WorldWideScience

Sample records for bargan ba bahregiri

  1. Akinola, AP Olokuntoye, BA

    African Journals Online (AJOL)

    ... ELASTIC THIN PLATE. Akinola, A.P. Olokuntoye, B.A.; Fadodun, 0.0. and Borokinm', A.S. ... 54 Akinola et al.: Analysis of Vibration Frequency in Transverselyisotropic Semilinear Elastic Thin Plate ... mathematically quite complex. The main ...

  2. Ba isotopic signature for early differentiation between Cs and Ba in natural fission reactors

    Science.gov (United States)

    Hidaka, Hiroshi; Gauthier-Lafaye, François

    2008-08-01

    Ba isotopic studies of the Oklo and Bangombé natural fission reactors in east Gabon provide information on the geochemical behavior of radioactive Cs ( 135Cs and 137Cs) in a geological medium. Large isotopic deviations derived from fissiogenic Ba were found in chemical leachates of the reactor uraninites. The fissiogenic Ba isotopic patterns calculated by subtracting the non-fissiogenic component are classified into three types that show different magnifications of chemical fractionation between Cs and Ba. In addition, the isotopic signatures of fissiogenic 135Ba, 137Ba and 138Ba suggest an early differentiation between Cs and Ba of less than 20 years after the production of fissiogenic Cs and Ba. On the other hand, only small excesses of 135Ba ( ɛ < +1.8) and/or 137Ba ( ɛ < +1.3) were identified in some clay samples, which might have resulted from selective adsorption of 135Cs and 137Cs that migrated from the reactors by differentiation.

  3. Y-Ba Superconducting Ceramics

    Science.gov (United States)

    Shunbao, Tian; Xiaofei, Li; Tinglian, Wen; Zuxiang, Lin; Shichun, Li; Huijun, Yu

    Polycrystalline Y-Ba-Cu-O superconducting materials have been studied. It was found that chemical composition and processing condition may play an important role in the final structure and superconducting properties. The density has been determined and compared with the calculated value according to the structure model reported by Bell Labs. The grain size and the morphology of the materials were observed by SEM.

  4. BaMa / Raivo Juurak

    Index Scriptorium Estoniae

    Juurak, Raivo, 1949-

    2002-01-01

    Eesti ülikoolide üleminekust 3+2 süsteemile. Lühend BaMa on tulnud kasutusele seoses Euroopa ülikoolide õppekavade reformimisega ning tähistab õppekava, kus esimese astme läbimise järel omandatakse bakalaureuse- ja teise järel magistrikraad. Õppekavade tüüpidest Eesti ja Euroopa Liidu kõrgkoolides ning Bologna deklaratsioonist

  5. IBFM for Ba isotopes and chaoticity

    Energy Technology Data Exchange (ETDEWEB)

    Bucurescu, D.; Cata-Danil, G.; Ivascu, M.; Ur, C.A. (Inst. of Atomic Physics, Bucharest (Romania)); Gizon, A.; Gizon, J. (Inst. des Sciences Nucleaires, 38 - Grenoble (France))

    1992-08-01

    Fluctuation properties have been analysed for the energy levels predicted by IBFM calculations in the Ba isotopes {sup 121}Ba to {sup 131}Ba. The results indicate, in general, a situation which is close to the chaotic limit. For the lighter isotopes studied (121 and 123), a phase transition is obtained in the low-spin, positive parity states, from a situation close to regularity at low excitation energies, towards chaoticity at higher excitations. (orig.).

  6. AMiBA, XMM, and Cluster Surveys

    CERN Document Server

    Liang, H

    2001-01-01

    The Array for Microwave Background Anisotropy (AMiBA) is an interferometric array of 19 dishes co-mounted on a steerable platform and operating at 95GHz. One of the main scientific aims of AMiBA is to conduct cluster surveys using the Sunyaev-Zel'dovich (SZ) effect. Here we explore the potential of AMiBA as a tailor-made SZ instrument for the study of cluster physics and cosmology via cluster surveys out to the epoch of cluster formation. In particular, we explore the potential of combining AMiBA cluster surveys with the XMM-LSS (Large Scale Structure) survey.

  7. BaBar Data Aquisition

    CERN Document Server

    Scott, I; Grosso, P; Hamilton, R T; Huffer, M E; O'Grady, C; Russell, J J

    1998-01-01

    The BaBar experiment at the Stanford Linear Accelerator Center is designed to perform a search for CP violation by analysing the decays of a very large sample of B and Bbar mesons produced at the high luminosity PEP-11 accelerator. The data acquisition system must cope with a sustained high event rate, while supporting real time feature extraction and data compression with minimal dead time. The BaBar data acquisition system is based around a common VME interface to the electronics read-out of the separate detector subsystems. Data from the front end electronics is read into commercial VME processors via a custom "personality card" and PCI interface. The commercial CPUs run the Tornado operating system to provide a platform for detector subsystem code to perform the necessary data processing. The data are read out via a non-blocking network switch to a farm of commercial UNIX processors. Careful design of the core data acquisition code has enabled us to sustain events rates in excess of 20 kHz while maintaini...

  8. Quasiparticle Band Structure of BaS

    Institute of Scientific and Technical Information of China (English)

    LU Tie-Yu; CHEN De-Yan; HUANG Mei-Chun

    2006-01-01

    @@ We calculate the band structure of BaS using the local density approximation and the GW approximation (GWA),i.e. in combination of the Green function G and the screened Coulomb interaction W. The Ba 4d states are treated as valence states. We find that BaS is a direct band-gap semiconductor. The result shows that the GWA band gap (Eg-Gw = 3.921 eV) agrees excellently with the experimental result (Eg-EXPT = 3.88 eV or 3.9eV).

  9. Syntheses, crystal structure, and electronic properties of the five ABaMQ4 compounds RbBaPS4, CsBaPS4, CsBaVS4, RbBaVSe4, and CsBaVSe4

    Science.gov (United States)

    Mesbah, Adel; Prakash, Jai; Rocca, Dario; Lebègue, Sébastien; Beard, Jessica C.; Lewis, Benjamin A.; Ibers, James A.

    2016-01-01

    Five new compounds belonging to the ABaMQ4 family were synthesized by solid-state chemistry at 1123 K. The compounds RbBaPS4, CsBaPS4, CsBaVS4, RbBaVSe4, and CsBaVSe4 are isostructural and have the TlEuPS4 structure type. They crystallize in space group D162h - Pnma of the orthorhombic system. Their structure consists isolated MQ4 tetrahedra separated by A and Ba atoms to form a salt-like structure. Density Functional Theory (DFT) calculations of the electronic structures with the use of the HSE functional suggest that the compounds are semiconductors with calculated band gaps of 3.3 eV (RbBaPS4), 3.4 eV (CsBaPS4), 2.3 eV (CsBaVS4), and 1.6 eV (RbBaVSe4).

  10. Thermophysical properties of BaUO4

    Science.gov (United States)

    Tanaka, Kosuke; Tokushima, Kazuyuki; Kurosaki, Ken; Ohishi, Yuji; Muta, Hiroaki; Yamanaka, Shinsuke

    2013-11-01

    Polycrystalline specimens of barium uranate, BaUO4, were prepared and several properties such as the thermal expansion coefficient, elastic moduli, thermal conductivity, and Debye temperature were evaluated. The sintered specimens had a single-phase orthorhombic structure and were crack-free. The elastic moduli of BaUO4 were determined from the longitudinal and shear sound velocities and from micro-indentation tests. The Debye temperature was also determined from the sound velocities and lattice parameter measurements. The thermal conductivity of BaUO4 was calculated from the measured density at room temperature, literature values of heat capacity, and thermal diffusivity measured by the laser flash method in vacuum. The thermophysical properties of BaUO4 were examined and compared with literature data for other barium ternary oxides and SrUO4.

  11. Exciton luminescence in BaFCl crystal

    Energy Technology Data Exchange (ETDEWEB)

    Radzhabov, E

    1998-05-01

    The luminescence spectra and decay characteristics of both 5.45 and 3.4 eV bands in BaFCl oxygen-free crystals were investigated at 5-300 K temperature range using vacuum ultraviolet excitation as well as X-ray excitation. The similarities with excitons in alkali halides allow us to consider both excitons in BaFCl as on-center excitons and strong off-center excitons.

  12. Luminescence and scintillation properties of BaY2F8 : Ce3+, BaLu2F8 and BaLu2F8 : Ce3+

    NARCIS (Netherlands)

    van't Spijker, JC; Dorenbos, P; van Eijk, CWE; Jacobs, JEM; den Hartog, HW; Korolev, N

    1999-01-01

    Spectroscopic and scintillation properties of BaY2F8 :Ce3+, BaLu2F8 and BaLu2F8 :Ce3+ are presented. For pure BaLu2F8, a luminescence with a decay time of similar to 1 ns is observed under gamma-ray excitation. This luminescence with a light yield of about 200 ph/MeV is attributed to core-valence lu

  13. Luminescence and scintillation properties of BaY2F8 : Ce3+, BaLu2F8 and BaLu2F8 : Ce3+

    NARCIS (Netherlands)

    van't Spijker, JC; Dorenbos, P; van Eijk, CWE; Jacobs, JEM; den Hartog, HW; Korolev, N

    1999-01-01

    Spectroscopic and scintillation properties of BaY2F8 :Ce3+, BaLu2F8 and BaLu2F8 :Ce3+ are presented. For pure BaLu2F8, a luminescence with a decay time of similar to 1 ns is observed under gamma-ray excitation. This luminescence with a light yield of about 200 ph/MeV is attributed to core-valence

  14. Coulomb excitation of levels in /sup 135/Ba and /sup 137/Ba

    Energy Technology Data Exchange (ETDEWEB)

    Dragulescu, E.; Ivascu, M.; Popescu, D.; Semenescu, G. (Institutul de Fizica si Inginerie Nucleara, Bucharest (Romania)); Mihu, R. (Bucharest Univ. (Romania). Dept. of Physics); Velenik, A. (Zagreb Univ. (Yugoslavia). Farmacetsko-Biokemijski Facultet); Paar, V. (Zagreb Univ. (Yugoslavia). Prirodoslovno Matematicki Fakultet)

    1984-08-01

    The low-lying states of /sup 135/Ba and /sup 137/Ba have been studied by means of Coulomb excitation with /sup 14/N, /sup 16/O and ..cap alpha.. particles. Angular distribution measurements were carried out for some transitions in both nuclei with 11.2 MeV ..cap alpha.. particles. Level energies, decay schemes, branching ratios, B(E2) up values and some spin assignments have been established. For the first time B(E2) up values in /sup 137/Ba have been measured and a new level at 1252.5 MeV with spin 7/2/sup +/ was observed. /sup 137/Ba and /sup 135/Ba have been described theoretically by coupling one and three holes, respectively, to the quadrupole vibrations, and rather good agreement with experiment was obtained.

  15. High spin properties of 124Ba

    Indian Academy of Sciences (India)

    K Ilangovan; N Arunachalam

    2002-03-01

    The 124Ba nucleus is investigated on the basis of the method of statistical mechanics by assuming the nucleons to move in triaxially deformed Nilsson potential. The variation in the Fermi energies of protons and neutrons is studied as a function of spin and temperature. The Fermi energies determined as a function of angular momentum is used to study the dependence of shell correction on angular momentum using the Strutinsky smoothing procedure. The most important observation is that the shell correction is almost the same for all spins for 124Ba. The spin cutoff parameter and the single particle level density parameter are studied as a function of spin and temperature. Constant entropy lines drawn by plotting the excitation energy against angular momentum are found to be roughly at constant energy above the yrast line and are almost equally spaced. It is observed that no yrast traps are present for 124Ba.

  16. Liquidus temperatures and phase equilibria in the BaCl2-MCl-BaO systems

    Science.gov (United States)

    Nikolaeva, E. V.; Bovet, A. L.; Korzun, I. V.

    2017-02-01

    The liquidus temperatures of the BaO-BaCl2-MCl systems (with M = alkali metal) are determined by thermal analysis. The caloric effects observed during melting of the barium-containing chloride eutectic with barium oxide additions are studied. A chemical mechanism of barium oxide dissolution in the melts is confirmed. X-ray diffraction patterns taken for the melt solidified after experiment indicate the presence of barium oxychloride Ba4OCl6 in the solid phase. It is shown that the significant increase in the liquidus temperature in adding the barium oxide to barium-containing chloride molten mixtures is related to substantial changes in their composition and structure.

  17. Incorporation of Ba in Al and Fe pollucite

    Science.gov (United States)

    Vance, Eric R.; Gregg, Daniel J.; Griffiths, Grant J.; Gaugliardo, Paul R.; Grant, Charmaine

    2016-09-01

    Ba, the transmutation product of radioactive Cs, can be incorporated at levels of up to ∼0.07 formula units in Cs(1-2x)BaxAlSi2O6 aluminium pollucite formed by sol-gel methods and sintering at 1400 °C, with more Ba forming BaAl2Si2O8 phases. The effect of Ba substitution in pollucite-structured CsFeSi2O6 was also studied and no evidence of Ba substitution in the pollucite structure via cation vacancies or Fe2+ formation was obtained. The Ba entered a Fe-silicate glass structure. Charge compensation was also attempted with a Cs+ + Fe3+ ↔ Ba2+ + Ni2+ scheme but again the Ba formed a glass and NiO was evident. PCT leaching data showed CsFeSi2O6 to be very leach resistant.

  18. Intercomparision of Standardized Radioactive Solution of 133Ba

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    <正>133Ba is a very important nuclide in the field of radiation, for example applied to efficienency calibration of the γ spectromenter. To ensure the accurate and reliable of measurement results of 133Ba, to

  19. Nucleon-Pair Shell Model: Magnetic Excitations for Ba Isotopes

    Institute of Scientific and Technical Information of China (English)

    LUO YanAn; NING PingZhi

    2002-01-01

    Magnetic excitations for Ba isotopes are discussed within the nucleon-pair shell model trmicated iti the SDsubspace. With the SD pair determined by a surface-δ interaction, M1 transitions for 1344Ba are well fitted. The M1 andM3 transitions for 132Ba and 130Ba are also predicted. It is shown that the statement, the collective magnetic propertiesarc due to the orbital motion of nucleons, is approximately valid.

  20. Spectroscopy of Ba and Ba$^+$ deposits in solid xenon for barium tagging in nEXO

    CERN Document Server

    Mong, B; Walton, T; Chambers, C; Craycraft, A; Benitez-Medina, C; Hall, K; Fairbank, W; Albert, J B; Auty, D J; Barbeau, P S; Basque, V; Beck, D; Breidenbach, M; Brunner, T; Cao, G F; Cleveland, B; Coon, M; Daniels, T; Daugherty, S J; DeVoe, R; Didberidze, T; Dilling, J; Dolinski, M J; Dunford, M; Fabris, L; Farine, J; Feldmeier, W; Fierlinger, P; Fudenberg, D; Giroux, G; Gornea, R; Graham, K; Gratta, G; Heffner, M; Hughes, M; Jiang, X S; Johnson, T N; Johnston, S; Karelin, A; Kaufman, L J; Killick, R; Koffas, T; Kravitz, S; Krucken, R; Kuchenkov, A; Kumar, K S; Leonard, D S; Licciardi, C; Lin, Y H; Ling, J; MacLellan, R; Marino, M G; Moore, D; Odian, A; Ostrovskiy, I; Piepke, A; Pocar, A; Retiere, F; Rowson, P C; Rozo, M P; Schubert, A; Sinclair, D; Smith, E; Stekhanov, V; Tarka, M; Tolba, T; Twelker, K; Vuilleumier, J -L; Walton, J; Weber, M; Wen, L J; Wichoski, U; Yang, L; Yen, Y -R; Zhao, Y B

    2014-01-01

    Progress on a method of barium tagging for the nEXO double beta decay experiment is reported. Absorption and emission spectra for deposits of barium atoms and ions in solid xenon matrices are presented. Excitation spectra for prominent emission lines, temperature dependence and bleaching of the fluorescence reveal the existence of different matrix sites. A regular series of sharp lines observed in Ba$^+$ deposits is identified with some type of barium hydride molecule. Lower limits for the fluorescence quantum efficiency of the principal Ba emission transition are reported. Under current conditions, an image of $\\le10^4$ Ba atoms can be obtained. Prospects for imaging single Ba atoms in solid xenon are discussed.

  1. Magnetic comparison of BaCa and BaSr substituted hexaferrite powders

    Energy Technology Data Exchange (ETDEWEB)

    Gonzalez-Angeles, A [Alvaro Gonzalez-Angeles, Facultad de IngenierIa, Universidad Autonoma de Baja California, (UABC), Blvd. Benito Juarez s/n, Cp 21280 Mexicali, B. C. (Mexico); Lipka, J; Gruskova, A; Slama, J; Jancarik, V; Slugen, V, E-mail: gangelesa@yahoo.com.m [Faculty of Electrical Engineering and Information Technology, (FEEIT), Slovak University of Technology, (SUT), Ilkovicova 3, 812 19 Bratislava (Slovakia)

    2010-03-01

    Results on magnetic studies of Ba{sub 0.5}Sr{sub 0.5}Fe{sub 12-2x}(ZnTi){sub x}O{sub 19} and Ba{sub 0.75}Ca{sub 0.25}Fe{sub 12-2x}(ZnTi){sub x}O{sub 19}, where x = 0.2 to 0.6, ferromagnetic powders prepared by mechanical alloying are discussed. The structural and magnetic properties of the resulting powders were analyzed by thermo-magnetic analysis, X-ray diffraction, scanning electron microscopy, Moessbauer spectroscopy and magnetic measurements. Curie temperature, T{sub c} decreased dramatically (drop {approx} 39%) for BaCa samples, whilst for BaSr samples remained almost without change (diminution {approx} 2%) at x {<=} 0.2. SEM studies showed that all the particles present nearly hexagonal platelet shape.

  2. The Chines BA-VP Structure and its English Translation

    Institute of Scientific and Technical Information of China (English)

    肖音

    2012-01-01

    The Ba-construction is a basic syntactic pattern in modern Chinese, and it is often regarded as one of its characteristic grammatical phenomena. This thesis demonstrates the Ba-VP sentences in details and introduces some suggestive methods to translate the Ba-VP sentences. In English there is no equivalent Ba-VP sentence pattern, thus, when translating Chines Ba-VP sentences into English, we should translate them according to their semantic functions such as “disposition”, “topic/comment” and “causation”。

  3. Mechanoluminescence and thermoluminescence of BaFCl:Sm 2+ and BaFBr:Sm 2+ crystals

    Science.gov (United States)

    Brahme, Nameeta; Shukla, M.; Choubey, A. K.; Kurrey, U.; Bisen, D. P.; Dhoble, S. J.

    2012-05-01

    The alkaline-earth fluorohalide crystals MFX, where M=Ca, Sr, Ba, Pb and X=Cl, Br, I, form an important class of materials crystallizing in the PbFCl-type tetragonal structure which is also called the matlockite structure. These compounds have long been of interest because of the various defect species which can be detected by spin resonance and associated techniques. The crystals were prepared by slow cooling of the melt of a stoichiometric mixture of BaF 2 and the corresponding chloride or bromide under 0.2 bar of ultrapure argon (5N5), often slightly fluorinated. We have studied the mechanoluminescence (ML) of BaFBr:Sm 2+ and BaFCl:Sm 2+ crystals. It is seen that after the impact of a moving piston, initially the ML intensity increases with time, attains a maximum value and then it decreases with time up to a particular minimum value, and then it increases again, attaining a peak value and finally disappears. The first peak lies in the deformation region and the second peak lies in the post-deformation region. The ML intensity of the BaFCl:Sm 2+ crystal is much higher than the ML intensity of the BaFBr:Sm 2+ crystal. For different impact velocities, the ML intensity increases with velocity; and the total ML intensity attains a saturation value for higher impact velocities. The total ML intensity increases with the increase in the applied load. It is suggested that the moving dislocation produced during deformation of crystals captures holes from hole-trapped centers (like H centers), and the subsequent radiative recombination of the dislocation holes with electron gives rise to ML. Thermoluminescence (TL) of BaFBr:Sm 2+ and BaFCl:Sm 2+ crystals was studied after exposure to ultraviolet rays with the help of a TLD reader. The peak of TL for the BaFBr:Sm 2+ crystal is found at ∼247°C and for BaFCl:Sm 2+ crystals at 283°C. The TL intensity initially increases with increase in the UV radiation and then it attains saturation for higher values of UV exposure. The

  4. Hadron Physics in BaBar

    Energy Technology Data Exchange (ETDEWEB)

    Lafferty, G.D.; /Manchester U.

    2005-08-29

    Some recent results in hadron physics from the BaBar experiment are discussed. In particular, the observation of two new charmed states, the D*{sub sJ}{sup +}(2317) and the D*{sub sJ}{sup +}(2457), is described, and results are presented on the first measurement of the rare decay mode of the B meson, B{sup 0} {pi}{sup 0}{pi}{sup 0}.

  5. Electroluminescence in BaFCl single crystals

    Energy Technology Data Exchange (ETDEWEB)

    Somaiah, K.; Paracchini, C.

    1987-06-01

    A study of electroluminescence in BaFCl single crystals as a function of temperature is reported. At an excitation voltage of 5 kV, electroluminescent intensity, which is feeble at room temperature, is shown to increase with decreasing temperature. The increase is rapid between 250 K and 175 K and levels off as 80 K is approached. A tentative explanation, in the light of x-ray induced luminescence, is offered. (U.K.).

  6. New Spectroscopy at BaBar

    Energy Technology Data Exchange (ETDEWEB)

    Mazzoni, M.A.; /INFN, Rome

    2007-04-18

    The Babar experiment at the SLAC B factory has accumulated a high luminosity that offers the possibility of systematic studies of quarkonium spectroscopy and of investigating rare new phenomena. Recent results in this field are presented. In recent times spectroscopy has become exciting again, after the discovery of new states that are not easily explained by conventional models. States such as the X(3872) and the Y(4260) could be new excited charmonium states, but require precise measurements for positive identification. The BaBar experiment [1] is installed at the asymmetric storage ring PEP-II. 90% of the data accumulated by BaBar are taken at the Y(4S) (10.58 GeV) and 10% just below (10.54 GeV). The BaBar detector includes a 5-layer, double-sided silicon vertex tracker and a 40-layer drift chamber in a 1.5 T solenoidal magnetic field, which detect charged particles and measures their momenta and ionization energy losses. Photons, electrons, and neutral hadrons are detected with a CsI(Tl)-crystal electromagnetic calorimeter. An internally reflecting ring-imaging Cherenkov is also used for particle id. Penetrating muon and neutral hadrons are identified by an array of resistive-plate chambers embedded in the steel of the flux return. The detector allows good track and vertex resolution, good particle id and good photon detection so it is especially suited for spectroscopy studies.

  7. The BaBar Data Acquisition System

    CERN Document Server

    Scott, I; Grosso, P; Huffer, M E; O'Grady, C; Russell, J J

    1999-01-01

    The BaBar experiment at the Stanford Linear Accelerator Center is designed to perform a search for CP violation by ana-lyzing the decays of a very large sample of B and B(Bar) mesons produced at the high luminosity PEP-II accelerator. The data acquisition system must cope with a sustained high event rate, while supporting real time feature extraction and data compression with minimal dead time. The BaBar data acquisition system is based around a common VME interface to the electronics read-out of the separate detec-tor subsystems. Data from the front end electronics is read into commercial VME processors via a custom "Personality Card" and PCI interface. The commercial CPUs run the Tornado operating system to provide a platform for detector subsystem code to perform the necessary data processing. The data is read out via a non-blocking network switch to a farm of commercial UNIX processors. The current implementation of the BaBar data acquisition sys-tem has been shown to sustain a Level 1 trigger rate of 1.3...

  8. The thermodynamic behavior of sulfur in BaO-BaF2 slags

    Science.gov (United States)

    Rachev, Ivan P.; Tsukihashi, Fumitaka; Sano, Nobuo

    1991-06-01

    A gas-slag-metal equilibration technique was used to determine the sulfide capacity of the BaO-BaF2 system at 1473 and 1573 K. The dependence of carbonate capacity on the slag composition was also measured at these temperatures. It was found that the BaO-BaF2 system has the highest sulfide capacities among the fluxes which are of metallurgical interest. The dependence of sulfide and carbonate capacities on the partial pressure of O2 and CO2 was also investigated. The partial pressure of CO2 proved to have a strong effect on these values at the investigated temperatures. The influence of temperature on the sulfide and carbonate capacities was studied in the temperature range between 1423 and 1623 K. The data for sulfide and carbonate capacities were correlated in order to check if the carbonate capacity can be used as a measure of basicity of slags. It was found that the carbonate capacity can be used as a representative measure of the slag basicity at low contents of BaO and at temperatures higher than 1623 K when the carbonate dissolution into the slag is low and the ratio of the activity coefficient of a sulfide ion to that of a carbonate ion is independent of slag composition.

  9. Thermodynamic modeling of the Ba - Mg binary system

    Energy Technology Data Exchange (ETDEWEB)

    Ren, Xin; Li, Changrong; Du, Zhenmin; Guo, Cuiping; Chen, Sicheng [Univ. of Science and Technology, Beijing (China). School of Materials Science and Engineering

    2013-04-15

    On the basis of the thermochemical and phase equilibrium experimental data, the phase diagram of the Ba - Mg binary system has been assessed by means of the calculation of phase diagrams technique. The liquid phase is of unlimited solubility and modeled as a solution phase using the Redlich-Kister equation. The intermetallic compounds, Mg{sub 17}Ba{sub 2}, Mg{sub 23}Ba{sub 6} and Mg{sub 2}Ba, with no solubility ranges are treated as strict stoichiometric compounds with the formula Mg{sub m} Ba{sub n}. Two terminal phases, BccBa and HcpMg, are kept as solution phases, since the solubilities of the two phases are of considerable importance. After optimization, a set of self-consistent thermodynamic parameters has been obtained. The calculated values agree well with the available experimental data.

  10. DongBa Dance--Mixture of cultures

    Institute of Scientific and Technical Information of China (English)

    赵春娟

    2014-01-01

    DongBa Dance is a kind of ancient dance that created by Naxi people living in the Southwest of China and recorded by their own hieroglyph.During the development, it adopted parts of Tibetan, Indian and Egyptian cultures.So, as the mixture of cultures, DongBa Dance is marching into the world and causing a great attention.The ancient DongBa Dance will get a new life in the world.

  11. DongBa Dance——Mixture of cultures

    Institute of Scientific and Technical Information of China (English)

    赵春娟

    2014-01-01

    Dong Ba Dance is a kind of ancient dance that created by Naxi people living in the Southwest of China and recorded by their own hieroglyph.During the development, it adopted parts of Tibetan, Indian and Egyptian cultures.So, as the mixture of cultures, Dong Ba Dance is marching into the world and causing a great attention.The ancient Dong Ba Dance will get a new life in the world.

  12. Preparation of directionally solidified BaTi2O5-Ba6Ti17O40 eutectic by the floating zone method

    Science.gov (United States)

    Shiga, K.; Katsui, H.; Goto, T.

    2017-02-01

    The BaTi2O5-Ba6Ti17O40 eutectic (BaO-68.7 mol% TiO2) was directionally solidified by the floating zone (FZ) method and crystalline phases, microstructures and orientation were investigated. Ba6Ti17O40 with faceted rod-like shape was dispersed in the BaTi2O5 matrix. The growth directions of BaTi2O5 and Ba6Ti17O40 were parallel to the b and a axis, respectively, and the orientation relations were BaTi2O5 (010)//Ba6Ti17O40(60 2 ̅) and BaTi2O5 (001)//Ba6Ti17O40 (001).

  13. Geoenvironmental weathering/deterioration of landfilled MSWI-BA glass.

    Science.gov (United States)

    Wei, Yunmei; Saffarzadeh, Amirhomayoun; Shimaoka, Takayuki; Zhao, Chun; Peng, Xuya; Gao, Junmin

    2014-08-15

    Municipal solid waste incineration bottom ash (MSWI-BA) glass serves as a matrix of assorted bottom ash (BA) compounds. Deterioration of the BA glass phases is quite important as they regulate the distribution of a series of toxic elements. This paper studied landfilled MSWI-BA samples from the mineralogical and geochemical viewpoint to understand the deterioration behavior of the BA glass phases as well as mechanisms involved. Bulk analysis by PXRD as well as micro-scale analysis by optical microscopy and SEM/EDX was conducted for such purposes. The results revealed that dissolution of the BA glass phases has resulted in a deterioration layer of 10(0)-10(2)μm thickness after years of disposal. This rapid weathering process is highly relevant to the specific glass characteristics and solution pH. The BA glass phases with more embedded compounds and cracks/fissures tend to be more vulnerable. Moreover, the generally alkaline pH in ash deposit favors a rapid disruption of the glass phase. The weathering products are mainly gel phases (including Al-Si gel, Ca-Al-Si gel, Fe-Al-Si gel etc.) with iron oxide/hydroxide as accessory products. Breakdown of the BA glass phases triggers chemical evolution of the embedded compounds. Based on all the findings above, a model is proposed to illustrate a general evolution trend for the landfilled MSWI-BA glass phases. Copyright © 2014 Elsevier B.V. All rights reserved.

  14. Incorporation of Ba in Al and Fe pollucite

    Energy Technology Data Exchange (ETDEWEB)

    Vance, Eric R., E-mail: erv@ansto.gov.au [Institute of Materials Engineering, Australian Nuclear Science and Technology Organisation, Locked Bag 2001 Kirrawee DC, NSW 2232 (Australia); Gregg, Daniel J.; Griffiths, Grant J. [Institute of Materials Engineering, Australian Nuclear Science and Technology Organisation, Locked Bag 2001 Kirrawee DC, NSW 2232 (Australia); Gaugliardo, Paul R. [Centre for Microscopy, Characterisation and Analysis, The University of Western Australia, Crawley, WA 6009 (Australia); Grant, Charmaine [Institute of Materials Engineering, Australian Nuclear Science and Technology Organisation, Locked Bag 2001 Kirrawee DC, NSW 2232 (Australia)

    2016-09-15

    Ba, the transmutation product of radioactive Cs, can be incorporated at levels of up to ∼0.07 formula units in Cs{sub (1−2x)}Ba{sub x}AlSi{sub 2}O{sub 6} aluminium pollucite formed by sol-gel methods and sintering at 1400 °C, with more Ba forming BaAl{sub 2}Si{sub 2}O{sub 8} phases. The effect of Ba substitution in pollucite-structured CsFeSi{sub 2}O{sub 6} was also studied and no evidence of Ba substitution in the pollucite structure via cation vacancies or Fe{sup 2+} formation was obtained. The Ba entered a Fe-silicate glass structure. Charge compensation was also attempted with a Cs{sup +} + Fe{sup 3+} ↔ Ba{sup 2+} + Ni{sup 2+} scheme but again the Ba formed a glass and NiO was evident. PCT leaching data showed CsFeSi{sub 2}O{sub 6} to be very leach resistant. - Highlights: • Barium can be incorporated into aluminium pollucite. • Positron annihilation lifetime spectroscopy supports a charge vacancy mechanism of incorporation. • Iron pollucite does not appear to incorporate any barium with either vacancy or charge compensation mechanisms. • Leaching data suggest iron pollucite is very leach resistant.

  15. Transition probabilities in the (5) candidate 122Ba

    CERN Document Server

    Bizzeti, P G; Tonev, D; Giannatiempo, A; Ur, C A; Dewald, A; Melon, B; Michelagnoli, C; Petkov, P; Bazzacco, D; Costin, A; de Angelis, G; Della Vedova, F; Fantuzi, M; Farnea, E; Fransen, C; Gadea, A; Lenzi, S; Lunardi, S; Marginean, N; Marginean, R; Menegazzo, R; Mengoni, D; Moeller, O; Nannini, A; Napoli, D R; Nespolo, M; Pavan, P; Perego, A; Petrache, C M; Pietralla, N; Alvarez, C Rossi; Sona, P

    2010-01-01

    To investigate the possible X(5) character of 122Ba, suggested by the ground state band energy pattern, the lifetimes of the lowest yrast states of 122Ba have been measured, via the Recoil Distance Doppler-Shift method. The relevant levels have been populated by using the 108Cd(16O,2n)122Ba and the Sn(13C,3n)122Ba reactions. The B(E2) values deduced in the present work are compared to the predictions of the X(5) model and to calculations performed in the framework of the IBA-1 and IBA-2 models.

  16. Solubility of BaS in BaO-BaF2 slag and the Influence of FeOx, SiO2, Cr2O3, BaCI2, CaO, and MgO on the sulfide capacity of this system

    Science.gov (United States)

    Rachev, Ivan P.; Tsukihashi, Fumitaka; Sano, Nobuo

    1992-03-01

    The influence of SiO2, FeOx, Cr2O3, BaCl2, CaO, and MgO on the sulfide capacity of the BaO-BaF2 system was measured at 1473 K, using a gas-slag-metal equilibration technique. It was found that the substitution of BaF2 by SiO2, FeOx, Cr2O3, and BaCl2 decreases the sulfide capacity of the BaO-BaF2 system. Similar results were obtained for the carbonate capacity. The CaO-saturated BaO-BaF2 flux, however, was found to have slightly higher sulfide and carbonate capacities than the pure BaO-BaF2 flux. The solubility of CaO increased with increasing BaF2 content and was 18 mol pet in BaF2 at 1473 K. The solubility of MgO in the BaO-BaF2 system at the same temperature is very low, and it has no effect on the sulfide and carbonate capacities. The solubility of BaS in the BaO-BaF2 system was also measured at 1473 K and had its maximum for the slag containing 40 mass pet BaO. The activity of BaO in the system was calculated from those data.

  17. Um baú de fundo fundo: e esse baú nunca acaba?

    Directory of Open Access Journals (Sweden)

    Luciano Flávio de Oliveira

    2013-10-01

    Full Text Available In this paper I discuss the cultural representations in the text and in the characters of Um baú de fundo fundo, show created in 1974, by the Giramundo Teatro de Bonecos, of Belo Horizonte city. Therefore, I observe the concepts of culture, more specifically cultures in plural, and representation.

  18. Revisiting the BaO2/BaO redox cycle for solar thermochemical energy storage.

    Science.gov (United States)

    Carrillo, A J; Sastre, D; Serrano, D P; Pizarro, P; Coronado, J M

    2016-03-21

    The barium peroxide-based redox cycle was proposed in the late 1970s as a thermochemical energy storage system. Since then, very little attention has been paid to such redox couples. In this paper, we have revisited the use of reduction-oxidation reactions of the BaO2/BaO system for thermochemical heat storage at high temperatures. Using thermogravimetric analysis, reduction and oxidation reactions were studied in order to find the main limitations associated with each process. Furthermore, the system was evaluated through several charge-discharge stages in order to analyse its possible degradation after repeated cycling. Through differential scanning calorimetry the heat stored and released were also determined. Oxidation reaction, which was found to be slower than reduction, was studied in more detail using isothermal tests. It was observed that the rate-controlling step of BaO oxidation follows zero-order kinetics, although at high temperatures a deviation from Arrhenius behaviour was observed probably due to hindrances to anionic oxygen diffusion caused by the formation of an external layer of BaO2. This redox couple was able to withstand several redox cycles without deactivation, showing reaction conversions close to 100% provided that impurities are previously eliminated through thermal pre-treatment, demonstrating the feasibility of this system for solar thermochemical heat storage.

  19. A computer simulation study of oxygen defect centers in BaFBr and BaFCl

    Energy Technology Data Exchange (ETDEWEB)

    Islam, M.S.; Baetzold, R.C. (Eastman Kodak Company, Rochester, NY (United States). Corporate Research Labs.)

    1992-01-01

    Atomistic simulation techniques are used to examine several oxygen trapped-hole centers resulting from X-irradiation of BaFBr and BaFCl crystals. The calculations employ recently derived interatomic potentials for the oxide ion-host anion interactions. Particular attention is focussed on the sites occupied by the oxide impurity and the energetics of ionization. Our results show the defect model involving O{sup -} substitutional at a Br{sup -}/Cl{sup -} site to be a favorable trapped-hole center, in accord with the assignment proposed from electron paramagnetic resonance measurements. The defect simulations find a large energy barrier to oxide interstitial formation from the oxide precursor at a substitutional site, which suggests that conversion from O{sub x}{sup -} to O{sub int}{sup -} is highly unlikely as has been demonstrated in EPR experiments. Ion displacements following lattice relaxation about the defect are also examined. The position of O{sup -} substituted for Br{sup -} in BaFBr is computed to be displaced from the regular lattice site by 0.53 A, along the c axis towards the Ba{sup 2+} ion plane, in agreement with models derived later from ENDOR experiments, while O{sup -} substituted for F{sup -} remains on the lattice site in agreement with experiment. (author).

  20. Co2FeAl based magnetic tunnel junctions with BaO and MgO/BaO barriers

    Directory of Open Access Journals (Sweden)

    J. Rogge

    2015-07-01

    Full Text Available We succeed to integrate BaO as a tunneling barrier into Co2FeAl based magnetic tunnel junctions (MTJs. By means of Auger electron spectroscopy it could be proven that the applied annealing temperatures during BaO deposition and afterwards do not cause any diffusion of Ba neither into the lower Heusler compound lead nor into the upper Fe counter electrode. Nevertheless, a negative tunnel magnetoresistance (TMR ratio of -10% is found for Co2FeAl (24 nm / BaO (5 nm / Fe (7 nm MTJs, which can be attributed to the preparation procedure and can be explained by the formation of Co- and Fe-oxides at the interfaces between the Heusler and the crystalline BaO barrier by comparing with theory. Although an amorphous structure of the BaO barrier seems to be confirmed by high-resolution transmission electron microscopy (TEM, it cannot entirely be ruled out that this is an artifact of TEM sample preparation due to the sensitivity of BaO to moisture. By replacing the BaO tunneling barrier with an MgO/BaO double layer barrier, the electric stability could effectively be increased by a factor of five. The resulting TMR effect is found to be about +20% at room temperature, although a fully antiparallel state has not been realized.

  1. Effect of local environment on crossluminescence kinetics in SrF{sub 2}:Ba and CaF{sub 2}:Ba solid solutions

    Energy Technology Data Exchange (ETDEWEB)

    Terekhin, M.A. [P.N. Lebedev Physical Institute, Leninskij Prospekt 53, 119991 Moscow (Russian Federation); Makhov, V.N., E-mail: makhov@sci.lebedev.ru [P.N. Lebedev Physical Institute, Leninskij Prospekt 53, 119991 Moscow (Russian Federation); Lebedev, A.I.; Sluchinskaya, I.A. [Lomonosov Moscow State University, Moscow 119991 (Russian Federation)

    2015-10-15

    Spectral and kinetic properties of extrinsic crossluminescence (CL) in SrF{sub 2}:Ba (1%) and CaF{sub 2}:Ba (1%) are compared with those of intrinsic CL in BaF{sub 2} and are analyzed taking into account EXAFS data obtained at the Ba L{sub III} edge and results of first-principles calculations. The CL decay time was revealed to be longer in SrF{sub 2}:Ba and CaF{sub 2}:Ba compared to BaF{sub 2}. This fact contradicts the expected acceleration of luminescence decay which could result from an increased overlap of wave functions in solid solutions due to shortening of the Ba-F distance obtained in both EXAFS measurements and first-principles calculations. This discrepancy is explained by the effect of migration and subsequent non-radiative decay of the Ba (5p) core holes in BaF{sub 2} and by decreasing of the probability of optical transitions between Ba (5p) states and the valence band in SrF{sub 2}:Ba and CaF{sub 2}:Ba predicted by first-principles calculations. - Highlights: • The crossluminescence kinetics in SrF{sub 2}:Ba and CaF{sub 2}:Ba is slower than in BaF{sub 2}. • Ba{sup 2+} ions substitute for host Ca{sup 2+}(Sr{sup 2+}) ions in the on-center positions. • The nearest Ba-F distances in SrF{sub 2}:Ba and CaF{sub 2}:Ba are shorter than in BaF{sub 2}. • EXAFS data and first-principles calculations of the local structure agree well. • First-principles calculations explain slower luminescence decay in solid solutions.

