6 (with = 0.4, 0.5 and 0.6) powders have been prepared by thermolysis of aqueous precursor solutions consisting of triethanolamine (TEA), niobium tartarate and, EDTA complexes of strontium and barium ions. Complete evaporation of the precursor solution by heating at ∼ 200°C, yields in a fluffy, mesoporous carbon rich precursor material, which on calcination at 750°C/2 h has resulted in the pure SBN powders. The crystallite and average particle sizes are found to be around 15 nm and 20 nm, respectively.

  7. Three-wave mixing mediated femtosecond pulse compression in β-barium borate. (United States)

    Grün, A; Austin, Dane R; Cousin, Seth L; Biegert, J


    Nonlinear pulse compression mediated by three-wave mixing is demonstrated for ultrashort Ti:sapphire pulses in a type II phase-matched β-barium borate (BBO) crystal using noncollinear geometry. 170 μJ pulses at 800 nm with a pulse duration of 74 fs are compressed at their sum frequency to 32 fs with 55 μJ of pulse energy. Experiments and computer simulations demonstrate the potential of sum-frequency pulse compression to match the group velocities of the interacting waves to crystals that were initially not considered in the context of nonlinear pulse compression.

  8. Dispersive waves induced by self-defocusing temporal solitons in a beta-barium-borate crystal

    DEFF Research Database (Denmark)

    Zhou, Binbin; Bache, Morten


    We experimentally observe dispersive waves in the anomalous dispersion regime of a beta-barium-borate (BBO) crystal, induced by a self-defocusing few-cycle temporal soliton. Together the soliton and dispersive waves form an energetic octave-spanning supercontinuum. The soliton was excited...... in the normal dispersion regime of BBO through a negative cascaded quadratic nonlinearity. Using pump wavelengths from 1.24 to 1.4 μm, dispersive waves are found from 1.9 to 2.2 μm, agreeing well with calculated resonant phasematching wavelengths due to degenerate four-wave mixing to the soliton. We also...

  9. Cascaded Brillouin lasing in monolithic barium fluoride whispering gallery mode resonators

    CERN Document Server

    Lin, Guoping; Saleh, Khaldoun; Martinenghi, Romain; Beugnot, Jean-Charles; Sylvestre, Thibaut; Chembo, Yanne K


    We report the observation of stimulated Brillouin scattering and lasing at 1550~nm in barium fluoride (BaF$_2$) crystal. Brillouin lasing was achieved with ultra-high quality ($Q$) factor monolithic whispering gallery mode (WGM) mm-size disk resonators. Overmoded resonators were specifically used to provide cavity resonances for both the pump and all Brillouin Stokes waves. Single and multiple Brillouin Stokes radiations with frequency shift ranging from $8.2$ GHz up to $49$ GHz have been generated through cascaded Brillouin lasing. BaF$_2$ resonator-based Brillouin lasing can find potential applications for high-coherence lasers and microwave photonics.

  10. Complications of barium enema examinations: a survey of UK Consultant Radiologists 1992 to 1994. (United States)

    Blakeborough, A; Sheridan, M B; Chapman, A H


    Questionnaires were sent to all Consultant Radiologists in the UK regarding complications from barium enema examinations. The 756 respondents performed a total of 738,216 examinations over the three year period 1992 to 1994. Seventy-seven Consultants (10.2%) reported a total of 82 complications including 13 deaths: an overall mortality rate of 1 in 56,786. Only three of 30 (10%) cases of bowel perforation died, as compared with nine out of 16 (56%) cases of cardiac arrhythmia. The only remaining death was a consequence of vaginal intubation. Details of all the reported complications are recorded. This was an entirely retrospective study. PMID:9043049

  11. Limitations of combined flexible sigmoidoscopy and double contrast barium enema in patients with rectal bleeding

    International Nuclear Information System (INIS)

    Eighty-seven outpatients with non-massive rectal bleeding or asymptomatic positive fecal occult blood were evaluated with 35 cm flexible sigmoidoscopy, double contrast barium enema (DBCE) and colonoscopy. 82% had hemorrhoids and 35% harbored colorectal neoplasia. The combination of flexible sigmoidoscopy and DCBE missed none of 7 malignant lesions. However, 35% of benign polyps ≥ 1 cm and 60.5% of those < 1 cm were not detected by this combination. The presence of hemorrhoids should not prevent a search for colon neoplasia and colonoscopy is the preferred method. (orig.)

  12. Removal of hexavalent chromium from aqueous solution by barium ion cross-linked alginate beads


    Uzaşçı Sesil; Tezcan Filiz; Bedia Erim F.


    Barium ion cross-linked alginate beads have shown great affinity to toxic hexavalent chromium ions in aqueous solution, contrary to the traditional calcium alginate beads. The adsorption experiments were carried out by the batch contact method. The optimal pH for removal was found to be pH 4. The equilibrium was established in 4 h and the removal efficiency of chromium (VI) was found as 95%. The adsorption data fit well with Langmuir and Freundlich isotherms. The maximum chromium (VI) adsorpt...

  13. Structure and properties of barium ferrite powders prepared by milling and annealing

    Directory of Open Access Journals (Sweden)

    J. Wron


    Full Text Available Purpose: Microstructure and magnetic properties analysis of barium ferrite powder obtained by milling and heat treatmentDesign/methodology/approach: The milling process was carried out in a vibratory mill, which generated vibrations of the balls and milled material inside the container. After milling process the powders were annealed in electric chamber furnace. The X-ray diffraction methods were used for qualitative phase analysis of studied powder samples. The morphology of Fe2O3 and BaCO3 powders after milling was analyzed using the scanning electron microscopy (SEM method. The distribution of powder particles was determined by a laser particle analyzer. The magnetic hysteresis loops of examined powder material were measured by resonance vibrating sample magnetometer (R-VSM.Findings: The milling process of iron oxide and barium carbonate mixture causes decrease of the crystallite size of involved phases and leads to increase the content of Fe2O3 phase and decrease of BaCO3 content. Milling process causes enriching of surface layer of powder particles by Fe2O3. The X-ray investigations of tested mixture milled for 30 hours and annealed at 950°C enabled the identification of hard magnetic BaFe12O19 phase and also the presence of Fe2O3 phase in examined material. The Fe2O3 phase is a rest of BaCO3 dissociation in the presence of Fe2O3, which forms a compound of BaFe12O19. The best coercive force for the mixture of powders annealed at 950°C for 10, 20 and 30 hours is 349 kA/m, 366 kA/m and 364 kA/m, respectively. From morphology images and distribution of powder particle size it can be concluded, that the size of tested powder particles increases with increasing time of milling process. The increase of milling time up to 20 hours leads to joining of smaller particles in bigger ones; agglomerates are formed.Practical implications: The barium ferrite powder obtained by milling and annealing can be suitable component to produce sintered and

  14. Fabrication of flexible magnetic papers based on bacterial cellulose and barium hexaferrite with improved mechanical properties (United States)

    Lim, Guh-Hwan; Lee, Jooyoung; Kwon, Nayoung; Bok, Shingyu; Sim, Hwansu; Moon, Kyoung-Seok; Lee, Sang-Eui; Lim, Byungkwon


    We report on a simple approach to fabricate mechanically robust magnetic cellulose papers containing M-type barium hexaferrite (BaFe12O19) nanoplates. BaFe12O19 nanoplates were synthesized by a hydrothermal method and then chemically functionalized by using a silane coupling agent. The magnetic cellulose papers prepared with the silane-treated BaFe12O19 nanoplates exhibited improved mechanical properties with tensile strength of 58.5 MPa and Young's modulus of 2.95 GPa.

  15. Screen printed barium titanate thick films prepared from mechanically activated powders

    Energy Technology Data Exchange (ETDEWEB)

    Stojanovic, B.D. [Universidad Estadual Paulista, Sao Paulo (Brazil). Inst. de Quimica; Belgrade Univ. (Yugoslavia). Center for Multidisciplinary Studies; Foschini, C.R.; Varela, J.A. [Universidad Estadual Paulista, Sao Paulo (Brazil). Inst. de Quimica; Pejovic, V.Z. [IRITEL, Belgrade (Yugoslavia); Pavlovic, V.B. [Faculty for Agriculture, Dept. of Physics, UB (Yugoslavia); Pavlovic, V.P. [Faculty for Mechanical Engineering, Dept. of Physics, UB (Yugoslavia)


    Barium titanate thick films were prepared from mechanically activated powders based on BaCO{sub 3} and TiO{sub 2}. The thick films were screen-printed on alumina substrates electroded with Ag/Pd. The BT films were sintered at 850 C for 1 hour. The thickness was 30-75 {mu}m depending of number of layers. The microstructure of thick films and the compatibility between BT layers and substrate was investigated by SEM. The dielectric properties were measured and the results were reported. (orig.)

  16. In vitro tests of barium sulphate suspensions for double contrast examinations of the stomach

    International Nuclear Information System (INIS)

    Four barium sulphate suspensions were investigated with respect to their adhesion and contrast following standard means of spreading the contrast over a model stomach, which corresponds in its detailed structure with the surface of the gastric mucosa. By this means various factors, which make a true comparison in vivo impossible, could be eliminated and a comparison of the suspensions became possible. Using similar mechanical and chemical situations, the radiographs of the artificial mucosa showed very different results from the use of the different preparations. These corresponded well with the findings in vivo. (orig.)