  2. Quantitative Spectroscopy of BA-type Supergiants

    CERN Document Server

    Przybilla, N; Becker, S R; Kudritzki, R P

    2005-01-01

    Luminous BA-SGs allow topics ranging from NLTE physics and the evolution of massive stars to the chemical evolution of galaxies and cosmology to be addressed. A hybrid NLTE technique for the quantitative spectroscopy of BA-SGs is discussed. Thorough tests and first applications of the spectrum synthesis method are presented for four bright Galactic objects. Stellar parameters are derived from spectroscopic indicators. The internal accuracy of the method allows the 1sigma-uncertainties to be reduced to <1-2% in Teff and to 0.05-0.10dex in log g. Elemental abundances are determined for over 20 chemical species, with many of the astrophysically most interesting in NLTE. The NLTE computations reduce random errors and remove systematic trends in the analysis. Inappropriate LTE analyses tend to systematically underestimate iron group abundances and overestimate the light and alpha-process element abundances by up to factors of 2-3 on the mean. Contrary to common assumptions, significant NLTE abundance correction...

  3. A Dubious Distinction? The BA versus the BS in Psychology

    Science.gov (United States)

    Pfund, Rory A.; Norcross, John C.; Hailstorks, Robin; Aiken, Leona S.; Stamm, Karen E.; Christidis, Peggy

    2016-01-01

    Previous studies have documented small differences between the bachelor of arts (BA) and the bachelor of science (BS) psychology degrees in their general education core requirements, particularly mathematics and science courses. But are there differences between the BA and BS degrees within the psychology curriculum? Using data from the…

  4. A Dubious Distinction? The BA versus the BS in Psychology

    Science.gov (United States)

    Pfund, Rory A.; Norcross, John C.; Hailstorks, Robin; Aiken, Leona S.; Stamm, Karen E.; Christidis, Peggy

    2016-01-01

    Previous studies have documented small differences between the bachelor of arts (BA) and the bachelor of science (BS) psychology degrees in their general education core requirements, particularly mathematics and science courses. But are there differences between the BA and BS degrees within the psychology curriculum? Using data from the…

  5. Solubility of Ba in Liquid Iron and Interaction Effect of the Third Elements

    Institute of Scientific and Technical Information of China (English)

    2000-01-01

    Experiments were carried out at 1 873 K in a double-temperature zone furnace using vapor pressure method. The equilibrium tests of barium vapor with liquid iron were conducted in CaO crucibles sealed in a Mo chamber. As a result, the experiments obtained the relation between the dissolved content of Ba in liquid iron and the vapor pressure of Ba, and the standard Gibbs energies for the reactions Ba(g)=[Ba] and Ba(l)=[Ba].

  6. Radioactive contamination of BaF2 crystal scintillator

    CERN Document Server

    Polischuk, O G; Bernabei, R; Cappella, F; Caracciolo, V; Cerulli, R; Di Marco, A; Danevich, F A; Incicchitti, A; Poda, D V; Tretyak, V I

    2013-01-01

    Barium fluoride (BaF$_2$) crystal scintillators are promising detectors to search for double beta decay processes in $^{130}$Ba ($Q_{2{\\beta}}$ = 2619(3) keV) and $^{132}$Ba ($Q_{2{\\beta}}$ = 844(1) keV). The $^{130}$Ba isotope is of particular interest because of the indications on 2${\\beta}$ decay found in two geochemical experiments. The radioactive contamination of BaF$_2$ scintillation crystal with mass of 1.714 kg was measured over 113.4 hours in a low-background DAMA/R&D set-up deep underground (3600 m w.e.) at the Gran Sasso National Laboratories of INFN (LNGS, Italy). The half-life of $^{212}$Po (present in the crystal scintillator due to contamination by radium) was estimated as $T_{1/2}$ = 298.8 $\\pm$ 0.8(stat.) $\\pm$ 1.4(syst.) ns by analysis of the events pulse profiles.

  7. Neutron Diffraction Study of the Structures of Ba5CuIr3O12 and Ba16Cu3Ir10O39

    NARCIS (Netherlands)

    Blake, Graeme R.; Battle, Peter D.; Sloan, Jeremy; Vente, Jaap F.; Darriet, Jacques; Weill, François

    1999-01-01

    The crystal structures of Ba5CuIr3O12 and Ba16Cu3Ir10O39 have been determined using a combination of X-ray and neutron powder diffraction data. Considering their structures to be based on hcp stacks of Ba3O9 and Ba3CuO6 layers, Ba5CuIr3O12 has a 10-layer structure, space group P3c1 with a = 10.14055

  8. Superconductivity in Ba(Pb,Bi,Sb)O 3, Ba(Pb,Bi,Te)O 3 and (Ba,La) (Pb,Bi,Tl)O 3 systems

    Science.gov (United States)

    Nagarajan, R.; Vasanthacharya, N. Y.; Gopalakrishnan, J.; Rao, C. N. R.

    1991-02-01

    It is possible to substitute Bi in the superconducting BaPb 0.75Bi 0.25O 3 by Sb or Te without destroying the superconductivity. With Sb, a continuous series of solid solutions BaPb 0.75Bi 0.25-ySb yO 3 (0 ⩽ y ⩽ 0.25) exists, while with Te, perovskite BaPb 0.75Bi 0.25-yTe yO 3 exists only upto y = 0.15. With increasing substitution by Sb or Te, T c decreases continously in both the systems. Superconductivity with a maximum T c of 8K is found in Ba 0.9La 0.1Pb 0.9-yBi yTl 0.1O 3 for y = 0.25.

  9. The van der Waals potentials of MgCa, MgSr, MgBa, CaSr, CaBa, and SrBa

    Science.gov (United States)

    Wei, L. M.; Li, P.; Tang, K. T.

    2015-08-01

    Based on the facts that the potential energy curves of the homo-nuclear group 2 dimers (group IIA metal), except Be2, are conformal, and they can be described by the Tang-Toennies potential model, a set of simple combining rules are proposed for the parameters of the reduced potentials of the hetero-nuclear dimers. Together with the well-established combining rules of the range parameters of the exponential repulsion and the known dispersion coefficients, these rules enable us to determine the ground state potential energy curves of MgCa, MgSr, MgBa, CaSr, CaBa, and SrBa from those of Mg2, Ca2, Sr2, and Ba2. The determined potentials are comparable to some ab initio calculations and in excellent agreement with the experiment.

  10. Innovative methodology for the synthesis of Ba-M hexaferrite BaFe{sub 12}O{sub 19} nanoparticles

    Energy Technology Data Exchange (ETDEWEB)

    Ahmed, M.A., E-mail: moala@47hotmail.com [Materials Science Lab. (1), Physics Department, Faculty of Science, Cairo University, Giza (Egypt); Helmy, N. [Physics Department, Faculty of Science and Art - Girls Branch, Baha University, Bilgurashy (Saudi Arabia); El-Dek, S.I. [Materials Science Lab. (1), Physics Department, Faculty of Science, Cairo University, Giza (Egypt)

    2013-09-01

    Graphical abstract: Transmission electron microscope images for the BaFe12O19. - Highlights: • BaFe{sub 12}O{sub 19}nanoparticles were prepared in single-phase from organometallic precursors. • BaFe{sub 12}O{sub 19} possesses small size 65 nm, H{sub C} = 3695 Oe and M{sub s} = 58 emu/g. • This method of preparation could be extended in the synthesis of other metal oxide nanoparticles. - Abstract: In this piece of work, high quality and homogeneity, barium hexaferrite (BaM) BaFe{sub 12}O{sub 19} nanoparticles were prepared from organometallic precursors for the 1st time. This method is based on the formation of supramolecular crystal structure of Ba[Fe(H{sub 3}NCH{sub 2}CH{sub 2}NH{sub 3})]Cl{sub 7}·8H{sub 2}O. The crystal structure, morphology and magnetic properties of BaFe{sub 12}O{sub 19} at two different annealing temperatures namely 1000 °C and 1200 °C were investigated using X-ray diffraction, transmission electron microscope TEM and vibrating sample magnetometry (VSM). The results show that monophasic nanoparticles of hexaferrites were obtained. Nanoparticles of crystallite size 40–50 nm distinguished by narrow distribution and excellent homogeneity were obtained with superior magnetic properties which suggested single-domain particles of Ba-M hexaferrite.

  11. When one becomes two: Ba12In4Se20, not quite isostructural to Ba12In4S19

    Science.gov (United States)

    Yin, Wenlong; Iyer, Abishek K.; Li, Chao; Yao, Jiyong; Mar, Arthur

    2017-09-01

    The ternary selenide Ba12In4Se20 was synthesized by reaction of BaSe, In2Se3, and Se at 1023 K. Single-crystal X-ray diffraction revealed a trigonal structure (space group R 3 bar, Z = 6, a = 10.0360(6) Å, c = 78.286(4) Å at room temperature) consisting of one-dimensional stacks of InSe4 tetrahedra, In2Se7 double tetrahedra, selenide Se2- anions, and diselenide Se22- anions, with Ba2+ cations in the intervening spaces. The selenide Ba12In4Se20 can be derived from the corresponding sulfide Ba12In4S19 by replacing one monoatomic Ch2- anion with a diatomic Ch22- anion. An optical band gap of 1.70(2) eV, consistent with the dark red colour of the crystals, was deduced from the UV-vis-NIR diffuse reflectance spectrum.

  12. X-ray absorption spectroscopy of doped BaCeO3-BaZrO3 systems

    Science.gov (United States)

    Basu, S.; Sawant, P.; Varma, S.; Wani, B. N.; Bharadwaj, S. R.; Jha, S. N.; Bhattacharyya, D.

    2012-06-01

    A solid solution of BaCeO3-BaZrO3 combines the high protonic conductivity of BaCeO3 in presence of hydrogen containing atmospheres at elevated temperatures and appreciable chemical and mechanical stability of BaZrO3 towards water and CO2. EXAFS measurements on the BaCe0.8-xZrxY0.2O3-δ system with x = 0, 0.2, 0.4, 0.6, 0.8 at the Y (dopant) K-edge (17046 eV) were carried out. Two different structural phases were identified as a consequence of change in the doping concentrations.

  13. Spectroscopy of Ba and Ba$^+$ deposits in solid xenon for barium tagging in nEXO

    OpenAIRE

    Mong, B.; Cook, S; Walton, T.; Chambers, C.; Craycraft, A.; Benitez-Medina, C.; Hall, K.; Fairbank Jr., W.; Albert, J. B.; Auty, D. J.; Barbeau, P. S.; Basque, V.; Beck, D.; Breidenbach, M.; Brunner, T.

    2014-01-01

    Progress on a method of barium tagging for the nEXO double beta decay experiment is reported. Absorption and emission spectra for deposits of barium atoms and ions in solid xenon matrices are presented. Excitation spectra for prominent emission lines, temperature dependence and bleaching of the fluorescence reveal the existence of different matrix sites. A regular series of sharp lines observed in Ba$^+$ deposits is identified with some type of barium hydride molecule. Lower limits for the fl...

  14. REVIEW: TALES OF KHA BA DKAR PO

    Directory of Open Access Journals (Sweden)

    Jundan (Jasmine Zhang

    2015-03-01

    Full Text Available Review of: Jing Guo . 2012. Xue shan zhi shu [Tales of Kha ba dkar po] [ཁ་བ་དཀར་པོ]. Kunming: Yunnan People's Press. My favorite color is to add a little white on the whiteness, as if there was a snow-white eagle landing on a snow-covered mountain rock. My favorite color is to add a bit green on the greenness, as if there was an emerald parrot flying in the wild walnut woods. Deqin xianzi lyrics. These lyrics evoke a space beyond a sense of realism. In his book, Tales of Kha ba dkar po (ToK, Guo mentions these lines three times, suggesting a transcendental experience one may encounter in Tibetan areas while, at the same time, humbled by the mindset of human nature relations enacted by Tibetan people. ToK is, in many ways, a valuable academic work. Guo's favorite lines of xianzi allude to a 'space-in-between' the secular and sacred, which provides a unique experience for a broad readership, and induces the readers to deeper reflections on topics such as 'nature/ culture', 'belief', 'rite', and 'life/ death'. ToK is one of nineteen contemporary anthropological and ethnological works conducted in Yunnan Province, Southwest China and published in the 'Anthropology and Ethnology series in Contemporary China'. In the preface for the series, Yin (2012 suggests that there are two primary reasons for the somewhat slow development of Chinese scholarship in the field of anthropology and ethnology. One is the historically Han-centered intellectual atmosphere, and the other is the ideological ambivalence that ethnic culture has faced since the establishment of the People's Republic of China. In this context, Guo's longitudinal academic and intellectual engagement with the Tibetan communities in northwest Yunnan is included in this series as part of the increasing recognition of the significance of understanding southwest China's complex ethnic and cultural diversity.

  15. Snakebites in Paraíba, Brazil

    Directory of Open Access Journals (Sweden)

    H. N. Albuquerque

    2005-09-01

    Full Text Available The epidemiological data on snakebites in the state of Paraíba, Brazil, is scarce. This accounts for the difficulties in helping the victims. Hence, to obtain the clinical and epidemic profile of the snakebite accidents in Paraíba, we studied the number of cases recorded in this state between January 1995 and December 2000. The data was collected from these sources: Center for Toxicological Assistance (Centro de Assistência Toxicológica - CEATOX and State Secretariat of Health (Secretaria Estadual de Saude, João Pessoa; 3rd Regional Health Center (3º Núcleo Regional de Saúde - NRS and the Division of Epidemiological Vigilance of the Municipal Secretariat of Health (Divisão de Vigilância Epidemiológica da Secretaria Municipal de Saúde - DVE/SMS, Campina Grande. The annual distribution of the snakebite incidence showed an irregularity and an increase in March, May and August; followed by a large reduction in November and December. It was also observed that snakebites occurred more frequently in the rural area, mainly among the male laborers between 10-49 years. In most cases, the bite occurred on the leg or foot. The interval between the snakebite and the medical assistance was less than six hours. The most common symptoms were pain, edema, erythema, and bleeding. The low lethality index and the high frequency of healing, without sequels, suggest that the treatment with serum neutralized the poison, indicating the efficacy of this treatment against snakebites by the specific species found in this region.

  16. Structural Transformation of Hexagonal (0001)BaTiO3 Ceramics to Tetragonal (111)BaTiO3 Ceramics

    Science.gov (United States)

    Watanabe, Takayuki; Shimada, Mikio; Aiba, Toshiaki; Yabuta, Hisato; Miura, Kaoru; Oka, Kengo; Azuma, Masaki; Wada, Satoshi; Kumada, Nobuhiro

    2011-09-01

    A ceramic slurry that contains a 6H-type Ba(Ti0.95Mn0.05)O3 powder was casted into a plaster mold under 10 T magnetic field to form a green compact of (0001)-oriented Ba(Ti0.95Mn0.05)O3. After sintering the green compact at 1300 °C in air, it was confirmed that the (0001)-oriented 6H-type perovskite structure transformed to a (111)-oriented 3C-type perovskite structure. The structural transformation was again examined using hexagonal BaTiO3 prepared by reducing pseudo-cubic BaTiO3 powder in H2 atmosphere. In this case, the preferred (0001) orientation was not confirmed for the green compacts. After sintering the green compacts at 1300 °C in air, mixed crystal orientations of (100)/(001) and (111) were observed for the resultant tetragonal BaTiO3 ceramics. This (100)/(001) orientation was suppressed by annealing the hexagonal BaTiO3 powder at 1000 °C before slip-casting, leading to highly (111)-oriented ceramics. It was found that the green compacts of (0001)-oriented hexagonal BaTiO3 can transform into (111)-oriented tetragonal BaTiO3 ceramics, maintaining the macroscopic crystal orientations due to a similar atomic stacking along [0001] of 6H-type BaTiO3 and [111] of 3C-type BaTiO3.

  17. Proton microbeam irradiation effects on PtBA polymer

    Indian Academy of Sciences (India)

    J Kamila; S Roy; K Bhattacharjee; B Rout; B N Dev; R Guico; J Wang; A W Haberl; P Ayyub; P V Satyam

    2006-04-01

    Proton beam lithography has made it possible to make various types of 3D-structures in polymers. Usually PMMA, SU-8, PS polymers have been used as resist materials for lithographic purpose. Microbeam irradiation effects on poly-tert-butyl-acrylate (PtBA) polymer using 2.0 MeV proton microbeam are reported. Preliminary results on pattern formation on PtBA are carried out as a function of fluence. After writing the pattern, a thin layer of Ge is deposited. Distribution of Ge in pristine and ion beam patterned surface of PtBA polymer is studied using the optical and secondary electron microscopic experimental methods.

  18. BaMAP: A Broadband Multimedia Application Platform

    Institute of Scientific and Technical Information of China (English)

    2003-01-01

    In this paper, a broadband multimedia application platform, BaMAP, is introduced. The BaMAP aims to offer content and service providers a good integrated environment for efficient content production, management, delivery and sharing. It supports large-scale hierarchical storage, as well as mechanisms for content distribution and queries from remote nodes. The on-demand service, part of the BaMAP, offers two access interfaces, DVB-C and IP, which allow the platform to run on most of the existing access networks.

  19. 奇幻积木Q-BA-MAZE

    Institute of Scientific and Technical Information of China (English)

    2009-01-01

    <正>Q-BA-MAZE是什么?它是一个玩具,游戏,雕塑?一切看你的发挥了。Q-BA-MAZE也是一个迷宫。它如同Lego(乐高积木),是模块化的玩具,有和魔方一样的魅力,可以给你一个创造发挥的空间。Q-BA-MAZE是由建筑设计师Andrew Comfort设

  20. gamma. -ray induced luminescence of doped and undoped BaFCl

    Energy Technology Data Exchange (ETDEWEB)

    Somaiah, K. (P.G. Coll. of Science, Hyderabad (India). Dept. of Physics); Babu, V.H. (Osmania Univ., Hyderabad (India). Dept. of Physics)

    1983-07-01

    Emission spectra of ..gamma..-irradiated doped and undoped BaFCl crystals have been recorded at RT and higher temperatures. An emission band at 390 nm was observed in BaFCl. In addition to this 390 nm band, a shoulder at 460 nm in BaFCl:Tl and a narrow band at 310 nm in BaFCl:Gd were seen.

  1. Octa-coordination and the hydrated Ba2+(aq) ion

    CERN Document Server

    Chaudhari, Mangesh I; Rempe, Susan B

    2014-01-01

    The hydration structure of Ba^{2+} ion is important for understanding blocking mechanisms in potassium ion channels. Here, we combine statistical mechanical theory, ab initio molecular dynamics simulations, and electronic structure methods to calculate the hydration free energy and local hydration structure of Ba^{2+}(aq). The predicted hydration free energy (-302.9$\\pm$0.7 kcal/mol) matches the experimental value (-302.56 kcal/mol) when the fully occupied and exclusive inner solvation shell is treated. In the local environment defined by the inner and first shell of hydrating waters, Ba^{2+} is directly coordinated by eight (8) waters. Octa-coordination resembles the structure of Ba^{2+} and K^+ bound in potassium ion channels, but differs from the local hydration structure of K^+(aq) determined earlier.

  2. Recent CKM and CP Results from BaBar

    CERN Document Server

    ,

    2011-01-01

    We present recent results of B and charm decays from the BaBar experiment. These results include searches for rare or forbidden charm decays, measurements of $|V_{ub}|$ from inclusive ${\\bar B} \\rightarrow X_u l {\\bar \

  3. Results on Charmonium-like States at BaBar

    OpenAIRE

    Santoro, Valentina; Collaboration, for the BABAR

    2012-01-01

    We present recent results on charmonium and charmonium-like states from the BaBar B-factory located at the PEP-II asymmetric energy $e^{+}e^{-}$ storage ring at the SLAC National Accelerator Laboratory.

  4. Phase transformations in the Y{sub 2}BaCuO{sub 5}, <<Ba{sub 3}Cu{sub 5}O{sub 8}>> and Y{sub 2}BaCuO{sub 5}-<<BaCuO{sub 2}>> systems

    Energy Technology Data Exchange (ETDEWEB)

    Kalanda, N.A.; Trukhan, V.M. [Belorussian National Academy of Sciences, Minsk (Belarus). Inst. of Physics of Solids and Semiconductors

    2001-07-01

    Peritectic interaction of Y{sub 2}BaCuO{sub 5} and Y{sub 2}BaCuO{sub 9-{delta}} phases with the Y-Ba-Cu-O system flux melt has been modeled. The sequence of phase transformations in the Y{sub 2}BaCuO{sub 5}-<<Ba{sub 3}Cu{sub 5}O{sub 8}>> and Y{sub 2}BaCuO{sub 5}-<<BaCuO{sub 2}>> systems when forming the YBa{sub 2} Cu{sub 3} O{sub 7-{delta}} single crystal compound has been established. (orig.)

  5. Tests of AMiBA Data Integrity

    CERN Document Server

    Nishioka, Hiroaki; Wu, Jiun-Huei Proty; Ho, Paul T P; Huang, Chih-Wei Locutus; Koch, Patrick M; Liao, Yu-Wei; Lin, Kai-Yang; Liu, Guo-Chin; Molnar, Sandor M; Umetsu, Keiichi; Birkinshaw, Mark; Altamirano, Pablo; Chang, Chia-Hao; Chang, Shu-Hao; Chang, Su-Wei; Chen, Ming-Tang; Han, Chih-Chiang; Huang, Yau-De; Hwang, Yuh-Jing; Jiang, Homin; Kesteven, Michael; Kubo, Derek Y; Li, Chao-Te; Martin-Cocher, Pierre; Oshiro, Peter; Raffin, Philippe; Wei, Tashun; Wilson, Warwick

    2008-01-01

    We describe methods used to validate data from the Y.T. Lee Array for Microwave Background Anisotropy (AMiBA), an interferometric array designed to measure the Sunyaev-Zel'dovich effect and the anisotropy of the Cosmic Microwave Background (CMB). We perform several statistical tests on data from pointed galaxy cluster observations taken in 2007 and noise data from long-term blank sky observations and measurements with the feeds covered by the absorbers. We apply power spectrum analysis, cross power spectrum analysis among different outputs with different time lags in our analog correlator, and sample variance law tests to noise data. We find that (1) there is no time variation of electronic offsets on the time scale of our two-patch observations (~10 minutes); (2) noise is correlated by less than 10% between different lags; and (3) the variance of noise scales with the inverse of time. To test the Gaussianity of the data, we apply Kolmogorov-Smirnov (K-S) tests to cluster data, and find that a 5% significance...

  6. Redetermination of β-Ba(PO32

    Directory of Open Access Journals (Sweden)

    Matthias Weil

    2014-02-01

    Full Text Available In comparison with the previous structure determination of the β-modification of barium catena-polyphosphate that was based on Weissenberg film data [Grenier et al. (1967. Bull. Soc. Fr. Minéral. Cristallogr. 90, 24–31], the current CCD-data-based redetermination reveals all atoms with anisotropic displacement parameters, standard uncertainties for the atomic coordinates, and the determination of the absolute structure. Moreover, a much higher accuracy in terms of the bond-length distribution for the polyphosphate chain, with two shorter and two longer P—O distances, was achieved. The structure consists of polyphosphate chains extending parallel to [100] with a periodicity of two PO4 tetrahedra. The Ba2+ cations are located between the chains and are surrounded by ten O atoms in the form of a distorted coordination polyhedron, with Ba—O distances ranging from 2.765 (3 to 3.143 (3 Å, also reflecting the higher precision of the current redetermination.

  7. Leptonic B Decays at BaBar

    Energy Technology Data Exchange (ETDEWEB)

    Baracchini, Elisabetta; /Rome U. /INFN, Rome

    2011-11-10

    We will present the most recent results on leptonic B decays B{sup {+-}(0)} {yields} K*{sup {+-}(0)}{nu}{bar {nu}} and B{sup {+-}} {yields} {mu}{sup {+-}}{nu}, based on the data collected by the BaBar detector at PEP-II, an asymmetric e{sup +}e{sup -} collider at the center of mass energy of the {Upsilon}(4S) resonance. Rare B decays have always been a standard probe for New Physics (NP) searches. The very low Standard Model (SM) rate of these decays often make them unaccessible with the present experimental datasets, unless NP effects enhance the rate up to the current experimental sensitivity. Moreover, as NP effects can modify the decay kinematic, particular attention must be paid in order to perform a model independent analysis. A B-Factory provides an unique environment to investigate these processes. The high number of B{bar B} pairs produced by a B-Factory often allows to approach the needed experimental sensitivity. Moreover, the clean environment and the closed kinematic of the initial state enable to obtaining a very pure sample where to look for these decays.

  8. Leptonic B Decays at BaBar

    Energy Technology Data Exchange (ETDEWEB)

    Monorchio, Diego; /INFN, Naples /Naples U.

    2011-09-13

    The authors will present the most recent results on leptonic B decays B{sup {+-}(0)} {yields} K*{sup {+-}(0)} {nu}{bar {nu}} and B{sup {+-}} {yields} {mu}{sup {+-}}{nu}, based on the data collected by the BaBar detector at PEP-II, an asymmetric e{sup +}e{sup -} collider at the center of mass energy of the {Upsilon}(4S) resonance. Rare B decays have always been a standard probe for New Physics (NP) searches. The very low Standard Model (SM) rate of these decays often make them unaccessible with the present experimental datasets, unless NP effects enhance the rate up to the current experimental sensitivity. Moreover, as NP effects can modify the decay kinematic, particular attention must be payed in order to perform a model independent analysis. A B-Factory provides an unique environment where to investigate these processes. The high number of B{bar B} pairs produced by a B-Factory often allows to approach the needed experimental sensitivity. Moreover, the clean environment and the closed kinematic of the initial state enable to obtaining a very pure sample where to look for these decays.

  9. Evidence of fissiogenic Cs estimated from Ba isotopic deviations in an Oklo natural reactor zone

    Science.gov (United States)

    Hidaka, Hiroshi; Holliger, Philippe; Masuda, Akimasa

    1993-01-01

    Isotopic studies of many elements from the uranium ore natural nuclear reactors at Oklo provide useful information on the migration of radioactive nuclides. The fissiogenic isotopic composition of Ba is particularly interesting, as it is an important indication in the search for fissiogenic Cs. In this report we detail the detection of remarkable isotopic deviations of Ba in the Oklo samples and estimate the geochemical behaviour of fissiogenic Cs from excess Ba isotopes. Six samples systematically collected from borehole SF84 (zone 10) at the Oklo uranium mine have been analyzed. Isotopic deviations of Ba indicate the existence of fissiogenic Cs and Ba. A good correlation between the elemental abundance of Cs and isotopic abundances of excess 135Ba and 137Ba suggests that fissiogenic 135Ba and 137Ba behaved as Cs rather than Ba.

  10. Ba-bah on tulnud / Liina Jänes

    Index Scriptorium Estoniae

    Jänes, Liina, 1977-

    2005-01-01

    Eesti noori disainereid-sisearhitekte ühendavast disainiagentuurist Ba-bah, selle eesmärgist. Agentuuri juhib Veiko Jääger. Mais 2005 Disaini- ja Arhitektuurigaleriis toimunud Ba-bahi avanäitusest, kus oli väljas töid EKA sisearhitektuuri, klaasi-, ehte- ja sepakunsti eriala üliõpilastelt ning metallmööbli valmistajalt Kalle Pruudenilt

  11. CONTRAST STUDY ON CT AND BA IN DIAGNOSIS OF PATIENTS WITH ATHEROTHROMBOTIC BRAIN INFARCTION

    Institute of Scientific and Technical Information of China (English)

    Mingshun Liu; Haixiang Gao; Xiaomei Fu; Po Ma

    2007-01-01

    Objectives: To explore applied value on CT and BA in diagnosis of patients with atherothrombotic brain infarction. Methods:CT and BA were examined in 246 patients with atherothrombotic brain infarction. Results:The different change of CT and BA were showed in 246 patients with atherothrombotic brain infarction. Conclusions: There were separately different advantage and shortcoming in CT and BA in diagnosis of atherothrombotic brain infarction. The value of clinical application of BA was important in diagnosis of atherothrombotic brain infarction.

  12. Heating effect of BaTiO3 in microwave field and microstructure of BaTiO3

    Institute of Scientific and Technical Information of China (English)

    李永伟; 刘韩星; 张汉林; 欧阳世翕

    1997-01-01

    Microwave equipment at 2 450 MHz was employed to prepare BaTiO3 The heating effect of thesystem in the microwave field,which was influenced by several factors including dielectric properties of synthesis system and thermal insulate structures,was discussed in detail.The heating rates of the synthesis system were mainly determined by BaCO3 and TiO2 at low temperature and by TiO2 and BaTiO3 at high temperature.The results show that the heating effects in microwave field are greatly different from those in conventional furnace.The reaction of BaCO3 and TiO2 only lasts for 3 min at 1 100℃,and the fine,narrow-distributed and well-crystallized powders were prepared.

  13. Structure and stability of Ba(4)CaCu(3)O(8+delta) and Ba(6)CaCu(3)O(10+delta)

    National Research Council Canada - National Science Library

    Xuan, H.Nguyen; Bertrand, Christiane; Beauquis, Sandrine; PISCH, Alexander; Soubeyroux, Jean-Louis; Galez, Philippe

    2006-01-01

    The crystal structure and thermal stability of Ba(4)CaCu(3)O(8+delta) and Ba(6)CaCu(3)O(10+delta) has been investigated by neutron powder diffration, differential thermal analysis and thermogravimetry...

  14. CHARACTERISTICS OF BACTERIOCIN BA28 PRODUCED BY Pediococcus acidilactici BA28

    Directory of Open Access Journals (Sweden)

    Kaur Baljinder

    2013-01-01

    Full Text Available Peptic ulcers are produced by an imbalance between gastro-duodenal mucosal defense mechanisms and damaging forces of gastric acid and pepsin, combined with superimposed injury from environmental or immunologic agents. Most common symptoms of peptic ulcer disease are abdominal discomfort, gnawing ache, occurs 2 to 3 hours after meal, other symptoms includes weight loss, poor appetite, bloating, nausea, vomiting etc. Some time duodenal wall perforates; bleeding due to the ulcer breaks blood vessels and obstructs the path of food trying to leave the stomach. Various studies have shown the association of Helicobacter pylori with peptic ulcers. Probiotic lactic acid bacteria are proposed to cure peptic ulcers by reducing colonization of H. pylori with stomach wall and by eradicating already established infection. A bacteriocin producing probiotic strain of P. acidilactici BA28 was evaluated for its antimicrobial activity against a number of Gram-positive and Gram-negative pathogens. Bacteriocin BA28 was partially purificated and characterized following in vitro assays. Preliminary investigations against H. plyori have suggested its effectiveness against peptic ulcer disease and therefore could be exploited to develop novel therapeutics.

  15. Metaplasia mieloide do baço na Ancilostomose

    Directory of Open Access Journals (Sweden)

    W. O. Cruz

    1934-06-01

    Full Text Available Pesquizamos, no figado e baço de dez casos puros de ancilostomose, elementos hemocitopoieticos; verificamos o peso do baço em 23 casos de individuos com idades compreendidas entre 3 e 60 anos; não encontramos, em nenhum caso, celulas hemoformadoras no figado. Em sete casos, encontramos, no baço, elementos da série vermelha em adiantado estado de evolução (eritroblastos ortocromaticos de nucleo picnotico. Em alguns destes casos observamos megacariocitos e numerosos mielocitos eosinofilos. Os tres casos que não apresentavam metaplasia mieloide no baço, eram os de individuos acima de 50 anos de idade. Entretanto, em outro caso de um individuo com 59 anos esta metaplasia foi verificada. Em individuos acima de 20 anos, o peso médio do baço, em nove casos, mostrou-se igual ao peso normal. Em 14 casos, compreendidos entre 3 e 14 anos, o peso deste orgão foi sempre sensivelmente mais elevado que nos normais de idade correspondente. Estes resultados sugerem a possibilidade de ser a metaplasia mieloide responsavel pelos aumentos de pezo nos baços de individuos jovens, vitimados pela anemia ancilostomica. A notavel proliferação dos eritroblastos ortocromaticos mostra que o grão e a rapidez da regeneração sanguinea, após a administração de ferro, são devidos, essencialmente, á grande quantidade de hemoglobina já preformada no baço e na medula ossea dos organismos ancilostomados.

  16. Prediction of a stable half-metal ferromagnetic BaCl solid

    Science.gov (United States)

    Greschner, Michael J.; Klug, Dennis D.; Yao, Yansun

    2016-03-01

    The modification of Ba in BaCl compounds from alkaline-metal to transition- and half-metal behavior is explored. High-pressure structural changes in BaCl are predicted using an ab initio structure search method. Dynamically stable bcc and R -3 m forms of BaCl are predicted at 15 and 10 GPa, respectively. The BaCl forms are more stable than elemental Ba plus BaC l2 above ˜10 GPa. Ba in stable BaCl adopts transition-metal properties via an s -d transition. At ambient pressure the fcc structure is ferromagnetic, and the bcc structure is half metallic and ferromagnetic. The transition-metal electronic structure found is sufficient to support superconductivity, with Tc as high as 3.4 K near ambient pressure.

  17. LaBaNiO{sub 4}: a Fermi glass

    Energy Technology Data Exchange (ETDEWEB)

    Schilling, A; Dell' Amore, R; Mueller, K A [Physics Institute of the Universitaet of Zuerich, Winterthurerstrasse 190, CH-8057 Zuerich (Switzerland); Karpinski, J; Bukowski, Z [Laboratory for Solid-State Physics, ETH Zuerich HPF F-7, CH-8093 Zuerich (Switzerland); Medarde, M; Pomjakushina, E [Laboratory for Neutron Scattering, ETHZ and PSI, CH-5232 Villigen PSI (Switzerland)], E-mail: schilling@physik.uzh.ch

    2009-01-07

    Polycrystalline samples of LaSr{sub 1-x}Ba{sub x}NiO{sub 4} show a crossover from a state with metallic transport properties for x = 0 to an insulating state as x{yields}1. The end member LaBaNiO{sub 4} with a nominal nickel Ni 3d{sup 7} configuration might therefore be regarded as a candidate for an antiferromagnetic insulator. However, we do not observe any magnetic ordering in LaBaNiO{sub 4} down to 1.5 K, and despite its insulating transport properties several other physical properties of LaBaNiO{sub 4} resemble those of metallic LaSrNiO{sub 4}. Based on an analysis of electrical and thermal-conductivity data as well as magnetic-susceptibility and low-temperature specific-heat measurements, we suggest that LaBaNiO{sub 4} is a Fermi glass with a finite electron density of states at the Fermi level but these states are localized.

  18. Thermophysical properties of BaThO{sub 3}

    Energy Technology Data Exchange (ETDEWEB)

    Ohishi, Yuji, E-mail: ohishi@see.eng.osaka-u.ac.jp [Graduate School of Engineering, Osaka University (Japan); Yusnitha, Erilia [Center for Nuclear Fuel Technology, National Nuclear Energy Agency (Indonesia); Kurosaki, Ken; Muta, Hiroaki [Graduate School of Engineering, Osaka University (Japan); Yamanaka, Shinsuke [Graduate School of Engineering, Osaka University (Japan); Research Institute of Nuclear Engineering, University of Fukui (Japan)

    2014-05-01

    Thermophysical properties of barium thorium trioxide (BaThO{sub 3}) prepared by the solid-state reaction method were studied. The average linear thermal expansion coefficient of BaThO{sub 3} measured in the temperature range of room temperature to 1073 K was estimated as α = 11.9 × 10{sup −6} K{sup −1} by using a high-temperature X-ray diffraction technique. The longitudinal sound velocity, shear sound velocity, and thermal diffusivity of BaThO{sub 3} were measured. Further, the shear modulus, Young’s modulus, bulk modulus and Debye temperature were evaluated from the measured sound velocities. Using the laser flash technique, the thermal diffusivity of BaThO{sub 3} was measured in the temperature range of room temperature to 1073 K. The thermal conductivity of BaThO{sub 3} was evaluated from the heat capacity, thermal diffusivity, and density to be 2.3–3.4 Wm{sup −1} K{sup −1} in the temperature range of room temperature to 1073 K.

  19. Contrast study on CT and BA in cerebral hemorrhage due to hypertension%CONTRAST STUDY ON CT AND BA IN CEREBRAL HEMORRHAGE DUE TO HYPERTENSION

    Institute of Scientific and Technical Information of China (English)

    Mingshun Liu; Guoqiu Wang; Po Ma

    2007-01-01

    Objectives:To explore contrast application on CT and BA in cerebral hemorrhage due to hypertension. Methods: CT and BA were examined in 106 patients with cerebral hemorrhage due to hypertension. Results:The different changes of CT and BA were showed in 106 patients with cerebral hemorrhage due to hypertension. Conclusions: There were separately different advantage and shortcoming in CT and BA in diagnosis of cerebral hemorrhage due to hypertension. The value of clinical application of BA was important in cerebral hemorrhage due to hypertension.

  20. Synthesis of BaTiO3 nanoparticles from TiO2-coated BaCO3 particles derived using a wet-chemical method

    Directory of Open Access Journals (Sweden)

    Yuuki Mochizuki

    2014-03-01

    Full Text Available BaCO3 particles coated with amorphous TiO2 precursor are prepared by a wet chemical method to produce BaTiO3 nanoparticles at low temperatures. Subsequently, we investigate the formation behavior of BaTiO3 particles and the particle growth behavior when the precursor is subjected to heat treatment. The state of the amorphous TiO2 coating on the surface of BaCO3 particles depends on the concentration of NH4HCO3, and the optimum concentration is found to be in the range 0.5–1.0 M. Thermogravimetric curves of the BaCO3 particles coated with the TiO2 precursor, prepared from BaCO3 particles of various sizes, show BaTiO3 formation occurring mainly at 550–650 °C in the case of fine BaCO3 particles. However, as evidenced from the curves, the temperature of formation of BaTiO3 shifts to higher values with an increase in the size of the BaCO3 particles. The average particle size of single phase BaTiO3 at heat-treatment temperature of 650–900 °C is observed to be in the range 60–250 nm.