  17. Comparison of barium titanate thin films prepared by inkjet printing and spin coating

    Directory of Open Access Journals (Sweden)

    Jelena Vukmirović


    Full Text Available In this paper, barium titanate films were prepared by different deposition techniques (spin coating, office Epson inkjet printer and commercial Dimatix inkjet printer. As inkjet technique requires special rheological properties of inks the first part of the study deals with the preparation of inks, whereas the second part examines and compares structural characteristics of the deposited films. Inks were synthesized by sol-gel method and parameters such as viscosity, particle size and surface tension were measured. Deposited films were examined by optical and scanning electron microscopy, XRD analysis and Raman spectroscopy. The findings consider advantages and disadvantages of the particular deposition techniques.

  18. Influence of Biofield Treatment on Physical and Structural Characteristics of Barium Oxide and Zinc Sulfide


    Mahendra Kumar Trivedi, Alice Branton


    Barium oxide (BaO) and zinc sulfide (ZnS) are well known for their applications in electrical, optical and chemical industries. The present study was aimed to evaluate the impact of biofield treatment on the structural and physical properties of BaO and ZnS powder. The study was carried out in two groups, one was set to control, and another group was subjected to Mr. Trivedi’s biofield treatment. Control and treated samples of BaO and ZnS were analyzed using X-ray diffraction (XRD), Fourier t...


    Directory of Open Access Journals (Sweden)



    Full Text Available ABSTRACT: Here, we report a fifty six year old male patient wit h intrathoracic incarceration and perforation of the stomach on the left side of t he diaphragmatic defect resulting as empyema and a late sequelae of barium induced pleural thickening where decortication was performed. It is not usual, without a history of tra uma patient developing acquired Bochdalek hernia with empyema as seen in our case. Anaesthetic management was successful in the repair of acquired Bochdalek hernia during the first surge ry and decortication of the lung during the second surgery in our patient

  20. Three-wave mixing mediated femtosecond pulse compression in β-barium borate. (United States)

    Grün, A; Austin, Dane R; Cousin, Seth L; Biegert, J


    Nonlinear pulse compression mediated by three-wave mixing is demonstrated for ultrashort Ti:sapphire pulses in a type II phase-matched β-barium borate (BBO) crystal using noncollinear geometry. 170 μJ pulses at 800 nm with a pulse duration of 74 fs are compressed at their sum frequency to 32 fs with 55 μJ of pulse energy. Experiments and computer simulations demonstrate the potential of sum-frequency pulse compression to match the group velocities of the interacting waves to crystals that were initially not considered in the context of nonlinear pulse compression. PMID:26469593

  1. Motional Stark Effect and Its Active Cancellation in Diamagnetic Spectrum of Barium

    Institute of Scientific and Technical Information of China (English)

    QUAN Wei; LIU Hong-Ping; SHEN Li; ZHAN Ming-Sheng


    With time-of-flight and electric field ionization detection technique, we investigate the motional Stark effect for highly excited Rydberg barium in high magnetic field and its active cancellation experimentally. In the experiment, the atom beam is aligned at a small angle of 15° with respect to the magnetic field. The motional Stark effect cancellation is demonstrated on two sets of circularly polarized spectra in static magnetic field B = 1.00000 Tesla and B = 1.70000 Tesla, respectively, although the effect is very small (~ 3.5 Vcm-1) in our apparatus configuration.

  2. Studies on characterization, microstructures and magnetic properties of nano-size barium hexa-ferrite prepared through a hydrothermal precipitation-calcination route

    International Nuclear Information System (INIS)

    An attempt was made to prepare nano-size barium hexa-ferrite particles following a hydrothermal precipitation-calcination route using barium and iron nitrate solutions. During hydrothermal treatment at 180 deg. C (2 h precipitation time) barium carbonate and hematite phases were formed. This precursor was calcined at 800, 1000 and 1200 deg. C to determine the conditions for obtaining barium hexa-ferrite. The characterization studies on calcined products revealed that up to 800 deg. C, the major crystalline phases (barium carbonate and hematite) of the precursor were retained. At 1000 deg. C, formation of barium hexa-ferrite started and at 1200 deg. C, though most of the major peaks of X-ray diffractogram corresponded to barium hexa-ferrite, a number of peaks corresponding to hematite were also present. Some low intensity peaks for barium carbonate were observed. The average particle size was 40 nm. Saturation magnetization, remanence magnetization and coercivity were found to be 40.0, 21.6 emu g-1 and 2.87 kOe, respectively. The values obtained both for coercivity and magnetization for the present sample were lower than the reported bulk values which could be due to the fact that the sample prepared through the present technique was not mono-phasic

  3. The role of the Ganges-Brahmaputra mixing zone in supplying barium and [sup 226]Ra to the Bay of Bengal

    Energy Technology Data Exchange (ETDEWEB)

    Carroll, J. (Univ. of South Carolina, Columbia (United States) Univ. of Alaska, Fairbanks (United States)); Falkner, K.K. (Massachusetts Inst. of Technology, Cambridge (United States) CNES, Toulouse (France)); Brown, E.T. (Massachusetts Inst. of Technology, Cambridge (United States)); Moore, W.S. (Univ. of South Carolina, Columbia (United States))


    The Ganges-Brahmaputra river system is ranked fourth among world rivers as a source of freshwater to the oceans and is believed to supply more sediment to the ocean than any other; 1.5 [times] 10[sup 12] kg/yr (Milliman and Meade, 1983). Barium and [sup 226]Ra are typically enriched in waters where sediment-laden rivers enter the ocean. As such, the Ganges-Brahmaputra is likely to produce globally significant barium and [sup 226]Ra fluxes to the ocean. Water samples for barium and [sup 226]Ra were collected within four major channels of the Ganges-Brahmaputra mixing zone during a period of low sediment and freshwater discharge. The data suggest that in addition to suspended sediments supplied directly from rivers, river sediments deposited during high discharge in mangroves and on islands are desorbing barium and [sup 226]Ra to seawater. The release of barium and [sup 226]Ra from these sediment deposits is out-of-phase with the direct supply of sediments from the rivers. Estimates of the annual fluxes of barium and [sup 226]Ra from the Ganges-Brahmaputra mixing zone were also derived. The fluxes of barium and [sup 226]Ra are 5.3 [times] 10[sup 8] mol barium/yr and 9.5 [times] 10[sub 14] dpm radium/yr. The first silicate and phosphate mixing profiles for this system are reported. 29 refs., 6 figs., 3 tabs.

  4. Beta-delayed particle emission from neutron-deficient tellurium, iodine, xenon, cesium and barium isotopes

    International Nuclear Information System (INIS)

    Using 58Ni, 63Cu(58Ni, xp yn) reactions and on-line mass separation the β-delayed proton and α-particle emission from neutron-deficient isotopes with 52113Xe, (protons), 114Cs (protons and α-particles) and 117Ba (protons). Coincidences between positons and β-delayed protons were recorded for 113Xe and 114Cs, yielding Qsub(EC)-Ssub(p) values of 7.92(15) and 8.73(15) MeV, respectively. The results are discussed within the statistical model. (orig.)

  5. 40 CFR 63.114 - Process vent provisions-monitoring requirements. (United States)


    ... accurately. Monitoring is not required for process vents with TRE index values greater than 4.0 as specified...) Maintains a TRE greater than 1.0 but less than or equal to 4.0 without a recovery device or with a recovery... Manufacturing Industry for Process Vents, Storage Vessels, Transfer Operations, and Wastewater § 63.114...

  6. 9 CFR 114.15 - Disposal of unsatisfactory products and byproducts. (United States)


    ... SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS PRODUCTION REQUIREMENTS FOR BIOLOGICAL PRODUCTS § 114.15 Disposal of unsatisfactory products and byproducts. All biological products found to be unsatisfactory for marketing, all biological products which...

  7. Symptomatic heterotopic ossification after very severe traumatic brain injury in 114 patients: incidence and risk factors

    DEFF Research Database (Denmark)

    Simonsen, Louise Lau; Sonne-Holm, Stig; Krasheninnikoff, Michael;


    Injury Unit and to list some of the risk-predicting features. The study comprised an approximately complete, consecutive series of 114 adult patients from a well-defined geographical area, and with a posttraumatic amnesia period of at least 28 days, i.e. very severe TBI. Demographic and functional data...


    The report gives results of a heat transfer evaluation of the refrigerants hexafluoropropane (HFC-236ea) and 1,1,2,2-dichloro-tetrafluoroethane (CFC-114). (NOTE: With the mandatory phase-out of chlorofluorocarbons (CFCs), as dictated by the Montreal Protocol and Clean Air Act Ame...

  9. 11 CFR 114.7 - Membership organizations, cooperatives, or corporations without capital stock. (United States)


    ... organizational structure. (j) A membership organization, including a trade association, cooperative, or... 11 Federal Elections 1 2010-01-01 2010-01-01 false Membership organizations, cooperatives, or... CORPORATE AND LABOR ORGANIZATION ACTIVITY § 114.7 Membership organizations, cooperatives, or...

  10. 19 CFR 200.735-114 - Employees required to submit statements. (United States)


    ... 19 Customs Duties 3 2010-04-01 2010-04-01 false Employees required to submit statements. 200.735... Employees required to submit statements. Except as provided in § 200.735-114a, the following employees shall submit confidential statements of employment and financial interests: (a)(1) Employees in grade GS-13...

  11. 7 CFR 766.114 - State-certified mediation or voluntary meeting of creditors. (United States)


    ... 7 Agriculture 7 2010-01-01 2010-01-01 false State-certified mediation or voluntary meeting of... Programs § 766.114 State-certified mediation or voluntary meeting of creditors. (a) A borrower who is...) State-certified mediation; or (2) Voluntary meeting of creditors when a State does not have a...

  12. 7 CFR 1220.114 - National nonprofit producer-governed organization. (United States)


    ... 7 Agriculture 10 2010-01-01 2010-01-01 false National nonprofit producer-governed organization... Definitions § 1220.114 National nonprofit producer-governed organization. The term national nonprofit producer-governed organization means an organization that— (a) Is a nonprofit organization pursuant to section...

  13. 9 CFR 114.14 - Extension of expiration date for a serial or subserial. (United States)


    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Extension of expiration date for a... PRODUCTION REQUIREMENTS FOR BIOLOGICAL PRODUCTS § 114.14 Extension of expiration date for a serial or... expiration date shall not be extended: (1) If all fractions of the product are not evaluated for potency...

  14. Synthesis of BaTiO3 powder from barium titanyl oxalate (BTO) precursor employing microwave heating technique

    Indian Academy of Sciences (India)

    Y S Malghe; A V Gurjar; S R Dharwadkar


    Cubic barium titanate (BaTiO3) powder was synthesized by heating barium titanyl oxalate hydrate, BaTiO(C2O4)$_{2}\\cdot$4H2O (BTO) precursor in microwave heating system in air at 500°C. Heating BTO in microwave above 600°C yielded tetragonal form of BaTiO3. Experiments repeated in silicon carbide furnace showed that BaTiO3 was formed only above 700°C. The product obtained was cubic.

  15. Contrast radiography in small bowel obstruction. A randomized trial of barium sulfate and a nonionic low-osmolar contrast medium

    International Nuclear Information System (INIS)

    Thirty-six adult patients clinically suspected of small bowel obstruction underwent small bowel contrast radiography with either barium sulfate or a nonionic low-osmolar contrast medium after randomization. Films were taken after 2, 4, and 8 hours and later when needed. No difference as regards visualization and diagnostic quality was found between the 2 media. It is concluded that a nonionic low-osmolar contrast medium is an alternative to barium sulfate for small bowel contrast radiography where small bowel obstruction is suspected. (orig.)

  16. 114例儿童药品不良反应报告分析%Analysis of 114 Pediatric Adverse Drug Reaction Reports in Our Hospital

    Institute of Scientific and Technical Information of China (English)

    李榕; 陈崇泽


    Objective:To investigate the adverse drug reactions that occurred in children. Methods: The ages, sex, drug usage, main manifestation, time of occurrence and level of severity of ADR were analyzed in 114 cases of children aged from 2 month to 15 years old. Results: Among 114 cases, 78 patients were male, 36 patients were female. There were fifty three drugs involved. Antibiotics held the first position (42. 11%) and the next was Chinese Anti-inffectives (25. 44%). The main manifestation of ADR was rash, anaphylactoid reaction and somnolence. The main route of administration was intravenous drip. Conclusions: Monitoring of ADR in children should be strengthened in order to ensure the safety of drug usage.%目的:了解儿童发生药品不良反应(ADR)的情况.方法:按患者的年龄、性别、用药情况及ADR的主要表现、发生时间、严重程度等进行统计分析.结果:114例ADR报告中,男78例,女36例,涉及药品53种,主要为抗感染药物(42.11%),其次为中药抗感染药物(25.44%).ADR主要表现是皮疹,其次是过敏样反应、嗜睡.主要给药途径是静脉滴注.结论:应加强对儿童ADR的监测工作,以保证用药安全.

  17. Separation of Methylene Blue Dye from Aqueous Solution Using Triton X-114 Surfactant

    Directory of Open Access Journals (Sweden)

    Arunagiri Appusamy


    Full Text Available In this study, the interaction energy between Triton X-114 surfactant + methylene blue or water and methylene blue + water was investigated using Hartree-Fock (HF theory with 6-31G* basis set. The results of structures and interaction energies show that these complexes have good physical and chemical interactions at atom and molecular levels. However, the Triton X-114 surfactant + methylene blue complex shows stronger molecular interaction compared to other complexes systems. The order of the interaction energy is 4303.472023 (Triton X-114 surfactant + water > -1222.962 (methylene blue + water > -3573.28 (Triton X-114 surfactant + methylene blue kJ·mole−1. Subsequently, the cloud point extraction was carried out for 15 ppm of methylene blue in a mixture at 313.15 and 323.15 K over the surfactant concentration range from 0.01 M to 0.1 M. From the measured data, the excess molar volume was calculated for both phases. The results show a positive deviation in the dilute phase and a negative deviation in the surfactant rich phase. It is confirmed that the interaction between Triton X-114 and methylene blue is stronger than other complex systems due to the presence of chemical and structural orientation. The concentration of dyes and surfactant in the feed mixture and temperature effect in both phases has been studied. In addition, the thermodynamics feasibility and efficiency of the process have also been investigated.

  18. Efficient 1.54-μm emission through Eu{sup 2+} sensitization of Er{sup 3+} in thin films of Eu{sup 2+}/Er{sup 3+} codoped barium strontium silicate under broad ultraviolet light excitation

    Energy Technology Data Exchange (ETDEWEB)

    Li, Leliang; Zheng, Jun, E-mail:; Zuo, Yuhua; Cheng, Buwen; Wang, Qiming


    Thin films of Eu{sup 2+}/Er{sup 3+} codoped barium strontium silicate were deposited on a thermal oxide Si substrate by magnetron sputtering. Optical properties suggest that after a rapid annealing process, these films can lead to efficient Er{sup 3+} emission at 1.54 μm with a lifetime of about 7.9 ms. Intense 1.54-μm light emission was achieved under broad ultraviolet light excitation through efficient energy transfer from Eu{sup 2+} to Er{sup 3+}. These results indicate that the Eu{sup 2+}/Er{sup 3+} thin films have potential applications as low cost and compact erbium doped waveguide amplifiers pumped by LEDs. - Highlights: • The Er{sub 0.07}Eu{sub 0.14}Sr{sub 1.14}Ba{sub 0.79}SiO{sub 4} films are fabricated by magnetron sputtering. • Efficient energy transfer from Eu{sup 2+} to Er{sup 3+} ions by the dipole–dipole interaction. • Intense 1.54 μm emission is achieved under broad excitation spectrum. • The films have potential applications as low cost and compact EDWAs.

  19. Dopant Behaviours of Sm2O3 on Microstructure and Properties of Barium Zirconium Titanate Ceramics

    Institute of Scientific and Technical Information of China (English)

    王永力; 李龙土; 齐建全; 桂治轮


    The effect of Sm2O3-dopant on the sintering characteristics and dielectric properties of barium zirconium titanate ceramics (BaZrxTi1-xO3) was investigated. It is shown that trace amount of Sm2O3 can greatly affect the grain growth and densification of barium zirconium titanate ceramics during sintering. At the same time, the dielectric peak at high temperature shifts to lower temperature and that at low temperature shifts to higher temperature. The two dielectric peaks overlap with each other when the Sm2O3-dopant content varies from 0.25% to 1%, and the maximum relative dielectric constant is greatly enhanced. These effects may be attributed to the substitution actions of the rare earth element in perovskite lattice. At the doping content of 0.75%, the dielectric constant maximum of 23570 can be obtained. By adopting some proper additives, an excellent Y5V dielective material is obtained, and the room temperature properties are as follows: relative dielectric constant εRT≥23,000, dielectric loss tgδ≤0.0075 and the breakdown strength under alternating field Eb≥5 kV·mm-1.

  20. Influence of preparation route and slip casting conditions on titania and barium titanate ceramics

    Institute of Scientific and Technical Information of China (English)

    Arvind K.Nikumbh; Parag V.Adhyapak


    Titania (TiO2) and barium titanate (BaTiO3) were synthesized using three different dicarboxylates,which included oxalate,malate and tartarate.These powders were characterized by X-ray powder diffraction,scanning electron micrographs,BET specific surface area and particle size distribution.Their properties depended to a great extent on the nature of the precursor.The titania and barium titanate powders obtained from the tartarate precursor were found to be good for slip casting.Slips of these oxides with different solids contents were prepared at different pH values using both distilled water and ethanol as the dispersing agent and also with and without deflocculant.The theological behaviors of the suspensions were then determined,and the slip,green and sedimentation bulk densities were measured.The minimum viscosities were observed at pH 8.2 for the TiO2-water and pH 10.2 for the BaTiO3-water system.

  1. Determination of barium and antimony in gun shot residues by neutron activation analysis

    International Nuclear Information System (INIS)

    The antimony contents on both hands of 7 persons before and after firing an automatic pistol were determined by instrumental neutron activation analysis. The gun shot residues were removed from hands by a 4% solution of cellulose acetate in acetone. The average content of antimony on both hands before firing obtained from 70 measurements (35 from each hand) was 0.040 ± 0.010 micro gram, whereas the average contents on the right and the left hands after 1 firing were 0.385 ± 0.036 and 0.144 ± 0.029 micro gram respectively. The ration of the antimony contents after 1 firing to the normal level (before firing) was 9.9 for the right and 3.6 for the left. No significant difference was observed between male and female, smoker and non-smoker. The antimony content after several firings was not much different from that of 1 firing and it reduced to the normal level within 2 days after firing. The barium contents before and after firing were studied from one person. Barium was precipitated as Ba SO4 before counting. An average contents of 0.936 ± 0.551 micro gram for both hands before firing, 4.092 ± 2.687 micro gram for the right hand and 1.363 ± 0.879 micro gram for the left hand after 1 firing were found

  2. Rapid synthesis of barium titanate microcubes using composite-hydroxides-mediated avenue

    Energy Technology Data Exchange (ETDEWEB)

    He, Xi; Ouyang, Jing, E-mail:; Jin, Jiao; Yang, Huaming, E-mail:


    Highlights: • Barium titanate oxides microcubes can be synthesized within 1 min. • Composite-hydroxides-mediated strategy provided a possible large scale production. • BST obtained in the strategy showed fairly good crystallinity and tetragonality. - Abstract: This paper reports the rapid synthesis of barium titanate (BaTiO{sub 3}, BTO) microcubes via composite-hydroxides-mediated reaction within 1 min. X-ray diffraction (XRD), scanning electron microscopy (SEM) and energy dispersion spectrum (EDS) results confirmed both cubic and tetragonal lattices in the sample and the uniform microcubes with an average size of 1 μm. Ultraviolet–visible (UV–vis) spectrum indicated that the band gap of the BTO powder was 3.05 eV. Ferroelectric polarization vs. electric field (P–E) tests showed that the ferroelectric domains had formed in the as-synthesized BTO microcubes and sintered ceramics. BTO ceramics sintered at 1100 °C for 3 h showed fairly good tetragonality and possessed a maximum polarization of 0.21 μC/cm{sup 2}, indicating that the sintering temperature for the BTO powders prepared via this method was relatively low. The process and equipment reported herein provided a potential method for the rapid synthesis of titanate based perovskites.