  1. Activity Enhancement of Pt/Ba/Al2O3 Mixed with Mn/Ba/Al2O3 for NOx Storage-reduction by Hydrogen

    Institute of Scientific and Technical Information of China (English)

    Jian Hua XIAO; Xue Hui LI; Sha DENG; Fu Rong WANG; Le Fu WANG

    2006-01-01

    Mn/Ba/Al2O3 catalyst for NO oxidation-storage and Pt/Ba/Al2O3 catalyst mixed with Mn/Ba/Al2O3 for NOx storage-reduction by hydrogen were investigated. The results showed that Mn/Ba/Al2O3 had large nitrogen oxides storage capacity (397.9 μmolg-1) under lean bum condition.When Pt/Ba/Al2O3 catalyst was mixed with Mn/Ba/Al2O3 in equal weight proportion, the NOx conversion increased between 250 ℃ and 500 ℃ under the dynamic lean-rich bum conditions, and the maximum NOx conversion increased from 95.4% to 98.2%. Mn/Ba/Al2O3 has promoted NOx storing in the lean stage and improved NOx reduction efficiency in the rich stage, these might result in higher NOx conversion over the low Pt loading content catalyst.

  2. Stellar laboratories III. New Ba V, Ba VI, and Ba VII oscillator strengths and the barium abundance in the hot white dwarfs G191-B2B and RE0503-289

    CERN Document Server

    Rauch, T; Quinet, P; Kruk, J W

    2014-01-01

    For the spectral analysis of high-resolution and high-signal-to-noise (S/N) spectra of hot stars, state-of-the-art non-local thermodynamic equilibrium (NLTE) model atmospheres are mandatory. These are strongly dependent on the reliability of the atomic data that is used for their calculation. Reliable Ba V - VII oscillator strengths are used to identify Ba lines in the spectra of the DA-type white dwarf G191-B2B and the DO-type white dwarf RE0503-289 and to determine their photospheric Ba abundances. We newly calculated Ba V - VII oscillator strengths to consider their radiative and collisional bound-bound transitions in detail in our NLTE stellar-atmosphere models for the analysis of Ba lines exhibited in high-resolution and high-S/N UV observations of G191-B2B and RE0503-289. For the first time, we identified highly ionized Ba in the spectra of hot white dwarfs. We detected Ba VI and Ba VII lines in the Far Ultraviolet Spectroscopic Explorer (FUSE) spectrum of RE0503-289. The Ba VI / Ba VII ionization equil...

  3. BaH molecular spectroscopy with relevance to laser cooling

    Science.gov (United States)

    Tarallo, M. G.; Iwata, G. Z.; Zelevinsky, T.

    2016-03-01

    We describe a simple experimental apparatus for laser ablation of barium monohydride (BaH) molecules and the study of their rovibrational spectra relevant to direct laser cooling. BaH is a promising candidate for laser cooling and ultracold fragmentation, both of which are precursors to novel experiments in many-body physics and precision measurement. We present a detailed analysis of the properties of ablation plumes that can improve the understanding of surface ablation and deposition technologies. A range of absorption spectroscopy and collisional thermalization regimes has been studied. We directly measured the Franck-Condon factor of the B 2Σ+(v'=0 ) ←X 2Σ+(v''=1 ) cycling transition. Prospects for production of a high luminosity cryogenic BaH beam are outlined.

  4. The BaBar instrumented flux return performance: lessons learned

    CERN Document Server

    Anulli, F; Baldini, R; Band, H R; Bionta, R; Brau, J E; Brigljevic, V; Buzzo, A; Calcaterra, A; Carpinelli, M; Cartaro, C; Cavallo, N; Crosetti, G; De Nardo, Gallieno; De Sangro, R; Eichenbaum, A; Fabozzi, F; Falciai, D; Ferrarotto, F; Ferroni, F; Finocchiaro, G; Forti, F; Frey, R; Gatto, C; Graug; Iakovlev, N I; Iwasaki, M; Johnson, J R; Lange, D J; Lista, L; Lo Vetere, M; Lü, C; Macri, M; Messner, R; Moore, T B; Morganti, S; Neal, H; Neri, N; Palano, A; Paoloni, E; Paolucci, P; Passaggio, S; Pastore, F C; Patteri, P; Peruzzi, I; Piccolo, D; Piccolo, M; Piredda, G; Robutti, E; Roodman, A; Santroni, A; Sciacca, C; Sinev, N B; Soha, A; Strom, D; Tosi, S; Vavra, J; Wisniewski, W J; Wright, D M; Xie, Y; Zallo, A

    2002-01-01

    The BaBar Collaboration has operated an instrumented flux return (IFR) system covering over 2000 m sup 2 with resistive plate chambers (RPCs) for nearly 3 years. The chambers are constructed of bakelite sheets separated by 2 mm. The inner surfaces are coated with linseed oil. This system provides muon and neutral hadron detection for BaBar. Installation and commissioning were completed in 1998, and operation began mid-year 1999. While initial performance of the system reached design, over time, a significant fraction of the RPCs demonstrated significant degradation, marked by increased currents and reduced efficiency. A coordinated effort of investigations have identified many of the elements responsible for the degradation. This article presents our current understanding of the aging process of the BaBar RPCs along with the action plan to combat performance degradation of the IFR system.

  5. Study of F- Production in BaBar RPCs

    Energy Technology Data Exchange (ETDEWEB)

    Band, H.R.; /Wisconsin U., Madison; Bellini, F.; /Rome U. /INFN, Rome; Covarelli, R.; /Perugia U. /INFN, Perugia; Di Marco, E.; /Rome U. /INFN, Rome; D' Orazio, A.; /Orsay, LAL; Ferroni, F.; Li Gioi, L.; /Rome U. /INFN, Rome; Lopez, L.; /Bari U. /INFN, Bari; Polci, F.; /Rome U. /INFN, Rome

    2008-02-22

    The BaBar detector has operated over 200 2nd generation Resistive Plate Chambers (RPCs) in the forward endcap since 2002. Many chambers have increased noise rates and high voltage currents. These aging symptoms are correlated with the integrated RPC current as expected, but also depend on the rate and direction of the gas flow, indicating that pollutants produced in the gas can accelerate aging of downstream RPC surfaces. HF produced by decomposition of the Freon 134a component of the BaBar RPC gas in electric discharges has been proposed as the main pollutant. This paper presents measurements of HF production and absorption rates in BaBar RPCs. Since many of the highest rate chambers in the forward endcap were converted to avalanche mode operation, a comparison of HF production in streamer and avalanche mode RPCs is made. Correlations between the HF production rate and other chamber operating conditions were also explored.

  6. Electronics for the BaBar Central Drift Chamber

    Energy Technology Data Exchange (ETDEWEB)

    Coupal, David P

    1998-12-07

    The central drift chamber for the BaBar detector at the SLAC B-factory is based on a hexagonal cell design with 7104 cells arranged in 40 layers and drift gas Helium:isobutane (80%:20%). Performance optimization and integration requirements led to an electronics design that mounts the amplifier-descriminator and digitizing circuitry directly on the endplate. High channel density is achieved using a 4-channel custom amplifier-discriminator IC and an 8-channel custom CMOS TDC/FADC IC on a single circuit board. Data read from the ends are multiplexed on 4 fiber optic links, and prompt trigger data are sent out continuously on 24 links. Analysis of cosmic ray data demonstrates that the electronics design meets the performance goals for the BaBar drift chamber. The final electronics were installed on the drift chamber in July, 1998. Installation of BaBar on beamline is scheduled for March, 1999.

  7. Exotic decay in Ba isotopes via 12C emission

    Indian Academy of Sciences (India)

    K P Santhosh; Antony Joseph

    2000-09-01

    Considering Coulomb and proximity potentials as barriers, we have calculated the half lives for 12C emission from various Ba isotopes using different mass tables. The half life for 112Ba isotope calculated by us is 6.020 × 103 s which is comparable with the experimental value 5.620 × 103 s. From our study it is found that 114Ba is the good parent for 12C emission whose emission rate is favorable for measurement. The half lives predicted by us lie very close to those reported by Shanmugam et al using their cubic plus Yukawa plus exponential model. It is observed that inclusion of proximity potential does not produce significant deviation from the linear nature of the Geiger–Nuttall plots. Also it is found that the neutron excess in the parent nuclei slows down the exotic decay process.

  8. The Danish Microbiology Database (MiBa) 2010 to 2013.

    Science.gov (United States)

    Voldstedlund, M; Haarh, M; Mølbak, K

    2014-01-09

    The Danish Microbiology Database (MiBa) is a national database that receives copies of reports from all Danish departments of clinical microbiology. The database was launched in order to provide healthcare personnel with nationwide access to microbiology reports and to enable real-time surveillance of communicable diseases and microorganisms. The establishment and management of MiBa has been a collaborative process among stakeholders, and the present paper summarises lessons learned from this nationwide endeavour which may be relevant to similar projects in the rapidly changing landscape of health informatics.

  9. Electron microscopy of a Gd-Ba-Cu-O superconductor

    Science.gov (United States)

    Ramesh, R.; Thomas, G.; Meng, R. L.; Hor, P. H.; Chu, C. W.

    1989-01-01

    An electron microscopy study has been carried out to characterize the microstructure of a sintered Gd-Ba-Cu-O superconductor alloy. The GdBa2Cu3O(7-x) phase in the oxygen annealed sample is orthorhombic, while in the vacuum annealed sample it is tetragonal. It is shown that the details of the fine structure in the 001-line zone axis convergent beam patterns can be used to distinguish between the orthorhombic form and the tetragonal form. In addition to this matrix phase, an amorphous phase is frequently observed at the triple grain junctions. Gd-rich inclusions have been observed inside the matrix phase.

  10. Results on conventional and exotic charmonium at BaBar

    CERN Document Server

    Bernard, Denis

    2013-01-01

    The B factories provide a unique playground for studying the properties of conventional and exotic charmonium states. We present recent results in initial state radiation and two-photon fusion, obtained using the full data set collected by the BaBar experiment. Amongst BaBar 's harvest presented in this talk, the determination of the quantum numbers of the X(3915) resonance, a body of concording evidence pointing to JPC = 1++ for the X(3872), and updates on the family of the Y resonance to the full integrated luminosity.

  11. Left posterior BA37 is involved in object recognition: a TMS study

    DEFF Research Database (Denmark)

    Stewart, Lauren; Meyer, Bernd-Ulrich; Frith, Uta

    2001-01-01

    Functional imaging studies have proposed a role for left BA37 in phonological retrieval, semantic processing, face processing and object recognition. The present study targeted the posterior aspect of BA37 to see whether a deficit, specific to one of the above types of processing could be induced....... Four conditions were investigated: word and nonword reading, colour naming and picture naming. Repetitive transcranial magnetic stimulation (rTMS) was delivered over posterior BA37 of the left and right hemispheres (lBA37 and rBA37, respectively) and over the vertex. divisions were significantly slower...... to name pictures when TMS was given over lBA37 compared to vertex or rBA37. rTMS over lBA37 had no significant effect on word reading, nonword reading or colour naming. The picture naming deficit is suggested to result from a disruption to object recognition processes. This study corroborates the finding...

  12. Punta Pitt, Galapagos Ba/Ca Data for 1963-1982

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — File contains Ba/Ca data (in mmol/mol) presented by Lea et al. (1989). Samples were measured at the Massachusetts Institute of Technology by D. Lea. Ba...

  13. Microstructural evolution and electrical properties of base-metal electroded BaTi4O9 materials with B-Si-Ba-Zn-O glass system.

    Science.gov (United States)

    Chou, Chen-Chia; Su, Yu-Hsuan; Liu, Ze-Ming; Utami, Brianti Satrianti; Chen, Cheng-Sao; Chu, Li-Wen

    2012-09-01

    Barium titanate-based microwave dielectrics usually require relatively high temperatures to sinter, which prevents the use of base metals such as copper for electrodes. In this work, BaTi(4)O(9) microwave dielectric ceramics co-fired with copper electrodes are made possible by adding B-Si-Ba- Zn-O glass to induce liquid-phase sintering at sufficiently low temperature and in reduced atmosphere. The microstructures and electric properties of the BaTi(4)O(9) ceramics thus obtained are carefully examined and studied. Proper glass composition may significantly facilitate mass transportation in the low-temperature co-fired ceramic (LTCC) material, resulting in better densification without serious degradation of electric properties. Although the B2O3/SiO2 ratio enhances the glass mobility during sintering, the BaO/ZnO ratio contributes to the chemical affinity of glass to BaTi(4)O(9) ceramics. In addition, various Ba-Ti-O phases with different Ba/Ti ratios may be found in the specimen through the X-ray diffraction patterns when the BaO/ZnO ratio is varied. If the BaO/ZnO ratio is high and the glass flows easily in the material, the Ba(4)Ti(13)O(30) phase is formed. If the BaO/ZnO ratio is low and the glass flows easily in the material, the BaTi(6)O(13) phase appears. We find that glass-induced Ba(4)Ti(13)O(30) transformation may significantly decrease Qxf values in the BT4-BSBZ materials. Therefore, the appropriate glass composition must be selected to ensure the phase stability of dielectrics to achieve the best performance possible.

  14. The Danish Microbiology Database (MiBa) 2010 to 2013

    DEFF Research Database (Denmark)

    Voldstedlund, M; Haarh, M; Mølbak, Kaare

    2014-01-01

    The Danish Microbiology Database (MiBa) is a national database that receives copies of reports from all Danish departments of clinical microbiology. The database was launched in order to provide healthcare personnel with nationwide access to microbiology reports and to enable real-time surveillance...

  15. Scintillation in LiBaF3(Ce) crystals

    NARCIS (Netherlands)

    Gektin, A; Shiran, N; Voloshinovski, A; Voronova, [No Value; Zimmerer, G

    Core-valence, self-trapped exciton and Ce3+-luminescences in pure and doped LiBaF3 crystals were determined on the basis of analysis of the time resolved emission and excitation spectra. It is shown that excitation of Ce-luminescence is caused both by carriers capture at or near activator ions and

  16. Generator Coordinate Method Analysis of Xe and Ba Isotopes

    Science.gov (United States)

    Higashiyama, Koji; Yoshinaga, Naotaka; Teruya, Eri

    Nuclear structure of Xe and Ba isotopes is studied in terms of the quantum-number projected generator coordinate method (GCM). The GCM reproduces well the energy levels of high-spin states as well as low-lying states. The structure of the low-lying states is analyzed through the GCM wave functions.

  17. The Danish Microbiology Database (MiBa) 2010 to 2013

    DEFF Research Database (Denmark)

    Voldstedlund, M; Haarh, M; Mølbak, K

    2014-01-01

    The Danish Microbiology Database (MiBa) is a national database that receives copies of reports from all Danish departments of clinical microbiology. The database was launched in order to provide healthcare personnel with nationwide access to microbiology reports and to enable real-time surveillance...

  18. PEM Fuel Cell System Replacement for BA-559O Battery

    Science.gov (United States)

    2007-11-02

    H Power Corp. developed a fuel cell system to demonstrate that fuel cells can be effectively designed for missions requiring a high degree of...equivalent in size to that of a BA-5590 battery. The system comprised an air-cooled fuel cell stack, a metal-hydride-based fuel storage section, and a

  19. Studies of radiative penguin B decays at BaBar

    Indian Academy of Sciences (India)

    John M LoSecco; BaBar Collaboration

    2004-03-01

    We summarize results on a number of observations of penguin dominated radiative decays of the meson. Such decays are forbidden at tree level and proceed via electroweak loops. As such they may be sensitive to physics beyond the standard model. The observations have been made at the BaBar experiment at PEP-II, the asymmetric factory at SLAC.

  20. Phase transitions in undoped BaCeO3

    DEFF Research Database (Denmark)

    Kuzmin, A.V.; Gorelov, V.P.; Melekh, B.T.

    2003-01-01

    of the structural phase transitions in BaCeO3. Five second-order transitions at 480 +/- 10, 530 +/- 10, 900 +/- 10, 1030 +/- 20 and 1170 +/- 20 K, and also one first-order transition at 665 +/- 10 K, were found. The transitions at 900 and 1030 K have not been reported before. (C) 2003 Elsevier B.V. All rights...

  1. Scintillation in LiBaF3(Ce) crystals

    NARCIS (Netherlands)

    Gektin, A; Shiran, N; Voloshinovski, A; Voronova, [No Value; Zimmerer, G

    1998-01-01

    Core-valence, self-trapped exciton and Ce3+-luminescences in pure and doped LiBaF3 crystals were determined on the basis of analysis of the time resolved emission and excitation spectra. It is shown that excitation of Ce-luminescence is caused both by carriers capture at or near activator ions and b

  2. The BaBar detector: Upgrades, operation and performance

    Energy Technology Data Exchange (ETDEWEB)

    Aubert, B.; Barate, R.; Boutigny, D.; Couderc, F.; del Amo Sanchez, P.; Gaillard, J. -M.; Hicheur, A.; Karyotakis, Y.; Lees, J. P.; Poireau, V.; Prudent, X.; Robbe, P.; Tisserand, V.; Zghiche, A.; Grauges, E.; Garra Tico, J.; Lopez, L.; Martinelli, M.; Palano, A.; Pappagallo, M.; Pompili, A.; Chen, G. P.; Chen, J. C.; Qi, N. D.; Rong, G.; Wang, P.; Zhu, Y. S.; Eigen, G.; Stugu, B.; Sun, L.; Abrams, G. S.; Battaglia, M.; Borgland, A. W.; Breon, A. B.; Brown, D. N.; Button-Shafer, J.; Cahn, R. N.; Charles, E.; Clark, A. R.; Day, C. T.; Furman, M.; Gill, M. S.; Groysman, Y.; Jacobsen, R. G.; Kadel, R. W.; Kadyk, J. A.; Kerth, L. T.; Kolomensky, Yu. G.; Kral, J. F.; Kukartsev, G.; LeClerc, C.; Levi, M. E.; Lynch, G.; Merchant, A. M.; Mir, L. M.; Oddone, P. J.; Orimoto, T. J.; Osipenkov, I. L.; Pripstein, M.; Roe, N. A.; Romosan, A.; Ronan, M. T.; Shelkov, V. G.; Suzuki, A.; Tackmann, K.; Tanabe, T.; Wenzel, W. A.; Zisman, M.; Barrett, M.; Bright-Thomas, P. G.; Ford, K. E.; Harrison, T. J.; Hart, A. J.; Hawkes, C. M.; Knowles, D. J.; Morgan, S. E.; O' Neale, S. W.; Penny, R. C.; Smith, D.; Soni, N.; Watson, A. T.; Watson, N. K.; Goetzen, K.; Held, T.; Koch, H.; Kunze, M.; Lewandowski, B.; Pelizaeus, M.; Peters, K.; Schmuecker, H.; Schroeder, T.; Steinke, M.; Fella, A.; Antonioli, E.; Boyd, J. T.; Chevalier, N.; Cottingham, W. N.; Foster, B.; Mackay, C.; Walker, D.; Abe, K.; Asgeirsson, D. J.; Cuhadar-Donszelmann, T.; Fulsom, B. G.; Hearty, C.; Knecht, N. S.; Mattison, T. S.; McKenna, J. A.; Thiessen, D.; Khan, A.; Kyberd, P.; McKemey, A. K.; Randle-Conde, A.; Saleem, M.; Sherwood, D. J.; Teodorescu, L.; Blinov, V. E.; Bukin, A. D.; Buzykaev, A. R.; Druzhinin, V. P.; Golubev, V. B.; Korol, A. A.; Kravchenko, E. A.; Onuchin, A. P.; Serednyakov, S. I.; Skovpen, Yu. I.; Solodov, E. P.; Telnov, V. I.; Todyshev, K. Yu.; Yushkov, A. N.; Best, D. S.; Bondioli, M.; Bruinsma, M.; Chao, M.; Curry, S.; Eschrich, I.; Kirkby, D.; Lankford, A. J.; Mandelkern, M.; Martin, E. C.; McMahon, S.; Mommsen, R. K.; Stoker, D. P.; Abachi, S.; Buchanan, C.; Hartfiel, B. L.; Weinstein, A. J. R.; Atmacan, H.; Foulkes, S. D.; Gary, J. W.; Layter, J.; Liu, F.; Long, O.; Shen, B. C.; Vitug, G. M.; Wang, K.; Yasin, Z.; Zhang, L.; Hadavand, H. K.; Hill, E. J.; Paar, H. P.; Rahatlou, S.; Schwanke, U.; Sharma, V.; Berryhill, J. W.; Campagnari, C.; Cunha, A.; Dahmes, B.; Hong, T. M.; Kovalskyi, D.; Kuznetsova, N.; Levy, S. L.; Lu, A.; Mazur, M. A.; Richman, J. D.; Verkerke, W.; Beck, T. W.; Beringer, J.; Eisner, A. M.; Flacco, C. J.; Grillo, A. A.; Grothe, M.; Heusch, C. A.; Kroseberg, J.; Lockman, W. S.; Martinez, A. J.; Nesom, G.; Schalk, T.; Schmitz, R. E.; Schumm, B. A.; Seiden, A.; Spencer, E.; Spradlin, P.; Turri, M.; Walkowiak, W.; Wang, L.; Wilder, M.; Williams, D. C.; Wilson, M. G.; Winstrom, L. O.; Chen, E.; Cheng, C. H.; Doll, D. A.; Dorsten, M. P.; Dvoretskii, A.; Echenard, B.; Erwin, R. J.; Fang, F.; Flood, K.; Hitlin, D. G.; Metzler, S.; Narsky, I.; Oyang, J.; Piatenko, T.; Porter, F. C.; Ryd, A.; Samuel, A.; Yang, S.; Zhu, R. Y.; Andreassen, R.; Devmal, S.; Geld, T. L.; Jayatilleke, S.; Mancinelli, G.; Meadows, B. T.; Mishra, K.; Sokoloff, M. D.; Abe, T.; Antillon, E. A.; Barillari, T.; Becker, J.; Blanc, F.; Bloom, P. C.; Chen, S.; Clifton, Z. C.; Derrington, I. M.; Destree, J.; Dima, M. O.; Ford, W. T.; Gaz, A.; Gilman, J. D.; Hachtel, J.; Hirschauer, J. F.; Johnson, D. R.; Kreisel, A.; Nagel, M.; Nauenberg, U.; Olivas, A.; Rankin, P.; Roy, J.; Ruddick, W. O.; Smith, J. G.; Ulmer, K. A.; van Hoek, W. C.; Wagner, S. R.; West, C. G.; Zhang, J.; Ayad, R.; Blouw, J.; Chen, A.; Eckhart, E. A.; Harton, J. L.; Hu, T.; Toki, W. H.; Wilson, R. J.; Winklmeier, F.; Zeng, Q. L.; Altenburg, D.; Feltresi, E.; Hauke, A.; Jasper, H.; Karbach, M.; Merkel, J.; Petzold, A.; Spaan, B.; Wacker, K.; Brandt, T.; Brose, J.; Colberg, T.; Dahlinger, G.; Dickopp, M.; Eckstein, P.; Futterschneider, H.; Kaiser, S.; Kobel, M. J.; Krause, R.; Müller-Pfefferkorn, R.; Mader, W. F.; Maly, E.; Nogowski, R.; Otto, S.; Schubert, J.; Schubert, K. R.; Schwierz, R.; Sundermann, J. E.; Volk, A.; Wilden, L.; Bernard, D.; Brochard, F.; Cohen-Tanugi, J.; Dohou, F.; Ferrag, S.; Latour, E.; Mathieu, A.; Renard, C.; Schrenk, S.; T' Jampens, S.; Thiebaux, Ch.; Vasileiadis, G.; Verderi, M.; Anjomshoaa, A.; Bernet, R.; Clark, P. J.; Lavin, D. R.; Muheim, F.; Playfer, S.; Robertson, A. I.; Swain, J. E.; Watson, J. E.; Xie, Y.; Andreotti, D.; Andreotti, M.; Bettoni, D.; Bozzi, C.; Calabrese, R.; Carassiti, V.; Cecchi, A.; Cibinetto, G.; Cotta Ramusino, A.; Evangelisti, F.; Fioravanti, E.; Franchini, P.; Garzia, I.; Landi, L.; Luppi, E.; Malaguti, R.; Negrini, M.; Padoan, C.; Petrella, A.; Piemontese, L.; Santoro, V.; Sarti, A.; Anulli, F.; Baldini-Ferroli, R.; Calcaterra, A.; Finocchiaro, G.; Pacetti, S.; Patteri, P.; Peruzzi, I. M.; Piccolo, M.; Rama, M.; de Sangro, R.; Santoni, M.; Zallo, A.; Bagnasco, S.; Buzzo, A.; Capra, R.; Contri, R.; Crosetti, G.; Lo Vetere, M.; Macri, M. M.; Minutoli, S.; Monge, M. R.; Musico, P.; Passaggio, S.; Pastore, F. C.; Patrignani, C.; Pia, M. G.; Robutti, E.; Santroni, A.; Tosi, S.; Bhuyan, B.; Prasad, V.; Bailey, S.; Brandenburg, G.; Chaisanguanthum, K. S.; Lee, C. L.; Morii, M.; Won, E.; Wu, J.; Adametz, A.; Dubitzky, R. S.; Marks, J.; Schenk, S.; Uwer, U.; Klose, V.; Lacker, H. M.; Aspinwall, M. L.; Bhimji, W.; Bowerman, D. A.; Dauncey, P. D.; Egede, U.; Flack, R. L.; Gaillard, J. R.; Gunawardane, N. J. W.; Morton, G. W.; Nash, J. A.; Nikolich, M. B.; Panduro Vazquez, W.; Sanders, P.; Smith, D.; Taylor, G. P.; Tibbetts, M.; Behera, P. K.; Chai, X.; Charles, M. J.; Grenier, G. J.; Hamilton, R.; Lee, S. -J.; Mallik, U.; Meyer, N. T.; Chen, C.; Cochran, J.; Crawley, H. B.; Dong, L.; Eyges, V.; Fischer, P. -A.; Lamsa, J.; Meyer, W. T.; Prell, S.; Rosenberg, E. I.; Rubin, A. E.; Gao, Y. Y.; Gritsan, A. V.; Guo, Z. J.; Lae, C. K.; Schott, G.; Albert, J. N.; Arnaud, N.; Beigbeder, C.; Breton, D.; Davier, M.; Derkach, D.; Dû, S.; Firmino da Costa, J.; Grosdidier, G.; Höcker, A.; Laplace, S.; Le Diberder, F.; Lepeltier, V.; Lutz, A. M.; Malaescu, B.; Nief, J. Y.; Petersen, T. C.; Plaszczynski, S.; Pruvot, S.; Roudeau, P.; Schune, M. H.; Serrano, J.; Sordini, V.; Stocchi, A.; Tocut, V.; Trincaz-Duvoid, S.; Wang, L. L.; Wormser, G.; Bionta, R. M.; Brigljević, V.; Lange, D. J.; Simani, M. C.; Wright, D. M.; Bingham, I.; Burke, J. P.; Chavez, C. A.; Coleman, J. P.; Forster, I. J.; Fry, J. R.; Gabathuler, E.; Gamet, R.; George, M.; Hutchcroft, D. E.; Kay, M.; Parry, R. J.; Payne, D. J.; Schofield, K. C.; Sloane, R. J.; Touramanis, C.; Azzopardi, D. E.; Bellodi, G.; Bevan, A. J.; Clarke, C. K.; Cormack, C. M.; Di Lodovico, F.; Dixon, P.; George, K. A.; Menges, W.; Potter, R. J. L.; Sacco, R.; Shorthouse, H. W.; Sigamani, M.; Strother, P.; Vidal, P. B.; Brown, C. L.; Cowan, G.; Flaecher, H. U.; George, S.; Green, M. G.; Hopkins, D. A.; Jackson, P. S.; Kurup, A.; Marker, C. E.; McGrath, P.; McMahon, T. R.; Paramesvaran, S.; Salvatore, F.; Vaitsas, G.; Winter, M. A.; Wren, A. C.; Brown, D. N.; Davis, C. L.; Denig, A. G.; Fritsch, M.; Gradl, W.; Griessinger, K.; Hafner, A.; Prencipe, E.; Allison, J.; Alwyn, K. E.; Bailey, D. S.; Barlow, N. R.; Barlow, R. J.; Chia, Y. M.; Edgar, C. L.; Forti, A. C.; Fullwood, J.; Hart, P. A.; Hodgkinson, M. C.; Jackson, F.; Jackson, G.; Kelly, M. P.; Kolya, S. D.; Lafferty, G. D.; Lyon, A. J.; Naisbit, M. T.; Savvas, N.; Weatherall, J. H.; West, T. J.; Williams, J. C.; Yi, J. I.; Anderson, J.; Farbin, A.; Hulsbergen, W. D.; Jawahery, A.; Lillard, V.; Roberts, D. A.; Schieck, J. R.; Simi, G.; Tuggle, J. M.; Blaylock, G.; Dallapiccola, C.; Hertzbach, S. S.; Kofler, R.; Koptchev, V. B.; Li, X.; Moore, T. B.; Salvati, E.; Saremi, S.; Staengle, H.; Willocq, S. Y.; Cowan, R.; Dujmic, D.; Fisher, P. H.; Henderson, S. W.; Koeneke, K.; Lang, M. I.; Sciolla, G.; Spitznagel, M.; Taylor, F.; Yamamoto, R. K.; Yi, M.; Zhao, M.; Zheng, Y.; Klemetti, M.; Lindemann, D.; Mangeol, D. J. J.; Mclachlin, S. E.; Milek, M.; Patel, P. M.; Robertson, S. H.; Biassoni, P.; Cerizza, G.; Lazzaro, A.; Lombardo, V.; Neri, N.; Palombo, F.; Pellegrini, R.; Stracka, S.; Bauer, J. M.; Cremaldi, L.; Eschenburg, V.; Kroeger, R.; Reidy, J.; Sanders, D. A.; Summers, D. J.; Zhao, H. W.; Godang, R.; Brunet, S.; Cote, D.; Nguyen, X.; Simard, M.; Taras, P.; Viaud, B.; Nicholson, H.; Cavallo, N.; De Nardo, G.; Fabozzi, F.; Gatto, C.; Lista, L.; Monorchio, D.; Onorato, G.; Paolucci, P.; Piccolo, D.; Sciacca, C.; Baak, M. A.; Raven, G.; Snoek, H. L.; Jessop, C. P.; Knoepfel, K. J.; LoSecco, J. M.; Wang, W. F.; Allmendinger, T.; Benelli, G.; Brau, B.; Corwin, L. A.; Gan, K. K.; Honscheid, K.; Hufnagel, D.; Kagan, H.; Kass, R.; Morris, J. P.; Rahimi, A. M.; Regensburger, J. J.; Smith, D. S.; Ter-Antonyan, R.; Wong, Q. K.; Blount, N. L.; Brau, J.; Frey, R.; Igonkina, O.; Iwasaki, M.; Kolb, J. A.; Lu, M.; Potter, C. T.; Rahmat, R.; Sinev, N. B.; Strom, D.; Strube, J.; Torrence, E.; Borsato, E.; Castelli, G.; Colecchia, F.; Crescente, A.; Dal Corso, F.; Dorigo, A.; Fanin, C.; Furano, F.; Gagliardi, N.; Galeazzi, F.; Margoni, M.; Marzolla, M.; Michelon, G.; Morandin, M.; Posocco, M.; Rotondo, M.; Simonetto, F.; Solagna, P.; Stevanato, E.; Stroili, R.; Tiozzo, G.; Voci, C.; Akar, S.; Bailly, P.; Ben-Haim, E.; Bonneaud, G.; Briand, H.; Chauveau, J.; Hamon, O.; John, M. J. J.; Lebbolo, H.; Leruste, Ph.; Malclès, J.; Marchiori, G.; Martin, L.; Ocariz, J.; Perez, A.; Pivk, M.; Prendki, J.; Roos, L.; Sitt, S.; Stark, J.; Thérin, G.; Vallereau, A.; Biasini, M.; Covarelli, R.; Manoni, E.; Pennazzi, S.; Pioppi, M.; Angelini, C.; Batignani, G.; Bettarini, S.; Bosi, F.; Bucci, F.; Calderini, G.; Carpinelli, M.; Cenci, R.; Cervelli, A.; Forti, F.; Giorgi, M. A.; Lusiani, A.; Marchiori, G.; Morganti, M.; Morsani, F.; Paoloni, E.; Raffaelli, F.; Rizzo, G.; Sandrelli, F.; Triggiani, G.; Walsh, J. J.; Haire, M.; Judd, D.; Biesiada, J.; Danielson, N.; Elmer, P.; Fernholz, R. E.; Lau, Y. P.; Lu, C.; Miftakov, V.; Olsen, J.; Lopes Pegna, D.; Sands, W. R.; Smith, A. J. S.; Telnov, A. V.; Tumanov, A.; Varnes, E. W.; Baracchini, E.; Bellini, F.; Bulfon, C.; Buccheri, E.; Cavoto, G.; D' Orazio, A.; Di Marco, E.; Faccini, R.; Ferrarotto, F.; Ferroni, F.; Gaspero, M.; Jackson, P. D.; Lamanna, E.; Leonardi, E.; Li Gioi, L.; Lunadei, R.; Mazzoni, M. A.; Morganti, S.; Piredda, G.; Polci, F.; del Re, D.; Renga, F.; Safai Tehrani, F.; Serra, M.; Voena, C.; Bünger, C.; Christ, S.; Hartmann, T.; Leddig, T.; Schröder, H.; Wagner, G.; Waldi, R.; Adye, T.; Bly, M.; Brew, C.; Condurache, C.; De Groot, N.; Franek, B.; Geddes, N. I.; Gopal, G. P.; Olaiya, E. O.; Ricciardi, S.; Roethel, W.; Wilson, F. F.; Xella, S. M.; Aleksan, R.; Bourgeois, P.; Emery, S.; Escalier, M.; Esteve, L.; Gaidot, A.; Ganzhur, S. F.; Giraud, P. -F.; Georgette, Z.; Graziani, G.; Hamel de Monchenault, G.; Kozanecki, W.; Langer, M.; Legendre, M.; London, G. W.; Mayer, B.; Micout, P.; Serfass, B.; Vasseur, G.; Yèche, Ch.; Zito, M.; Allen, M. T.; Akre, R.; Aston, D.; Azemoon, T.; Bard, D. J.; Bartelt, J.; Bartoldus, R.; Bechtle, P.; Becla, J.; Benitez, J. F.; Berger, N.; Bertsche, K.; Boeheim, C. T.; Bouldin, K.; Boyarski, A. M.; Boyce, R. F.; Browne, M.; Buchmueller, O. L.; Burgess, W.; Cai, Y.; Cartaro, C.; Ceseracciu, A.; Claus, R.; Convery, M. R.; Coupal, D. P.; Craddock, W. W.; Crane, G.; Cristinziani, M.; DeBarger, S.; Decker, F. J.; Dingfelder, J. C.; Donald, M.; Dorfan, J.; Dubois-Felsmann, G. P.; Dunwoodie, W.; Ebert, M.; Ecklund, S.; Erickson, R.; Fan, S.; Field, R. C.; Fisher, A.; Fox, J.; Franco Sevilla, M.; Fulsom, B. G.; Gabareen, A. M.; Gaponenko, I.; Glanzman, T.; Gowdy, S. J.; Graham, M. T.; Grenier, P.; Hadig, T.; Halyo, V.; Haller, G.; Hamilton, J.; Hanushevsky, A.; Hasan, A.; Hast, C.; Hee, C.; Himel, T.; Hryn' ova, T.; Huffer, M. E.; Hung, T.; Innes, W. R.; Iverson, R.; Kaminski, J.; Kelsey, M. H.; Kim, H.; Kim, P.; Kharakh, D.; Kocian, M. L.; Krasnykh, A.; Krebs, J.; Kroeger, W.; Kulikov, A.; Kurita, N.; Langenegger, U.; Leith, D. W. G. S.; Lewis, P.; Li, S.; Libby, J.; Lindquist, B.; Luitz, S.; Lüth, V.; Lynch, H. L.; MacFarlane, D. B.; Marsiske, H.; McCulloch, M.; McDonald, J.; Melen, R.; Menke, S.; Metcalfe, S.; Messner, R.; Moss, L. J.; Mount, R.; Muller, D. R.; Neal, H.; Nelson, D.; Nelson, S.; Nordby, M.; Nosochkov, Y.; Novokhatski, A.; O' Grady, C. P.; O' Neill, F. G.; Ofte, I.; Ozcan, V. E.; Perazzo, A.; Perl, M.; Petrak, S.; Piemontese, M.; Pierson, S.; Pulliam, T.; Ratcliff, B. N.; Ratkovsky, S.; Reif, R.; Rivetta, C.; Rodriguez, R.; Roodman, A.; Salnikov, A. A.; Schietinger, T.; Schindler, R. H.; Schwarz, H.; Schwiening, J.; Seeman, J.; Smith, D.; Snyder, A.; Soha, A.; Stanek, M.; Stelzer, J.; Su, D.; Sullivan, M. K.; Suzuki, K.; Swain, S. K.; Tanaka, H. A.; Teytelman, D.; Thompson, J. M.; Tinslay, J. S.; Trunov, A.; Turner, J.; van Bakel, N.; van Winkle, D.; Va' vra, J.; Wagner, A. P.; Weaver, M.; Weinstein, A. J. R.; Weber, T.; West, C. A.; Wienands, U.; Wisniewski, W. J.; Wittgen, M.; Wittmer, W.; Wright, D. H.; Wulsin, H. W.; Yan, Y.; Yarritu, A. K.; Yi, K.; Yocky, G.; Young, C. C.; Ziegler, V.; Chen, X. R.; Liu, H.; Park, W.; Purohit, M. V.; Singh, H.; Weidemann, A. W.; White, R. M.; Wilson, J. R.; Yumiceva, F. X.; Sekula, S. J.; Bellis, M.; Burchat, P. R.; Edwards, A. J.; Majewski, S. A.; Meyer, T. I.; Miyashita, T. S.; Petersen, B. A.; Roat, C.; Ahmed, M.; Ahmed, S.; Alam, M. S.; Bula, R.; Ernst, J. A.; Jain, V.; Liu, J.; Pan, B.; Saeed, M. A.; Wappler, F. R.; Zain, S. B.; Gorodeisky, R.; Guttman, N.; Peimer, D.; Soffer, A.; De Silva, A.; Lund, P.; Krishnamurthy, M.; Ragghianti, G.; Spanier, S. M.; Wogsland, B. J.; Eckmann, R.; Ritchie, J. L.; Ruland, A. M.; Satpathy, A.; Schilling, C. J.; Schwitters, R. F.; Wray, B. C.; Drummond, B. W.; Izen, J. M.; Kitayama, I.; Lou, X. C.; Ye, S.; Bianchi, F.; Bona, M.; Gallo, F.; Gamba, D.; Pelliccioni, M.; Bomben, M.; Borean, C.; Bosisio, L.; Cossutti, F.; Della Ricca, G.; Dittongo, S.; Grancagnolo, S.; Lanceri, L.; Poropat, P.; Rashevskaya, I.; Vitale, L.; Vuagnin, G.; Manfredi, P. F.; Re, V.; Speziali, V.; Frank, E. D.; Gladney, L.; Guo, Q. H.; Panetta, J.; Azzolini, V.; Lopez-March, N.; Martinez-Vidal, F.; Milanes, D. A.; Oyanguren, A.; Agarwal, A.; Albert, J.; Banerjee, Sw.; Bernlochner, F. U.; Brown, C. M.; Choi, H. H. F.; Fortin, D.; Fransham, K. B.; Hamano, K.; Kowalewski, R.; Lewczuk, M. J.; Nugent, I. M.; Roney, J. M.; Sobie, R. J.; Back, J. J.; Gershon, T. J.; Harrison, P. F.; Ilic, J.; Latham, T. E.; Mohanty, G. B.; Puccio, E.; Band, H. R.; Chen, X.; Cheng, B.; Dasu, S.; Datta, M.; Eichenbaum, A. M.; Hollar, J. J.; Hu, H.; Johnson, J. R.; Kutter, P. E.; Li, H.; Liu, R.; Mellado, B.; Mihalyi, A.; Mohapatra, A. K.; Pan, Y.; Pierini, M.; Prepost, R.; Scott, I. J.; Tan, P.; Vuosalo, C. O.; von Wimmersperg-Toeller, J. H.; Wu, S. L.; Yu, Z.; Greene, M. G.; Kordich, T. M. B.

    2013-11-01

    The BaBar detector operated successfully at the PEP-II asymmetric e+e- collider at the SLAC National Accelerator Laboratory from 1999 to 2008. This report covers upgrades, operation, and performance of the collider and the detector systems, as well as the trigger, online and offline computing, and aspects of event reconstruction since the beginning of data taking.

  3. X-ray excited optical luminescence studies on the system Ba (, =F, Cl, Br, I)

    Indian Academy of Sciences (India)

    K Govinda Rajan; A Jestin Lenus

    2005-08-01

    The present paper reports the experimental observations on the x-ray excited optical luminescence (XEOL) along with the afterglow and colour center features found for the barium salts, represented by the formula, Ba, where and are the halides. The system thus consists of four dihalides (BaF2, . . . ,BaI2) and six mixed halides (BaFCl,. . . ,BaBrI). To start with, it was found that on two of the binary halides of barium, BaClI and BaBrI, no literature exists, and so these were prepared for the first time and their crystal structures were determined. An x-ray generator of 3-kW rating was next coupled to a spectrometer via a high throughput fiberoptic sensor for recording the luminescence spectra under x-irradiation. Also presented in this paper are the observations on the Ba compounds in which about 0.1 mole% of Eu2+ was doped, in order to study the efficiency between the prompt luminescence and the photostimulated luminescence in these compounds. The crystal structure varies from fluorite (BaF2), to matlockite (BaF) and finally to orthorhombic (BaCl2, . . .,BaBrI) for these compounds. Hence searching for systematics and empirical relations in the observed XEOL behaviour of these compounds is still a challenging problem.

  4. Effect of Polymerization Condition on Particle Size Distribution in St/BA/MAA Emulsion Polymerization Process

    Institute of Scientific and Technical Information of China (English)

    2000-01-01

    A series of St/BA/MAA emulsion polymerizations was carried out. By using PCS (photon correlation spectroscopy), the particle size distribution(PSD) of the whole St/BA/MAA emulsion polymerization process was gotten easily and quickly. The effect of polymerization condition on PSD in St/BA/MAA emulsion process was discussed.

  5. Crystallization of the HigBA2 toxin-antitoxin complex from Vibrio cholerae

    DEFF Research Database (Denmark)

    Hadǽi, San; Garcia-Pino, Abel; Martinez-Rodriguez, Sergio

    2013-01-01

    The genome of Vibrio cholerae encodes two higBA toxin-antitoxin (TA) modules that are activated by amino-acid starvation. Here, the TA complex of the second module, higBA2, as well as the C-terminal domain of the corresponding HigA2 antitoxin, have been purified and crystallized. The HigBA2 complex...

  6. Core-corona PSt/P(BA-AA) composite particles by two-stage emulsion polymerization

    Science.gov (United States)

    Xie, Delong; Ren, Xiaolin; Zhang, Xinya; Liao, Shijun

    2016-03-01

    Raspberry-shaped composite particles with polystyrene (PSt) as core and poly(n-butyl acrylate-co-acrylic acid) (P(BA-AA)) as corona were synthesized via emulsion polymerization. The random copolymer, P(BA-AA), was pre-prepared and used as a polymeric surfactant, its emulsifying properties adjusted by changing the mass ratio of BA and AA. The morphology of the resulting core-corona composite particles, P(St/P(BA-AA)), could be regulated and controlled by varying the concentrations of P(BA-AA) or the mass ratio of BA:AA in P(BA-AA). The experimental results indicate that 3.0-6.0 wt% of P(BA-AA) is required to obtain stable composite emulsions, and P(BA-AA) with a mass ratio of BA:AA = 1:2 is able to generate distinct core-corona structures. A mechanism of composite particle formation is proposed based on the high affinity between the PSt core and the hydrophobic segments of P(BA-A). The regular morphology of the colloidal film is expected to facilitate potential application of core-corona particles in the field of light scattering. Furthermore, the diversity of core-corona particles can be expanded by replacing P(BA-AA) corona particles with other amphiphilic particles.

  7. 40 CFR 721.10010 - Barium manganese oxide (BaMnO3).

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 30 2010-07-01 2010-07-01 false Barium manganese oxide (BaMnO3). 721... Substances § 721.10010 Barium manganese oxide (BaMnO3). (a) Chemical substance and significant new uses subject to reporting. (1) The chemical substance identified as barium manganese oxide (BaMnO3) (PMN...

  8. Barium stable isotopes in the global ocean: Tracer of Ba inputs and utilization

    Science.gov (United States)

    Hsieh, Yu-Te; Henderson, Gideon M.

    2017-09-01

    Barium has been used as a biogeochemical tracer for alkalinity, productivity, and riverine inputs in the ocean, but its oceanic cycle remains poorly constrained. Barium stable isotope measurements may improve the use of Ba as a tracer and better constrain the cycling of Ba, but data are only available in limited regions of the oceans. In this study, we present dissolved seawater Ba isotopic compositions in a sample collection spanning the North Atlantic, South Atlantic, North Pacific and Southern Oceans. Compiled global upper-ocean [Ba] data show a relatively constant [Ba] (35-45 nM) in the near-surface waters throughout the global ocean, with the exception of areas near river inputs or strong upwelling. The relatively uniform distribution of [Ba] in the upper ocean seawater indicates that Ba removal is slow relative to supply and mixing, and implies that near-surface Ba isotope values are controlled by basin-scale balances rather than by regional or short-term processes. Seawater Ba isotopic compositions show a large variation of δ 138 / 134 Ba values ranging from 0.24 to 0.65‰, and a tight relationship with [Ba]. This global relationship can be simply modelled assuming a primary deep Southern Ocean source for Ba to yield a maximum isotope fractionation of α = 1.00058 ± 0.00010 (α =seawater 138/134Ba/particle 138/134Ba). This suggested isotope fractionation during Ba removal from seawater is larger than implied by laboratory measurement during barite formation, suggesting additional fractionating phases or a two-stage fractionation process. Riverine input from the Rio de la Plata to the South Atlantic has a signature of δ 138 / 134 Ba = - 0.06- 0.11 ‰, which is too light to explain the heavy values (>0.58‰) observed in the surface open ocean. Globally, the Ba isotope composition of the upper ocean waters is correlated with the fraction of Ba utilization at the basin scale (which varies from water (≈0.25‰) trace mixing and allow identification of non

  9. Storage-Reduction of NOx over Combined Catalysts of Pt/Ba/Al2O3-Mn/Ba/Al2O3: Carbon Monoxide as Reductant

    Institute of Scientific and Technical Information of China (English)

    Sha Deng; Xuehui Li; Jianhua Xiao; Furong Wang; Lefu Wang

    2007-01-01

    Storage-reduction of NOx by carbon monoxide was investigated over combined catalysts of Mn/Ba/Al2O3-Pt/Ba/Al2O3. Combination of Mn/Ba/Al2O3 and Pt/Ba/Al2O3 catalysts in different ways showed excellent NOx storage-reduction performance and the content of Pt could be reduced by 50%.Not only the addition of 5Mn/15Ba/Al2O3 to 1Pt/15Ba/Al2O3 could improve its storage ability, but also enhance the NOx conversion consequently. NOx conversion over the combined catalysts (the combined catalysts Ⅰ and Ⅱ) was increased under dynamic lean-rich burn conditions, the maximum NOx conversion increased from 69.4% to respectively 78.8% and 75.7% over two combined catalysts.

  10. Experimental investigation of decay properties of neutron deficient $^{116-118}$Ba isotopes and test of $^{112-115}$Ba beam counts

    CERN Multimedia

    We propose to study decay of neutron deficient isotopes $^{116-118}$Ba using Double Sided Silicon Strip Detector (DSSSD). To study delayed-proton and $\\alpha$-decay branching ratios of $^{116-118}$Ba are of special interest because of their vicinity to the proton drip line. The nuclear life-times and properties of the proton unstable states of Cs isotopes, populated through decay of $^{116-118}$Ba isotopes will be measured. In addition to that we propose beam development of $^{112-115}$Ba to study exotic decay properties of these neutron deficient nuclei and to search for super-allowed $\\alpha$-decay in future.

  11. Improvement of electron mobility in La:BaSnO3 thin films by insertion of an atomically flat insulating (Sr,BaSnO3 buffer layer

    Directory of Open Access Journals (Sweden)

    Junichi Shiogai

    2016-06-01

    Full Text Available One perovskite oxide, ASnO3 (A = Sr, Ba, is a candidate for use as a transparent conductive oxide with high electron mobility in single crystalline form. However, the electron mobility of films grown on SrTiO3 substrates does not reach the bulk value, probably because of dislocation scattering that originates from the large lattice mismatch. This study investigates the effect of insertion of bilayer BaSnO3 / (Sr,BaSnO3 for buffering this large lattice mismatch between La:BaSnO3 and SrTiO3 substrate. The insertion of 200-nm-thick BaSnO3 on (Sr,BaSnO3 bilayer buffer structures reduces the number of dislocations and improves surface smoothness of the films after annealing as proved respectively by scanning transmission electron microscopy and atomic force microscopy. A systematic investigation of BaSnO3 buffer layer thickness dependence on Hall mobility of the electron transport in La:BaSnO3 shows that the highest obtained value of mobility is 78 cm2V−1s−1 because of its fewer dislocations. High electron mobility films based on perovskite BaSnO3 can provide a good platform for transparent-conducting-oxide electronic devices and for creation of fascinating perovskite heterostructures.

  12. Influence of Impurities on the Luminescence of Er3+ Doped BaTiO3 Nanophosphors

    Directory of Open Access Journals (Sweden)

    G. D. Webler

    2014-01-01

    Full Text Available The influence of the presence of barium carbonate (BaCO3 phase on the luminescence properties of barium titanate nanocrystals (BaTiO3 powders was investigated. Structural and optical characterizations of erbium (Er3+ doped BaTiO3 synthesized by the sol-emulsion-gel were performed. Using Fourier transform infrared spectroscopy and X-ray powder diffraction, we identified the presence of impurities related to BaCO3 and quantified its fraction. It was observed that the presence of BaCO3 phase, even at low levels, depletes significantly the infrared-to-visible upconverted luminescence efficiency of the produced nanopowders.

  13. Bound-bound transitions in the emission spectra of Ba$^{+}$--He excimer

    OpenAIRE

    Moroshkin, Peter; Kono, Kimitoshi

    2016-01-01

    We present an experimental and theoretical study of the emission and absorption spectra of the Ba$^{+}$ ions and Ba$^{+\\ast}$He excimer quasimolecules in the cryogenic Ba--He plasma. We observe several new spectral features in the emission spectrum which we assign to the electronic transitions between bound states of the excimer correlating to the 6$^{2}P_{3/2}$ and 5$^{2}D_{3/2,5/2}$ states of Ba$^{+}$. The resulting Ba$^{+}$(5$^{2}D_{J}$)He is a metastable electronically excited complex wit...

  14. Ionic interactions of Ba2+ blockades in the MthK K+ channel.

    Science.gov (United States)

    Guo, Rui; Zeng, Weizhong; Cui, Hengjun; Chen, Liping; Ye, Sheng

    2014-08-01

    The movement and interaction of multiple ions passing through in single file underlie various fundamental K(+) channel properties, from the effective conduction of K(+) ions to channel blockade by Ba(2+) ions. In this study, we used single-channel electrophysiology and x-ray crystallography to probe the interactions of Ba(2+) with permeant ions within the ion conduction pathway of the MthK K(+) channel. We found that, as typical of K(+) channels, the MthK channel was blocked by Ba(2+) at the internal side, and the Ba(2+)-blocking effect was enhanced by external K(+). We also obtained crystal structures of the MthK K(+) channel pore in both Ba(2+)-Na(+) and Ba(2+)-K(+) environments. In the Ba(2+)-Na(+) environment, we found that a single Ba(2+) ion remained bound in the selectivity filter, preferably at site 2, whereas in the Ba(2+)-K(+) environment, Ba(2+) ions were predominantly distributed between sites 3 and 4. These ionic configurations are remarkably consistent with the functional studies and identify a molecular basis for Ba(2+) blockade of K(+) channels.

  15. The quasi-binary phase diagram BaF2-BaBr2 and its relation to the x-ray storage phosphor BaFBr : Eu2+

    Science.gov (United States)

    Kolb, R.; Schlapp, M.; Hesse, S.; Schmechel, R.; von Seggern, H.; Fasel, C.; Riedel, R.; Ehrenberg, H.; Fuess, H.

    2002-08-01

    In order to understand the formation and stoichiometry of the x-ray storage phosphor BaFBr : Eu2+, the phase diagram of the quasi-binary BaF2-BaBr2 system has been investigated. The phase diagram was obtained by means of differential thermal analysis and temperature controlled x-ray diffraction experiments. The resulting phase diagram indicates that BaFBr forms a compound with no detectable solid solubility for neither BaF2 nor BaBr2. Experiments to obtain non-stoichiometric BaFBr via the synthesis route using BaF2 and NH4Br as proposed in the literature could not be verified. It will be shown that the type of colour centre created during x-ray irradiation is related to the non-stoichiometry of the starting compositions before sintering. A surplus of either barium fluoride or barium bromide during sintering allows the controlled formation of F(Br-)- and F(F-)-centres, respectively.

  16. The quasi-binary phase diagram BaF{sub 2}-BaBr{sub 2} and its relation to the x-ray storage phosphor BaFBr:Eu{sup 2+}

    Energy Technology Data Exchange (ETDEWEB)

    Kolb, R.; Schlapp, M.; Hesse, S.; Schmechel, R.; Seggern, H. von [Department of Electronic Materials, Institute of Materials Science, Darmstadt University of Technology, Darmstadt (Germany); Fasel, C.; Riedel, R. [Department of Nondispersive Solids, Institute of Materials Science, Darmstadt University of Technology, Darmstadt (Germany); Ehrenberg, H.; Fuess, H. [Department of Structural Research, Institute of Materials Science, Darmstadt University of Technology, Darmstadt (Germany)

    2002-08-21

    In order to understand the formation and stoichiometry of the x-ray storage phosphor BaFBr:Eu{sup 2+}, the phase diagram of the quasi-binary BaF{sub 2}-BaBr{sub 2} system has been investigated. The phase diagram was obtained by means of differential thermal analysis and temperature controlled x-ray diffraction experiments. The resulting phase diagram indicates that BaFBr forms a compound with no detectable solid solubility for neither BaF{sub 2} nor BaBr{sub 2}. Experiments to obtain non-stoichiometric BaFBr via the synthesis route using BaF{sub 2} and NH{sub 4}Br as proposed in the literature could not be verified. It will be shown that the type of colour centre created during x-ray irradiation is related to the non-stoichiometry of the starting compositions before sintering. A surplus of either barium fluoride or barium bromide during sintering allows the controlled formation of F(Br{sup -})- and F(F{sup -})-centres, respectively. (author)

  17. Configuration Database for BaBar On-line

    Energy Technology Data Exchange (ETDEWEB)

    Salnikov, Andrei

    2003-05-27

    The configuration database is one of the vital systems in the BaBar on-line system. It provides services for the different parts of the data acquisition system and control system, which require run-time parameters. The original design and implementation of the configuration database played a significant role in the successful BaBar operations since the beginning of experiment. Recent additions to the design of the configuration database provide better means for the management of data and add new tools to simplify main configuration tasks. We describe the design of the configuration database, its implementation with the Objectivity/DB object-oriented database, and our experience collected during the years of operation.

  18. Dynamic moments of inertia in Xe, Cs and Ba nuclei

    Energy Technology Data Exchange (ETDEWEB)

    El-Samman, H.; Barci, V.; Gizon, A.; Gizon, J.; Hildingsson, L.; Jerrestam, D.; Klamra, W.; Kossakowski, R.; Lindblad, T.; Gono, Y.; Bengtsson, T.; Leander, G.A.

    1984-01-01

    The ..gamma..-rays following the reactions induced by /sup 12/C ions on /sup 115/In, /sup 112/,/sup 117/,/sup 122/Sn and /sup 123/Sb targets have been investigated using six NaI(Tl) detectors in a two-dimensional arrangement. The collective moment of inertia I(/sup 2/) /sub band/ of /sup 118/,/sup 122/Xe, /sup 123/Cs and /sup 128/,/sup 130/Ba have been extracted from the energy-correlation spectra. The behaviour of these nuclei and the observed differences are interpreted in terms of high-spin collective properties. Data are also presented on the effective moment of inertia I(/sup 2/)/sub eff/ of /sup 118/Xe and /sup 130/Ba measured by sum-spectrometer techniques. 13 references.

  19. Performances of RPCs in the BaBar Experiment

    CERN Document Server

    Messner, R

    2003-01-01

    The BaBar experiment uses a big system based on RPC detectors to discriminate muons from pions and to identify neutral hadrons. About 2000 m sup 2 of RPC chambers have been working at SLAC since the end of 1998. We report on the performances of the RPC chambers focusing on new problems discovered in the RPC behavior. These problems started very soon after the installation of the chambers on the detector when the high ambient temperature triggered an increase of dark currents inside the chambers and a reduction of the efficiency. Careful analysis of the BaBar data and dedicated R and D efforts in the laboratory have helped to identify the main source of the trouble in the linseed oil varnish on the bakelite electrodes.

  20. BaTMAn: Bayesian Technique for Multi-image Analysis

    Science.gov (United States)

    Casado, J.; Ascasibar, Y.; García-Benito, R.; Guidi, G.; Choudhury, O. S.; Bellocchi, E.; Sánchez, S. F.; Díaz, A. I.

    2016-12-01

    Bayesian Technique for Multi-image Analysis (BaTMAn) characterizes any astronomical dataset containing spatial information and performs a tessellation based on the measurements and errors provided as input. The algorithm iteratively merges spatial elements as long as they are statistically consistent with carrying the same information (i.e. identical signal within the errors). The output segmentations successfully adapt to the underlying spatial structure, regardless of its morphology and/or the statistical properties of the noise. BaTMAn identifies (and keeps) all the statistically-significant information contained in the input multi-image (e.g. an IFS datacube). The main aim of the algorithm is to characterize spatially-resolved data prior to their analysis.

  1. BaTMAn: Bayesian Technique for Multi-image Analysis

    CERN Document Server

    Casado, J; García-Benito, R; Guidi, G; Choudhury, O S; Bellocchi, E; Sánchez, S; Díaz, A I

    2016-01-01

    This paper describes the Bayesian Technique for Multi-image Analysis (BaTMAn), a novel image segmentation technique based on Bayesian statistics, whose main purpose is to characterize an astronomical dataset containing spatial information and perform a tessellation based on the measurements and errors provided as input. The algorithm will iteratively merge spatial elements as long as they are statistically consistent with carrying the same information (i.e. signal compatible with being identical within the errors). We illustrate its operation and performance with a set of test cases that comprises both synthetic and real Integral-Field Spectroscopic (IFS) data. Our results show that the segmentations obtained by BaTMAn adapt to the underlying structure of the data, regardless of the precise details of their morphology and the statistical properties of the noise. The quality of the recovered signal represents an improvement with respect to the input, especially in those regions where the signal is actually con...

  2. BaH molecular spectroscopy with relevance to laser cooling

    CERN Document Server

    Tarallo, M G; Zelevinsky, T

    2015-01-01

    We describe a simple experimental apparatus for laser ablation of barium monohydride (BaH) molecules and the study of their rovibrational spectra that are relevant to direct laser cooling. We present a detailed analysis of the properties of ablation plumes that can improve the understanding of surface ablation and deposition technologies. A range of absorption spectroscopy and collisional thermalization regimes has been studied. We directly measured the Franck-Condon factor of the $\\mathrm{B}^2\\Sigma^+(v'=0)\\leftarrow\\mathrm{X}^2\\Sigma^+(v"=1)$ transition. Prospects for production of a high luminosity cryogenic BaH beam are outlined. This molecule is a promising candidate for laser cooling and ultracold fragmentation, both of which are precursors to novel experiments in many-body physics and precision measurement.

  3. Monitoring the BaBar Data Acquisition System

    Institute of Scientific and Technical Information of China (English)

    2001-01-01

    The BaBar data acquisition system(DAQ)transports data from the detector front end eletronics to short term disk storage.A monitoring application(VMON)has been developed to monitor the one hundred and ninety computers in the dataflow system.Performance information for each CPU is collected and multicast across the existing data transport network.The packets are currently collected by a single UNIX workstation and archived.A ROOT based GUI provides control and displays the DAQ performance in real time.The same GUI is reused to recover archived VMON data,VMON has been deployed and constantly monitors the BaBar dataflow system.It has been used for diagnostics and provides input to models projecting future performance.The application has no measurable impact on data taking ,responds instantaneously on the human timescale to requests for information display,and uses only 3% of a 300MHz Sun Ultra5 CPU.

  4. Superconductivity in the Graphite Intercalation Compound BaC(6).

    Science.gov (United States)

    Heguri, Satoshi; Kawade, Naoya; Fujisawa, Takumi; Yamaguchi, Akira; Sumiyama, Akihiko; Tanigaki, Katsumi; Kobayashi, Mototada

    2015-06-19

    Among many two-dimensional (2D) high T(C) superconductors, graphite intercalation compounds (GICs) are the most famous intercalation family, which are classified as typical electron-phonon mediated superconductors. We show unambiguous experimental facts that BaC(6), the superconductivity of which has been missing for many years so far among various alkaline earth metal (Ca, Sr, and Ba) intercalted GICs, exhibits superconductivity at T(C)=65  mK. By adding this finding as the additional experimental point, a complete figure displaying the relationship between T(C) and interlayer distance (d) for GICs is now provided, and their possible superconducting mechanisms raised so far are revisited. The present study settles a long-running debate between theories and experiments on the superconductivity in the first stage GICs.

  5. In Situ Investigation of the Mechanism of BaO Dissolution in Chloride Melts by Raman Spectroscopy

    Science.gov (United States)

    Zakir‧yanova, I. D.; Nikolaeva, E. V.; Bove, A. L.

    2015-01-01

    The mechanism of BaO dissolution in a melt of the BaCl2-KCl-NaCl eutectic mixture was determined in situ using Raman spectroscopy. The types, structures, and compositions of oxychloride groups present in the melt were established. It was found that BaO dissolution proceeded according to the reaction BaO (s) + [BaCl6]4- (soln.) → [Ba2OCl6]4- (soln.) and was accompanied by the appearance of [Ba2OCl6]4- groups (D3d symmetry) of a mixed oxychloride composition.

  6. CuBA - a CUDA implementation of BAMPS

    CERN Document Server

    Cardoso, Nuno; Eilhauer, Ulrike; Bouras, Ioanni

    2012-01-01

    Using CUDA as programming language, we create a code named CuBA which is based on the CPU code "Boltzmann Approach for Many Parton Scattering (BAMPS)" developed in Frankfurt in order to study a system of many colliding particles resulting from heavy ion collisions. Furthermore, we benchmark our code with the Riemann Problem and compare the results with BAMPS. They demonstrate an improvement of the computational runtime, by one order of magitude.

  7. Thermoelectric properties of topological insulator BaSn2

    Science.gov (United States)

    Guo, San-Dong; Qiu, Liang

    2017-01-01

    Recently, \\text{BaS}{{\\text{n}}2} has been predicted to be a strong topological insulator by the first-principle calculations. It is well known that topological insulators have a close connection to thermoelectric materials, such as the \\text{B}{{\\text{i}}2}\\text{T}{{\\text{e}}3} family. In this work, we investigate thermoelectric properties of \\text{BaS}{{\\text{n}}2} by the first-principles calculations combined with the Boltzmann transport theory. The electronic part is carried out by a modified Becke and Johnson (mBJ) exchange potential, including spin-orbit coupling (SOC), while the phonon part is performed using a generalized gradient approximation (GGA). It was found that the electronic transport coefficients between the in-plane and cross-plane directions showed strong anisotropy, while lattice-lattice thermal conductivities demonstrated almost complete isotropy. Calculated results revealed a very low lattice thermal conductivity for \\text{BaS}{{\\text{n}}2} , and the corresponding average lattice thermal conductivity at room temperature is 1.69 \\text{W}~{{\\text{m}}-1}~{{\\text{K}}-1} , which is comparable or lower than those of lead chalcogenides and bismuth-tellurium systems as classic thermoelectric materials. Due to the complicated scattering mechanism, calculating the scattering time τ is challenging. By using an empirical τ ={{10}-14} s, the n-type figure of merit ZT is greater than 0.40 in wide temperature ranges. Experimentally, it is possible to attain better thermoelectric performance by strain or tuning size parameters. This work indicates that \\text{BaS}{{\\text{n}}2} may be a potential thermoelectric material, which can stimulate further theoretical and experimental work.

  8. BaF2 TIME DIFFERENTIAL PERTURBED ANGULAR DISTRIBUTION SPECTROMETER

    Institute of Scientific and Technical Information of China (English)

    朱升云; 勾振辉; 等

    1994-01-01

    A BaF2 time differential perturbed angular distribution spectrometer has been established at the HI-13 tandem accelerator in CIAE.The time resolution of the spectrometer is 195ps and the nonlinearity is less than 2%.The spectrometer works very stably and no time drift is found over a period of experimental runs.This spectrometer has been successfully used in the g-factor measurement of 43Sc(19/2-,3.1232MeV).

  9. Microscopic investigation of magnetic dipole bands in {sup 132}Ba

    Energy Technology Data Exchange (ETDEWEB)

    Higashiyama, Koji [Department of Physics, University of Tokyo, Hongo, Tokyo 113-0033 (Japan); Yoshinaga, Naotaka [Department of Physics, Saitama University, Saitama City 338-8570 (Japan)

    2005-10-01

    Nuclear structure of {sup 132}Ba is investigated within a framework of the pair-truncated shell model. The model reproduces experimental energy levels of the magnetic dipole band with the {nu}(h{sup 2}{sub 11/2}) x {pi}(h{sub 11/2}g{sub 7/2}) configuration. From the analysis of its structure, it turns out that two angular momenta of valence neutrons and protons gradually close as total spin increases.

  10. BaBar Level 1 Drift Chamber Trigger Upgrade

    CERN Document Server

    Halyo, V

    2002-01-01

    As PEP-II is exceeding the original design luminosity, BaBar is currently upgrading its Level 1 Drift Chamber Trigger (DCT) to reduce the rate of background Level 1 triggers by more than 50% while preserving the high Level 1 trigger physics efficiency. New Z-Pt-Discriminator VME boards (ZPD) utilizing the stereo hit information from the drift chamber are being built to extract the track z coordinate at the beam line with a resolution of a few centimeters.

  11. Earth Observation for Biodiversity Assessment (EO-BA)

    CSIR Research Space (South Africa)

    Cho, Moses A

    2012-10-01

    Full Text Available in the Dukuduku coastal forest Earth Observation for Biodiversity Assessment (EO-BA) MA CHO, P DEBBA, R MATHIEU, A RAMOELO, L NAIDOO, H VAN DEVENTER, O MALAHLELA AND R MAIN CSIR Natural Resources and the Environment, Pretoria, South Africa PO Box 395..., Pretoria, South Africa, 0001 Email: mcho@csir.co.za ? www.csir.co.za THE ROLE OF EARTH OBSERVATION IN PROVIDING BIODIVERSITY INFORMATION Biodiversity encompasses four levels: genetic, species, ecosystem and functional diversities. By sustaining...

  12. Analysis of Jupiter's Oval BA: A Streamlined Approach

    Science.gov (United States)

    Sussman, Michael G.; Chanover, Nancy J.; Simon-Miller, Amy A.; Vasavada, Ashwin R.; Beebe, Reta F.

    2010-01-01

    We present a novel method of constructing streamlines to derive wind speeds within jovian vortices and demonstrate its application to Oval BA for 2001 pre-reddened Cassini flyby data, 2007 post-reddened New Horizons flyby data, and 1998 Galileo data of precursor Oval DE. Our method, while automated, attempts to combine the advantages of both automated and manual cloud tracking methods. The southern maximum wind speed of Oval BA does not show significant changes between these data sets to within our measurement uncertainty. The northern maximum dries appear to have increased in strength during this time interval, tvhich likely correlates with the oval's return to a symmetric shape. We demonstrate how the use of closed streamlines can provide measurements of vorticity averaged over the encircled area with no a priori assumptions concerning oval shape. We find increased averaged interior vorticity between pre- and post-reddened Oval BA, with the precursor Oval DE occupying a middle value of vorticity between these two.

  13. Calibration of {sup 133}Ba by Sum-Peak Method

    Energy Technology Data Exchange (ETDEWEB)

    Silva, R.L. da; Delgado, J.U.; Poledna, R.; Trindade, O.L.; Veras, E.V. de; Santos, A.; Rangel, J., E-mail: ronaldo@ird.gov.br, E-mail: delgado@ird.gov.br, E-mail: poledna@ird.gov.br [Instituto de Radioprotecao e Dosimetria (IRD/CNEN-RJ), Rio de Janeiro, RJ (Brazil); Almeida, M.C.M, E-mail: marcandida@yahoo.com.br [Comissao Nacional de Energia Nuclear (CNEN), Rio de Janeiro, RJ (Brazil)

    2015-07-01

    A calibration laboratory should have several methods of measurement in order to ensure robustness on the values applied. The National Laboratory for Metrology of Ionizing Radiation, (LNMRI IRD), provides gamma sources of radionuclide in various geometries and standardized in activity with reduced uncertainties. Some absolute and relative methods of calibrations could be used routinely. Relative methods require standards to determine the activity of sample to be calibrated, while the absolute methods do not need, simply make the counting and the calculation of the activity is obtained directly. The great advantage of calibrations of radionuclides by absolute method is the accuracy and low uncertainties. {sup 133}Ba is a radionuclide enough used in research laboratories and calibration of detectors for environmental analysis and, according to the scheme, it decays 100% by electron capture and emits about 14 energy gamma and X-ray lines, forming several coincidences. However, the classical methods of absolute measurement, as coincidence 4 πβ-γ have difficulty to calibrate {sup 133}Ba due to its complex decay scheme. The sum-peak method, developed by Brickman, could allow this calibration. It is used for radionuclide calibration that emits at least two photons in coincidence. Therefore, it was developed a methodology that combines gamma spectrometry technique with sum-peak method to standardize {sup 133}Ba samples. Activity results obtained proved compatible, with uncertainties of less than 1%, and, when compared with other methods of calibration, sum-peak demonstrated the feasibility of this methodology, particularly, for simplicity and effectiveness. (author)

  14. Upconversion emission of BaTiO3:Er nanocrystals

    Indian Academy of Sciences (India)

    Pushpal Ghosh; Suparna Sadhu; Tapasi Sen; Amitava Patra

    2008-06-01

    Here, we report the dopant concentration and pump-power dependence upconversion emission properties of erbium doped BaTiO3 nanocrystals derived from sol–emulsion–gel method. Green (550 nm) and red (670 nm) upconversion emissions were observed at room temperature from the ${}^{4}S_{3/2}$ and ${}^{4}F_{9/2}$ levels of Er3+ : BaTiO3 nanocrystals. It is found that at 850 mW of cw excitation power (at 980 nm) the total luminescence was 17130 Cd/m2 for 1000°C heated 0.25 mol% Er-doped BaTiO3 nanocrystals. It is worthwhile to mention that the unusual power-dependent upconversion luminescence (saturation) is observed at higher dopant concentration (2.5 mol%) and high pump power. Our analysis confirms that the depletion of the excited state is responsible for the relevant fluorescence upconversion. We have again confirmed that a twophoton excited state absorption process occurs for all samples.

  15. Synthesis and characterization of (Ba,Yb doped ceria nanopowders

    Directory of Open Access Journals (Sweden)

    Branko Matović

    2011-06-01

    Full Text Available Nanometric size (Ba, Yb doped ceria powders with fluorite-type structure were obtained by applying selfpropagating room temperature methods. Tailored composition was: Ce0.95−xBa0.05YbxO2−δ with fixed amount of Ba − 0.05 and varying Yb content “x” from 0.05 to 0.2. Powder properties such as crystallite and particle size and lattice parameters have been studied. Röntgen diffraction analyses (XRD were used to characterize the samples at room temperature. Also, high temperature treatment (up to 1550°C was used to follow stability of solid solutions. The mean diameters of the nanocrystals are determined from the full width at half maxima (FWHM of the XRD peaks. It was found that average diameter of crystallites is less than 3 nm. WilliamsonHall plots were used to separate the effect of the size and strain in the nanocrystals.

  16. Mechanism of microwave synthesized BaTiO3

    Institute of Scientific and Technical Information of China (English)

    刘韩星; 李永伟; 张汉林; 欧阳世翕

    1997-01-01

    The difference of intermediate products,microstructure and element concentration in the particles between microwave synthesized samples and conventional samples was responsible for the existence of non-thermal effect in the microwave field.The diffusions of Ba2+,Ti4+ in the microwave field were enhanced,so that the diffusion of Ti4+ could not be neglected as in the conventional solid state reactions.The influences of the microwave field were mainly expressed as diffusion coefficient and the driving force of ionic motion.The intermediate phase Ba2TiO4 which occurred in the conventional solid reaction was not found during microwave syntheses.The quantity analyses based on XRD experimental data show that the reaction dynamics in microwave is suitable for the Carter equation.The activity energy for reaction of BaCO3 and TiO2 in the microwave field was 42.26 kJ/mol,which was only one fifth of the conventional reaction.

  17. The luminescence of Eu3+, Tb3+ and Tm3+ activated Gd2BaZnO5 and La2BaZnO5

    NARCIS (Netherlands)

    Lammers, M. J. J.; Donker, H.; Blasse, G.

    1985-01-01

    The luminescence of several rare-earth activators in the new compounds Gd2BaZnO5 and La2BaZnO5 is reported and discussed. Activation with the Eu3+ ion yields highly efficient red-emitting phosphors. Some unknown structural details can be derived from the luminescence spectra.

  18. Peixes recifais da costa da Paraíba, Brasil Reef fishes from Paraíba, Brazil

    Directory of Open Access Journals (Sweden)

    Luiz A. Rocha

    1998-01-01

    Full Text Available The coral reef is an ecossystem which evokes great interest, for its beaury, species diversity and fisheries potential. The coast of Paraíba State, northeast Brazil, possesses several natural reefs and shipwrecks which are inhabited by a rich fish fauna. In order to survey the reef fish fauna of Paraíba State, a total of 118 dives, utilizing SCUBA diving techniques, were carriedoutin 27samplingpoints (depths: 0,5-66m, from February/1995 to May/1996. Specimens were collected whenever underwater identification was precluded. A total of 157 known species belonging to 59 families were found. Four unidentified species, one dasyatid, one haemulid, one scarid, and one labrid were recorded. Haemulidae was the most representative family in number of individuais, whereas Carangidae was the most speciose family. This paper is part of a broader study of the northeast Brazilian reef fishes.

  19. Phase equilibria, structure and properties of Y-Ba ceramic

    Energy Technology Data Exchange (ETDEWEB)

    Shamrai, V.F.; Efimov, Yu.V.; Karpinskii, O.G.; Babareko, A.A.; Leitus, G.M.; Frolova, T.M.; Myasnikova, E.A.; Postnikov, A.M.; Savel' yeva, M.E.; Lipikhin, Yu.L. (A.A. Baikov Inst. of Metallurgy, Academy of Sciences, Moscow (USSR))

    1990-05-01

    XRD, microscopy, chemical and activation analysis, together with measurement of Tc and some other properties, have been used to study changes in phase composition, microstructure, crystal structure, texture and composition-property diagrams of high temperature Y-Ba superconductors (single-crystal and polycrystalline specimens and cold-rolled strips) with variations in preparation, heat treatment, deformation and temperature. When prepared by conventional solid state reactions, specimens of the Y-Ba ceramic are generally polyphase (orthorhombic superconducting 123 phase, 2115 phase, sometimes BaCuO{sub 2}, and residual amounts of the initial oxides). The non-equilibrium specimens also contain Y{sub x}Ba{sub y}O{sub z}-type phases. Homogeneous single-phase (as shown by XRD) specimens of the 123-type phase with Tc=88-92 K (containing under 2-5 vol.% second phase, predominantly 2115) are obtained by repeated wet grinding, mixing and solid state annealing at 920-930degC, in air and under oxygen, of the initial mixture of oxides, including BaO{sub 2}. The manner in which the lattice periods of the orthorhombic 123 phase (Tc=92 K) vary with temperature displays an anomaly near Tc that correlates with the thermal behaviour of the Debye temperature. The lattice parameters of a YBa{sub 2}Cu{sub 3}O{sub 6.6} orthorhombic crystal have been studied at 91 and 293 K to ascertain the occupancy of the oxygen positions. Cooling the orthorhombic crystals involves the compression of the triple layers formed by two sheets of CuO{sub 5} pyramids, with their vertices facing the Cu1-O1-Cu1 chains. The compression is mainly due to a reduction in the Cu1-O2 distance. Centrally located in the ''a'' edges, the oxygen atoms may ''trigger'' the interchain interaction. Rolling of the 123 phase powder and strip with the addition of a plasticizer causes brittle cleavage of the crystals and gives rise to the (001) (110) basal texture.

  20. Calculated g -factors of 5 d double perovskites Ba2NaOsO6 and Ba2YOsO6

    Science.gov (United States)

    Ahn, Kyo-Hoon; Pajskr, Karel; Lee, Kwan-Woo; Kuneš, Jan

    2017-02-01

    Using Wannier functions to represent the density functional results we calculate the hybridization corrections to the orbital momentum operator in the Os 5 d shell of the Mott insulators Ba2NaOsO6 and Ba2YOsO6 . The g -factors are obtained by evaluating the spin and orbital momentum operators in the atomic ground states of the Os ion. While the hybridization corrections play a minor role in the d3 ion of Ba2YOsO6 with a dominant spin moment, they are instrumental for the observation of the nonzero g -factor of the d1 ions of Ba2NaOsO6 . In addition, we analyze the exchange interactions in Ba2YOsO6 and find them to be consistent with the reported magnetic structure.

  1. The influence of BA and BA+GA4+7 on formation of sylleptic shoots on one-year-old apple nursery trees

    Directory of Open Access Journals (Sweden)

    Radivojević Dragan D.