  3. Sulphate removal over barium-modified blast-furnace-slag geopolymer. (United States)

    Runtti, Hanna; Luukkonen, Tero; Niskanen, Mikko; Tuomikoski, Sari; Kangas, Teija; Tynjälä, Pekka; Tolonen, Emma-Tuulia; Sarkkinen, Minna; Kemppainen, Kimmo; Rämö, Jaakko; Lassi, Ulla


    Blast-furnace slag and metakaolin were geopolymerised, modified with barium or treated with a combination of these methods in order to obtain an efficient SO4(2-) sorbent for mine water treatment. Of prepared materials, barium-modified blast-furnace slag geopolymer (Ba-BFS-GP) exhibited the highest SO4(2-) maximum sorption capacity (up to 119mgg(-1)) and it compared also favourably to materials reported in the literature. Therefore, Ba-BFS-GP was selected for further studies and the factors affecting to the sorption efficiency were assessed. Several isotherms were applied to describe the experimental results of Ba-BFS-GP and the Sips model showed the best fit. Kinetic studies showed that the sorption process follows the pseudo-second-order kinetics. In the dynamic removal experiments with columns, total SO4(2-) removal was observed initially when treating mine effluent. The novel modification method of geopolymer material proved to be technically suitable in achieving extremely low concentrations of SO4(2-) (<2mgL(-1)) in mine effluents.

  4. Growth of thick YBa2Cu3O7 layers via a barium fluoride process

    International Nuclear Information System (INIS)

    The ex situ process has emerged as a popular technology for growing epitaxial YBa2Cu3O7 (YBCO) for the second generation of coated conductors. The process combines low cost, ease of scale-up, the possibility of achieving high critical currents in relatively thick YBCO layers, as well as high tolerances to substrate misalignment. All of these factors explain why the process is increasingly becoming adapted by manufacturing companies for the production of YBCO wires. Studies of the barium fluoride variant of the ex situ process have offered rare insights into the structure, chemistry and pinning in ultra-thick, 5 μm, ex situ YBCO layers. The transition to thick YBCO layers is viewed as one of the key ingredients of the commercial success of the YBCO wire technology, which makes these studies especially relevant. This review is intended to be a comprehensive introduction into the history, physics and chemistry of barium fluoride processing, discussed concomitantly with recent results and trends in this field. Furthermore, comparisons are made between YBCO films made by ex situ and in situ deposition processes. (topical review)

  5. Curie temperature and magnetic properties of aluminum doped barium ferrite particles prepared by ball mill method (United States)

    Chen, Daming; Harward, Ian; Baptist, Joshua; Goldman, Sara; Celinski, Zbigniew


    Barium ferrite has attracted considerable interest in the fields of permanent magnets and perpendicular magnetic recording due to its strong uniaxial anisotropy and high Curie temperature (Tc). We prepared aluminum doped barium ferrite ceramics (BaAlxFe12-xO19, 0≤x≤6) by the ball mill method. The powder was milled for 96 h, and after forming pellets, annealed for 48 h in air at 1000 °C. The X-ray diffraction (XRD) data show that there are only single hexagonal phases in the samples without any impurity phase. The crystal lattice constants, a and c, were calculated by Cohen's method. Both a and c decrease with increasing x, ranging from 0.588 nm and 2.318 nm to 0.573 nm and 2.294 nm, respectively. A Vibrating Sample Magnetometer (VSM) and Superconducting Quantum Interference Device (SQUID) were used to investigate Tc and magnetic properties of BaFe12-xAlxO19. It is found that Tc decreases with increasing x, from 425 °C to 298 °C. It is also found that the saturated magnetization (4πMs) decreases with increasing x, while the coercivity (Hc) increases with the increase in x. The anisotropy field was also determined from the SQUID measurement.

  6. Synthesis of nanosized barium titanate/epoxy resin composites and measurement of microwave absorption

    Indian Academy of Sciences (India)

    M Murugan; V K Kokate; M S Bapat; A M Sapkal


    Barium titanate/epoxy resin composites have been synthesized and tested for microwave absorption/transmission. Nanocrystalline barium titanate (BaTiO3 or BT) was synthesized by the hydrothermal method and the composites of BT/epoxy resin were fabricated as thin solid slabs of four different weight ratios. BT was obtained in the cubic phase with an average particle size of 21 nm, deduced from the X-ray diffraction data. The reflection loss (RL) and transmission loss (TL) of the composite materials were measured by the reflection/transmission method using a vector network analyser R&S: ZVA40, in the frequency range 8.0–18.5 GHz (X and Ku-bands). The RL was found to be better than −10 dB over wide frequency bands. The higher RL for lower concentration of BT could be due to increase in impedance matching effects. Low TL values indicate that the absorption by BT is quite low. This could be due to formation of BT in the cubic paraelectric phase.

  7. Radium and barium removal through blending hydraulic fracturing fluids with acid mine drainage. (United States)

    Kondash, Andrew J; Warner, Nathaniel R; Lahav, Ori; Vengosh, Avner


    Wastewaters generated during hydraulic fracturing of the Marcellus Shale typically contain high concentrations of salts, naturally occurring radioactive material (NORM), and metals, such as barium, that pose environmental and public health risks upon inadequate treatment and disposal. In addition, fresh water scarcity in dry regions or during periods of drought could limit shale gas development. This paper explores the possibility of using alternative water sources and their impact on NORM levels through blending acid mine drainage (AMD) effluent with recycled hydraulic fracturing flowback fluids (HFFFs). We conducted a series of laboratory experiments in which the chemistry and NORM of different mix proportions of AMD and HFFF were examined after reacting for 48 h. The experimental data combined with geochemical modeling and X-ray diffraction analysis suggest that several ions, including sulfate, iron, barium, strontium, and a large portion of radium (60-100%), precipitated into newly formed solids composed mainly of Sr barite within the first ∼ 10 h of mixing. The results imply that blending AMD and HFFF could be an effective management practice for both remediation of the high NORM in the Marcellus HFFF wastewater and beneficial utilization of AMD that is currently contaminating waterways in northeastern U.S.A. PMID:24367969

  8. Single Molecule Fluorescence Imaging as a Technique for Barium Tagging in Neutrinoless Double Beta Decay

    CERN Document Server

    Jones, B J P; Nygren, D R


    Background rejection is key to success for future neutrinoless double beta decay experiments. To achieve sensitivity to effective Majorana lifetimes of $\\sim10^{28}$ years, backgrounds must be controlled to better than 0.1 count per ton per year, beyond the reach of any present technology. In this paper we propose a new method to identify the birth of the barium daughter ion in the neutrinoless double beta decay of $^{136}$Xe. The method adapts Single Molecule Fluorescent Imaging, a technique from biochemistry research with demonstrated single ion sensitivity. We explore possible SMFI dyes suitable for the problem of barium ion detection in high pressure xenon gas, and develop a fiber-coupled sensing system with which we can detect the presence of bulk Ba$^{++}$ ions remotely. We show that our sensor produces signal-to-background ratios as high as 85 in response to Ba$^{++}$ ions when operated in aqueous solution. We then describe the next stage of this R\\&D program, which will be to demonstrate chelation...

  9. Ammonia synthesis with barium-promoted iron–cobalt alloys supported on carbon

    DEFF Research Database (Denmark)

    Hagen, Stefan; Barfod, Rasmus; Fehrmann, Rasmus;


    Iron–cobalt alloys supported on carbon were investigated as ammonia synthesis catalysts. Barium was found to have a promoting effect for Fe with an optimum atomic ratio Ba/Fe of 0.35. At this Ba loading, a local maximum for the NH3 synthesis activity was found at 4 wt% Co by varying the Fe/Co ratio....... Samples containing only Co and no Fe, however, yielded by far the most active catalysts (7.0 μmol (NH3) g−1 s−1, 673 K, 10 bar). Barium was a very efficient promoter for Co, increasing the NH3 synthesis activity by more than two orders of magnitude compared to the unpromoted Co samples, while...... it was not as effective for Fe. Power-law kinetic investigation revealed that, compared to the commercial Fe-based NH3 catalyst, the Ba–Co/C samples showed a lower inhibition by NH3 and were more active under ordinary ammonia synthesis conditions....