    2015-01-01

    Full Text Available This study presents the influence of BA (6-benzyladenine and BA+GA4+7 (6-benzyladenine + gibberellic acids 4 and 7 on feathering of one-year-old apple trees of two cultivars Jonagold and Čadel. Different concentrations of BA (300, 600, 1,200 and 1,800 mg L-1 and BA+GA4+7 (500, 1,000, 1,500 and 2,000 mg L-1 were applied, and two treatments for both chemicals were performed. The first treatment was applied at 70-cm height of nursery trees and the second 2 weeks later. Comparison was performed in relation to untreated control. An application of BA and BA+GA4+7 did not affect both rootstock and nursery tree diameter at 10 cm above the grafting union. Nursery trees of cultivar Jonagold were not influenced by treatments applied, whereas in cultivar Čadel, the treatment with BA+GA4+7 decreased apical growth of nursery trees. The development of sylleptic shoots in both cultivars tested was influenced by the type of growth regulator and concentration applied. Treatment with BA at 300 mg L-1 concentration in both cultivars tested did not influence total length and number of sylleptic shoots, as well as the number of sylleptic shoots longer than 20 cm. The most positive influence on all studied parameters was observed on nursery trees treated with the concentration of 1,200 mg L-1 BA. The lowest concentration of BA+GA4+7 (500 mg L-1 caused the low feathering of both studied cultivars. The higher concentrations (1,000, 1,500 and 2,000 mg L-1 similarly increased the number and total length of sylleptic shoots of nursery trees. [Projekat Ministarstva nauke Republike Srbije, br. TR31063 i br. III46008

  2. Paracoherence studies in Tl 2CaBa 2Cu 2O 8,CaLaBaCu 3O 7-y and CaSmBaCu 3O 7-y

    Science.gov (United States)

    Krishnan, H.; Sankaranarayanan, V.; Srinivasan, R.

    1990-08-01

    In ceramic superconductors, where the intergrain coupling is weak, the phase transition at T co corresponds to the temperature at which phase coherence occurs in all the grains. The region between T m, the mid point of the superconducting transition, and T co, the temperature at which the resistivity goes to zero, is called the paracofioerence region. The resistivity behaviour of single phase Tl 2CaBa 2Cu 2O 8, CaLaBaCu 3O 7-y and CaSmBaCu 3O 7-y has been studied in the above region and the results indicate that the excess conductivity varies as (T - T co) -γ.

  3. Water adsorption induced in-plane domain switching on BaTiO{sub 3} surface

    Energy Technology Data Exchange (ETDEWEB)

    Li, X.; Bai, Y.; Su, Y. J., E-mail: yjsu@ustb.edu.cn [Corrosion and Protection Center, Key Laboratory for Environmental Fracture (MOE), University of Science and Technology Beijing, Beijing 100083 (China); Wang, B. C. [Corrosion and Protection Center, Key Laboratory for Environmental Fracture (MOE), University of Science and Technology Beijing, Beijing 100083 (China); Multiscale Materials Modelling group, Department of Materials and Engineering, Royal Institute of Technology, SE-10044 Stockholm (Sweden)

    2015-09-07

    In this study, the influences of the adsorption of water molecules on the changes in the atomic and electric structures of BaTiO{sub 3} surface were investigated using ab initio calculation. Water molecules are molecularly and dissociatively adsorbed on the BaTiO{sub 3} surface, which makes electrons transfer from water molecules to the BaTiO{sub 3} surface. The redistribution of electrons in the BaTiO{sub 3} surface layers weakens the Ba-O interactions and strengthens the Ti-O interactions, so that the Ti atom shifts in TiO{sub 2} plane, i.e., an in-plane domain switching. The adsorption of water molecules on BaTiO{sub 3} surfaces also results in a reduction in the surface rumpling.

  4. Effect of pinning on the flux motion of Gd-Ba-Cu-O bulk superconductors

    Energy Technology Data Exchange (ETDEWEB)

    Yoshizawa, K.; Nariki, S.; Murakami, M.; Takizawa, T

    2003-10-15

    We have observed the flux motion using Hall probe sensors that are placed on the surface of high quality Y-Ba-Cu-O and Gd-Ba-Cu-O disks 15 mm in diameter with 0.95 mm thickness with applying pulsed magnetic field. The peak value of the field was varied from 0.1 to 0.8 T. The effects of static bias fields was also studied in the field range of 0-3 T at 77 K. Gd-Ba-Cu-O shows the clear secondary peak effect on the J{sub c}-B curve so that the pinning property was different from Y-Ba-Cu-O for which J{sub c} monotonically decreases with field. The flux motion was enhanced in Y-Ba-Cu-O with increasing static bias field, while that was suppressed in Gd-Ba-Cu-O, reflecting the secondary peak effect.

  5. Growth of single crystals of BaFe12O19 by solid state crystal growth

    Science.gov (United States)

    Fisher, John G.; Sun, Hengyang; Kook, Young-Geun; Kim, Joon-Seong; Le, Phan Gia

    2016-10-01

    Single crystals of BaFe12O19 are grown for the first time by solid state crystal growth. Seed crystals of BaFe12O19 are buried in BaFe12O19+1 wt% BaCO3 powder, which are then pressed into pellets containing the seed crystals. During sintering, single crystals of BaFe12O19 up to ∼130 μm thick in the c-axis direction grow on the seed crystals by consuming grains from the surrounding polycrystalline matrix. Scanning electron microscopy-energy dispersive spectroscopy analysis shows that the single crystal and the surrounding polycrystalline matrix have the same chemical composition. Micro-Raman scattering shows the single crystal to have the BaFe12O19 structure. The optimum growth temperature is found to be 1200 °C. The single crystal growth behavior is explained using the mixed control theory of grain growth.

  6. Effect of temperature and time on solvothermal synthesis of tetragonal BaTiO3

    Indian Academy of Sciences (India)

    Amir Habib; Nils Stelzer; Paul Angerer; Roland Haubner

    2011-02-01

    Tetragonal BaTiO3 nanoparticles are synthesized via solvothermal route in an ethanol water mixture. Ba(OH)2.8H2O is used as Ba precursor and TiO2 (P25 Degussa ∼25 nm, 30% anatase, 70% rutile) is used as Ti precursor in the Ba : Ti molar ratio 2 : 1. Effect of temperature and time study on solvothermal synthesis of BaTiO3 revealed that a moderate reaction temperature i.e. 185°C and longer reaction time favour tetragonal phase stabilization. Dissolution–precipitation appears to be the transformation mechanism for the crystallization of BaTiO3 from particulate TiO2 precursor.

  7. Research on fabricating technique of Ba-Al-S:Eu sputtering target

    Institute of Scientific and Technical Information of China (English)

    DING Zhao; YU Zhinong; ZHANG Dongpu; XUE Wei; WANG Wuyu

    2009-01-01

    Ba-Al-S-Eu sputtering target for blue emitting phosphors was prepared by powder sintering method. XRD patterns showed that the main components of the target were barium tetra aluminum sulfide (BaAl4S7), bariutm sulfide (BaS), and europium sulfide (EuS). In the samples, part of the barium and aluminum are formed into barium aluminum oxide (BaAl2O4) with the impurity element of oxygen. The PL characteristic spectra of the target showed the 470 nm blue emission obviously, and the Ba-Al-S thin films also transmitted a purple-blue emission at the position of 440 nm.The results indicated that this method was suitable for the fabrication of the Ba-Al-S:Eu sputtering target.

  8. Thermodynamic investigation of ZrO2-BaO system

    Institute of Scientific and Technical Information of China (English)

    GONG Wei-ping; CHEN Teng-fei; JIN Zhan-peng

    2007-01-01

    Thermodynamic description of ZrO2-BaO system was developed using the available experimental information. Special attention was paid to the modelling of the perovskite phase BaZrO3 by a temperature-dependent polynomial to fit the experimental thermodynamic properties. The liquid phases, CSS (cubic ZrO2 solid solution) and TSS (tetragonal ZrO2 solid solution) were modelled with Redlich-Kister formula. The compounds Ba2ZrO4 and Ba3Zr2O7 were treated as stoichiometric phases and the BaOSS and MSS (halite BaO and monoclinic ZrO2 solid solutions) were treated as pure compounds. Comparisons between the calculated and the measured phase diagram as well as the thermodynamic quantities indicate that the most reliable experimental information is satisfactorily accounted for by the present thermodynamic calculation.

  9. Light Sensitive Lattice Defects In BaTiO3 Containing Fe

    Science.gov (United States)

    Possenriede, Ewald; Schirmer, Ortwin F.; Godefroy, Genevieve; Maillard, Alain

    1989-01-01

    Electron spin resonance spectra, which can consistently be explained by the models Fe4+ - Vo and Fe5+ - vBa, have been observed with BaTiO3 containing Fe. Also Fe3+ and - Fe3+ - Vo have been identified. All these centers as well as several unidentified ones are observed to change their charge states under illumination. They thus are possibly in involved in photorefractive processes in BaTiO3 containing Fe.

  10. Separation Sr and Ba From Fission Products Using Sr-spec Resin Column

    Institute of Scientific and Technical Information of China (English)

    WANG; Xiu-feng

    2013-01-01

    Sr and Ba are the IIA group elements,with the same outer electronic structure,and the very similar properties,so separation of the two elements becomes very difficult.The traditional separation method of Sr and Ba in fission products is repeated precipitation of BaCl2·H2O in hydrochloric acid-ether medium.Four times repeated precipitation steps are needed to ensure the decontamination factor of Sr to be better

  11. Quo Vadis the B.A. degree: Perceptions and visions1

    Directory of Open Access Journals (Sweden)

    Annette L. Combrink

    1993-03-01

    Full Text Available Today is a very special day for all the graduates assembled to have a B.A. degree conferred on them. It is a day on which to celebrate the reward for hard work and for realized dreams. This is a very homogeneous group of people - in the sense that they will be receiving B.A. degrees, and for that reason it would be highly apposite to share some cherished thought and ideas about the B.A. degree.

  12. THINNING OF ‘GALA’ AND 'GOLDEN DELICIOUS' APPLES WITH BA, NAA AND THEIR COMBINATIONS

    Directory of Open Access Journals (Sweden)

    M STOPAR

    2002-07-01

    Full Text Available Apple trees, eight-year-old ‘Gala’/M.9 and four-year-old ‘Golden Delicious’/M.9 have been thinned with 6- benzyladenine (BA 50 ppm, 100 ppm and 200 ppm, with 1-naphthaleneacetic acid (NAA 5 ppm, 10 ppm and 20 ppm, and with the tank mix combinations of BA 50 ppm + NAA 5 ppm or BA 20 ppm + NAA 5 ppm, all at 9-10 mm fruitlet diameter. All applied concentrations of BA and NAA thinned both cultivars significantly and no significant difference was found between BA or NAA thinning action. No concentration response on thinning was observed with neither BA nor NAA application. All BA or NAA separate treatments caused yield of fruit to shift to bigger size class. The only concentration response effect was found on evaluation of mean fruit weight data on ‘Golden Delicious’. The higher concentration of BA was used, the higher was the weight of ‘Golden Delicious’ fruit. On the opposite, the higher concentration of NAA was used, the lower was the weight of ‘Golden Delicious’ fruit (not significantly. When BA and NAA were sprayed on ‘Gala’ or ‘Golden Delicious’ as a tank mix combination, similar effect on thinning or fruit growth occurred comparing to BA or NAA when sprayed alone. Return bloom was enhanced on all thinned ‘Gala’ trees while flower formation of ‘Golden Delicious’ was better in the case of BA 200 ppm, NAA 5 ppm, NAA 20 ppm or tank mix spraying of BA 20 ppm + NAA 5 ppm.

  13. Beyond survival: fostering growth and innovation in doctoral study--a concept analysis of the Ba space.

    Science.gov (United States)

    Krahe, J A E; Lalley, Cathy; Solomons, Nan M

    2014-01-25

    This concept analysis examines the Ba space in the context of interdisciplinary doctoral study in nursing and healthcare innovation in a minimal residency program. The authors identified Ba in their small, highly diverse, self-selected doctoral study group and believe Ba is an educational innovation that will prove useful to nursing and healthcare educators. Ba originates from Japanese philosophy and is foundational to the birth and sustainment of environments fostering knowledge creation. Ba manifests in complex environments where participants are emotionally invested and relies on the tacit knowledge of each participant, allowing for synthesis of rationality and intuition. Walker and Avant's concept analysis methodology will explore Ba's centrality to interdisciplinary education. Ba's utility and application in fostering innovation in doctoral study will be illustrated. Ba is a true educational innovation, enriching learning environments promoting interdisciplinary collaboration. Ba permits each member a voice and fosters a safe environment where relationships are created and sustained.

  14. Epitaxial thin-film growth of Ruddlesden-Popper-type Ba3Zr2O7 from a BaZrO3 target by pulsed laser deposition

    Science.gov (United States)

    Butt, Shariqa Hassan; Rafique, M. S.; Siraj, K.; Latif, A.; Afzal, Amina; Awan, M. S.; Bashir, Shazia; Iqbal, Nida

    2016-07-01

    Ruddlesden-Popper Ba3Zr2O7 thin films have been synthesized via pulsed laser deposition (PLD) technique. The optimization of deposition parameters in PLD enables the formation of thin film of metastable Ba3Zr2O7 phase from BaZrO3 target. In order to see the post-annealing effects on the structural and optical properties, the deposited Ba3Zr2O7 thin films were annealed at 500, 600 and 800 °C. X-ray diffraction (XRD) reveals the formation of Ba3Zr2O7 phase with tetragonal structure. The changes in the surface of the deposited films were analysed by FE-SEM and AFM. The thin film post-annealed at 500 °C exhibited the best structural, optical and surface properties. Furthermore, the chemical states and chemical composition of the films were determined by X-ray photoelectron spectroscopy (XPS) near the surface. The XPS results show that Ba, Zr and O exist mainly in the form of Ba3Zr2O7 Ruddlesden-Popper-type perovskite structure.

  15. Neutron diffraction study of the crystal structure of BaMoO{sub 4}: A suitable precursor for metallic BaMoO{sub 3} perovskite

    Energy Technology Data Exchange (ETDEWEB)

    Nassif, V.; Carbonio, R.E. [Univ. Nacional de Cordoba (Argentina). Inst. de Investigaciones en Fisicoquimica; Alonso, J.A. [C.S.I.C., Madrid (Spain). Inst. de Ciencia de Materiales

    1999-08-01

    BaMoO{sub 3}, metallic and Pauli paramagnetic, has been prepared by controlled reduction of BaMoO{sub 4}. This precursor, containing Mo(VI), is unusually stable against reduction, due to structural factors. The crystal structure of BaMoO{sub 4} has been refined from neutron powder diffraction data: space group I4{sub 1}/a (no. 88), Z = 4, a = 5.5479(9), and c = 12.743(2) {angstrom}. A bond-valence study allowed the authors to detect the presence of slight tensile and compressive stresses in the crystal structure of BaMoO{sub 4}, in which Ba is overbonded and Mo is underbonded. However, this effect is less pronounced than in other AMO{sub 4} oxides with a scheelite structure (A = Ca, Sr, Ba; M = Mo, W): BaMoO{sub 4} contains the M cation exhibiting the closest valence to the nominal value of 6+, suggesting a large covalent contribution to the Mo-O bonds. This observation is coherent with the large thermal stability of this compound against reduction, taking place at temperatures above 920 C in H{sub 2} flow.

  16. Thermal analysis of formation of nano-crystalline BaTiO3 using Ba(NO32 and TiO2

    Directory of Open Access Journals (Sweden)

    Md. Jawed Ansaree

    2015-12-01

    Full Text Available The reaction of Ba(NO32 with TiO2 was studied by thermogravimetric (TG and differential scanning calorimetric (DSC techniques up to 1000 °C and in nitrogen atmosphere. It was found that the formation of BaTiO3 takes place above 600 °C and that precursor mixing time and heating rate have no effect on the reaction temperature. BaTiO3 powder was prepared by calcination of Ba(NO32 and TiO2 precursor mixture at 800 °C for 8 h. X-ray diffraction analysis of the synthesized BaTiO3 confirmed the formation of tetragonal phase with lattice parameters a = 3.9950±0.0003 Å and c = 4.0318±0.0004 Å. Thermal analysis of the synthesized BaTiO3 powder showed weight loss within temperature range 40–1000 °C of only 0.40%. This small amount of weight loss was connected with some impurity phase, and identified as BaCO3 using Fourier transform infrared (FTIR technique.

  17. Piezoelectric and Dielectric Properties of Multilayered BaTiO3/(Ba,Ca)TiO3/CaTiO3 Thin Films.

    Science.gov (United States)

    Zhu, Xiao Na; Gao, Ting Ting; Xu, Xing; Liang, Wei Zheng; Lin, Yuan; Chen, Chonglin; Chen, Xiang Ming

    2016-08-31

    Highly oriented multilayered BaTiO3-(Ba,Ca)TiO3-CaTiO3 thin films were fabricated on Nb-doped (001) SrTiO3 (Nb:STO) substrates by pulsed laser deposition. The configurations of multilayered BaTiO3-(Ba,Ca)TiO3-CaTiO3 thin films are designed with the thickness ratio of 1:1:1 and 2:1:1 and total thickness ∼300 nm. Microstructural characterization by X-ray diffraction indicates that the as-deposited thin films are highly c-axis oriented and large in-plane strain is determined in BaTiO3 and CaTiO3 layers. Piezoresponse force microscopy (PFM) studies reveal an intense in-plane polarization component, whereas the out-of-plane shows inferior phase contrast. The optimized combination is found to be the BaTiO3-(Ba0.85Ca0.15)TiO3-CaTiO3 structure with combination ratio 2:1:1, which displays the largest domain switching amplitude under DC electric field, the largest room-temperature dielectric constant ∼646, a small dielectric loss of 0.03, and the largest dielectric tunability of ∼50% at 400 kV/cm. These results suggest that the enhanced dielectric and tunability performance are greatly associated with the large in-plane polarization component and domain switching.

  18. Er3+ infrared fluorescence affected by spatial distribution synchronicity of Ba2+ and Er3+ in Er3+-doped BaO–SiO2 glasses

    Directory of Open Access Journals (Sweden)

    Atsunobu Masuno

    2016-02-01

    Full Text Available Glasses with the composition xBaO–(99.9 − xSiO2–0.1ErO3/2 (0 ≤x ≤ 34.9 were fabricated by a levitation technique. The glasses in the immiscibility region were opaque due to chemical inhomogeneity, while the other glasses were colorless and transparent. The scanning electron microscope observations and electron probe microanalysis scan profiles revealed that more Er3+ ions were preferentially distributed in the regions where more Ba2+ ions existed in the chemically inhomogeneous glasses. The synchronicity of the spatial distributions of the two ions initially increased with increasing x and then decreased when the Ba2+ concentration exceeded a certain value. The peak shape and lifetime of the fluorescence at 1.55 μm depended on x as well as the spatial distribution of both ions. These results indicate that although ErOn polyhedra are preferentially coordinated with Ba2+ ions and their local structure is affected by the coordination of Ba2+, there is a maximum in the amount of Ba2+ ions that can coordinate ErOn polyhedra since the available space for Ba2+ ions is limited. These findings provide us with efficient ways to design the chemical composition of glasses with superior Er3+ fluorescence properties for optical communication network systems.

  19. An Investigation of Insulating La 4BaCu 5O 12 Obtained by the Reduction of Metallic La 4BaCu 5O 13.1

    Science.gov (United States)

    Rangavittal, N.; Subbanna, G. N.; Row, T. N. Guru; Rao, C. N. R.

    1995-01-01

    The structure of insulating La 4BaCu 5O 12 obtained by the reduction of metallic La 4BaCu 5O 13.1 has been studied by using electron microscopy and high-resolution X-ray diffraction data. While La 4BaCu 5O 13.1 ( P4/ m) has a tetragonal structure with the supercell a c5 × a c5 × a c, the reduced phase, La 4BaCu 5O 12, is monoclinic ( P2/ m) with the supercell a c5 × a c × a c5. La 4BaCu 5O 12 consists of CuO 5 square pyramids and CuO 4 square planar units, instead of CuO 6 octahedra and CuO 5 square pyramids as in La 4BaCu 5O 13.1. Electron microscopic examination reveals the presence of twinning in some of the crystals of La 4BaCu 5O 12.

  20. From Ba3Ta5O14N to LaBa2Ta5O13N2: Decreasing the optical band gap of a photocatalyst

    Science.gov (United States)

    Anke, B.; Bredow, T.; Pilarski, M.; Wark, M.; Lerch, M.

    2017-02-01

    Yellow LaBa2Ta5O13N2 was successfully synthesized as phase-pure material crystallizing isostructurally to previously reported Ba3Ta5O14N and mixed-valence Ba3TaV4TaIVO15. The electronic structure of LaBa2Ta5O13N2 was studied theoretically with the range-separated hybrid method HSE06. The most stable structure was obtained when lanthanum was placed on 2a and nitrogen on 4h sites confirming Pauling's second rule. By incorporating nitrogen, the measured band gap decreases from ∼3.8 eV for the oxide via 2.74 eV for Ba3Ta5O14N to 2.63 eV for the new oxide nitride, giving rise to an absorption band well in the visible-light region. Calculated fundamental band gaps confirm the experimental trend. The atom-projected density of states has large contributions from N2p orbitals close to the valence band edge. These are responsible for the observed band gap reduction. Photocatalytic hydrogen formation was investigated and compared with that of Ba3Ta5O14N revealing significantly higher activity for LaBa2Ta5O13N2 under UV-light.

  1. Dielectric tunable properties of BaTi4Og-doped Ba0.6Sr0.4TiO3 microwave composite ceramics

    Institute of Scientific and Technical Information of China (English)

    ZHANG JingJi; ZHAI JiWei; JIANG HaiTao; YAO Xi

    2009-01-01

    BaTi4O9-doped Ba0.6Sr0.4TiO3 (BST) composite ceramics were prepared by the conventional solid-state reaction and their structure, dielectric nonlinear characteristics and microwave dielectric properties were investigated. The secondary phase of the orthorhombic structure Ba4Ti13O30 is formed among BST composite ceramics with the increase of BaTi4O9. At the same time, a duplex or bimodal grains size distribution shows fine grains in a coarse grain matrix. The degree of frequency dispersion of dielectric permittivity below Tm is increased initially and then decreased with respect to BaTi4O9. As the BaTi4O9 content increases, the tunability of composite ceramics decreases, while the Q value increases. Inter-estingly, 70 wt% BaTi4O9-doped BST has a tunability -4.0% (under 30 kV/cm biasing) versus a permit-tivity ~68 and quality factor ~134.1 (at ~3.2 GHz).

  2. Dielectric tunable properties of BaTi4O9-doped Ba0.6Sr0.4TiO3 microwave composite ceramics

    Institute of Scientific and Technical Information of China (English)

    2009-01-01

    BaTi4O9-doped Ba0.6Sr0.4TiO3 (BST) composite ceramics were prepared by the conventional solid-state reaction and their structure, dielectric nonlinear characteristics and microwave dielectric properties were investigated. The secondary phase of the orthorhombic structure Ba4Ti13O30 is formed among BST composite ceramics with the increase of BaTi4O9. At the same time, a duplex or bimodal grains size distribution shows fine grains in a coarse grain matrix. The degree of frequency dispersion of dielectric permittivity below Tm is increased initially and then decreased with respect to BaTi4O9. As the BaTi4O9 content increases, the tunability of composite ceramics decreases, while the Q value increases. Inter-estingly, 70 wt% BaTi4O9-doped BST has a tunability ~4.0% (under 30 kV/cm biasing) versus a permit- tivity ~68 and quality factor ~134.1 (at ~3.2 GHz).

  3. Superconducting thin films of Tl 2Ca 2Ba 2Cu 3O y and Tl 2CaBa 2Cu 2O y

    Science.gov (United States)

    Ginley, D. S.; Kwak, J. F.; Hellmer, R. P.; Baughman, R. J.; Venturini, E. L.; Mitchell, M. A.; Morosin, B.

    1988-11-01

    We present techniques for preparing unoriented polycrystalline and epitaxial superconducting thin films of the Tl 2CaBa 2Cu 2O y and Tl 2Ca 2Ba 2Cu 3O y phases on a wide variety of substrates. The crucial steps determining the properties of the films are shown to be the air sintering and oxygen annealing following the initial metal deposition by electron beam evaporation under a slight oxygen overpressure. A sintered Tl-Ca-Ba-Cu-O pellet is employed as a source of excess Tl during sintering and annealing of the thin film. The Tl concentration in the final films controls the nature of the intergrain connections. The films are characterized by their structural, chemical, magnetic and transport properties. Zero resistance typically occurs at 97 K for Tl 2CaBa 2Cu 2O and at 106 K for Tl 2Ca 2Ba 2Cu 3O y. Transport critical currents of up to 110 000 A/cm 2 have been obtained at 77 K for unoriented Tl 2CaBa 2Cu 2O y, up to 160 000 A/cm 2 for epitaxial Tl 2Ca 2Ba 2Cu 3O y and up to 240 000 A/cm 2 for unoriented Tl 2Ca 2Cu 3O y films with little field dependence of the critical current observed.

  4. How Extended Is Wernicke’s Area? Meta-Analytic Connectivity Study of BA20 and Integrative Proposal

    Directory of Open Access Journals (Sweden)

    Alfredo Ardila

    2016-01-01

    Full Text Available Understanding the functions of different brain areas has represented a major endeavor of contemporary neurosciences. The purpose of this paper was to pinpoint the connectivity of Brodmann area 20 (BA20 (inferior temporal gyrus, fusiform gyrus in language tasks. A meta-analysis was conducted to assess the language network in which BA20 is involved. The DataBase of Brainmap was used; 11 papers corresponding to 12 experimental conditions with a total of 207 subjects were included in this analysis. Our results demonstrated seven clusters of activation including other temporal lobe areas (BA3, BA21, the insula, and the prefrontal cortex; minor clusters in the cingulate gyrus and the occipital lobe were observed; however, the volumes of all the activation clusters were small. Our results suggest that regardless of BA20 having certain participation in language processes it cannot be considered as a core language processing area (Wernicke’s area; nonetheless, it could be regarded as kind of language processing marginal area, participating in “extended Wernicke’s area” or simply “Wernicke’s system.” It is suggested that “core Wernicke’s area” roughly corresponds to BA21, BA22, BA41, and BA42, while a “language associations area” roughly corresponds to BA20, BA37, BA38, BA39, and BA40 (“extended Wernicke’s area” or “Wernicke’s system”.

  5. R-Ferrite-type barium cobalt stannate, BaCo2Sn4O11

    Directory of Open Access Journals (Sweden)

    Takahiro Yamada

    2008-10-01

    Full Text Available BaCo2Sn4O11 is isotypic with R-ferrite, BaTi2Fe4O11. The Co atoms fully occupy trigonal–bipyramidal sites (overline 6 m2 and are disordered with Sn atoms in octahedral sites (.2/m symmetry, as represented in the formula BaCoSn2(Co0.34Sn0.664O11. Ba atoms are situated in a 12-fold coordinated site (=6m2 symmetry.

  6. [Study on continued degradation of BaP and its metabolites].

    Science.gov (United States)

    Zang, Shu-yan; Li, Pei-Jun; Zhou, Qi-xing; Wang, Xin; Lin, Gui-feng; Wang, Juan

    2006-12-01

    Two metabolites, cis-BP4, 5-dihydrodiol and cis-BP7, 8-dihydrodiol, were identified by high-performance liquid chromatography (HPLC) during the degradation of BaP by Bacillus-07 (BA-07). The two metabolites were hardly further metabolized for their toxicity to microorganism. To promote degradation of BaP and decrease accumulation of cis-BP4, 5-dihydrodiol and cis-BP7, 8-dihydrodiol, two methods (degradation only by BA-07, degradation by coupling the BA-07 and KMnO4) were compared. In addition, parameters of continued degradation of BaP and the two metabolites were optimized under the experiment conditions. The results showed that (1)the method of coupling the chemical oxidation and biodegradation (BA-07 and KMnO4) was better than only biodegradation (BA-07); (2) residue rate of cis-BP4, 5-dihydrodiol was higher than that of cis-BP7, 8-dihydrodiol when the samples were determined in the same time; (3)the effect of continued degradation was the best when the initial concentration of BaP was 40 microg/mL, pH value of the culture was 7.0, co-metabolic substrates was sodium succinate. Meanwhile, it was put forward that the method of coupling the chemical oxidation and biodegradation was effective on continued degradation of persistent organic contaminants in the environment.

  7. Enhanced 77 K vortex-pinning in Y Ba2Cu3O7−x films with Ba2Y TaO6 and mixed Ba2Y TaO6 + Ba2Y NbO6 nano-columnar inclusions with irreversibility field to 11 T

    Directory of Open Access Journals (Sweden)

    F. Rizzo

    2016-06-01

    Full Text Available Pulsed laser deposited thin Y Ba2Cu3O7−x (YBCO films with pinning additions of 5 at. % Ba2Y TaO6 (BYTO were compared to films with 2.5 at. % Ba2Y TaO6 + 2.5 at. % Ba2Y NbO6 (BYNTO additions. Excellent magnetic flux-pinning at 77 K was obtained with remarkably high irreversibility fields greater than 10 T (YBCO-BYTO and 11 T (YBCO-BYNTO, representing the highest ever achieved values in YBCO films.

  8. Enhanced 77 K vortex-pinning in Y Ba2Cu3O7-x films with Ba2Y TaO6 and mixed Ba2Y TaO6 + Ba2Y NbO6 nano-columnar inclusions with irreversibility field to 11 T

    Science.gov (United States)

    Rizzo, F.; Augieri, A.; Angrisani Armenio, A.; Galluzzi, V.; Mancini, A.; Pinto, V.; Rufoloni, A.; Vannozzi, A.; Bianchetti, M.; Kursumovic, A.; MacManus-Driscoll, J. L.; Meledin, A.; Van Tendeloo, G.; Celentano, G.

    2016-06-01

    Pulsed laser deposited thin Y Ba2Cu3O7-x (YBCO) films with pinning additions of 5 at. % Ba2Y TaO6 (BYTO) were compared to films with 2.5 at. % Ba2Y TaO6 + 2.5 at. % Ba2Y NbO6 (BYNTO) additions. Excellent magnetic flux-pinning at 77 K was obtained with remarkably high irreversibility fields greater than 10 T (YBCO-BYTO) and 11 T (YBCO-BYNTO), representing the highest ever achieved values in YBCO films.

  9. Ferroelectric properties of epitaxial BaTiO3 thin films and heterostructures on different substrates

    OpenAIRE

    Trithaveesak, O.; Schubert, J; Buchal, Ch.

    2005-01-01

    Ferroelectric thin films of BaTiO3 and BaTiO3/SrRuO3 epitaxial heterostructures on different single-crystalline substrates were fabricated by pulsed laser deposition. The BaTiO3 films of 100-400 nm thickness show high structural perfection and c-axis-oriented growth. For the electrical characterization of the BaTiO3 in a thin-film capacitor structure, Pt top electrodes were deposited by e-beam evaporation. The results are compared to the current experimental and theoretical models. Special co...

  10. Ferroelectric BaTiO3 thin-film optical waveguide modulators

    OpenAIRE

    Petraru, A.; Schubert, J; Schmid, M.; Buchal, Ch.

    2002-01-01

    High-quality BaTiO3 epitaxial thin films on MgO substrates have been grown by pulsed-laser deposition. Both, c-axis and a-axis BaTiO3 orientations were studied. Mach-Zehnder optical waveguide modulators with a fork angle of 1.7degrees have been fabricated by ion-beam etching. The waveguides are of the ridge type, the BaTiO3 thickness is 1 mum, the ridge step 50 nm, and the width 2 mum. Light was coupled into the waveguides from optical fibers. The BaTiO3 waveguide propagation losses are 2-3 d...

  11. On the compressibility of BaFe(2)AS(2)

    DEFF Research Database (Denmark)

    Jørgensen, J. E.; Olsen, J. S.; Gerward, Leif

    2009-01-01

    BaFe(2)AS(2) has been studied by high-pressure energy dispersive X-ray diffraction. The compression mechanism was found to be highly anisotropic, and a tetragonal to orthorhombic phase transition was observed at about 17 GPa. The length of the a- and c-axes of the tetragonal phase is reduced by 2...... and 11%, respectively, at the transition pressure. Furthermore, an increase in compressibility was observed at about 1 GPa. The zero-pressure bulk modulus was determined to be B-0 = 71(4) GPa using experimental data points in the pressure range from 1 to 16.5 GPa. The experimental results are supported...

  12. Managing the BaBar Object Oriented Database

    Institute of Scientific and Technical Information of China (English)

    AdilHasan; ArtemTrunov

    2001-01-01

    The BaBer experiment stores its data in an Object oriented federated database supplied by Objectivity/DB(tm),this database is surrently 350TB in size and is expected to increase considerably as the experiment matures.Management of this database requires careful planning and specialized tools in order to make the data available to physicists in an efficient and timely manner,We discuss the operational issues and management tools that were developed during the previous run to deal with this vast quantity of data at SLAC.

  13. Preparation of nanocrystalline BaTiO3 ceramics

    Institute of Scientific and Technical Information of China (English)

    DENG XiangYun; LI DeJun; LI JianBao; WANG XiaoHui; LI LongTu

    2009-01-01

    The high-dense nanocrystalline BaTiO3 (BT) ceramics with grain size smaller than 100 nm have been successfully prepared by the two step sintering and the spark plasma sintering (SPS) process. The successive transitions in nanograin BT ceramics from rhombohedrel to orthorhombic, tetragonal and cubic transitions, similar to those in coarse BT ceramics, were revealed by in-situ temperature dependent Raman spectrum. The multiphase coexistence and the diffused phase transition character were demonstrated in the 8 nm nanocrystalline BT ceramics.

  14. Pressure dependence of BaNi2As2

    Energy Technology Data Exchange (ETDEWEB)

    Ronning, Filip [Los Alamos National Laboratory; Park, Tuscon [Los Alamos National Laboratory; Bauer, Eric D [Los Alamos National Laboratory; Thompson, Joe D [Los Alamos National Laboratory

    2009-01-01

    We report results from resistivity measurements of BaNi{sub 2}As{sub 2} up to 27.4 kbar of pressure. We find the structural transition at 130 K is broadened slightly with increasing pressure. There is also minimal influence on the superconducting transition, where the resistive onset increases from 2 to 3 K, but the temperature at which zero resistance is obtained is unchanged up to 27.4 kbar. This behavior is in contrast to that observed in the Fe-based systems as well as in LaNiPO and LaNiAsO.

  15. Design of a minimum emittance nBA lattice

    Science.gov (United States)

    Lee, S. Y.

    1998-04-01

    An attempt to design a minimum emittance n-bend achromat (nBA) lattice has been made. One distinct feature is that dipoles with two different lengths were used. As a multiple bend achromat, five bend achromat lattices with six superperiod were designed. The obtained emittace is three times larger than the theoretical minimum. Tunes were chosen to avoid third order resonances. In order to correct first and second order chromaticities, eight family sextupoles were placed. The obtained emittance of five bend achromat lattices is almost equal to the minimum emittance of five bend achromat lattice consisting of dipoles with equal length.

  16. Camino Inca Cajamarca – Baños del Inca

    OpenAIRE

    Camargo Mareovich, Cecilia; León Ascurra, Wilder Javier

    2014-01-01

    En 1532 los capitanes Hernando de Soto y Hernando Pizarro recorrieron un antiguo camino desde la actual Plaza de Armas de Cajamarca hasta los Baños del Inca para entrevistarse con el Inca Atahualpa, quien recorrió por última vez este camino para su encuentro con Francisco Pizarro y sus huestes un 16 de noviembre de 1532. Esta información fue tomada de las descripciones del asentamiento inca que hicieran Hernando Pizarro (1537), Francisco de Xerez (1534), Miguel de Estete (1534), entre otros, ...

  17. Preparation of P(St-BA-VBT)/dye Colored Nanoparticles

    Institute of Scientific and Technical Information of China (English)

    HAN Dong-mei; FANG Kuan-jun

    2015-01-01

    P (St-BA-VBT)/dye colored nanoparticles were prepared by staining P (Styrene-Butyl Acrylate-VinylBenzyl Trimethylammonium chloride) nanoparticles synthesized by soap free cationic emulsion polymerization with reactive dyes. The effects of reactive dyes dosage, dyeing temperature and time on amounts of dyes adsorbed on the nanoparticles were analysed. Results showed that when Reactive Red 195 dosage was 5.25%, the adsorption amounts of dyes on the nanoparticles reached a maximum value of 18.64 mg/g at 65℃for 90 min.

  18. Preparation of nanocrystalline BaTiO3 ceramics

    Institute of Scientific and Technical Information of China (English)

    2009-01-01

    The high-dense nanocrystalline BaTiO3(BT)ceramics with grain size smaller than 100nm have been successfully prepared by the two step sintering and the spark plasma sintering(SPS)process.The successive transitions in nanograin BT ceramics from rhombohedral to orthorhombic,tetragonal and cubic transitions,similar to those in coarse BT ceramics,were revealed by in-situ temperature dependent Raman spectrum.The multiphase coexistence and the diffused phase transition character were demonstrated in the 8nm nanocrystalline BT ceramics.

  19. Thermodynamics of phosphorus and sulfur in the BaO-MnO flux system between 1573 and 1673 K

    Science.gov (United States)

    Watanabe, Yoshinori; Kitamura, Katsuhiro; Rachev, Ivan Petkov; Tsukihashi, Fumitaka; Sano, Nobuo

    1993-04-01

    The oxidative dephosphorization of carbon-saturated Fe-Mn alloys was successfully demonstrated by measuring the phosphorus partition ratio between BaO-MnO, BaO-MnO-BaF2, and BaO-CaOsatd.-MnO fluxes and liquid Fe-Mn-Csatd. alloy between 1573 and 1673 K. The phosphorus partition ratio increases with increasing BaO content of the flux. The phosphate capacity of the BaO-MnO flux is as high as that of the BaO-BaF2 flux and is far larger than those of CaO-bearing fluxes. Addition of BaF2 to the BaO-MnO flux increases BaO solubility, which increases the phosphate capacity. The manganese partition ratios between the BaO-MnO flux and Fe-Mn-Csatd. alloy were approximately constant at 0.64, 0.33, and 0.23 at 1573, 1623, and 1673 K, respectively. The carbon content of the BaO-MnO flux was measured as functions of slag composition, temperature, and partial pressure of CO. A stable species of carbon in the BaO-MnO flux was found to be BaC2 experimentally and thermodynamically. The sulfide capacity of the BaO-MnO system at 1573 K has been shown to be far larger than any known flux systems and to be a few times larger than that for the BaO-BaF2 system.