  10. Effect of glucagon on the diagnostic accuracy of double-contrast barium enema examinations. (United States)

    Thoeni, R F; Vandeman, F; Wall, S D


    The effect of glucagon-induced hypotonicity on the diagnostic accuracy of double-contrast barium enema examinations was determined in 133 consecutive patients in a double-blind crossover study. All patients underwent colonoscopy and served as their own controls by undergoing a double-contrast study after intravenous injection of 1 mg of glucagon and another after intravenous injection of 1 ml of saline placebo, in randomized order. The frequencies of good/excellent hypotonicity and quality of examinations after first doses of glucagon (55.3% and 80.8%) were not significantly different from the frequencies of good/excellent results after first doses of saline (51.3% and 86.5%). The sensitivity was 72.6% after glucagon and 64.5% after placebo; the specificity was 88.7% after glucagon and 77.9% after placebo; and the respective accuracies were 81.2% and 71.9%. These percentages should be used only to compare results with and without glucagon and, by study design, do not represent results of a complete double-contrast study. The variation among these percentages was not statistically significant, but diverticulitis was more accurately diagnosed after glucagon. It was concluded that glucagon does not significantly improve the sensitivity and specificity of the double-contrast barium enema examination and should be used only in selected instances. PMID:6606942

  11. Low-Temperature Synthesis and Thermodynamic and Electrical Properties of Barium Titanate Nanorods

    Directory of Open Access Journals (Sweden)

    Florentina Maxim


    Full Text Available Studies regarding the morphology dependence of the perovskite-type oxides functional materials properties are of recent interest. With this aim, nanorods (NRs and nanocubes (NCs of barium titanate (BaTiO3 have been successfully synthesized via a hydrothermal route at temperature as low as 408 K, employing barium acetate, titanium isopropoxide, and sodium hydroxide as reagents without any surfactant or template. Scanning electron microscopy (SEM, transmission electron microscopy (TEM, and X-ray powder diffraction (XRD, used for the morphology and structure analyses, showed that the NRs were formed by an oriented attachment of the NCs building-blocks with 20 nm average crystallites size. The thermodynamic properties represented by the relative partial molar free energies, enthalpies, and entropies of the oxygen dissolution in the perovskite phase, as well as the equilibrium partial pressure of oxygen, indicated that NRs powders have lower oxygen vacancies concentration than the NCs. This NRs characteristic, together with higher tetragonallity of the structure, leads to the enhancement of the dielectric properties of BaTiO3 ceramics. The results presented in this work show indubitably the importance of the nanopowders morphology on the material properties.

  12. Sulphate removal over barium-modified blast-furnace-slag geopolymer. (United States)

    Runtti, Hanna; Luukkonen, Tero; Niskanen, Mikko; Tuomikoski, Sari; Kangas, Teija; Tynjälä, Pekka; Tolonen, Emma-Tuulia; Sarkkinen, Minna; Kemppainen, Kimmo; Rämö, Jaakko; Lassi, Ulla


    Blast-furnace slag and metakaolin were geopolymerised, modified with barium or treated with a combination of these methods in order to obtain an efficient SO4(2-) sorbent for mine water treatment. Of prepared materials, barium-modified blast-furnace slag geopolymer (Ba-BFS-GP) exhibited the highest SO4(2-) maximum sorption capacity (up to 119mgg(-1)) and it compared also favourably to materials reported in the literature. Therefore, Ba-BFS-GP was selected for further studies and the factors affecting to the sorption efficiency were assessed. Several isotherms were applied to describe the experimental results of Ba-BFS-GP and the Sips model showed the best fit. Kinetic studies showed that the sorption process follows the pseudo-second-order kinetics. In the dynamic removal experiments with columns, total SO4(2-) removal was observed initially when treating mine effluent. The novel modification method of geopolymer material proved to be technically suitable in achieving extremely low concentrations of SO4(2-) (<2mgL(-1)) in mine effluents. PMID:27318734

  13. Structural and optical characterization of barium sulphide thin films grown by solution growth technique

    International Nuclear Information System (INIS)

    Three thin films of barium sulphide were deposited on glass slides using solution growth technique. The bath compositions include barium chloride (BaCI/sub 2/) which was the source of Ba/sup 2+/ sodium thiosulphate (Na/sub 2/S/sub 2/O/sub 3/5H/sub 2/O), source of S/sup 2-) and EDTA served as a complexing agent. The structural compositions of these films were examined using the microscope (HUND WETZLAR H600) and camera (RICOH 35mm SLR, XR-X300) at magnification of x400. Fourier transform infrared (FTIR) spectroscopy and spectrophotometer were used to determine the optical properties like absorbance, transmittance, reflectance, refractive index, extinction coefficient and optical conductivity. The results of characterization show that these films have poor absorbance and reflectance. The transmittance range of the films from UV-NIR is 60-90%. The range of the refractive index is 1.3-1.6; extinction coefficient has range of 0.001-0.012 while optical conductivity has a range of 1.0 x10/sup 12/ s/sup -1/-2.5 * 10/sup 12/ s/sup -1/. (author)

  14. Mapping of strain mechanisms in barium titanate by three-dimensional X-ray diffraction

    DEFF Research Database (Denmark)

    Majkut, Marta

    This thesis presents an in-situ three-dimensional study of the grain-scale response of a prototypical piezoelectric ceramic, barium titanate (BT), to an exernally applied electric field. Piezoceramics take advantage of the coupling of electrical and mechanical energies for use in sensors and actu......This thesis presents an in-situ three-dimensional study of the grain-scale response of a prototypical piezoelectric ceramic, barium titanate (BT), to an exernally applied electric field. Piezoceramics take advantage of the coupling of electrical and mechanical energies for use in sensors...... and actuators, found in both common applications such as fuel injectors and specialized applications such as medical imaging equipment. Since piezoceramics are typically used in the polycrystalline state it is important to consider not just the crystal structure but also the role of intergranular effects...... local environment at the cubic to tetragonal transition during processing. When a field is applied, we observe a first-order orientation dependence with second order deviations, again attributed to the grain neighbourhood effect. Corellation of this with microstructural parameters such as grain size...

  15. Synthesis and characterization of hard magnetic composite photocatalyst-Barium ferrite/silica/titania

    International Nuclear Information System (INIS)

    Hard magnetic composite photocatalytic particles-barium ferrite (magnetic core)/silica (intermediate layer)/titania (photoactive shell) (B/S/T) were prepared by wet-chemical methods. Anatase titania nanoparticles were directly coated on the silica-coated barium ferrite forming photoactive titania shell by hydrolysis and condensation of titanium n-butoxide. The prepared hard magnetic composite photocatalyst can be magnetically fluidized and recovered by an applied magnetic field enhancing both the separation and mixing efficiency for remediating fluids. The prepared composite particles were characterized with scanning electron microscopy (SEM), transmission electron microscopy (TEM), high resolution TEM (HRTEM), X-ray diffraction (XRD), energy dispersive spectroscopy (EDS), BET specific surface area measurement and inductively coupled plasma (ICP) spectroscopy. The photocatalytic activity of the synthesized composite particles was tested by photodegradation of Procion red MX-5B dye under UV illumination (302 nm) and compared with that of titania nanoparticles. The as-prepared composite particles were photoactive, with enhanced photocatalytic activity after the heat-treatment at 500 deg. C for 1 h. The reusability of the composite photocatalytic particles was also tested and the recycled composite particles presented the photocatalytic activity comparable to the fresh composite particles

  16. Electronic structure of barium strontium titanate by soft-x-ray absorption spectroscopy

    Energy Technology Data Exchange (ETDEWEB)

    Uehara, Y. [Mitsubishi Electric Co., Hyogo (Japan); Underwood, J.H.; Gullikson, E.M.; Perera, R.C.C. [Ernest Orlando Lawrence Berkeley National Lab., CA (United States)


    Perovskite-type titanates, such as Strontium Titanate (STO), Barium Titanate (BTO), and Lead Titanate (PTO) have been widely studied because they show good electric and optical properties. In recent years, thin films of Barium Strontium Titanate (BST) have been paid much attention as dielectrics of dynamic random access memory (DRAM) capacitors. BST is a better insulator with a higher dielectric constant than STO and can be controlled in a paraelectric phase with an appropriate ratio of Ba/Sr composition, however, few studies have been done on the electronic structure of the material. Studies of the electronic structure of such materials can be beneficial, both for fundamental physics research and for improving technological applications. BTO is a famous ferroelectric material with a tetragonal structure, in which Ti and Ba atoms are slightly displaced from the lattice points. On the other hand, BST keeps a paraelectric phase, which means that the atoms are still at the cubic lattice points. It should be of great interest to see how this difference of the local structure around Ti atoms between BTO and BST effects the electronic structure of these two materials. In this report, the authors present the Ti L{sub 2,3} absorption spectra of STO, BTO, and BST measured with very high accuracy in energy of the absorption features.

  17. Structural aspects of barium borosilicate glasses containing thorium and uranium oxides

    International Nuclear Information System (INIS)

    Barium borosilicate glasses incorporated with 15.86 wt% ThO2 and containing different amounts of uranium oxide were prepared by conventional melt quench method. Based on 29Si and 11B magic angle spinning nuclear magnetic resonance (MAS NMR) studies, it has been confirmed that uranium oxide incorporation is associated with distortion of borosilicate network as revealed by the increase in the relative concentration of Q2 structural units of silicon as well as the increase in the quadrupolar coupling constant (C q) of BO3 structural units. The increased number of non-bridging oxygen atoms brought about by the increase in Q2 structural units of silicon facilitates the incorporation of both uranium and thorium ions in the sites created by non-bridging oxygen atoms (network modifying positions) in the glass. Uranium oxide incorporation above 7.5 wt% resulted in the phase separation of ThO2 as revealed by the X-ray diffraction studies. The present study focuses on the structural changes with the borosilicate network of barium borosilicate glasses brought about by the introduction of thorium and uranium ions

  18. Organometallic halide perovskite/barium di-silicide thin-film double-junction solar cells (United States)

    Vismara, R.; Isabella, O.; Zeman, M.