  20. Petrogenetic implications from Ba-sanidine of Tufo Lionato (Colli Albani Volcanic District); Indicazioni petrogenetiche dal Ba-sanidino presente nel Tufo Lionato (Distretto Vulcanico dei Colli Albani)

    Energy Technology Data Exchange (ETDEWEB)

    Gaeta, Mario [Rome, Univ. (Italy). Dipt. di Scienze della Terra

    1997-12-31

    A vitric fiamme containing Ba O-bearing sanidine (Ba O = 11 wt %) was sampled (via di Fioranello, Roma) in the piroclastic products of the Lower Flow Unit (LFU) belonging to the Villa Senni Eruption Unit in the Colli Albani Volcanic District (Roman Comagmatic Province, Central Italy). The fiamme of the LFU is essentially made up of glass, in which scarce phenocrysts of Ba O-bearing sanidine, leucite and Al{sub 2} O{sub 3}-bearing Ca-clinopyroxene occur. In this report the various parameters controlling barium partitioning between alkali feldspar and LFU liquid, are discussed.

  1. Electron spin resonance, thermoluminescence and fluorescence studies on BaSO{sub 4}:Eu and BaSO{sub 4}:Eu, P thermoluminescent phosphors

    Energy Technology Data Exchange (ETDEWEB)

    Gundo Rao, T.K.; Shinde, S.S.; Bhatt, B.C.; Srivastava, J.K.; Nambi, K.S.V. [Regional Sophisticated Instrumentation Centre, Indian Inst. of Technol., Bombay (India)

    1995-08-07

    The paramagnetic radicals formed in the TL phosphors BaSO{sub 4}:Eu and BaSO{sub 4}:Eu, P have been studied using the technique of ESR. Two radicals assigned to SO{sub 2}{sup -}, were observed at room temperature. One of them exhibits a hyperfine interaction with a nearby cation. Step annealing measurements suggest a connection between these radicals and the TL glow peaks at 170 and 215 degrees C. Co-doping BaSO{sub 4}:Eu with phosphorus enhanced its TL efficiency. ESR and fluorescence emission measurements indicate that the enhancement results from an increased intake of divalent europium into the lattice. (author)

  2. Ba5{V,Nb}12Sb19+x, novel variants of the Ba5Ti12Sb19+x-type: crystal structure and physical properties.

    Science.gov (United States)

    Failamani, F; Grytsiv, A; Giester, G; Polt, G; Heinrich, P; Michor, H; Bauer, E; Zehetbauer, M; Rogl, P

    2015-10-07

    The novel compounds Ba5{V,Nb}12Sb19+x, initially found in diffusion zone experiments between Ba-filled skutterudite Ba0.3Co4Sb12 and group V transition metals (V,Nb,Ta), were synthesized via solid state reaction and were characterized by means of X-ray (single crystal and powder) diffraction, electron probe microanalysis (EPMA), and physical (transport and mechanical) properties measurements. Ba5V12Sb19.41 (a = 1.21230(1) nm, space group P4[combining overline]3m; RF(2) = 0.0189) and Ba5Nb12Sb19.14 (a = 1.24979(2) nm, space group P4[combining overline]3m; RF(2) = 0.0219) are the first representatives of the Ba5Ti12Sb19+x-type, however, in contrast to the aristotype, the structure of Ba5V12Sb19.41 shows additional atom disorder. Temperature dependent ADPs and specific heat of Ba5V12Sb19.41 confirmed the rattling behaviour of Ba1,2 and Sb7 atoms within the framework built by V and Sb atoms. Electrical resistivity of both compounds show an upturn at low temperature, and a change from p- to n-type conductivity above 300 K in Ba4.9Nb12Sb19.4. As expected from the complex crystal structure and the presence of defects and disorder, the thermal conductivity is suppressed and lattice thermal conductivity of ∼0.43 W m(-1) K(-1) is near values typical for amorphous systems. Vicker's hardness of (3.8 ± 0.1) GPa (vanadium compound) and (3.5 ± 0.2) GPa (niobium compound) are comparable to Sb-based filled skutterudites. However, the Young's moduli measured by nanoindentation for these compounds EI(Ba4.9V12Sb19.0) = (85 ± 2) GPa and EI(Ba4.9Nb12Sb19.4) = (79 ± 5) GPa are significantly smaller than those of skutterudites, which range from about 130 to 145 GPa.

  3. Thin films sputtered from Ba{sub 2}NdFeNb{sub 4}O{sub 15} multiferroic targets on BaFe{sub 12}O{sub 19} coated substrates

    Energy Technology Data Exchange (ETDEWEB)

    Bodeux, Romain [CNRS, ICMCB, UPR 9048, F-33600 Pessac (France); Univ. Bordeaux, ICMCB, UPR 9048, F-33600 Pessac (France); Michau, Dominique, E-mail: dominique.michau@icmcb.cnrs.fr [CNRS, ICMCB, UPR 9048, F-33600 Pessac (France); Univ. Bordeaux, ICMCB, UPR 9048, F-33600 Pessac (France); Maglione, Mario; Josse, Michaël [CNRS, ICMCB, UPR 9048, F-33600 Pessac (France); Univ. Bordeaux, ICMCB, UPR 9048, F-33600 Pessac (France)

    2016-09-15

    Highlights: • Synthesis of Ba{sub 2}NdFeNb{sub 4}O{sub 15}/BaFe{sub 12}O{sub 19} (BaM) heterostructures by RF magnetron sputtering. • Growth of TTB layer were retained regardless of the underlayer (Pt bottom electrode or BaM). • Dielectric and magnetic properties were obtained from the Pt/TTB/BaM/Pt stacks. - Abstract: Ba{sub 2}NdFeNb{sub 4}O{sub 15} tetragonal tungsten bronze (TTB)/BaFe{sub 12}O{sub 19} (BaM) hexaferrite bilayers have been grown by RF magnetron sputtering on Pt/TiO{sub 2}/SiO{sub 2}/Si (PtS) substrates. The BaM layer is textured along (0 0 1) while the TTB layer is multioriented regardless of the PtS or BaM/PtS substrate. Dielectric properties of TTB films are similar to those of bulk, i.e., ε ∼ 150 and a magnetic hysteresis loop is obtained from TTB/BaM bilayers, thanks to the BaM component. This demonstrates the possibility of transferring to 2 dimensional structures the composite multiferroic system TTB/BaM previously identified in 3 dimensional bulk ceramics.

  4. Photoluminescence Study of BaFCl:Eu Crystal%BaFCl:Eu晶体的光致发光研究

    Institute of Scientific and Technical Information of China (English)

    苏勉曾; 孙小平

    1986-01-01

    @@ 过去关于BaFCl:Eu的发光的研究[1,4]都认为它的发射光谱中只包括一个峰值位于385nm的窄带[Eu2+ 4f65d-4f7(8S7/2)]和一个叠加在带谱上的锐线发射[Eu2+4f7(6P7/2)-4f7(857/2)],它的激发光谱是由一个相当于Eu2+4f65d激发能级在晶场中分裂成四个蜂的宽带组成[2,5]。最近我们发现在H,-N2、N2、空气、O2等气氛中焙烧合成的BaFCl:Eu中,都共存有Eu2+和Eu3+,它们的发射光谱中不仅有上述Eu2+的两种跃迁发射,而且还存在有Eu3+的 5D0-7Fj跃迁的锐线发射,Eu3+的电荷转移态一4f6(7Fj)跃迁的带状发射,以及BaFCl基质的带状发射。后面这两种谱带的波长和形状与Eu2+的4f65d一4f7(8S7/2)的谱带非常相近,所以过去未能分辨出来o

  5. Stellar laboratories. III. New Ba v, Ba vi, and Ba vii oscillator strengths and the barium abundance in the hot white dwarfs G191-B2B and RE 0503-289

    Science.gov (United States)

    Rauch, T.; Werner, K.; Quinet, P.; Kruk, J. W.

    2014-06-01

    Context. For the spectral analysis of high-resolution and high-signal-to-noise (S/N) spectra of hot stars, state-of-the-art non-local thermodynamic equilibrium (NLTE) model atmospheres are mandatory. These are strongly dependent on the reliability of the atomic data that is used for their calculation. Aims: Reliable Ba v-vii oscillator strengths are used to identify Ba lines in the spectra of the DA-type white dwarf G191-B2B and the DO-type white dwarf RE 0503-289 and to determine their photospheric Ba abundances. Methods: We newly calculated Ba v-vii oscillator strengths to consider their radiative and collisional bound-bound transitions in detail in our NLTE stellar-atmosphere models for the analysis of Ba lines exhibited in high-resolution and high-S/N UV observations of G191-B2B and RE 0503-289. Results: For the first time, we identified highly ionized Ba in the spectra of hot white dwarfs. We detected Ba vi and Ba vii lines in the Far Ultraviolet Spectroscopic Explorer (FUSE) spectrum of RE 0503-289. The Ba vi/Ba vii ionization equilibrium is well reproduced with the previously determined effective temperature of 70 000 K and surface gravity of log g = 7.5. The Ba abundance is 3.5 ± 0.5 × 10-4 (mass fraction, about 23 000 times the solar value). In the FUSE spectrum of G191-B2B, we identified the strongest Ba vii line (at 993.41 Å) only, and determined a Ba abundance of 4.0 ± 0.5 × 10-6 (about 265 times solar). Conclusions: Reliable measurements and calculations of atomic data are a pre-requisite for stellar-atmosphere modeling. Observed Ba vi-vii line profiles in two white dwarfs' (G191-B2B and RE 0503-289) far-ultraviolet spectra were well reproduced with our newly calculated oscillator strengths. This allowed to determine the photospheric Ba abundance of these two stars precisely. Based on observations with the NASA/ESA Hubble Space Telescope, obtained at the Space Telescope Science Institute, which is operated by the Association of Universities for

  6. Pregnane X receptor protects HepG2 cells from BaP-induced DNA damage.

    Science.gov (United States)

    Naspinski, Christine; Gu, Xinsheng; Zhou, Guo-Dong; Mertens-Talcott, Susanne U; Donnelly, Kirby C; Tian, Yanan

    2008-07-01

    Pregnane X receptor (PXR) is a nuclear receptor that coordinately regulates transcriptional expression of both phase I and phase II metabolizing enzymes. PXR plays an important role in the pharmacokinetics of a broad spectrum of endogenous and xenobiotic compounds and appears to have evolved in part to protect organisms from toxic xenobiotics. Metabolism of benzo[a]pyrene (BaP), a well-established carcinogen and ubiquitous environmental contaminant, can result in either detoxification or bioactivation to its genotoxic forms. Therefore, PXR could modulate the genotoxicity of BaP by changing the balance of the metabolic pathways in favor of BaP detoxification. To examine the role of PXR in BaP genotoxicity, BaP-DNA adduct formation was measured by 32P-postlabeling in BaP-treated parental HepG2 cells and human PXR-transfected HepG2 cells. The presence of transfected PXR significantly reduced the level of adducts relative to parental cells by 50-65% (p BaP. To analyze potential PXR-regulated detoxification pathways in liver cells, a panel of genes involved in phase I and phase II metabolism and excretion was surveyed with real-time quantitative reverse transcription PCR. The messenger RNA levels of CYP1A2, GSTA1, GSTA2, GSTM1, UGT1A6, and BCRP (ABCG2) were significantly higher in cells overexpressing PXR, independent of exposure to BaP. In addition, the total GST enzymatic activity, which favors the metabolic detoxification of BaP, was significantly increased by the presence of PXR (p BaP exposure. Taken together, these results suggest that PXR plays an important role in protection against DNA damage by polycyclic aromatic hydrocarbons (PAHs) such as BaP, and that these protective effects may be through a coordinated regulation of genes involved in xenobiotic metabolism.

  7. On Internet Topology Modeling and an Improved BA Model

    Directory of Open Access Journals (Sweden)

    Ye XU

    2011-03-01

    Full Text Available Modeling of Internet topology structure is studied in this paper. First, measuring results of Internet topology from CAIDA monitors have been used to produce a complete topology sample. With this sample, research approaches of the frequency-degree power-law, degree-rank power-law and CCDF(d-degree power-law have been studied to outline the network power-law properties. The frequency-degree power-law relationship is found to be with a power exponent of 2.1406. The degree-rank power-law, however, is found to have two phases of power-law relationships with power-exponents of 0.29981 and 0.84639 respectively. Then, we improved the traditional BA model to construct an Internet topology model (Improved BA model, IBA model, and optimized the IBA model in Genetic Algorithm by the power-exponents gained from frequency-degree power and degree-rank power-law analyses in the paper. Generation algorithm for the IBA model was given at last.

  8. Electromagnetic Properties of Substituted Ba - Ferrites by Selected Cations

    Directory of Open Access Journals (Sweden)

    Darina Kevicka

    2004-01-01

    Full Text Available The powdered samples of barium hexaferrite BaFe12-2x(Me1Me2 with x varying from 0.0 to 0.6 were prepared by citrate precursor method. The cation preference of mainly four-valence Me1=(Zr, Ti, Sn ions and two-valence Me2=(Co, Ni, Zn ions and their combinations in substituted Ba ferrites were investigated by the thermomagnetic analysis, Mossbauer spectroscopy and measurement of the magnetic properties. Mossbaur studies reveal that Zr4+, Sn4+ and less Co2+, Zn2+ ions have a strong preference to occupy 2b position, this position has the greatest contribution to the magnetocrystalline anisotropy. The La3+, Ti4+, Ni2+ ions preferently enter 4f2 sites and Zn2+, Co2+ ions also prefer to occupy 4f1 tetrahedral sites. The specific saturation magnetic polarisation Js-m and remanence Js-r increased with small x due to th substitution of non-magnetic and less magnetic ions in 4f1 and 4f2 sites. The coercivity Hc was casily controllable by the sustituions level x.

  9. Barium Qubit State Detection and Ba Ion-Photon Entanglement

    Science.gov (United States)

    Sosnova, Ksenia; Inlek, Ismail Volkan; Crocker, Clayton; Lichtman, Martin; Monroe, Christopher

    2016-05-01

    A modular ion-trap network is a promising framework for scalable quantum-computational devices. In this architecture, different ion-trap modules are connected via photonic buses while within one module ions interact locally via phonons. To eliminate cross-talk between photonic-link qubits and memory qubits, we use different atomic species for quantum information storage (171 Yb+) and intermodular communication (138 Ba+). Conventional deterministic Zeeman-qubit state detection schemes require additional stabilized narrow-linewidth lasers. Instead, we perform fast probabilistic state detection utilizing efficient detectors and high-NA lenses to detect emitted photons from circularly polarized 493 nm laser excitation. Our method is not susceptible to intensity and frequency noise, and we show single-shot detection efficiency of ~ 2%, meaning that we can discriminate between the two qubits states with 99% confidence after as little as 50 ms of averaging. Using this measurement technique, we report entanglement between a single 138 Ba+ ion and its emitted photon with 86% fidelity. This work is supported by the ARO with funding from the IARPA MQCO program, the DARPA Quiness program, the AFOSR MURI on Quantum Transduction, and the ARL Center for Distributed Quantum Information.

  10. BaBar computing - From collisions to physics results

    CERN Document Server

    CERN. Geneva

    2004-01-01

    The BaBar experiment at SLAC studies B-physics at the Upsilon(4S) resonance using the high-luminosity e+e- collider PEP-II at the Stanford Linear Accelerator Center (SLAC). Taking, processing and analyzing the very large data samples is a significant computing challenge. This presentation will describe the entire BaBar computing chain and illustrate the solutions chosen as well as their evolution with the ever higher luminosity being delivered by PEP-II. This will include data acquisition and software triggering in a high availability, low-deadtime online environment, a prompt, automated calibration pass through the data SLAC and then the full reconstruction of the data that takes place at INFN-Padova within 24 hours. Monte Carlo production takes place in a highly automated fashion in 25+ sites. The resulting real and simulated data is distributed and made available at SLAC and other computing centers. For analysis a much more sophisticated skimming pass has been introduced in the past year, ...

  11. Towards a sub 15-dBA optical micromachined microphone.

    Science.gov (United States)

    Kim, Donghwan; Hall, Neal A

    2014-05-01

    Micromachined microphones with grating-based optical-interferometric readout have been demonstrated previously. These microphones are similar in construction to bottom-inlet capacitive microelectromechanical-system (MEMS) microphones, with the exception that optoelectronic emitters and detectors are placed inside the microphone's front or back cavity. A potential advantage of optical microphones in designing for low noise level is the use of highly-perforated microphone backplates to enable low-damping and low thermal-mechanical noise levels. This work presents an experimental study of a microphone diaphragm and backplate designed for optical readout and low thermal-mechanical noise. The backplate is 1 mm × 1 mm and is fabricated in a 2-μm-thick epitaxial silicon layer of a silicon-on-insulator wafer and contains a diffraction grating with 4-μm pitch etched at the center. The presented system has a measured thermal-mechanical noise level equal to 22.6 dBA. Through measurement of the electrostatic frequency response and measured noise spectra, a device model for the microphone system is verified. The model is in-turn used to identify design paths towards MEMS microphones with sub 15-dBA noise floors.

  12. Characterization of novel BaZnSnO thin films by solution process and applications in thin film transistors

    Energy Technology Data Exchange (ETDEWEB)

    Li, Jun, E-mail: lijun_yt@163.com [School of Material Science and Engineering, Shanghai University, Jiading, Shanghai 201800 (China); Key Laboratory of Advanced Display and System Applications, Ministry of Education, Shanghai University, Shanghai 200072 (China); Huang, Chuan-Xin [School of Material Science and Engineering, Shanghai University, Jiading, Shanghai 201800 (China); Zhang, Jian-Hua, E-mail: jhzhang@staff.shu.edu.cn [Key Laboratory of Advanced Display and System Applications, Ministry of Education, Shanghai University, Shanghai 200072 (China); Zhu, Wen-Qing; Jiang, Xue-Yin [School of Material Science and Engineering, Shanghai University, Jiading, Shanghai 201800 (China); Zhang, Zhi-Lin [School of Material Science and Engineering, Shanghai University, Jiading, Shanghai 201800 (China); Key Laboratory of Advanced Display and System Applications, Ministry of Education, Shanghai University, Shanghai 200072 (China)

    2015-08-15

    Graphical abstract: This work reports the Ba content on thin film transistor based on a novel BaZnSnO semiconductor using solution process. - Highlights: • No reports about BaZnSnO thin film using solution process. • BaZnSnO thin film transistor (TFT) was firstly fabricated. • BaZnSnO-TFT shows a acceptable performace. • Influence of Ba content on BaZnSnO-TFT. - Abstract: A novel BaZnSnO semiconductor is fabricated using solution process and the influence of Ba addition on the structure, the chemical state of oxygen and electrical performance of BaZnSnO thin films are investigated. A high performance BaZnSnO-based thin film transistor with 15 mol% Ba is obtained, showing a saturation mobility of 1.94 cm{sup 2}/V s, a threshold voltage of 3.6 V, an on/off current ratio of 6.2 × 10{sup 6}, a subthreshold swing of 0.94 V/decade, and a good bias stability. Transistors with solution processed BaZnSnO films are promising candidates for the development of future large-area, low-cost and high-performance electronic devices.

  13. Molecular recognition at methyl methacrylate/n-butyl acrylate (MMA/nBA) monomer unit boundaries of phospholipids at p-MMA/nBA copolymer surfaces.

    Science.gov (United States)

    Yu, Min; Urban, Marek W; Sheng, Yinghong; Leszczynski, Jerzy

    2008-09-16

    Lipid structural features and their interactions with proteins provide a useful vehicle for further advances in membrane proteins research. To mimic one of potential lipid-protein interactions we synthesized poly(methyl methacrylate/ n-butyl acrylate) (p-MMA/nBA) colloidal particles that were stabilized by phospholipid (PLs). Upon the particle coalescence, PL stratification resulted in the formation of surface localized ionic clusters (SLICs). These entities are capable of recognizing MMA/nBA monomer interfaces along the p-MMA/nBA copolymer backbone and form crystalline SLICs at the monomer interface. By utilizing attenuated total reflectance Fourier transform infrared (ATR FT-IR) spectroscopy and selected area electron diffraction (SAD) combined with ab initio calculations, studies were conducted that identified the origin of SLICs as well as their structural features formed on the surface of p-MMA/nBA copolymer films stabilized by 1,2-dilauroyl-sn-glycero-3-phosphocholine (DLPC) PL. Specific entities responsible for SLIC formation are selective noncovalent bonds of anionic phosphate and cationic quaternary ammonium segments of DLPC that interact with two neighboring carbonyl groups of nBA and MMA monomers of the p-MMA/nBA polymer backbone. To the best of our knowledge this is the first example of molecular recognition facilitated by coalescence of copolymer colloidal particles and the ability of PLs to form SLICs at the boundaries of the neighboring MMA and nBA monomer units of the p-MMA/nBA chain. The dominating noncovalent bonds responsible for the molecular recognition is a combination of H-bonding and electrostatic interactions.

  14. Synthesis, crystal and electronic structures of the new Zintl phases Ba3Al3Pn5 (Pn = P, As) and Ba3Ga3P5.

    Science.gov (United States)

    He, Hua; Tyson, Chauntae; Saito, Maia; Bobev, Svilen

    2013-01-01

    The new Zintl compounds Ba(3)Al(3)P(5), Ba(3)Al(3)As(5,) and Ba(3)Ga(3)P(5) have been synthesized using molten metal fluxes. They are isoelectronic and isotypic, crystallizing with a novel rhombohedral structure type in the space group R3c with unit cell constants a = 14.5886(9) Å, c = 28.990(3) Å for Ba(3)Al(3)P(5), a = 14.613(3) Å, c = 28.884(8) Å for Ba(3)Ga(3)P(5), and a = 14.9727(13) Å, c = 29.689(4) Å for Ba(3)Al(3)As(5), respectively. The structures are based on TrPn(4) (Tr = Al, Ga; Pn = P, As) tetrahedra that share both edges and corners, leading to intricate arrangements embodied in the [Tr(4)Pn(9)](15-) and [Tr(3)Pn(6)](9-) strands, interconnected by dimeric [Tr(2)Pn(6)](12-) units. The Ba(2+) cations reside within cylindrical channels within the polyanionic framework and provide the valence electrons needed for Tr-Pn covalent bonding. In spite of the large and complex structure, there are no homoatomic Tr-Tr or Pn-Pn interactions, hence, the structures can be readily rationalized in the context of the Zintl-Klemm formalism as follows [Ba(2+)](3)[Tr(3+)](3)[Pn(3-)](5); calculations on their electronic band-structures confirm this reasoning and reveal about 1.4-1.9 eV energy band gaps, that is, semiconducting behavior. Structural parallels with other known Zintl compounds are also presented.

  15. Normal mode coordinates of high T c superconductors TlCaBa 2Cu 2O 7 and Tl 2CaBa 2Cu 2O 8

    Science.gov (United States)

    Mori, T.; Nakaoka, K.; Onari, S.; Arai, T.

    1989-10-01

    Normal mode coordinates of high Tc superconductors TlCaBa 2Cu 2O 7- (Tl-1122) and Tl 2CaBa 2Cu 2O 8(Tl-2122) are analyzed by the shell model calculations. The model calculations have reproduced very well the observed Raman frequencies. The vibrational frequencies of the oxygens on the CuO 2 layers are found to depend on the ionic charges of the oxygens on the CuO 2 layers.

  16. BA3b and BA1 activate in a serial fashion after median nerve stimulation: direct evidence from combining source analysis of evoked fields and cytoarchitectonic probabilistic maps.

    Science.gov (United States)

    Papadelis, Christos; Eickhoff, Simon B; Zilles, Karl; Ioannides, Andreas A

    2011-01-01

    This study combines source analysis imaging data for early somatosensory processing and the probabilistic cytoarchitectonic maps (PCMs). Human somatosensory evoked fields (SEFs) were recorded by stimulating left and right median nerves. Filtering the recorded responses in different frequency ranges identified the most responsive frequency band. The short-latency averaged SEFs were analyzed using a single equivalent current dipole (ECD) model and magnetic field tomography (MFT). The identified foci of activity were superimposed with PCMs. Two major components of opposite polarity were prominent around 21 and 31 ms. A weak component around 25 ms was also identified. For the most responsive frequency band (50-150 Hz) ECD and MFT revealed one focal source at the contralateral Brodmann area 3b (BA3b) at the peak of N20. The component ~25 ms was localised in Brodmann area 1 (BA1) in 50-150 Hz. By using ECD, focal generators around 28-30 ms located initially in BA3b and 2 ms later to BA1. MFT also revealed two focal sources - one in BA3b and one in BA1 for these latencies. Our results provide direct evidence that the earliest cortical response after median nerve stimulation is generated within the contralateral BA3b. BA1 activation few milliseconds later indicates a serial mode of somatosensory processing within cytoarchitectonic SI subdivisions. Analysis of non-invasive magnetoencephalography (MEG) data and the use of PCMs allow unambiguous and quantitative (probabilistic) interpretation of cytoarchitectonic identity of activated areas following median nerve stimulation, even with the simple ECD model, but only when the model fits the data extremely well.

  17. High-k perovskite gate oxide BaHfO3

    Directory of Open Access Journals (Sweden)

    Young Mo Kim

    2017-01-01

    Full Text Available We have investigated epitaxial BaHfO3 as a high-k perovskite dielectric. From x-ray diffraction measurement, we confirmed the epitaxial growth of BaHfO3 on BaSnO3 and MgO. We measured optical and dielectric properties of the BaHfO3 gate insulator; the optical bandgap, the dielectric constant, and the breakdown field. Furthermore, we fabricated a perovskite heterostructure field effect transistor using epitaxial BaHfO3 as a gate insulator and La-doped BaSnO3 as a channel layer on SrTiO3 substrate. To reduce the threading dislocations and enhance the electrical properties of the channel, an undoped BaSnO3 buffer layer was grown on SrTiO3 substrates before the channel layer deposition. The device exhibited a field effect mobility value of 52.7 cm2 V−1 s−1, a Ion/Ioff ratio higher than 107, and a subthreshold swing value of 0.80 V dec−1. We compare the device performances with those of other field effect transistors based on BaSnO3 channels and different gate oxides.

  18. Effect of Ba in KDP crystal on the wavelength dependence of laser-induced damage

    Institute of Scientific and Technical Information of China (English)

    Hui Gao; Xun Sun; Xinguang Xu; Baoan Liu; Mingxia Xu; Xian Zhao

    2011-01-01

    @@ Ba impurity in potassium dihydrogen phosphate(KDP)is studied with the first-principle simulation method.The relaxed configurations and density of the states of KDP crystal with Ba impurity are calculated.We find that Ba can generate a K vacancy and an interstitial O-H unit for charge compensation.The band gap of KDP crystal narrowed down to about 3.9 eV,which is consistent with the experimental data from previously reported studies and indicates that Ba may be a source of low-damage threshold.%Ba impurity in potassium dihydrogen phosphate (KDP) is studied with the first-principle simulation method. The relaxed configurations and density of the states of KDP crystal with Ba impurity are calculated. We find that Ba can generate a K vacancy and an interstitial O-H unit for charge compensation. The band gap of KDP crystal narrowed down to about 3.9 eV, which is consistent with the experimental data from previously reported studies and indicates that Ba may be a source of low-damage threshold.

  19. The new readout electronics for the BaF2-calorimeter TAPS

    NARCIS (Netherlands)

    Drexler, P; Thoring, U; Bonn, W; van der Duin, HAP; Holzmann, R; van der Kruk, G; Krusche, B; Lohner, H; Metag, [No Value; Nijboer, TW; Novotny, R; Potapov, A; Salz, C; Schadmand, S; Steinacher, M; Thiel, M; Vorenholt, H

    2003-01-01

    A highly compact and fast VME based readout board for BaF2 scintillation detectors has been designed, developed, and finally tested in an in-beam experiment. Adapted to the excellent properties of BaF2, the unit allows to digitize time, energy, and pulse-shape information of four detector channels i

  20. Data of evolutionary structure change: 1JJIA-3H1BA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available hain> 3H1BA WLLDQ----GFKPQ ...>HHH ---- > ATOM 942 CA TRP A 127 -20.677 16.86...Chain>1JJIA WVAENAEELRIDPS ture>HHHH HHHH ...3H1BA LNGAD-AKHPY >H - HH...ure> GGGGG HH> ATOM 1801 CA PHE A 223

  1. Coexistence of symmetric and asymmetric shapes in $^{145}$/Ba, $^{145}$/La

    CERN Document Server

    Hamilton, J H; Jones, E F; Ramayya, A V; Hwang, J K; Gore, P M; Wang, M G; Cole, J D; Collins, W E; Peker, L K

    2000-01-01

    A new region of stable octupole deformation was predicted to occur with its center around the reinforcing shell gaps for beta /sub 3 /~0.15 at Z=56, N=88, and with /sub 56//sup 145/Ba/sub 89/ was predicted to be a prime candidate for stable octupole deformation. Evidence for stable octupole deformation was found in /sup 144/Ba, /sup 146/Ce and expanded to include odd-A /sup 143/Ba and other neighboring isotopes but was not observed in /sup 145/Ba. Recently we found evidence for the rotational enhancement of stable octupole deformation in /sup 145,147/La. In a reinvestigation of /sup 145/Ba, two new bands were discovered that are connected by enhanced, intertwined E1 transitions to two different previously known bands in /sup 145/Ba. These new data support the predicted presence of octupole deformation in /sup 145/Ba, which is rotation-enhanced above about spin 19/2. In both /sup 145/La and /sup 145/Ba, the low spin ground bands are built on a symmetric rotor shape and at intermediate spins there are shifts to...

  2. AMiBA: Cluster Sunyaev-Zel'dovich Effect Observations with the Expanded 13-Element Array

    CERN Document Server

    Lin, Kai-Yang; Wang, Fu-Cheng; Huang, Chih-Wei Locutus; Liao, Yu-Wei; Wu, Jiun-Huei Proty; Koch, Patrick M; Umetsu, Keiichi; Chen, Ming-Tang; Chan, Shun-Hsiang; Chang, Shu-Hao; Chang, Wen-Hsuan Lucky; Cheng, Tai-An; Duy, Hoang Ngoc; Fu, Szu-Yuan; Han, Chih-Chiang; Ho, Solomon; Ho, Ming-Feng; Ho, Paul T P; Huang, Yau-De; Jiang, Homin; Kubo, Derek Y; Li, Chao-Te; Lin, Yu-Chiung; Liu, Guo-Chin; Martin-Cocher, Pierre; Molnar, Sandor M; Nunez, Emmanuel; Oshiro, Peter; Pai, Shang-Ping; Raffin, Philippe; Ridenour, Anthony; Shih, Chia-You; Stoebner, Sara; Teo, Giap-Siong; Yeh, Jia-Long Johnny; Williams, Joshua; Birkinshaw, Mark

    2016-01-01

    The Yuan-Tseh Lee Array for Microwave Background Anisotropy (AMiBA) is a co-planar interferometer array operating at a wavelength of 3mm to measure the Sunyaev-Zeldovich effect (SZE) of galaxy clusters. In the first phase of operation -- with a compact 7-element array with 0.6m antennas (AMiBA-7) -- we observed six clusters at angular scales from 5\\arcmin to 23\\arcmin. Here, we describe the expansion of AMiBA to a 13-element array with 1.2m antennas (AMiBA-13), its subsequent commissioning, and our cluster SZE observing program. The most important changes compared to AMiBA-7 are (1) array re-configuration with baselines ranging from 1.4m to 4.8m covering angular scales from 2\\arcmin to 11.5\\arcmin, (2) thirteen new lightweight carbon-fiber-reinforced plastic (CFRP) 1.2m reflectors, and (3) additional correlators and six new receivers. From the AMiBA-13 SZE observing program, we present here maps of a subset of twelve clusters. In highlights, we combine AMiBA-7 and AMiBA-13 observations of Abell 1689 and perfo...

  3. A facile method for the preparation of Eu{sup 2+}-doped nanocrystalline BaFCl

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Xianglei; Liu, Zhiqiang [School of Physical, Environmental and Mathematical Sciences, The University of New South Wales, UNSW Canberra (ADFA), Canberra, ACT 2600 (Australia); Stevens-Kalceff, Marion A. [School of Physics and Electron Microscope Unit, Mark Wainwright Analytical Centre, The University of New South Wales, Sydney, NSW 2052 (Australia); Riesen, Hans, E-mail: h.riesen@adfa.edu.au [School of Physical, Environmental and Mathematical Sciences, The University of New South Wales, UNSW Canberra (ADFA), Canberra, ACT 2600 (Australia)

    2013-10-15

    Graphical abstract: - Highlights: • A facile co-precipitation method for the preparation of Eu{sup 2+}-doped BaFCl. • Reduction of Eu{sup 3+} to Eu{sup 2+} by zinc granular under nitrogen flow. • Photoluminescence and cathodoluminescence spectroscopy of the as-prepared BaFCl:Eu{sup 2+}. • Temperature dependent photoluminescence properties of Eu{sup 2+} ions in BaFCl. - Abstract: A facile method for the preparation of Eu{sup 2+}-doped BaFCl is reported. The method is based on the co-precipitation of aqueous solutions of BaCl{sub 2} and NH{sub 4}F to yield BaFCl. The doping by europium in the 2+ oxidation state is realized by the reduction of Eu{sup 3+} to Eu{sup 2+} employing granular zinc in the BaCl{sub 2} solution under nitrogen. Powder X-ray diffraction and electron microscopy have been used to confirm the BaFCl phase and photoluminescence, in the temperature range of 2.5–290 K, and room-temperature cathodoluminescence spectra have been measured to characterize the Eu{sup 2+} ions in the sample.

  4. Thermal conductivity of BaPuO 3 at temperatures from 300 to 1500 K

    Science.gov (United States)

    Tanaka, Kosuke; Sato, Isamu; Hirosawa, Takashi; Kurosaki, Ken; Muta, Hiroaki; Yamanaka, Shinsuke

    2011-07-01

    Polycrystalline specimens of barium plutonate, BaPuO 3, have been prepared by mixing the appropriate amounts of PuO 2 and BaCO 3 followed by reacting and sintering at 1600 K under the flowing gas atmosphere of dry-air. The sintered specimens had a single phase of orthorhombic perovskite structure and were crack-free. The Debye temperature of BaPuO 3 was determined from the sound velocity and lattice parameter measurements. The elastic moduli were also determined from the longitudinal and shear sound velocity. The thermal conductivity of BaPuO 3 was calculated from the measured density at room temperature, literature values of heat capacity, and thermal diffusivity measured by a laser flash method in vacuum. The thermal conductivity of BaPuO 3 was roughly independent of the temperature and was almost the same magnitude as that of BaUO 3. This was markedly lower than the conductivities of other perovskite type oxides and was about one-tenth that of UO 2 around room temperature. The temperature dependence of the thermal conductivity of BaPuO 3 was found to be quite similar to that of BaUO 3.

  5. Searches for low-mass Higgs and dark bosons at BaBar

    Energy Technology Data Exchange (ETDEWEB)

    Oberhof, Benjamin, E-mail: benjamin.oberhof@pi.infn.it [INFN sezione di Pisa and Universitá di Pisa, Polo Fibonacci - Edificio C, Largo B. Pontecorvo 3, 56125 - Pisa (Italy)

    2013-01-15

    We present BaBar latest results for the direct search of a light CP-odd Higgs boson using radiative decays of the ϒ(nS) (n=1,2,3) resonances in different final states. We also present the results for the search of a hidden sector gauge and Higgs bosons using the full BaBar datasample.

  6. The new readout electronics for the BaF2-calorimeter TAPS

    NARCIS (Netherlands)

    Drexler, P; Thoring, U; Bonn, W; van der Duin, HAP; Holzmann, R; van der Kruk, G; Krusche, B; Lohner, H; Metag, [No Value; Nijboer, TW; Novotny, R; Potapov, A; Salz, C; Schadmand, S; Steinacher, M; Thiel, M; Vorenholt, H

    A highly compact and fast VME based readout board for BaF2 scintillation detectors has been designed, developed, and finally tested in an in-beam experiment. Adapted to the excellent properties of BaF2, the unit allows to digitize time, energy, and pulse-shape information of four detector channels

  7. Search for low-mass Higgs and dark bosons at BaBar

    OpenAIRE

    Oberhof, Benjamin; Collaboration, for the BABAR

    2012-01-01

    I present BaBar latest results for the direct search of a light CP-odd Higgs boson using radiative decays of the Y(nS) (n=1,2,3) resonances in different final states. I also present the results for the search of a hidden sector gauge and Higgs bosons using the full BaBar datasample.

  8. Bc、Bt、Ba 质粒研究进展%Plasmids Research Progress of Bc,Bt and Ba

    Institute of Scientific and Technical Information of China (English)

    王品舒; 岳瑾; 乔岩; 董杰; 张金良; 袁志强; 杨建国∗

    2013-01-01

      质粒是蜡样芽胞杆菌群中蜡样芽胞杆菌、苏云金芽胞杆菌和炭疽芽胞杆菌呈现出不同表型特征和病理效果的重要原因。本文对三种细菌质粒 Bc、Bt、Ba 的研究进展进行了综述,重点阐述了质粒与毒素的关系、质粒的接合转移、插入序列、代表性质粒的研究进展,分析了质粒研究在公共卫生安全、生物防治及转基因技术发展与应用中的重要作用,最后展望了质粒研究的方向。%  Plasmids have important role in phenotype characteristics and pathological effects of Bacillus cereus( Bc), Bacillus thuringiensis(Bt) and Bacillus anthracis ( Ba). This paper reviewed the research progress of plasmids of the three kinds of Bacillus, in which we mainly elaborated the relationship between the plasmids and the toxin production, plasmids conjugal transfer, inserted sequence, and typical plasmids. We analyzed the important role of plasmids research in public health security, biological control and transgenic technology. Finally, We prospected the direction of the plasmids research.

  9. Enhanced electron mobility in epitaxial (Ba,La)SnO3 films on BaSnO3(001) substrates

    Science.gov (United States)

    Lee, Woong-Jhae; Kim, Hyung Joon; Sohn, Egon; Kim, Tai Hoon; Park, Ju-Young; Park, Woanseo; Jeong, Hyunhak; Lee, Takhee; Kim, Jin Hyeok; Choi, Ki-Young; Kim, Kee Hoon

    2016-02-01

    We report the growth of Ba1-xLaxSnO3 (x = 0.00, 0.005, 0.01, 0.02, and 0.04) thin films on the insulating BaSnO3(001) substrate by pulsed laser deposition. The insulating BaSnO3 substrates were grown by the Cu2O-CuO flux, in which the molar fraction of KClO4 was systematically increased to reduce electron carriers and thus induce a doping induced metal-insulator transition, exhibiting a resistivity increase from ˜10-3 to ˜1012 Ω cm at room temperature. We find that all the Ba1-xLaxSnO3 films are epitaxial, showing good in-plane lattice matching with the substrate as confirmed by X-ray reciprocal space mappings and transmission electron microscopy studies. The Ba1-xLaxSnO3 (x = 0.005-0.04) films showed degenerate semiconducting behavior, and the electron mobility at room temperature reached 100 and 85 cm2 V-1 s-1 at doping levels 1.3 × 1020 and 6.8 × 1019 cm-3, respectively. This work demonstrates that thin perovskite stannate films of high quality can be grown on the BaSnO3(001) substrates for potential applications in transparent electronic devices.