    Barium di-silicide (BaSi2) is an abundant and inexpensive semiconductor with appealing opto-electrical properties. In this work we show that a 2-μm thick BaSi2-based thin-film solar cell can exhibit an implied photo-current density equal to 41.1 mA/cm2, which is higher than that of a state-of-the-art wafer-based c-Si hetero-junction solar cell. This performance makes BaSi2 an attractive absorber for high-performing thin-film and multi-junction solar cells. In particular, to assess the potential of barium di-silicide, we propose a thin-film double-junction solar cell based on organometallic halide perovskite (CH3NH3PbI3) as top absorber and BaSi2 as bottom absorber. The resulting modelled ultra-thin double-junction CH3NH3PbI3 / BaSi2 (< 2 μm) exhibits an implied total photo-current density equal to 38.65 mA/cm2 (19.84 mA/cm2 top cell, 18.81 mA/cm2 bottom cell) and conversion efficiencies up to 28%.

  19. Role of intensive milling in the processing of barium ferrite/magnetite/iron hybrid magnetic nano-composites via partial reduction of barium ferrite

    International Nuclear Information System (INIS)

    In this research a mixture of barium ferrite and graphite was milled for different periods of time and then heat treated at different temperatures. The effects of milling time and heat treatment temperature on the phase composition, thermal behavior, morphology and magnetic properties of the samples have been investigated using X-ray diffraction, differential thermal analysis, high resolution transmission electron microscopy and vibrating sample magnetometer techniques, respectively. X-ray diffraction results revealed that BaFe12O19/Fe3O4 nanocomposites form after a 20 h milling due to the partial reduction of BaFe12O19. High resolution transmission electron microscope images of a 40 h milled sample showed agglomerated structure consisting of nanoparticles with a mean particle size of 30 nm. Thermal analysis of the samples via differential thermal analysis indicated that for un-milled samples, heat treatment up to 900 °C did not result in α-Fe formation, while for a 20 h milled sample heat treatment at 700 °C resulted in reduction process progress to the formation of α-Fe. Wustite was disappeared in an X-ray diffraction pattern of a heat treated sample at 850 °C, by increasing the milling time from 20 to 40 h. By increasing the milling time, the structure of heat treated samples becomes magnetically softer due to an increase in saturation magnetization and a decrease in coercivity. Saturation magnetization and coercivity of a sample milled for 20 h and heat treated at 850 °C were 126.3 emu/g and 149.5 Oe which by increasing the milling time to 40 h, alter to 169.1 emu/g and 24.3 Oe, respectively. High coercivity values of milled and heat treated samples were attributed to the nano-scale formed iron particles. - Graphical abstract: Display Omitted - Highlights: • Barium ferrite and graphite were treated mechano-thermally. • Increasing milling time increases reduction progress after heat treatment. • Composites including iron nano-crystals forms by

  20. Role of intensive milling in the processing of barium ferrite/magnetite/iron hybrid magnetic nano-composites via partial reduction of barium ferrite

    Energy Technology Data Exchange (ETDEWEB)

    Molaei, M.J., E-mail: [Materials and Energy Research Center, P.O. Box: 31787-316, Karaj (Iran, Islamic Republic of); Delft Chem Tech, Faculty of Applied Sciences, Delft University of Technology, Julianalaan 136, 2628 BL Delft (Netherlands); Ataie, A.; Raygan, S. [School of Metallurgy and Materials Engineering, College of Engineering, University of Tehran, P.O. Box: 14395-553, Tehran (Iran, Islamic Republic of); Picken, S.J. [Delft Chem Tech, Faculty of Applied Sciences, Delft University of Technology, Julianalaan 136, 2628 BL Delft (Netherlands)


    In this research a mixture of barium ferrite and graphite was milled for different periods of time and then heat treated at different temperatures. The effects of milling time and heat treatment temperature on the phase composition, thermal behavior, morphology and magnetic properties of the samples have been investigated using X-ray diffraction, differential thermal analysis, high resolution transmission electron microscopy and vibrating sample magnetometer techniques, respectively. X-ray diffraction results revealed that BaFe{sub 12}O{sub 19}/Fe{sub 3}O{sub 4} nanocomposites form after a 20 h milling due to the partial reduction of BaFe{sub 12}O{sub 19}. High resolution transmission electron microscope images of a 40 h milled sample showed agglomerated structure consisting of nanoparticles with a mean particle size of 30 nm. Thermal analysis of the samples via differential thermal analysis indicated that for un-milled samples, heat treatment up to 900 °C did not result in α-Fe formation, while for a 20 h milled sample heat treatment at 700 °C resulted in reduction process progress to the formation of α-Fe. Wustite was disappeared in an X-ray diffraction pattern of a heat treated sample at 850 °C, by increasing the milling time from 20 to 40 h. By increasing the milling time, the structure of heat treated samples becomes magnetically softer due to an increase in saturation magnetization and a decrease in coercivity. Saturation magnetization and coercivity of a sample milled for 20 h and heat treated at 850 °C were 126.3 emu/g and 149.5 Oe which by increasing the milling time to 40 h, alter to 169.1 emu/g and 24.3 Oe, respectively. High coercivity values of milled and heat treated samples were attributed to the nano-scale formed iron particles. - Graphical abstract: Display Omitted - Highlights: • Barium ferrite and graphite were treated mechano-thermally. • Increasing milling time increases reduction progress after heat treatment. • Composites

  1. 11 CFR 114.14 - Further restrictions on the use of corporate and labor organization funds for electioneering... (United States)


    ... restrictions on the use of corporate and labor organization funds for electioneering communications. (a)(1... of which is to pay for an electioneering communication that is not permissible under 11 CFR 114.15... electioneering communication that is not permissible under 11 CFR 114.15. (2)(i) Any person other than...

  2. 11 CFR 114.15 - Permissible use of corporate and labor organization funds for certain electioneering communications. (United States)


    ... CFR 100.29, to those outside the restricted class unless the communication is susceptible of no... 11 Federal Elections 1 2010-01-01 2010-01-01 false Permissible use of corporate and labor organization funds for certain electioneering communications. 114.15 Section 114.15 Federal Elections...

  3. 46 CFR 171.114 - Penetrations and openings in watertight bulkheads in a vessel less than a 100 gross tons. (United States)


    ... 46 Shipping 7 2010-10-01 2010-10-01 false Penetrations and openings in watertight bulkheads in a vessel less than a 100 gross tons. 171.114 Section 171.114 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) SUBDIVISION AND STABILITY SPECIAL RULES PERTAINING TO VESSELS CARRYING PASSENGERS Penetrations and Openings in...

  4. 18 CFR 11.4 - Use of government dams for pumped storage projects, and use of tribal lands. (United States)


    ... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Use of government dams for pumped storage projects, and use of tribal lands. 11.4 Section 11.4 Conservation of Power and Water Resources FEDERAL ENERGY REGULATORY COMMISSION, DEPARTMENT OF ENERGY REGULATIONS UNDER THE FEDERAL POWER ACT ANNUAL CHARGES UNDER PART I OF...

  5. Determination of free barium in barium sulphate by atomic absorption spectrometry%火焰原子吸收光谱法测定硫酸钡中的游离钡

    Institute of Scientific and Technical Information of China (English)



    关于硫酸钡中游离钡的含量,国标中没有规定分析方法,随着硫酸钡用途的增加,游离钡的含量已成为硫酸钡产品中一个重要的杂质指标.提出了用火焰原子吸收分光光度法分析硫酸钡中的游离钡,并对溶解试样过程中酸度的控制、燃气的流量控制、助燃气的选择等影响因素进行了讨论.在波长553.6 nm、氧化亚氮作助燃气的条件下进行实验,计算得到的相对标准偏差为1.6%~3.5%,加标回收率为99.13%~ 100.07%,灵敏度为0.2,钡的检出限为0.2 mg/L,该方法具有低干扰性和高准确性的特点,测定结果令人满意,能够满足工业化生产要求.%There isn't analysis method for free barium of barium sulphate in national standards.With the increasing use of barium barium content has become one of the important impurity indexes of barium sulphate product.Free barium was analyzed by flame atomic absorption spectrometry (AAS).The influencing factors,such as the acidity when sample was dissolved, the gas flow, and selection of combustion-supporting gas, in experiment were discussed.The experiment was carried out under the conditions of the wavelength of 553.6 nm and with nitrous oxide as combustion-supporting gas.Through calculation relative standard deviation was at 1.6%~3.5% .standard sample recovery rates was at 99.13%~100.07% , sensitivity was 0.2,and barium detect limit was 0.2 mg/L.The deter-mination by AAS had the features of low interference and high accuracy.The experimental results were quite satisfactory and this method could meet the industrialized production requirements.