  10. Tsdc and Neutron-Scattering Measurements on Ba1-Xlaxf2+X and Ba1-Xuxf2+2x Solid-Solutions

    DEFF Research Database (Denmark)

    Ouwerkerk, M; Veldkamp, F. F.; Andersen, Niels Hessel

    1985-01-01

    the TSDC spectra showed four reorientation peaks to be present in Ba1−xLaxF2+x, and six in Ba1−xUxF2+2x, along with the relaxation of the macroscopic space charge. The position of a space charge peak shifted to lower temperatures with increasing solute content. The dipolar realaxations were concentration......A study was made of the dynamical behaviour of bound interstitial fluoride ions in disordered Ba1−xLaxF2+x and Ba1−xUxF2+2x solid solutions with Thermally Stimulated Depolarisation Current measurements and neutron scattering measurements, and a combination of both techniques. From 10 K to 400 K...... invariant. In Ba1−xLaxF2+x neutral associates, L-shaped- and (222)- clusters occur. The present study reveals (212)-clusters to be present in Ba1−xUxF2+2x. The relations between ion dynamics and defect structures are discussed....

  11. High-pressure study of the new Y-Ba-Cu-O superconducting compound system

    Science.gov (United States)

    Hor, P. H.; Gao, L.; Meng, R. L.; Huang, Z. J.; Wang, Y. Q.

    1987-01-01

    Hydrostatic effects on the superconducting transition temperature of the Y-Ba-Cu-O compound system, resistively, up to 19 kbar are investigated. It is found that pressure has little effect on the superconducting state of Y-Ba-Cu-O, in marked contrast to the behavior of the K2NiF4-phase La-Ba-Cu-O and La-Sr-Cu-O systems. It is suggested that this effect may be due to chemical pressure associated with the smaller Y atoms already present in Y-Ba-Cu-O. X-ray powder-diffraction studies show that the high-temperature superconductivity in Y-Ba-Cu-O can only be attributed to one or more phases with structures different from the cubic perovskite or tetragonal layered ones.

  12. The Ba813 chromosomal DNA sequence effectively traces the whole Bacillus anthracis community.

    Science.gov (United States)

    Ramisse, V; Patra, G; Vaissaire, J; Mock, M

    1999-08-01

    Plasmid genes that are responsible for virulence of Bacillus anthracis are important targets for the DNA-based detection of anthrax. We evaluated the distribution of the Ba813 chromosomal DNA sequence (Ba813) within closely related Bacillus species. Ba813 was systematically identified from 47 strains or isolates of B. anthracis tested, thus indicating its reliability as a tracer for that species. From the 60 strains of closely related Bacillus spp. examined, three bona fide B. cereus and one bona fide B. thuringiensis were found to harbour Ba813. This marker was also detected in Bacillus sp. isolates that were present at high levels in soil samples collected in a place where an anthrax outbreak had occurred. The significance and the possible function of the Ba813 locus is discussed.

  13. Surface structures and dielectric response of ultrafine BaTiO{sub 3} particles

    Energy Technology Data Exchange (ETDEWEB)

    Jiang, B.; Peng, J.L.; Bursill, L.A

    1998-09-01

    Characteristic differences are observed for the dielectric response and microstructures of BaTiO{sub 3} nanoscale fine powders prepared using sol gel (SG) and steric acid gel (SAG) methods. The former exhibit a critical size below which there is no paraelectric/ferroelectric phase transition whereas BaTiO{sub 3} prepared via the SAG route remained cubic for all conditions. Atomic resolution images of both varieties showed a high density of interesting surface steps and facets. Computer simulated images of surface structure models showed that the outer (100) surface was typically a BaO layer and that at corners and ledges the steps are typically finished with Ba+2 ions; i.e. the surfaces and steps are Ba-rich. Otherwise the surfaces were typically clean and free of amorphous layers. The relationship between the observed surfaces structures and theoretical models for size effects on the dielectric properties is discussed. (authors) 22 refs., 2 tabs., 8 figs.

  14. The Structural Disorder and Lattice Stability of (Ba,Sr)(Co,Fe)O3 Complex Perovskites

    Energy Technology Data Exchange (ETDEWEB)

    S.N.Rashkeev

    2011-05-01

    The structural disorder and lattice stability of complex perovskite (Ba,Sr)(Co,Fe)O3, a promising cathode material for solid oxide fuel cells and oxygen permeation membranes, is explored by means of first principles DFT calculations. It is predicted that Ba and Sr ions easily exchange their lattice positions (A-cation disorder) similarly to Co and Fe ions (B-cation disorder). The cation antisite defects (exchange of A- and B-type cations) have a relatively high formation energy. The BSCF is predicted to exist in an equilibrium mixture of several phases and can decompose exothermically into the Ba- and Co-rich hexagonal (Ba,Sr)CoO3 and Sr- and Fe-rich cubic (Ba,Sr)FeO3 perovskites.

  15. Ab initio structure determination of new compound Ba 3(BO 3)(PO 4)

    Science.gov (United States)

    Ma, H. W.; Liang, J. K.; Wu, L.; Liu, G. Y.; Rao, G. H.; Chen, X. L.

    2004-10-01

    The crystal structure of new compound Ba3BPO7 was determined by ab initio method from high-resolution conventional X-ray powder diffraction data. The Rietveld refinement converged to Rp=5.92%, Rwp=8.87%, Rexp=5.00% with the following details: Hexagonal, space group P63mc, a=5.4898 (1) Å, c=14.7551(1) Å, Z=2. The basic unit of the structure is the [BaO10]-[BO3]-[PO4] polar polyhedra-chain composed of Ba1-B-P-O cluster. These chains, running along c-axis, stack in a HCP mode to build the whole structure with triangular prism channels. The channels are parallel to c-axis too, in which Ba2 and Ba3 are located.

  16. Electron-relaxation-mode interaction in BaTiO3:Nb

    Science.gov (United States)

    Maglione, M.; Belkaoumi, M.

    1992-02-01

    Dielectric relaxation was previously reported in BaTiO3 and BaTiO3:Fe single crystals at radio frequencies [M. Maglione et al., Phys. Rev. B 40, 11 441 (1989)]. We have measured the dielectric dispersion in four BaTiO3:Nb samples (xNb<0.3 at. %) as a function of frequency (10BaTiO3:Nb enhances drastically the relaxation step at all temperatures. In the rhombohedral phase of BaTiO3:Nb (T<180 K), an unusual slowing down of the relaxation motion is measured. The relaxation time increases to more than 10-2 s at 20 K while the relaxation step is temperature independent. The precursor effect of this slowing down is a maximum in the dc conductivity. A simple electron-relaxation-mode coupling model may explain such behavior.

  17. Bound-bound transitions in the emission spectra of Ba$^{+}$--He excimer

    CERN Document Server

    Moroshkin, Peter

    2016-01-01

    We present an experimental and theoretical study of the emission and absorption spectra of the Ba$^{+}$ ions and Ba$^{+\\ast}$He excimer quasimolecules in the cryogenic Ba--He plasma. We observe several new spectral features in the emission spectrum which we assign to the electronic transitions between bound states of the excimer correlating to the 6$^{2}P_{3/2}$ and 5$^{2}D_{3/2,5/2}$ states of Ba$^{+}$. The resulting Ba$^{+}$(5$^{2}D_{J}$)He is a metastable electronically excited complex with orbital angular momentum $L$=2, thus expanding the family of known metal--helium quasimolecules. It might be suitable for high-resolution spectroscopic studies and for the search for new polyatomic exciplex structures.

  18. Bound-bound transitions in the emission spectra of Ba+-He excimer

    Science.gov (United States)

    Moroshkin, P.; Kono, K.

    2016-05-01

    We present an experimental and theoretical study of the emission and absorption spectra of the Ba+ ions and Ba+*He excimer quasimolecules in the cryogenic Ba-He plasma. We observe several spectral features in the emission spectrum, which we assign to the electronic transitions between bound states of the excimer correlating to the 6 2P3 /2 and 5 2D3 /2 ,5 /2 states of Ba+. The resulting Ba+(5 2DJ) He is a metastable electronically excited complex with orbital angular momentum L =2 , thus expanding the family of known metal-helium quasimolecules. It might be suitable for high-resolution spectroscopic studies and for the search for new polyatomic exciplex structures.

  19. Dual preparation of hydrophobic and hydrophilic BaWO{sub 4}:Eu phosphors

    Energy Technology Data Exchange (ETDEWEB)

    Cho, Young-Sik; Huh, Young-Duk, E-mail: ydhuh@dankook.ac.kr

    2016-06-15

    Highlights: • Red-emitting BaWO{sub 4}:Eu phosphors were prepared in hexane-water bilayer system. • The hydrophobic nanometer-sized BaWO{sub 4}:Eu phosphors were obtained in hexane. • The hydrophilic micrometer-sized BaWO{sub 4}:Eu dendrites were obtained in water. - Abstract: BaWO{sub 4}:Eu phosphors were prepared by performing a solvothermal reaction in a water–hexane bilayer system. A barium oleate (and europium oleate) complex was obtained in hexane via a phase transfer reaction involving Ba{sup 2+} (and Eu{sup 3+}) ions in an aqueous solution of sodium oleate. The outer surfaces of the nanometer-sized BaWO{sub 4}:Eu phosphors were capped by the long alkyl chain of oleate; therefore, the hydrophobic nanometer-sized BaWO{sub 4}:Eu phosphors preferentially dissolved in the hexane layer. The micrometer-sized BaWO{sub 4}:Eu phosphors were obtained in the water layer. The BaWO{sub 4}:Eu phosphors prepared in hexane and water yielded sharp strong absorption and emission peaks at 464 and 615 nm, respectively, due to the {sup 7}F{sub 0} → {sup 5}D{sub 2} and the {sup 5}D{sub 0} →{sup 7} F{sub 2} transitions of the Eu{sup 3+} ions. The BaWO{sub 4}:Eu phosphors are good candidate red-emitting phosphors for use in InGaN blue-emitting diodes, which have an emission wavelength of 465 nm.

  20. Ba/Ca Ratios in North Pacific Bamboo Corals Record Changes in Intermediate Water Biogeochemistry

    Science.gov (United States)

    Serrato Marks, G.; LaVigne, M.; Hill, T. M.; Sauthoff, W.; Guilderson, T. P.; Roark, E. B.; Dunbar, R. B.

    2015-12-01

    Trace elemental ratios preserved in the skeleton of bamboo corals, which live for hundreds of years at >500m depth, have been utilized as archives of deep-ocean conditions. However, it was previously unclear whether trace element data from these corals were internally reproducible and could therefore be used as reliable climate proxies. This study tests the internal reproducibility of Ba/Ca in the calcite of nine bamboo corals to further develop a new proxy for dissolved Ba in seawater (BaSW). Trace element LA-ICP-MS data were collected along three replicate radii of varying lengths of the calcitic internodes of well-dated corals collected live from the Gulf of Alaska (720m and 643m) and the California Margin (870m, 1012m, 1295m, 1500m, 1521m, 1954m, and 2054m; samples from 1295-1521m are not yet dated). Data were aligned using visible bands measured with a petrographic microscope to account for irregular growth. Ba/Ca data filtered with a 50μm (1.5-2 year) moving average were reproducible within each coral to 2.9 ± 2.1% (n=3 radii/coral, 9 corals), suggesting that regional geochemical signals are recorded as reproducible Ba/Ca signals on >annual timescales. Coral Ba/Ca presents an excellent proxy for BaSW, which has been found to be correlated with refractory nutrients (e.g. silicate) and oxygen minima. Increasing BaSW with depth and increased variability near 1000m suggests that BaSW is not constant with depth or with time. Several factors, including barite saturation state, particulate organic carbon (POC) remineralization rate, and particle sinking time, may be involved in the observed changes in BaSW. Further examination of such mechanisms could provide new insights into modern changes in deep-sea biogeochemistry.

  1. Dielectric response of polystyrene - BaTiO3 nanocomposites

    Science.gov (United States)

    Korotkova, Tatyana N.; Sysoev, Oleg I.; Belov, Pavel A.; Emelianov, Nikita A.; Velyaev, Yury O.; Mandalawi, Wissam M. Al; Korotkov, Leonid N.

    2016-07-01

    The series of composite materials based on polystyrene and non-ferroelectric BaTiO3 nanoparticles ((1-x)PS-xBT, where the volume concentration x = 0-1.0) was prepared. Their dielectric properties were studied within the temperature range 20-160 °C at the frequency of 100 kHz. It is found that an increase in the barium titanate concentration leads to increase of the both dielectric permittivity (ɛ) and dielectric losses (tgδ). The concentration dependence of ɛ can be described by the modified Kerner model. It was found that the glass transition in polystyrene matrix is diffused and its temperature is increased with concentration x.

  2. Preparation of MMA-BA-DMAEMA Nanosized Latex

    Institute of Scientific and Technical Information of China (English)

    Yu Yang LIU; Mu Jie YANG

    2003-01-01

    The terpolymer latex of methyl methacrylate (MMA)/butyl acrylate (BA)/ dimethyl aminoethyl methacrylate (DMAEMA) with diameter of less than 100 nm was prepared by seeding semi-continuous emulsion copolymerization using APS (ammonium persulfate) / TMEDA (N,N,N, N-tetramethylethylenediamine) as the redox initiators and SDS (sodium dodecylsulfate) and OP (P-octylpolyethylene glycol phenylether) as co-emulsifiers. The factors that influenced the process stability of the copolymerization and the particle size of the latex were investigated. The addition of aqueous ammonia as coagulation inhibitor provided better process stability of the copoly- merization. The addition of acetic acid as the acidification agent caused a remarkable reduction of the latex particle size.

  3. Determination of transition frequencies in a single $^{138}$Ba$^{+}$ ion

    CERN Document Server

    Dijck, E A; Grier, A T; Jungmann, K; Mohanty, A; Valappol, N; Willmann, L

    2015-01-01

    Transition frequencies between low-lying energy levels in a single trapped $^{138}$Ba$^{+}$ ion have been measured with laser spectroscopy referenced to an optical frequency comb. By extracting the frequencies of one-photon and two-photon components of the line shape using an eight-level optical Bloch model, we achieved 0.1 MHz accuracy for the 5d $^{2}$D$_{3/2}$ - 6p $^{2}$P$_{1/2}$ and 6s $^{2}$S$_{1/2}$ - 5d $^{2}$D$_{3/2}$ transition frequencies, and 0.2 MHz for the 6s $^{2}$S$_{1/2}$ - 6p $^{2}$P$_{1/2}$ transition frequency.

  4. Thermoluminescence properties of -irradiated Bi doped BaS nanostructures

    Indian Academy of Sciences (India)

    Surender Singh; Ankush Vij; S P Lochab; Ravi Kumar; Nafa Singh

    2011-07-01

    Bismuth doped barium sulphide nanocrystallities were prepared and characterized by XRD. Thermoluminescence (TL) studies of these samples after exposure to gamma radiation were carried out. The TL glow curve of the phosphors have two peaks at 403 K and 658 K while in their bulk counterparts these peaks were reported at 486 K and 570 K (Rao 1986). We noted that TL intensity increases with gamma exposure time in the range 30 min – 41 h which may be explained on the basis of track interaction model (TIM) and a high surface to volume ratio for the nanostructures. The kinetic parameters at various heating rates namely activation energy (E), order of kinetics (b) and frequency factor (s) of BaS : Bi (0.4 mol%) sample was determined using Chen’s method. The deconvolution of curve was done using the GCD function suggested by Kitis. The effect of different heating rates and different amount of dose has also been discussed.

  5. CP Violation, Mixing and Lifetime Results from BaBar

    CERN Document Server

    Payne, D

    2003-01-01

    The BaBar collaboration has analysed 60M BB_ pairs collected at the Upsilon (4S) resonance at the PEP II asymetric collider at SLAC. Using this data sample we have measured the CP violation parameters sin (2beta)=0.75+/- 0.09 (STAT) +/-0.04 (SYST) and lambda =0.92+/- 0.06 (STAT) +/- 0.02 (SYST) from B0 to cc_+K*0 + c.c. decays. From charmless 2-body B decays we measure A_Kpi =-0.05 +/- 0.06 +/- 0.01(-0.14,+0.05), S_pipi = -0.01 +/- 0.37 +/- 0.07(-0.66,+0.62), C_pipi =-0.02 +/- 0.29 +/- 0.07(-0.54,+0.48). A number of B lifetime and mixing parameters, extracted from subsamples of this data set, are also presented.

  6. Experience with the BaBar Resistive Plate Chambers

    Energy Technology Data Exchange (ETDEWEB)

    Band, H.

    2005-04-06

    The BaBar detector has operated over 2000 m{sup 2} of Resistive Plates Chambers (RPCs) as muon and neutral hadron detectors since 1999. Most of the original RPC production have lost significant efficiency and many are now completely inefficient. Both the linseed oil used to coat the inner surfaces and the graphite coating on the outer surfaces are implicated as contributors to the efficiency loss which was accelerated by the operation of the RPCs at 29 to 34 C during the first summer. RPCs from 2 more recent production runs have been installed and tested. The most recent RPCs have exhibited stable efficiencies and high voltage plateaus during the first 8 months of service. Some have shown increased dark currents and noise rates.

  7. Casa de baño, en Massachusetts

    Directory of Open Access Journals (Sweden)

    Arquitectos Colettl Brothers

    2017-05-01

    Full Text Available Este edificio corresponde a una serie de establecimientos semejantes, a lo largo de la costa del Atlántico, cuya realización se llevará a cabo sucesivamente. En el desarrollo del proyecto se ha tenido la máxima libertad, lo que ha dado lugar a la aparición de una construcción plástica transparente y de indudable belleza. En todo momento, se deja ver que la única misión que ha de cumplir es la de albergar los vestuarios de baño, disponiendo de los servicios necesarios, tales como: conserjería, aseos y parte administrativa.

  8. The magnetic properties of multiferroic BaCoF4

    Directory of Open Access Journals (Sweden)

    Shuang Zhou

    2017-05-01

    Full Text Available Multiferroic barium cobalt fluoride, BaCoF4, has been prepared by hydrothermal method. The antiferromagnetic structure has been confirmed, and the possible weak ferromagnetism due to Dzyaloshinskii-Moriya interaction has been excluded, from the straight line shape of applied magnetic field dependent magnetization (M-H curve without hysteresis loop at low temperature down to 5 K. After cooling under a magnetic field, conspicuous exchange bias effect was observed at low temperature of T<50 K, which was attributed to the exchange coupling between the two phases of different spin configuration. Furthermore, significant magnetodielectric effect was observed at room temperature, which has been interpreted to the magnetic field modified weak interaction between different layers.

  9. O, Na, Ba and Eu abundance patterns in open clusters

    CERN Document Server

    MacLean, B T; Lattanzio, J

    2014-01-01

    Open clusters are historically regarded as single-aged stellar populations representative of star formation within the Galactic disk. Recent literature has questioned this view, based on discrepant Na abundances relative to the field, and concerns about the longevity of bound clusters contributing to a selection bias: perhaps long-lived open clusters are chemically different to the star formation events that contributed to the Galactic disk. We explore a large sample of high resolution Na, O, Ba & Eu abundances from the literature, homogenized as much as reasonable including accounting for NLTE effects, variations in analysis and choice of spectral lines. Compared to a template globular cluster and representative field stars, we find no significant abundance trends, confirming that the process producing the Na-O anti-correlation in globular clusters is not present in open clusters. Furthermore, previously reported Na-enhancement of open clusters is found to be an artefact of NLTE effects, with the open cl...

  10. Positron trapping in BaTiO{sub 3} perovskite

    Energy Technology Data Exchange (ETDEWEB)

    Macchi, C.; Somoza, A. [IFIMAT-UNCentro and Comision de Investigaciones Cientificas de la Provincia de Buenos Aires, Pinto, Tandil (Argentina)]. E-mail: asomoza@exa.unicen.edu.ar; Dupasquier, A. [Istituto Nazionale di Fisica della Materia and Dipartimento di Fisica, Politecnico di Milano, Milan (Italy); Lopez Garcia, A. [Departamento de Fisica, Facultad de Ciencias Exactas, Universidad Nacional de La Plata and Consejo Nacional de Investigaciones Cientificas y Tecnicas, La Plata (Argentina); Castro, M. [INTEMA-Universidad Nacional de Mar del Plata, Mar del Plata (Argentina)

    2001-06-18

    Positron lifetime spectra in BaTiO{sub 3} single crystals were measured at temperatures up to 873 K, also at room temperature after quenching from temperatures up to 473 K. The explored temperature range includes the ferroelectric to paraelectric phase transition. The material displays an irreversible behaviour when heated, with anomalies around T{sub C}. The temperature dependence of the positron lifetime becomes reversible only after annealing above 550 K. The results suggest modifications of the charge state of non-equilibrium vacancies occurring at moderate temperature and microstructural changes taking place at high temperature. The reversible behaviour of the annealed crystal is consistent with thermally activated positron trap formation. (author)

  11. Search for a Light Higgs Boson at BaBar

    CERN Document Server

    Banerjee, Swagato

    2009-01-01

    We search for evidence of a light Higgs boson (A0) in the radiative decays of the narrow Upsilon(3S) resonance: Upsilon(3S) -> gamma A0, where A0 -> invisible or A0 -> mu+mu-. Such an object appears in extensions of the Standard Model, where a light CP-odd Higgs boson naturally couples strongly to b-quarks. We find no evidence for such processes in a sample of 122 million Upsilon(3S) decays collected by the BaBar collaboration at the PEP II B-factory, and set 90% C.L. upper limits on the product of the corresponding branching fractions. We also set a limit on the di-muon branching fraction of the recently discovered eta_b meson.

  12. CVD Diamonds in the BaBar Radiation Monitoring System

    CERN Document Server

    Bruinsma, M; Edwards, A J; Kagan, H; Kass, R; Kirkby, D; Petersen, B A

    2006-01-01

    To prevent excessive radiation damage to its Silicon Vertex Tracker, the BaBar experiment at SLAC uses a radiation monitoring and protection system that triggers a beam abort whenever radiation levels are anomalously high. The existing system, which employs large area Si PIN diodes as radiation sensors, has become increasingly difficult to operate due to radiation damage. We have studied CVD diamond sensors as a potential alternative for these silicon sensors. Two diamond sensors have been routinely used since their installation in the Vertex Tracker in August 2002. The experience with these sensors and a variety of tests in the laboratory have shown CVD diamonds to be a viable solution for dosimetry in high radiation environments. However, our studies have also revealed surprising side-effects.

  13. Chain magnetic polarons in Y-Ba-Cu-O

    CERN Document Server

    Eremenko, V V; Ponomarchuk, V L

    2002-01-01

    The electron self-localization process in a superconducting cuprate paramagnetic compound Y-Ba-Cu-O is studied by the Moessbauer effect technique. It is shown that the electron self-localization in chain sites gives rise to a phase with a local magnetic ordering and a relaxation time more than 10 sup - sup 7 s. Analysis of the accompanying charge redistribution suggests that the electron self-localization creates a pair of exchange interacted electrons which are mainly localized in oxygen sites. Such a quasiparticle, which consists of a pair of antiferromagnetically oriented atomic moments and a pair of self-localized electrons, has an integer spin and may form a Bose-condensate.

  14. Historical materials from the medieval fortress Bač

    Directory of Open Access Journals (Sweden)

    Snežana Petrović

    2007-12-01

    Full Text Available Conservation and restoration of cultural heritage are the objects of great interest worldwide. For setting the correct methodology for the procedures of the restoration it is very important to have the right information about the state of the object and the characteristics of the original materials. The basis of our examinations were clay products (samples of bricks, terracotta and clay roof tile from the middle ages, the fortress in Bač. The following methods were used: x-ray diffraction, classic chemical analysis, SEM-EDS, Hg-porosimetry and dilatometry. Based on the used methods, mineral composition, temperature and regime of firing and textural properties of the examined materials were determined. The degree of destruction of examined materials was also identified, in order to find compatible materials for future techniques of conservation and restoration.

  15. Radiation dosimetry using nano-BaSO{sub 4}:Eu

    Energy Technology Data Exchange (ETDEWEB)

    Pandey, A.; Sharma R, K. [University of Delhi, Department of Physics, Sri Venkateswara College, Benito Juarez Road, Dhaula Kuan, 110021 New Delhi (India); Bahl, S.; Kumar, P. [Medical Physics Unit, IRCH, AIIMS, 110029 New Delhi (India); Pal L, S., E-mail: apandey@svc.ac.in [Inter-University Accelerator Centre, Aruna Asaf Ali Marg, 110067 New Delhi (India)

    2015-10-15

    Nanocrystalline barium sulfate doped with europium (BaSO{sub 4}:Eu) was successfully prepared by the chemical co-precipitation technique and its thermoluminescence (Tl) dosimetry characteristics were studied for gamma radiation. Initially the dopant (Eu) concentration was varied, starting from 0.05 mol % to up to 1.00 mol %, and it was found that the nano phosphor BaSO{sub 4}:Eu with the dopant concentration of 0.2 mol % had the highest sensitivity within the given lot. The nano phosphor was also optimized for its annealing temperature in order to obtain the best results and was thereafter tested for its reusability and fading features. Further the nano phosphor was compared with the commercially available standard Tl dosimeter material LiF:Mg,Ti (popularly referred to as TLD-100) and it was found that the nano phosphor not only had a higher Tl sensitivity compared to the standard material over a wide range of doses but also had a Tl response which was linear even beyond the dose of 1 kGy. Linearity in Tl response to up to such high doses (∼1 kGy) is typical of nanocrystalline Tl phosphors. All the samples were irradiated by Co-60 source (having 1.25 MeV average energy) of gamma radiation. In order to test the energy independence of the nano phosphor (an important characteristic of an ideal Tl dosimeter) further studies are being carried out to examine the response of the nano phosphor to ionizing radiations of different energies. (Author)

  16. Bamboo coral Ba/Ca: Calibration of a new deep ocean refractory nutrient proxy

    Science.gov (United States)

    LaVigne, Michèle; Hill, Tessa M.; Spero, Howard J.; Guilderson, Thomas P.

    2011-12-01

    It is poorly understood how intermediate water masses are affected by decadal scale climate via biogeochemical cycling, export production, and changes in circulation/ventilation. To this end, a geochemical nutrient proxy from deep-sea bamboo corals would provide decadal to centennial scale records of deep and intermediate-water nutrient dynamics. Seawater barium (Ba SW) has a nutrient-like distribution in the water-column (similar to silicate), so Ba/Ca records in foraminifera, shallow water surface corals, and other deep-sea corals have been used to trace refractory nutrients. Here we present the first calibration of a nutrient proxy from skeletal barium preserved in the calcitic internodes of deep-sea bamboo corals, collected from intermediate water depths. A calibration was calculated from a broadly distributed suite of Isidella and Keratoisis corals spanning a silicate and Ba SW gradient (n = 33 corals; 300-2800 m): Ba/Caμmol/mol=0.079±0.008∗Banmol/kg+4.205±0.870r=0.77;n=33 The strong linear correlation between Ba/Ca bamboo coral and Ba SW suggests that coral Ba/Ca is a reliable recorder of seawater barium (and, therefore, silicate). We find a distribution coefficient (D Ba) for Ba/Ca bamboo coral of 1.3 ± 0.2, similar to that of other corals (surface and deep-sea dwelling) and inorganic calcium carbonate precipitation experiments (D Ba = 1.2-1.5). This suggests that Ba incorporation is primarily driven by cationic substitution in bamboo corals and holds promise as a globally applicable refractory nutrient proxy. We find interannual-decadal scale variability in a Ba/Ca bamboo coral timeseries from a California Margin coral (San Juan Seamount; 1295 m). These data suggest that additional high-resolution Ba/Ca bamboo coral records may reveal a connection between regional-scale intermediate water biogeochemistry and low-latitude surface ocean/atmospheric climate.

  17. Effects of Cerium Doping at Ti Sites and Europium Doping at Ba Sites on Dielectric Properties of BaTiO3 Ceramics

    Institute of Scientific and Technical Information of China (English)

    2006-01-01

    Two special rare earth elements cerium and europium were chosen to conduct chemical modification of the BaTiO3 structure. The cold-pressing ceramic processing technique was used to prepare barium titanate ceramics doped with Ce at Ti sites and with Eu at Ba sites on the base of formulas Ba(Ti1-xCex)O3(x=0.05, 0.10)(CBT) and(Ba1-yEuy)Ti1-y/8O3(y=0.05, 0.10)(EBT). Associated with structures and microstructures, the effects of cerium and europium doping on dielectric properties of BaTiO3 ceramics were discussed. The CBT ceramics exhibit a pseudo-cubic perovskite structure, while the EBT ceramics exhibit a tetragonal perovskite structure with the exception of the existence of a small percentage of the Eu2Ti2O7 phase. The Curie peak of BaTiO3 shifts towards room temperature at rates of 3 ℃/mol Ce atoms and 10 ℃/mol Eu atoms(Eu≤5%), respectively. Compared with the CBT ceramics, the EBT ceramics show significant advantages, such as a narrow fine grain size distribution(1 μm), a lower porosity and a higher density(5.85 g/cm3), more stable dielectric-temperature dependence(ε'=1600-1800 at t<50 ℃) and a lower dissipation factor(<0.05). The stability of dielectric constant with frequency in BaTiO3 can extend to 107 Hz due to Ce and Eu doping.

  18. Thickness-dependent dielectric properties of nanoscale Pt/(Pb,Ba)ZrO 3/BaPbO 3 capacitors

    Science.gov (United States)

    Wu, Lin-Jung; Wu, Jenn-Ming

    2007-10-01

    Lead barium zirconate (PBZ) thin films on BaPbO 3(BPO)/Pt/Ti/SiO 2/Si substrates have been prepared by rf-magnetron sputtering at 500 °C. The orientation of PBZ film changes from random to (1 1 1)-prefer oriented when the thickness increases. The grain size increases with increasing PBZ thickness. The dielectric properties are greatly suppressed when the thickness of dielectrics decreases. The dielectric constant and tunability decrease from 536% and 49.1% to 205% and 22.7%, respectively, when the thickness of PBZ decreases from 323 to 62 nm. The origins of the collapsed dielectric behavior are discussed. The variation of dielectric properties with film thickness can be interpreted by (a) antiferroelectric layer at PBZ/BPO interface, (b) dead layer at Pt/PBZ interface, and (c) grain boundary dead layers.

  19. BaMnO3 and Ba1/2Sr1/2MnO3 Nanoparticles Synthesized by CHM Method%CHM法合成BaMnO3、Ba1/2Sr1/2MnO3纳米晶体

    Institute of Scientific and Technical Information of China (English)

    夏川茴; 胡陈果; 韩向宇; 王娜; 张祖伟

    2008-01-01

    采用复合碱媒介法(CHM),以BaCl和MnO2为原料在200 ℃、24 h的生长条件下合成了纳米BaMnO3单晶颗粒.采用同样方法,以Sr(NO3)2、BaCO3以及MnO2为原料,在200 ℃、24 h的生长条件下,用50%的Sr替代50%的Ba,成功合成了Ba1/2Sr1/2MnO3.用X射线衍射仪(XRD)、扫描电镜(SEM)及能量散射X射线谱(EDS)对产物的晶相、形貌和成分进行了分析,并且解释了BaMnO3及Ba1/2Sr1/2MnO3的生长机理.

  20. Mitochondrial decay is involved in BaP-induced cervical damage.

    Science.gov (United States)

    Gao, Meili; Long, Jiangang; Li, Yongfei; Shah, Walayat; Fu, Ling; Liu, Jiankang; Wang, Yili

    2010-12-01

    Benzo[a]pyrene (BaP) is a polycyclic aromatic hydrocarbon and a potent inducer of carcinogenesis. Many studies have reported that the carcinogenic effects of BaP might be due to its intermediate metabolites and to reactive oxygen species (ROS) that cause oxidative damage to the cells. However, the mechanisms of BaP-induced oxidative damage in cervical tissue are still not clear. We studied these mechanisms in female ICR mice treated with BaP either orally or intraperitoneally by measuring (1) several general biomarkers of oxidative stress in serum, (2) mitochondrial function in the cervix, and (3) the morphology of mitochondria in cervical tissue. BaP treatment (1) significantly lowered levels of vitamins A, C, and E and of glutathione; (2) reduced activities of superoxide dismutase, catalase, glutathione peroxidase, and glutathione S-transferases; and (3) significantly increased lipid peroxidation levels. In addition, significant increases in the levels of superoxide anion, hydrogen peroxide, and hydroxyl radical were observed. These results were confirmed by morphological changes in mitochondria and by decreases in membrane potential levels and in succinate dehydrogenase and malate dehydrogenase activities. The changes in these biomarkers and mitochondrial damage were BaP-dose-dependent and eventually induced both cell apoptosis and necrosis in cervical tissue. As mitochondria are the major sites of ROS generation, these findings show that mitochondrial decay greatly contributes to BaP-induced cervical damage.

  1. Thermodynamic stability of radiogenic Ba in CsAlSi2O6 pollucite

    Science.gov (United States)

    Jaffe, John; van Ginhoven, Renée; Jiang, Weilin

    2013-03-01

    Pollucite, a zeolite-like nanoporous aluminosilicate structure with nominal composition CsAlSi2O6, has been suggested as a nuclear waste storage form for fission-product radioactive isotopes of cesium, especially 137Cs. One factor affecting the long-term stability of this waste form is the valence change associated with the beta decay that converts Cs into barium. We have used first-principles density functional total energy calculations to evaluate the thermodynamic stability of pollucite with Ba replacing Cs at regular lattice sites with respect to the precipitation of Ba, Cs or their oxides. We included small clusters of substitutional BaCs as well as localized complexes of BaCs with compensating electron donor defects, specifically Cs vacancies and interstitial oxygen. We conclude that Cs-Ba pollucite is thermodynamically stable against precipitation of Cs or its oxide, but that partial precipitation of Ba or BaO may be thermodynamically favored under some conditions. Even this change may be kinetically limited, however. Fuel Cycle Research and Development, U.S. Department of Energy Waste Form Campaign

  2. Hemostatic effects of recombinant DisBa-01, a disintegrin from Bothrops alternatus.

    Science.gov (United States)

    Kauskot, Alexandre; Cominetti, Marcia R; Ramos, Oscar H P; Bechyne, Iga; Renard, Jean-Marie; Hoylaerts, Marc F; Crepin, Michel; Legrand, Chantal; Selistre-de-Araujo, Heloisa S; Bonnefoy, Arnaud

    2008-05-01

    A monomeric RGD-disintegrin was recently identified from a cDNA library from the venom gland of Bothrops alternatus. The corresponding 12 kDa-recombinant protein, DisBa-01, specifically interacted with alpha(v)beta3 integrin and displayed potent anti-metastatic and anti-angiogenic properties. Here, the interaction of DisBa-01 with platelet alphaIIb beta3 integrin and its effects on hemostasis and thrombosis were investigated. DisBa-01 bound to Chinese Hamster Ovary (CHO) cells expressing beta3 or alphaIIb beta3 and promoted their adhesion and the adhesion of resting platelets onto glass coverslips. The disintegrin inhibited the binding of FITC-fibrinogen and FITC-PAC-1 to ADP-stimulated platelets and inhibited ADP-, TRAP- and collagen-induced aggregation of murine, rabbit or human platelets. In a flow chamber assay, DisBa-01 inhibited and reverted platelet adhesion to immobilized fibrinogen. DisBa-01 inhibited the phosphorylation of FAK following platelet activation. The intravenous injection of DisBa-01 in C57Bl6/j mice, prolonged tail bleeding time as well as thrombotic occlusion time in mesenteric venules and arterioles following vessel injury with FeCl3. In conclusion, DisBa-01 antagonizes the platelet alphaIIb beta3 integrin and potently inhibits thrombosis.

  3. Effects of induced optical tunable and ferromagnetic behaviors of Ba doped nanocrystalline LaB6.

    Science.gov (United States)

    Bao, Lihong; Qi, Xiaoping; Tana; Chao, Lumen; Tegus, O

    2016-07-28

    Multiple nanocrystalline rare-earth hexaborides La1-xBaxB6 have been synthesized via a single step solid-state reaction. The Ba doping effects on crystal structure, grain morphology, magnetic and optical absorption properties were investigated using XRD, FESEM, HRTEM, SQUID magnetometry and optical measurements. The results show that all the Ba-doped hexaborides crystallize in the CsCl-type single phase, indicating the Ba atoms occupied the lattice sites of LaB6. The optical absorption results indicate that the absorption valleys of LaB6 are red-shifted from 622 nm to 780 nm when the Ba doping content increases to x = 0.8. The first-principle calculation results reveal that Ba doping reduces the total kinetic energy of the electrons of LaB6, which lead to the absorption valleys moving toward a higher wavelength. Meanwhile, the band gap of BaB6 obtained from optical absorption is in good agreement with the theoretical calculation results. The magnetic measurements results showed that Ba doping lead to room-temperature ferromagnetism of LaB6 due to the different ionic radii of La(3+) and Ba(2+) causing intrinsic crystal defects, which is directly observed experimentally by HRTEM. This is the first time that we have found the tunable optical and ferromagnetic behavior of Ba doped nanocrystalline LaB6. Thus, nanocrystalline La1-xBaxB6, as multi-functional materials, should open up a new route to extend the optical and magnetic applications of LaB6 nanopowder.

  4. Rapid preparation of ultrafine BaSO{sub 3} by SO{sub 2} storage material

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Fei; Sha, Feng; Qiao, Xian Shu; Zhao, Tian Xiang; Guo, Bo; Zhang, Jian Bin [College of Chemical Engineering, Inner Mongolia University of Technology, Huhhot (Korea, Republic of)

    2017-01-15

    In this work, a green and efficient process was developed for the preparation of ultrafine BaSO{sub 3} with layered nanostructure surface via the reaction of BaCl{sub 2} with a SO{sub 2} storage material (SO{sub 2}SM) at room temperature. The absorption of SO{sub 2} with equimolar ethylenediamine (EDA) and ethylene glycol (EG) afforded SO{sub 2}SM, which not only offered alkyl sulfite but also released EDA and EG that served as efficient surfactants to promote the formation of BaSO{sub 3} with spherical morphology and porous structure in the process of synthesis of ultrafine BaSO{sub 3}. The factors affecting the morphology and size of BaSO{sub 3} particle were assessed by investigating the effects of SO{sub 2}SM concentration, BaCl{sub 2} concentration, stirring time and speed. It was found that a higher SO{sub 2}SM concentration led to a higher degree of supersaturation, and the particle size of BaSO{sub 3} could be reduced by increasing SO{sub 2}SM concentration. Moreover, under the identified optimal reaction conditions, ultrafine BaSO{sub 3} was obtained with an average diameter of 450 nm. In addition, a plausible formation process of BaSO{sub 3} was proposed to explain the observed reaction results. Overall, the developed process in this work provides an efficient method for the capture, utilization, and conversion of SO{sub 2} into a valuable chemical.