  6. Efficacy of Barium-Based Fecal Tagging for CT Colonography: a Comparison between the Use of High and Low Density Barium Suspensions in a Korean Population - a Preliminary Study

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Min Ju; Park, Seong Ho; Lee, Seung Soo; Byeon, Jeong Sik; Kim, Jung Hoon; Kim, Yeoung Nam; Kim, Ah Young; Ha, Hyun Kwon [University of Ulsan College of Medicine, Asan Medical Center, Seoul (Korea, Republic of); Choi, Eugene K. [University of California Los Angeles, Los Angeles (United States)


    This preliminarily study was designed to determine and to compare the efficacy of two commercially available barium-based fecal tagging agents for CT colonography (CTC) (high-density [40% w/v] and low-density [4.6% w/v] barium suspensions) in a population in Korea. In a population with an identified with an average-risk for colorectal cancer, 15 adults were administered three doses of 20 ml 40% w/v barium for fecal tagging (group I) and 15 adults were administered three doses of 200 ml 4.6% w/v barium (group II) for fecal tagging. Excluding five patients in group I and one patient in group II that left the study, ten patients in group I and 14 patients in group II were finally included in the analysis. Two experienced readers evaluated the CTC images in consensus regarding the degree of tagging of stool pieces 6 mm or larger. Stool pieces were confirmed with the use of standardized CTC criteria or the absence of matched lesions as seen on colonoscopy. The rates of complete fecal tagging were analyzed on a per-lesion and a per-segment basis and were compared between the patients in the two groups. Per-lesion rates of complete fecal tagging were 52% (22 of 42; 95% CI, 37.7-66.6%) in group I and 78% (28 of 36; 95% CI, 61.7-88.5%) in group II. The difference between the two groups did not reach statistical significance (p = 0.285). The per-segment rates of complete tagging were 33% (6 of 18; 95% CI, 16.1%-56.4%) in group I and 60% (9 of 15; 95% CI, 35.7%-80.3%) in group II; again, the difference between the two groups did not reach statistical significance (p = 0.171). Barium-based fecal tagging using both the 40% w/v and the 4.6% w/v barium suspensions showed moderate tagging efficacy. The preliminary comparison did not demonstrate a statistically significant difference in the tagging efficacy between the use of the two tagging agents, despite the tendency toward better tagging with the use of the 4.6% w/v barium suspension.

  7. Experimental investigation of the effect of titanium dioxide and barium titanate additives on DC transient currents in low density polyethylene

    DEFF Research Database (Denmark)

    Khalil, M.S; Henk, Peter O; Henriksen, Mogens;


    The effect of titanium dioxide as a semiconductive additive and barium titanate as a highly polar additive on the DC transient currents in low-density polyethylene is investigated. Experiments were made using thick specimens under a high electric field (>25×106 V/m) and a constant temperature of 40...

  8. CT colonography: optimisation, diagnostic performance and patient acceptability of reduced-laxative regimens using barium-based faecal tagging

    Energy Technology Data Exchange (ETDEWEB)

    Taylor, Stuart A. [University College Hospital, Department of Specialist Radiology, London (United Kingdom); University College Hospital, Department of Imaging, London (United Kingdom); Slater, Andrew [John Radcliffe Hospital, Oxford (United Kingdom); Burling, David N.; Tam, Emily; Gartner, Louise; Scarth, Julia; Bassett, Paul [St Mark' s Hospital, Northwick Park (United Kingdom); Greenhalgh, Rebecca; Pearce, Robert; Halligan, Steve [University College Hospital, Department of Specialist Radiology, London (United Kingdom)


    To establish the optimum barium-based reduced-laxative tagging regimen prior to CT colonography (CTC). Ninety-five subjects underwent reduced-laxative (13 g senna/18 g magnesium citrate) CTC prior to same-day colonoscopy and were randomised to one of four tagging regimens using 20 ml 40%w/v barium sulphate: regimen A: four doses, B: three doses, C: three doses plus 220 ml 2.1% barium sulphate, or D: three doses plus 15 ml diatriazoate megluamine. Patient experience was assessed immediately after CTC and 1 week later. Two radiologists graded residual stool (1: none/scattered to 4: >50% circumference) and tagging efficacy for stool (1: untagged to 5: 100% tagged) and fluid (1: untagged, 2: layered, 3: tagged), noting the HU of tagged fluid. Preparation was good (76-94% segments graded 1), although best for regimen D (P = 0.02). Across all regimens, stool tagging quality was high (mean 3.7-4.5) and not significantly different among regimens. The HU of layered tagged fluid was higher for regimens C/D than A/B (P = 0.002). Detection of cancer (n = 2), polyps {>=}6 mm (n = 21), and {<=}5 mm (n = 72) was 100, 81 and 32% respectively, with only four false positives {>=}6 mm. Reduced preparation was tolerated better than full endoscopic preparation by 61%. Reduced-laxative CTC with three doses of 20 ml 40% barium sulphate is as effective as more complex regimens, retaining adequate diagnostic accuracy. (orig.)

  9. Synthesis and characterization of M-type barium hexferrite by ultrasonic inter-dispersion of chemical precipitate

    International Nuclear Information System (INIS)

    This work is concerned with the study the synthesis and characterization of M-type barium hexaferrite powder by chemical precipitation type and ultrasonic interdispersion of precursor materials Fe(OH)3 and Ba(OH)2,separately and ultrasonic inter-dispersion, followed by drying and calcining. In order to guide the experimental work was carried out a preliminary thermodynamic analysis of the system Ba-Fe-H2O at 25 deg C. The study shows that the phase formation of M-type barium hexaferrite is obtained at a calcination at 1000 deg C, characterized by X-ray diffraction, the grain growth of the final product of synthesis depending on the calcination temperature is visible by SEM. The synthesis method developed in this research is an option to achieve the results that would be obtained if the co-precipitation of ferric and barium hydroxide was thermodynamically possible, where you can get crystallization of barium hexaferrite in a calcination at 1000 deg C. (author)

  10. A one-dimensional barium(II) coordination polymer with a coordinated nitro group of 2-nitrobenzoate

    Indian Academy of Sciences (India)

    Bikshandarkoil R Srinivasan; Santosh Y Shetgaonkar; Pallepogu Raghavaiah


    The aqueous reaction of barium carbonate with 2-nitrobenzoic acid (2-nbaH) results in the formation of a one-dimensional coordination polymer, catena-poly[[hexa(aqua)dibarium(II)]bis[(2-2-nitrobenzoate-O,O,O-NO2)(2-2-nitrobenzoate-O,O,O')

  11. The diagnosis of recurrent gastric carcinoma: high-field-strength MRI compared with barium meal of alimentary canal gastroscope

    International Nuclear Information System (INIS)

    Objective: To evaluate the clinical value of high-field-strength MRI in the diagnosis of recurrent gastric cancer compared with X-ray barium meal and gastroscope examinations. Methods: All the 53 cases of postoperative recurrence of gastric cancer underwent MRI, X-ray barium meal and gastroscopy examinations. Using the results of surgery or biopsy as the gold standard, the differences in categorical data were analyzed with the Chi square test. Results: Thirty postoperative recurrent gastric carcinoma in anastomotic stoma confirmed with pathological findings. There was ten cases with adjacent tissue infiltration and remote metastasis. Thirteen cases had no recurrent gastric carcinoma. The sensibility, specificity, accuracy, positive predictive value and negative predictive value for recurrent gastric carcinoma in anastomotic stoma for MRI, barium meal of alimentary canal and gastroscope were 96.6% , 86.9% , 92.4% , 90.6% , 95.2% ; 70.0% , 86.9% , 77.3% , 87.5% , 68.9% ; 96.6% , 91.3% , 94.3% , 93.5% , 95.4% respectively. The sensibility, specificity, accuracy, positive predictive value and negative predictive value for recurrent gastric cancer (including adjacent tissue infiltration and remote metastasis) were 97.5% , 76.9% , 92.4% , 92.8% , 90.9% ; 52.5% , 76.9% , 58.4% , 87.5% , 34.4% ; 72.5% , 84.6% , 75.4% , 93.5% , 50.0% respectively. There were significant differences between MRI and X-ray barium meal with respect to detect recurrent gastric carcinoma in anastomotic stoma and MRI is better than X-ray barium meal to detect recurrent gastric carcinoma in anastomotic stoma (χ2=4.90, P<0.05). There were no significant differences between MRI and gastroscope with respect to detect recurrent gastric carcinoma in anastomotic stoma (χ2=0.03, P>0.05). In examination of recurrent gastric carcinoma including adjacent tissue infiltration and remote metastasis, MRI shows statistical differences with X-ray barium meal (χ2=12.46, P<0.05) and gastroscopy (χ2=5.26, P<0

  12. Collisional processes involving the metastable 6s5d 3DJ levels of barium

    International Nuclear Information System (INIS)

    The authors have studied a number of collisional processes involving the metastable 6s5d 3DJ levels of barium. The metastable levels were populated through optical pumping of the 6s21S0 → 6s6p 3P01 intercombination transition at 791.13 nm, followed by either spontaneous or stimulated decay into the 3D1,2 levels. Collisional mixing further redistributed population over the three 3DJ levels. The authors measured line shapes and foreign-gas broadening rates for the 6s5d 3D1 → 5d6p 1D02, 6s5d 3D2 → 5d6p 3F3, and 6s5d 3D3 → 5d6p 3F4 transitions by using a cw pump laser to populate the metastable levels and monitoring the absorption of a weak cw probe laser. In additions, line shapes and broadening rates were also measured for the 6s21S0 → 6s6p 1P01 resonance and 6s21S0 → 6s6p 3P01 intercombination transitions. Using the broadening rate coefficients determined for these transitions, they were able to accurately estimate the total number density of barium atoms in the heat-pipe oven, as well as the number density of atoms in the metastable levels when optically pumping the vapor. The authors estimate that 60% of the barium atoms were pumped into the metastable levels using 200 mW of cw laser power. They have also developed a useful technique for studying time-resolved line shapes that combines the time resolution capabilities of a pulsed laser with the frequency resolution of a narrowband, single-mode cw laser. With this technique, they have measured time-dependent line shapes for transitions involving metastable levels using a pulsed pump laser and a cw probe. A comparison of the pulsed and cw line shapes indicates that experimental conditions are below the threshold where Stark broadening is significant

  13. Hot-pressed barium sulphate ceramic waste forms for direct immobilization of medium level Magnox waste

    International Nuclear Information System (INIS)

    A possible method of treatment for Magnox cladding waste is by dissolution in nitric acid and precipitation of barium sulphate-based floc with which radioactive ions are co-precipitated. The floc could then be immobilized in a matrix material such as cement or bitumen to give the waste form, or alternatively can be converted directly into a waste form by hot pressing. This paper describes the direct conversion of barium sulphate floc, containing simulated radwaste, into a synthetic, ceramic version of the natural mineral barite by a hot-pressing route. By variation of the parameters pressure, temperature and time, optimum conditions for consolidation of the floc to > 90% theoretical density on a laboratory scale are found to be 22.5 MPa, 9000C for 10 minutes. Using a pressure of 15 MPa, at 9000C for 30 min., hot-pressed billets of BaSO4 have been made on a 5 kg scale. In going from the magnox waste to the hot-pressed barium sulphate a volume reduction factor approx. 18 is achieved. The principal phases in the product are found to be BaSO4, MgO and Fe3O4, and the degree of consolidation achieved depends on the MgO content. The leaching behaviour of the hot-pressed materials in 1000C, 3 day Soxhlet tests also depends on the MgO content, and on the consequent level of open porosity. If there is porosity accessible to the leach water, MgO at the internal surfaces is converted to Mg(OH)2, which deposits within the pores, and a weight gain is registered in the Soxhlet test. If, however, there is no open porosity, a weight loss occurs, and leach rates approx. 4 x 10-7 kg/m2/sec are found. In contrast, pure BaSO4, hot-pressed to similar densities, shows no variation in leaching behaviour over a wide range of open porosities, and gives Soxhlet leach rates approx. 8 x 10-8 kg/m2/sec. 6 figures, 2 tables

  14. Monte Carlo estimation of radiation doses during paediatric barium meal and cystourethrography examinations

    Energy Technology Data Exchange (ETDEWEB)

    Dimitriadis, A; Gialousis, G; Karlatira, M; Karaiskos, P; Georgiou, E; Yakoumakis, E [Medical Physics Department, Medical School, University of Athens, 75 Mikras Asias Str., Goudi 11527, Athens (Greece); Makri, T; Papaodysseas, S, E-mail: [Radiological Imaging Department, Ag. Sofia Hospital, Lebadias and Thibon, Goudi 11527, Athens (Greece)


    Organ doses are important quantities in assessing the radiation risk. In the case of children, estimation of this risk is of particular concern due to their significant radiosensitivity and the greater health detriment. The purpose of this study is to estimate the organ doses to paediatric patients undergoing barium meal and micturating cystourethrography examinations by clinical measurements and Monte Carlo simulation. In clinical measurements, dose-area products (DAPs) were assessed during examination of 50 patients undergoing barium meal and 90 patients undergoing cystourethrography examinations, separated equally within three age categories: namely newborn, 1 year and 5 years old. Monte Carlo simulation of photon transport in male and female mathematical phantoms was applied using the MCNP5 code in order to estimate the equivalent organ doses. Regarding the micturating cystourethrography examinations, the organs receiving considerable amounts of radiation doses were the urinary bladder (1.87, 2.43 and 4.7 mSv, the first, second and third value in the parentheses corresponds to neonatal, 1 year old and 5 year old patients, respectively), the large intestines (1.54, 1.8, 3.1 mSv), the small intestines (1.34, 1.56, 2.78 mSv), the stomach (1.46, 1.02, 2.01 mSv) and the gall bladder (1.46, 1.66, 2.18 mSv), depending upon the age of the child. Organs receiving considerable amounts of radiation during barium meal examinations were the stomach (9.81, 9.92, 11.5 mSv), the gall bladder (3.05, 5.74, 7.15 mSv), the rib bones (9.82, 10.1, 11.1 mSv) and the pancreas (5.8, 5.93, 6.65 mSv), depending upon the age of the child. DAPs to organ/effective doses conversion factors were derived for each age and examination in order to be compared with other studies.

  15. 阿联酋采购AGM-114R3海尔法导弹

    Institute of Scientific and Technical Information of China (English)




  16. Barium chloride induces redox status unbalance, upregulates cytokine genes expression and confers hepatotoxicity in rats-alleviation by pomegranate peel. (United States)

    Elwej, Awatef; Grojja, Yousri; Ghorbel, Imen; Boudawara, Ons; Jarraya, Raoudha; Boudawara, Tahia; Zeghal, Najiba


    The present study was performed to establish the therapeutic efficacy of pomegranate peel against barium chloride induced liver injury. Adult rats were divided into four groups of six animals each: group I, serving as controls, received distilled water; group II received by their drinking water 67 ppm of BaCl2; group III received both 67 ppm of BaCl2 by the same way than group II and 5 % of pomegranate peel (PP) via diet; group IV received 5 % of PP. Analysis by HPLC/MS of PP showed its rich composition in flavonoids such as gallic acid, castalin, hyperin, quercitrin, syringic acid, and quercetin. The protective effects of pomegranate peel against hepatotoxicity induced by barium chloride were assessed using biochemical parameters and histological studies. Exposure of rats to barium caused oxidative stress in the liver as evidenced by an increase in malondialdehyde (MDA), lipid hydroperoxides (LOOHs), H2O2 and advanced oxidation protein product (AOPP) levels, and lactate dehydrogenase (LDH), gamma glutamyl transpeptidase (GGT), alanine aminotransferase (AST) and aspartate aminotransferase (ALT) activities, a decrease in catalase (CAT) and glutathione peroxidase (GPx) activities, glutathion (GSH), non-protein thiol (NPSH), vitamin C levels, and Mn-SOD gene expression. Liver total MT levels, MT-1, and MT-2 and pro-inflammatory cytokine genes expression like TNF-α, IL-1β and IL-6 were increased. Pomegranate peel, supplemented in the diet of barium-treated rats, showed an improvement of all the parameters indicated above.The present work provided ethnopharmacological relevance of pomegranate peel against the toxic effects of barium, suggesting its beneficial role as a potential antioxidant. PMID:26732703



    Taba, P


    One source of water pollutions is caused by the high use of surface-active agents (surfactants) by industries and households. As a consequence, it is required to remove such substances from the environment One of the important and widely used methods for removal of substances from solution is adsorption. In this research, MCM-41 and its modification MCM41-TMCS were used to adsorb nonionic surfactant, Triton X-114. FTIR and NMR methods were used to study the interaction between the...

  18. Comparison between the exact and the thermal description of the pairing interaction in 114Sn

    International Nuclear Information System (INIS)

    The pairing interaction is solved exactly in the 114Sn nucleus using a realistic strength parameter as well as standard energy levels for the shell seniority zero states. The same single-particle and two-body Hamiltonian is treated with finite-temperature BCS and the thermal random-phase approximation. The results obtained through these calculations are compared to obtain insight about the suitability of the thermal approach to the description of nuclear phenomena

  19. Investigation on microstructure and internal friction for low density TiB2/ZL114 composites

    Institute of Scientific and Technical Information of China (English)

    Wenmao HUANG; Haihong ZHAN; Lingyan XU; Zhengbing XU; Jianmin ZENG


    TiB2/ZL114 composites with the density of 2.733 g/cm3 were fabricated through reaction of K2TiF4 and KBF4 (LSM method). The composites were characterized by X-ray diffraction (XRD) and scanning electron microscope (SEM). The internal friction measurements were performed on DTM-Ⅱ-J dynamic modulus damping an-alyzer and the mechanisms were investigated. Experimental results indicate that reinforced particles are well-distributed in the matrix and the internal friction value of TiB2/ZL114 composites is up to a maximum of 9.04x10-3, almost twice that of ZL114. The internal friction results form dislocation vibration within the material,the sliding of grain boundary and phase interface, and together with the micro-plastic deformation caused by difference in coefficients of thermal expansion and elasticity modulus of various phases. The average internal friction values of samples with the sizes of 40 min×4 mm×2 mm, 40 mm×8 mm×2 mm and 40 mm×25 mm×2 mm are 8.83x 10-3, 8.89x 10-3, and 8.93×10-3, respectively. Thus, the developed composites are of low density, high internal friction, and the sizes of samples have no relation to the internal friction behavior.

  20. The IMF-sensitive 1.14-micron Na I doublet in early-type galaxies

    CERN Document Server

    Smith, Russell J; Lucey, John R; Conroy, Charlie; Carter, David


    We present J-band spectroscopy of passive galaxies focusing on the Na I doublet at 1.14 {\\mu}m. Like the Na I 0.82 {\\mu}m doublet, this feature is strong in low-mass stars and hence may provide a useful probe of the initial mass function (IMF). From high signal-to-noise composite spectra, we find that Na I 1.14 {\\mu}m increases steeply with increasing velocity dispersion, {\\sigma}, and for the most massive galaxies (\\sigma > 300 km/s) is much stronger than predicted from synthetic spectra with Milky-Way-like IMFs and solar abundances. Reproducing Na I 1.14 {\\mu}m at high {\\sigma} likely requires either a very high [Na/H], or a bottom-heavy IMF, or a combination of both. Using the Na D line to break the degeneracy between IMF and abundance, we infer [Na/H] $\\approx$ +0.5 and a steep IMF (single-slope-equivalent x $\\approx$ 3.2, where x = 2.35 for Salpeter), for the high-\\sigma galaxies. At lower mass ({\\sigma} = 50-100 km/s), the line strengths are compatible with MW-like IMFs and near-solar [Na/H]. We highlig...