  5. Adsorption removal of Sr by Barium impregnated 4A Zeolite(BaA) from high radioactive seawater waste

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Eil Hee; Lee, Keun Young; Kim, Kwang Wook; Kim, Ik Soo; Chung, Dong Yong; Moon, Jei Kwon; Choi, Jong Won [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of)

    2016-06-15

    This study investigated the removal of Sr, which was one of the high radioactive nuclides, by adsorption with Barium (Ba) impregnated 4A zeolite (BaA) from high-radioactive seawater waste (HSW). Adsorption of Sr by BaA (BaA-Sr), in the impregnated Ba concentration of above 20.2wt%, was decreased by increasing the impregnated Ba concentration, and the impregnated Ba concentration was suitable at 20.2wt%. The BaA-Sr adsorption was added to the co-precipitation of Sr with BaSO4 precipitation in the adsorption of Sr by 4A (4A-Sr) within BaA. Thus, it was possible to remove Sr more than 99% at m/V (adsorbent weight/solution volume)=5 g/L for BaA and m/V >20 g/L for 4A, respectively, in the Sr concentration of less than 0.2 mg/L (actual concentration level of Sr in HSW). It shows that BaA-Sr adsorption is better than 4A-Sr adsorption in for the removal capacity of Sr per unit gram of adsorbent, and the reduction of the secondary solid waste generation (spent adsorbent etc.). Also, BaA-Sr adsorption was more excellent removal capacity of Sr in the seawater waste than distilled water. Therefore, it seems to be effective for the direct removal of Sr from HSW. On the other hand, the adsorption of Cs by BaA (BaA-Cs) was mainly performed by 4A within BaA. Accordingly, it seems to be little effect of impregnated Ba into BaA. Meanwhile, BaA-Sr adsorption kinetics could be expressed the pseudosecond order rate equation. By increasing the initial Sr concentrations and the ratios of V/m, the adsorption rate constants (k2) were decreased, but the equilibrium adsorption capacities (qe) were increasing. However, with increasing the temperature of solution, k2 was conversely increased, and qe was decreased. The activation energy of BaA-Sr adsorption was 38 kJ/mol. Thus, the chemical adsorption seems to be dominant rather than physical adsorption, although it is not a chemisorption with strong bonding form.

  6. Dielectric Behavior of BaTiO3/PVDF Nanocomposites In-situ Synthesized by the Sol-Gel Method

    Institute of Scientific and Technical Information of China (English)

    DONG Li-jie; XIONG Chuan-xi; CHEN Juan; NAN Ce-wen

    2004-01-01

    BaTiO3/ PVDF nanocomposites were prepared via in-situ growth of nanosized BaTiO3 particlesin PVDF matrix by using the solgel method. The present elements of BaTiO3/ PVDF nanocomposites were ana-lyzed by an electron probe X-ray microanalyser. Nanosized BaTiO3 grown in the composite films was characterizedby an X-ray diffractometer and a transmission electron microscope, and the dielectric properties of the compositefilms were measured. The distribution of BaTiO3 nanoparticles in-situ grown in the PVDF matrix was examined us-ing a scanning electron microscope.

  7. Does BaYF{sub 5} nanocrystals exist? – The BaF{sub 2}-YF{sub 3} solid solution revisited using photoluminescence spectroscopy

    Energy Technology Data Exchange (ETDEWEB)

    Karbowiak, Mirosław, E-mail: miroslaw.karbowiak@chem.uni.wroc.pl; Cichos, Jakub

    2016-07-15

    During thermolysis of metal trifluoroacetates in high boiling organic solvents the two Ba{sub 1−x}RE{sub x}F{sub 2+x} phases with cubic fluorite-type structure are formed in BaF{sub 2}-YF{sub 3} system. In contrast to previous reports formation of so-called ‘BaYF{sub 5}’ nanocrystals was not observed. Besides the X-ray diffraction analysis the samples doped with optically active Eu{sup 3+} and Er{sup 3+} ions were characterized with photoluminescence spectroscopy and results provided by both methods corroborates each other. Upconversion emission observed under excitation at 980 nm for the Ba{sub 1−x}Y{sub x}F{sub 2+x} phase co-doped with Yb{sup 3+} and Er{sup 3+} ions is strongly composition dependent. Its intensity increases with increasing of REF{sub 3} content for 0.2 < x < 0.45, whereas the opposite trend is evident for x > 0.45 and upconversion emission is totally quenched for x > 0.6. The important outcome of the present study is that compositions other than that with x = 0.5 should be probed to fully benefit from photoluminescence potential of Ba{sub 1−x}RE{sub x}F{sub 2+x} nanofluoride phases activated with lanthanide ions. - Highlights: • PL spectroscopy is a reliable tool for identification of phases formed in BaF{sub 2}-REF{sub 3} system. • Ba{sub 1−x}RE{sub x}F{sub 2+x} nanofluoride phases with fluorite-type structure are formed during thermolysis. • In contrast to previous reports formation of so-called ‘BaREF{sub 5}’ nanocrystals was not observed. • The highest PL intensity is observed for Ba{sub 1−x}RE{sub x}F{sub 2+x} compositions other than that with x = 0.5.

  8. Dendrite crystal morphology evolution mechanism of β-BaB2O4 crystal

    Institute of Scientific and Technical Information of China (English)

    HE ChongJun; ZHONG WeiZhuo; LIU YouWen

    2009-01-01

    Existence of [B3-O6]3- hexagonal ring growth unit in melt solution of β-BaB2O4 crystal was proved by the results of high temperature Raman measurements. A morphology evolution process of β-BaB2O4 crys-tal was observed by a high temperature in-situ observation device. The crystal morphology varied with the supersaturation of growth melt solution. The mechanism of β-BaB2O4 crystal morphology evolution was analyzed through the growth unit model.

  9. Dendrite crystal morphology evolution mechanism of β-BaB2O4 crystal

    Institute of Scientific and Technical Information of China (English)

    2009-01-01

    Existence of [B3-O6]3- hexagonal ring growth unit in melt solution of β-BaB2O4 crystal was proved by the results of high temperature Raman measurements.A morphology evolution process of β-BaB2O4 crys-tal was observed by a high temperature in-situ observation device.The crystal morphology varied with the supersaturation of growth melt solution.The mechanism of β-BaB2O4 crystal morphology evolution was analyzed through the growth unit model.

  10. Vibrational spectra of (BaF2)n (n=1-6) clusters

    Science.gov (United States)

    Pandey, Ratnesh K.; Waters, Kevin; Nigam, Sandeep; Pandey, Ravindra; Pandey, Avinash C.

    2016-05-01

    The vibrational properties of alkaline-earth metal fluoride clusters (BaF2)n (n=1-6) are investigated in the framework of density functional theory. The calculated Raman and Infrared (IR) spectra reveals shift in Raman and IR peak position towards lower frequency region with the increase in the cluster size. Further the calculated spectra have been compared with the experimental vibrational spectra of bulk BaF2 crystal. Even though the smaller size cluster lacks translational symmetry, the structural and vibrational characteristic of (BaF2)5-6 are nearer to bulk counterpart.

  11. Climate, productivity, and intermediate water nutrients: new records from bamboo coral Ba/Ca

    Science.gov (United States)

    Lavigne, M.; Hill, T. M.; Spero, H. J.; Guilderson, T. P.

    2010-12-01

    A geochemical nutrient proxy from deep-sea corals would provide decadal to centennial scale records of intermediate-water nutrient dynamics. Such records could be used to determine how intermediate water masses (300-2000m) are affected by decadal scale climate change (e.g. Pacific Decadal Oscillation) via carbon cycling, export production, and intermediate water-mass circulation/ventilation. Because seawater barium (BaSW ) has a nutrient-like distribution in the water-column (similar to silicate), Ba/Ca records have been used to trace upwelled nutrient supply in shallow water surface corals isolated from terrestrial barium sources. Here we show the first calibration of a nutrient proxy from skeletal barium preserved in the calcitic internodes of bamboo corals. Our calibration was calculated from a depth transect (500-2000m) of Isidella and Keratoisis corals spanning a silicate and (BaSW ) gradient on the California Margin (Ba/Ca coral (µmol/mol) = 0.117 BaSW (nmol/kg ) + 0.835; R2 = 0.88; n = 29). The strong linear correlation between Ba/Ca coral and BaSW suggests that coral Ba/Ca is a reliable recorder of seawater barium (and, therefore, silicate). We find a distribution coefficient (DBa) for bamboo coral Ba/Ca of 1.3±0.1, similar to that of other corals (surface and deep-sea dwelling) and inorganic calcium carbonate precipitation experiments (DBa = 1.2-1.5). This implies that, as true for other carbonates, Ba incorporation is primarily driven by ionic substitution and holds promise as a globally applicable nutrient proxy in bamboo corals. High-resolution Ba/Ca timeseries records sampled via LA-ICP-MS in two co-located California Margin corals (Pioneer Seamount; 830m; 37°22’27”N) co-vary with ~decadal-scale variations in silicate and nitrate measured at 500m depth (CalCOFI line 80 sta. 60; 34°8’60”N). This suggests that high-resolution records of bamboo coral Ba/Ca can be used to reconstruct broad changes in intermediate water nutrients driven by

  12. Study of the flavour changing neutral current beta-s gamma at BaBar

    CERN Document Server

    Smith, D

    2002-01-01

    The main theme of this thesis, is a monte-carlo analysis of the rare Flavour Changing Neutral Current (FCNC) decay b -> s gamma. The analysis develops techniques that could be applied to real data, to discriminate between signal and background events in order to make a measurement of the branching ratio of this rare decay using the BaBar detector. Also included in this thesis is a description of the BaBar detector and the work I have undertaken in the development of the electronic data acquisition system for the Electromagnetic Calorimeter (EMC), a subsystem of the BaBar detector.

  13. Metrological activity determination of 133Ba by sum-peak absolute method

    Science.gov (United States)

    da Silva, R. L.; de Almeida, M. C. M.; Delgado, J. U.; Poledna, R.; Santos, A.; de Veras, E. V.; Rangel, J.; Trindade, O. L.

    2016-07-01

    The National Laboratory for Metrology of Ionizing Radiation provides gamma sources of radionuclide and standardized in activity with reduced uncertainties. Relative methods require standards to determine the sample activity while the absolute methods, as sum-peak, not. The activity is obtained directly with good accuracy and low uncertainties. 133Ba is used in research laboratories and on calibration of detectors for analysis in different work areas. Classical absolute methods don't calibrate 133Ba due to its complex decay scheme. The sum-peak method using gamma spectrometry with germanium detector standardizes 133Ba samples. Uncertainties lower than 1% to activity results were obtained.

  14. Superconductivity in novel Ge-based skutterudites: {Sr,Ba}pt4Ge12.

    Science.gov (United States)

    Bauer, E; Grytsiv, A; Chen, Xing-Qiu; Melnychenko-Koblyuk, N; Hilscher, G; Kaldarar, H; Michor, H; Royanian, E; Giester, G; Rotter, M; Podloucky, R; Rogl, P

    2007-11-23

    Combining experiments and ab initio models we report on SrPt4Ge12 and BaPt4Ge12 as members of a novel class of superconducting skutterudites, where Sr or Ba atoms stabilize a framework entirely formed by Ge atoms. Below T(c)=5.35 and 5.10 K for BaPt4Ge12 and SrPt4Ge12, respectively, electron-phonon coupled superconductivity emerges, ascribed to intrinsic features of the Pt-Ge framework, where Ge-p states dominate the electronic structure at the Fermi energy.

  15. Direct writing of three-dimensional woodpile BaTiO3 structures

    Science.gov (United States)

    Li, Jijiao; Li, Bo; Wu, Hongya; Zhou, Ji

    2014-05-01

    Barium titanate (BaTiO3) woodpile structures with designed, three-dimensional (3D) geometry have been fabricated by direct-writing assembly techniques. Concentrated BaTiO3 inks with suitable rheological properties were prepared to enable the fabrication of the complex 3D structures. It was demonstrated that BaTiO3 inks with a total solids volume fraction of 0.41 are shear thinning and have a high storage modulus 1 × 105Pa with a yield stress of 300 Pa. Additionally, the woodpile lattice structures exhibited an excellent self-supporting feature.

  16. Ferroelectric control of magnetism in BaTiO3/Fe heterostructures via interface strain coupling

    Science.gov (United States)

    Sahoo, Sarbeswar; Polisetty, Srinivas; Duan, Chun-Gang; Jaswal, Sitaram S.; Tsymbal, Evgeny Y.; Binek, Christian

    2007-09-01

    Reversible control of magnetism is reported for a Fe thin film in proximity of a BaTiO3 single crystal. Large magnetization changes emerge in response to ferroelectric switching and structural transitions of BaTiO3 controlled by applied electric fields and temperature, respectively. Interface strain coupling is the primary mechanism altering the induced magnetic anisotropy. As a result, coercivity changes up to 120% occur between the various structural states of BaTiO3 . Up to 20% coercivity change is achieved via electrical control at room temperature. Our all solid state ferroelectric-ferromagnetic heterostructures open viable possibilities for technological applications.

  17. Calibration of a 2D-CDB spectrometer using a reference {sup 133}Ba source

    Energy Technology Data Exchange (ETDEWEB)

    Macchi, C. [Dipartimento di Fisica, Universita di Trento, Via Sommarive 14, I-38050 Povo, Trento (Italy) and IFIMAT, Facultad de Ciencias Exactas, UNICEN, Pinto 399, B7000GHG Tandil, Argentina. (Argentina)]. E-mail: cmacchi@exa.unicen.edu.ar; Karwasz, G.P. [Dipartimento di Fisica, Universita di Trento, Via Sommarive 14, I-38050 Povo, Trento (Italy); Facolta di Ingegneria, Universita di Trento, I-38050 Mesiano, Trento (Italy); Somoza, A. [IFIMAT, Facultad de Ciencias Exactas, UNICEN, Pinto 399, B7000GHG Tandil (Argentina); Comision de Investigaciones Cientificas de la Provincia de Buenos Aires (Argentina); Brusa, R.S. [Dipartimento di Fisica, Universita di Trento, Via Sommarive 14, I-38050 Povo, Trento (Italy)

    2007-02-15

    A procedure for calibrating a FAST-ComTec 2D-CDB spectrometer using a {sup 133}Ba source is presented. The energy calibration consisted of acquiring two-dimensional (2D) spectra by measuring simultaneously with two HPGe detectors the 356 and 511 keV peaks. As the {sup 133}Ba source only emits one photon per decay, the Ba contribution to the 2D spectra was built up by taking two successive and uncorrelated events, i.e. one from each detector (pseudo-coincidence technique). The FWHM of the spectrometer was estimated from the E {sub 1}=E {sub 2} diagonal of the spectra.

  18. Phonon modes in Gd1-xCexBa2Cu3O7-δ

    Directory of Open Access Journals (Sweden)

    SH Mozaffari

    2009-08-01

    Full Text Available  XRD and Raman analyses were performed to probe the phase formation and the variation of the normal phonon frequencies of the high temperature superconductor GdBa2Cu3O7-δ upon Ce doping. It was found that in addition to the orthorhombic 123 phase, some nonsuperconducting peaks, which are mainly due to the BaCeO3 secondary phase, are also formed that suppress the superconducting transition temperature. Besides, analysis of the Raman peaks shows that substitutions of Ce for Gd in GdBa2Cu3O7-δ are restricted to low concentrations in favor of impurity island formation .

  19. A Novel Process for Synthesis of Ultrafine BaTiO3 Powders

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    A novel process termed low-temperature combustion-synthesis (LCS) of Ba(NO3)-TiO-C6H8O7H2O system was investigated at the initial temperature of 600℃ and ultrafine BaTiO3 powders with a particle size of 200€?350nm were prepared. It was found that the molar ratio of NO/citric acid and the homogeneity of combustion have remarkable effect on the characteristics of the powder. The reaction mechanism of LCS BaTiO3 powders was proposed on the basis of thermodynamic analysis.

  20. KloKunst. bañarte // toil-et-art

    OpenAIRE

    2010-01-01

    Das Wort "Toil-et-art-" ist eine Mischung aus dem englischen 'Toilet's Art' und dem französischen 'et art'. Auch das Wort 'Bañ@rte' ist auf Spanisch eine Kombination aus den Wörtern 'Baño' und 'Arte'. Indem man die Vokabeln 'o' und 'a' für das Zeichen '@' ersetzt, verbindet man beide Worte. Daraus entsteht das Wort "Bañarte", das zweideutig ist: einerseits deutet es auf die Kunst auf dem Klo, also KloKunst, und andererseits bedeutet es 'sich duschen', konjugiert in der zweiten Person Singula...

  1. Evidence of diffusion at BaTiO{sub 3}/silicon interfaces

    Energy Technology Data Exchange (ETDEWEB)

    Chung, U-C., E-mail: chungseu@icmcb-bordeaux.cnrs.fr [ICMCB - CNRS, Universite Bordeaux, 87 Avenue du Dr A. Schweitzer, F-33608 Pessac cedex (France); Michau, D., E-mail: d.michau@icmcb-bordeaux.cnrs.fr [ICMCB - CNRS, Universite Bordeaux, 87 Avenue du Dr A. Schweitzer, F-33608 Pessac cedex (France); Elissalde, C., E-mail: elissald@icmcb-bordeaux.cnrs.fr [ICMCB - CNRS, Universite Bordeaux, 87 Avenue du Dr A. Schweitzer, F-33608 Pessac cedex (France); Li, S., E-mail: sli@surface.tu-darmstadt.de [Darmstadt University of Technology, Institute of Materials Science, Surface Science Division, Building L1/08, Petersenstrasse 32, 64287 Darmstadt (Germany); Klein, A., E-mail: aklein@surface.tu-darmstadt.de [Darmstadt University of Technology, Institute of Materials Science, Surface Science Division, Building L1/08, Petersenstrasse 32, 64287 Darmstadt (Germany); Maglione, M., E-mail: maglione@icmcb-bordeaux.cnrs.fr [ICMCB - CNRS, Universite Bordeaux, 87 Avenue du Dr A. Schweitzer, F-33608 Pessac cedex (France)

    2012-01-01

    Interdiffusion at interfaces between several materials in integrated structures is becoming more and more challenging. We performed a deep study of diffusion in BaTiO{sub 3}/Si films using X-Ray Diffraction analysis, Rutherford Backscattering Spectrometry and X-ray Photoelectron Spectroscopy at intermediate annealing stages. We show that controlling local chemistry through inter-diffusion phenomena at interfaces is possible thanks to the structural and chemical matching between BaTiO{sub 3} and fresnoite. BaTiO{sub 3}/Si stacks can serve as a model system to investigate the interphase generation at interfaces.

  2. Addendum: Safety Standards for Gua sha (press-stroking) and Ba guan (cupping).

    Science.gov (United States)

    Nielsen, Arya; Kligler, Ben; Koll, Brian S

    2014-06-01

    Our previous article Safety Standards for Gua sha (press-stroking) and Baguan (cupping) discussed the risk of transfer of blood-borne pathogens with Gua sha and Ba guan, identified Gua sha and Ba guan 'instrument criticality' as semi-critical and offered recommendations for safe practice based on hospital disinfection standards. Based on the article's feedback, we feel the need to clarify that Gua sha and Ba guan instruments, if intended for reuse, must undergo high level disinfection (HLD) or, in the case of 'wet-cupping', sterilization. We update our recommendations to be amenable to both private practice and education settings.

  3. Target characterization for the 130Ba(alpha,gamma)134Ce gamma-process experiment

    CERN Document Server

    Gyürky, Gy; Farkas, J; Fülöp, Zs; Somorjai, E; Szücs, T

    2011-01-01

    In order to extend the available experimental database for the astrophysical gamma-process, the cross section measurement of the 130Ba(alpha,gamma)134Ce and 130Ba(alpha,n)133Ce reactions is in progress. The measurements are carried out using thin layers of evaporated BaCO3 as target. Since the target thickness enters directly into the calculation of the cross sections, the reliability of its determination is of crucial importance. Three different methods have been used to determine the target thickness. Details of these experiments and the obtained results are presented.

  4. Metrological activity determination of {sup 133}Ba by sum-peak absolute method

    Energy Technology Data Exchange (ETDEWEB)

    Silva, R.L. da; Delgado, J.U.; Poledna, R.; Santos, A.; Veras, E.V. de; Rangel, J.; Trindade, O.L. [Instituto de Radioprotecao e Dosimetria (IRD/CNEN-RJ), Rio de Janeiro, RJ (Brazil); Almeida, M.C.M. de, E-mail: marcandida@yahoo.com.br, E-mail: candida@cnen.gov.br [Comissao Nacional de Energia Nuclear (CNEN), Rio de Janeiro, RJ (Brazil)

    2015-07-01

    The National Laboratory for Metrology of Ionizing Radiation provides gamma sources of radionuclide and standardized in activity with reduced uncertainties. Relative methods require standards to determine the sample activity while the absolute methods, as sum-peak, not. The activity is obtained directly with good accuracy and low uncertainties. {sup 133}Ba is used in research laboratories and on calibration of detectors for analysis in different work areas. Classical absolute methods do not calibrate {sup 133}Ba due to its complex decay scheme. The sum-peak method using gamma spectrometry with germanium detector standardizes {sup 133}Ba samples. Uncertainties lower than 1% to activity results were obtained.

  5. Microstructural properties of BaTiO{sub 3} ceramics and thin films

    Energy Technology Data Exchange (ETDEWEB)

    Fundora C, A.; Portelles, J.J.; Siqueiros, J.M. [Posgrado en Fisica de Materiales, Centro de Investigacion Cientifica y de Educacion Superior de Ensenada. Apartado Postal 2861, 22800 Ensenada, Baja California (Mexico)

    2000-07-01

    A microstructural study of BaTiO{sub 3} ceramics obtained by the conventional ceramic method is presented. Targets were produced to grow BaTiO{sub 3} thin films by pulsed laser deposition on Pt/Ti/Si (100) substrates. X-ray diffraction, Auger Electron Spectroscopy, X-ray Photon Spectroscopy and Scanning Electron Microscopy were used to study the properties of the BaTiO{sub 3} ceramic samples and thin films, as deposited and after an annealing process. (Author)

  6. Effect of composition and interface intermixing on polarization behaviors of BaTiO{sub 3}/(Ba,Sr)TiO{sub 3} superlattices

    Energy Technology Data Exchange (ETDEWEB)

    Chew, Khian-Hooi; Lim, Kok-Geng [Department of Physics, University of Malaya, 50603, Kuala Lumpur (Malaysia); Ong, Lye-Hock [School of Physics, Universiti Sains Malaysia, 11800, Minden, Penang (Malaysia); Iwata, Makoto [Department of Engineering Physics, Electronics and Mechanics, Graduate School of Engineering, Nagoya Institute of Technology, Nagoya, Aichi, 4668555 (Japan)

    2014-08-15

    We have developed a thermodynamic model based on the Landau-Ginzburg theory to study the effect of composition and interface intermixing on ferroelectric properties of BaTiO{sub 3}/Ba{sub x}Sr{sub 1-x}TiO{sub 3} (BT/BST) superlattices. Dependence of the lattice parameter and the substrate-induced misfit strain of BST layer in BT/BST superlattices on Ba/Sr content are obtained. Effect of composition and interface intermixing on ferroelectricity of superlattices are examined by investigating the modulated profiles of polarization and the mismatch in polarization at interface. Our study reveals that the polarization behaviors of BT/BST superlattices can be manipulated by varying the Ba/Sr content in BST layer without changing the period thickness of superlattices. The effect of Ba/Sr content on polarization behavior of BT/BST superlattices is stronger than the effect of interface intermixing on polarization of the superlattices. (copyright 2014 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  7. Fabrication and characterization of BaSnO{sub 3}-doped NdBa{sub 2}Cu{sub 3}O{sub 7-{delta}} thin film

    Energy Technology Data Exchange (ETDEWEB)

    Tanaka, Y. [Department of Materials Physics and Chemistry, Graduate School of Kyushu University, 744 Motooka, Nishi-ku, Fukuoka 819-0395 (Japan); CREST-JST, Honmachi 4-1-8, Kawaguchi, Saitama 332-0012 (Japan)], E-mail: tanaka06@zaiko10.zaiko.kyushu-u.ac.jp; Mukaida, M.; Teranishi, R.; Yamada, K. [Department of Materials Physics and Chemistry, Graduate School of Kyushu University, 744 Motooka, Nishi-ku, Fukuoka 819-0395 (Japan); CREST-JST, Honmachi 4-1-8, Kawaguchi, Saitama 332-0012 (Japan); Ichinose, A. [CRIEPI, Nagasaka 2-6-1, Yokosuka, Kanagawa 240-0196 (Japan); CREST-JST, Honmachi 4-1-8, Kawaguchi, Saitama 332-0012 (Japan); Matsumoto, K. [Kyushu Institute of Technology, Sensui-cho 1-1, Tobata-ku, Kitakyushu, Fukuoka 804-8550 (Japan); CREST-JST, Honmachi 4-1-8, Kawaguchi, Saitama 332-0012 (Japan); Horii, S. [University of Tokyo, Hongo 7-3-1, Bunkyo-ku, Tokyo 113-8656 (Japan); CREST-JST, Honmachi 4-1-8, Kawaguchi, Saitama 332-0012 (Japan); Yoshida, Y. [Nagoya University, Chikusa-ku, Nagoya, Aichi 464-8603 (Japan); CREST-JST, Honmachi 4-1-8, Kawaguchi, Saitama 332-0012 (Japan); Kita, R. [Shizuoka University, Johoku 3-5-1, Hamamatsu, Shizuoka 430-8501 (Japan); CREST-JST, Honmachi 4-1-8, Kawaguchi, Saitama 332-0012 (Japan); Fujiyoshi, T. [Kumamoto University, Kurokami 2-39-1, Kumamoto, Kumamoto 860-8555 (Japan); Mori, N. [Department of Materials Physics and Chemistry, Graduate School of Kyushu University, 744 Motooka, Nishi-ku, Fukuoka 819-0395 (Japan)

    2008-09-15

    We fabricated a BaSnO{sub 3}-doped NdBa{sub 2}Cu{sub 3}O{sub 7-{delta}} film on a MgO substrate by a pulsed laser deposition method. We confirmed 00l reflections of NdBa{sub 2}Cu{sub 3}O{sub 7-{delta}} film in X-ray diffraction. In the cross-sectional transmission electron microscopy observation of the film, the presence of nanorods with 20 nm with average diameter is confirmed from bright-field images. We confirmed these nanorods contained tin (Sn) by EDS elemental maps. The crystal structure of the nanorod was determined to be cubic perovskite from its selected area electron diffraction pattern. Using the selected area electron diffraction patterns, the lattice constant of the nanorods in the NdBa{sub 2}Cu{sub 3}O{sub 7-{delta}} film was calculated to be 0.415 nm which was in good agreement with the lattice constant of BaSnO{sub 3} of 0.412 nm.

  8. Genome Sequence of African Swine Fever Virus BA71, the Virulent Parental Strain of the Nonpathogenic and Tissue-Culture Adapted BA71V.

    Directory of Open Access Journals (Sweden)

    Javier M Rodríguez

    Full Text Available The strain BA71V has played a key role in African swine fever virus (ASFV research. It was the first genome sequenced, and remains the only genome completely determined. A large part of the studies on the function of ASFV genes, viral transcription, replication, DNA repair and morphogenesis, has been performed using this model. This avirulent strain was obtained by adaptation to grow in Vero cells of the highly virulent BA71 strain. We report here the analysis of the genome sequence of BA71 in comparison with that of BA71V. They possess the smallest genomes for a virulent or an attenuated ASFV, and are essentially identical except for a relatively small number of changes. We discuss the possible contribution of these changes to virulence. Analysis of the BA71 sequence allowed us to identify new similarities among ASFV proteins, and with database proteins including two ASFV proteins that could function as a two-component signaling network.

  9. Structural studies of BaTiO3:Er3+and BaTiO3:Yb3+powders synthesized by hydrothermal method

    Institute of Scientific and Technical Information of China (English)

    Garrido-Hernndez A; Garca-Murillo A; Carrillo-Romo Fde J; Cruz-Santiago LA; Chadeyron G; Morales-Ramrez Ade J; Velumani S

    2014-01-01

    Erbium and ytterbium doped barium titanate nanopowders were prepared using the hydrothermal method. A barium titan-ate structure doped with rare earth ions manifested new characteristics and improved the field of application of optical devices such as trichromatic tubes, LCD displays, lamps, and infrared lasers. In this work, BaTiO3:Er3+and BaTiO3:Yb3+were prepared using barium chloride [BaCl2], titanium butoxide [C16H36O4Ti], erbium chloride [ErCl3] and ytterbium chloride [YbCl3] as precursors. Anhydrous methanol was employed as a solvent. Metallic potassium was used to promote solubility in the system and increase the pH to 13. This method yielded the formation of a predominantly cubic structure in both Er3+and Yb3+doped BaTiO3 powders. Characteristic bond-ings of BaTiO3 were observed with FT-IR spectroscopy. The predominantly cubic structure was confirmed by X-ray diffraction and micro-Raman analyses. The particle size (∼30 nm) was estimated using the Scherrer equation and X-ray diffraction data. The results were presented and discussed.

  10. Wetting of Al2O3 by Molten Aluminum: The Influence of BaSO4 Additions

    Directory of Open Access Journals (Sweden)

    Joaquin Aguilar-Santillan

    2008-01-01

    Full Text Available The effects of BaSO4 additions on the wetting of alumina by molten aluminum were studied by the sessile drop technique. To study the effect of BaSO4 decomposition (1100–1150∘C, the additions were treated at two temperatures 700∘C (973 K and 1450∘C (1723 K, respectively. BaSO4 additions at low and high temperatures did not improve the nonwetting character of these compositions. However, at higher firing temperature, the formation of BA6 (BaO•6Al2O3 has a nonwetting trend with increasing its content. To address the BA6 specifically a pure BaO•6Al2O3 was produced and tested. It was more nonwetting than the pure alumina. After the analysis of the contact angles for the BaSO4 and the BA6 (BaO•6Al2O3, it was concluded that these additions to alumina do not inhibit wetting by molten aluminum. In fact, at the addition levels common for refractories, the wetting tendency of molten aluminum is enhanced. Alternative explanations for the effectiveness of BaSO4 additions to alumina refractories are discussed.

  11. Mitochondrial dysfunction and transactivation of p53-dependent apoptotic genes in BaP-treated human fetal lung fibroblasts.

    Science.gov (United States)

    Yang, Guangtao; Jiang, Ying; Rao, Kaimin; Chen, Xi; Wang, Qian; Liu, Ailin; Xiong, Wei; Yuan, Jing

    2011-12-01

    Benzo(a)pyrene (BaP) has been shown to be an inducer of apoptosis. However, mechanisms involved in BaP-induced mitochondrial dysfunction are not well-known. In this study, human fetal lung fibroblasts cells were treated with BaP (8, 16, 32, 64 and 128 μM) for 4 and 12 h. Cell viability, intracellular level of reactive oxygen species (ROS), total antioxidant capacity (T-AOC), mitochondrial membrane potential (ΔΨ(m)) and cytochrome c release were determined. Changes in transcriptional levels of p53-dependent apoptotic genes (p53, APAF1, CASPASE3, CASPASE9, NOXA and PUMA) were measured. At time point of 4 h, BaP induced the intracellular ROS generation in 64 (p BaP groups (p BaP groups (p BaP groups (p BaP group (p BaP groups (p BaP group a relatively little expression of p53 mRNA was observed (p BaP promoted the generation of excessive ROS and subsequently the mitochondrial depolarization, whereas transactivations of the p53-dependent apoptotic genes were significantly induced at the later period.

  12. Crystal structure of the solid solution Ba8.35Pb0.65(B3O6)6.

    Science.gov (United States)

    Zhao, Wenwu

    2017-03-01

    Single crystals of lead barium borate, Ba8.35Pb0.65(B3O6)6, octabarium lead(II) hexa-kis-(triborate), have been obtained by spontaneous nucleation from a high-temperature melt. Its three-dimensional structure is constructed on the basis of a BaO9 polyhedron, a (Pb/Ba)O6 octa-hedron (occupancy ratio Pb:Ba = 0.216:0.784) and a condensed B3O6 ring anion. In the crystal, the planar B3O6 anions are stacked in an alternating fashion with Ba and (Pb/Ba) atoms along [001]. A comparison is made with the structures of related solid solutions in the system Ba/Pb/B/O.

  13. Effect of reagent vibrational excitation and isotope substitution on the stereo-dynamics of the Ba+HF→BaF+H reaction

    Institute of Scientific and Technical Information of China (English)

    Zhao Juan; Luo Yi

    2011-01-01

    Based on an extended London-Eyring-Polanyi-Sato(LEPS)potential energy surface(PES), the Ba+HF reaction has been studied by the quasi-classical trajectory(QCT)method. The reaction integral cross section as a function of collision energy for the Ba+HF→ BaF+H reaction is presented and the influence of isotope substitution on the differential cross sections(DCSs)and alignments of the product's rotational angular momentum have also been studied.The results suggest that the integral cross sections increase with increasing collision energy, and the vibrational excitation of the reagent has great influence on the DCS. In addition, the product's rotational polarization is very strong as a result of heavy-heavy-light(HHL)mass combination, and the distinct effect of isotope substitution on the stereodynamics is also revealed.

  14. Metallic behavior of GaAs/BaTiO3 heterostructure

    Science.gov (United States)

    Yuan, Mengqi; Wang, Jianli; Pu, Long; Tang, Gang; Guo, Sandong

    2016-07-01

    The integration of III-V semiconductors on functional perovskite-oxide can lead to new material properties and new device applications by combining the rich properties of perovskite-oxides together with the superior optical and electronic properties of III-V semiconductors. The structural and electronic properties of the surface and interface of the GaAs/BaTiO3 are studied using first-principles calculations. We point out the energetically favorable GaAs/BaTiO3 interfaces according to the GaAs initial adsorption on the BaTiO3(001) substrate. Our calculations predict the existence of the metallic behavior at the GaAs/BaTiO3 interfaces.

  15. Effect of BaO on Catalytic Activity of Pt-Rh TWC

    Institute of Scientific and Technical Information of China (English)

    2006-01-01

    The effects of BaO doping on the three-way catalytic activity of Pt-Rh catalyst and on water-gas shift were investigated. The results show that the light-off temperatures of hydrocarbon and carbon monoxide and nitrogen oxides of the fresh catalysts slightly differ from those of the aged catalysts, and the catalysts containing CeO2-ZrO2-BaO have lower lightoff temperature and better catalytic activity than these containing BaO and CeO2-ZrO2 after hydrothermal aging for 5 h at 1000 C. The catalysts were characterized by means of the temperature-programmed reduction (TPR) in hydrogen and the temperature-programmed desorption (TPD) in oxygen. It is confirmed that the suggested route of CeO2-ZrO2-BaO by coprecipitation can improve the catalytic activity of catalysts.

  16. Data of evolutionary structure change: 1ADIA-1J4BA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1ADIA-1J4BA 1ADI 1J4B A A -----GNNVVVLGTQWGDEGKGKIVDLLTERAKYVVRYQ...DKVARRGLRVGDLF-DKETFAEKLKEVMEYHNFQLVNYYKAEAVDYQKVLDDTMAVADILTSMVVDVSDLLDQARQR-GDFVMFEGAQGTLLDIDHGTYPYVTSSNTT...seq1> AAATGSRVTVVLGAQWGDEGKGKVVDLLATDADIVSRCQGGNNAGHTVVVDGKEYDFHLLPSGIINTKAVSFIGNGVVIHLPGLFEEAEKNEKKGL... EEEE GGEEE ----- 0 1ADI... A 1ADIA EDR

  17. Data of evolutionary structure change: 1ADIB-1J4BA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1ADIB-1J4BA 1ADI 1J4B B A -----GNNVVVLGTQWGDEGKGKIVDLLTERAKYVVRYQ...DKVARRGLRVGDLF-DKETFAEKLKEVMEYHNFQLVNYYKAEAVDYQKVLDDTMAVADILTSMVVDVSDLLDQARQR-GDFVMFEGAQGTLLDIDHGTYPYVTSSNTT...seq1> AAATGSRVTVVLGAQWGDEGKGKVVDLLATDADIVSRCQGGNNAGHTVVVDGKEYDFHLLPSGIINTKAVSFIGNGVVIHLPGLFEEAEKNEKKGL...HHHHHH EEEE GGEEE ----- 0 1ADI... B 1ADIB

  18. Synthesis, crystal structure, and photocatalytical properties of Ba3Ta5O14N

    Science.gov (United States)

    Anke, B.; Bredow, T.; Soldat, J.; Wark, M.; Lerch, M.

    2016-01-01

    Light yellow Ba3TaV5O14N was successfully synthesized as phase-pure material crystallizing isostructurally to well-known mixed-valence Ba3TaV4TaIVO15. The electronic structure of Ba3Ta5O14N was studied theoretically with a hybrid Hartree-Fock-DFT method. The most stable structure was obtained when nitrogen atoms were placed at 4 h sites having fourfold coordination. By incorporating nitrogen, the band gap decreases from ∼3.8 eV commonly known for barium tantalum(V) oxides to 2.8 eV for the oxide nitride, giving rise to an absorption band well in the visible-light region. Ba3Ta5O14N was also tested for photocatalytic hydrogen formation.

  19. Pyroelectric response of spray-deposited BaTiO3 thin film

    Science.gov (United States)

    Peale, Robert E.; Oladeji, Isaiah O.; Smith, Evan M.; Vasilyev, Vladimir; Alhasan, Sarmad Fawzi Hamza; Abouelkhair, Hussain; Todorovski, Dalibor; Kimani, Martin; Cleary, Justin W.

    2016-09-01

    Pyroelectric photoresponse of aqueous spray deposited thin films containing BaTiO3 nano-crystals is reported. X-ray diffraction data indicate the presence of hexagonal BaTiO3 nano-crystals with 20 nm crystalline domains in a matrix of some as yet unidentified nano-crystalline material. When the film is annealed at 600 C, the X-ray pattern changes significantly and indicates a conversion to one of the non-hexagonal phases of BaTiO3 as well as a complete change in the matrix. With suitable amplifier, the measured photoresponse was 40V/W. Ferroelectric hysteresis on a film with significant presence of hexagonal BaTiO3 shows saturated polarization which is about 5-times smaller than for the bulk tetragonal phase. A potential application is a patternable infrared detector for photonic and plasmonic devices, such as chip-scale spectral sensors.

  20. Surfactant-assisted synthesis of BaTiO3 nanoparticles by micro-emulsion method

    Directory of Open Access Journals (Sweden)

    J. L. Gao

    2015-10-01

    Full Text Available Barium titanate (BaTiO3 nanoparticles were successfully synthesized by using a surfactant-assisted method. The various processing parameters, namely, th e species of surfactant, reaction temperature and micro-emusion concentration had been varied, and the effects on the micrographs and crystal structure of BaTiO3 particles had been analyzed by scanning electron microscope (SEM, transmission electron microscopy (TEM and X-ray diffraction (XRD. XRD analyses confirming the tetragonal structure of the BaTiO3 nanoparticles using hexadecyl trimethyl ammonium Bromide (CTAB or nonylphenol polyoxyethylene ether (NP-10 as surfactant. The SEM analysis showed that by changing the species of surfactant, grains with different dimensions could be synthesized. TEM analyses indicate that BaTiO3 nanoparticles with 15–20 nm in diameter were successfully synthesized.

  1. submitter Performance simulation of BaBar DIRC bar boxes in TORCH

    CERN Document Server

    Föhl, K; Castillo García, L; Cussans, D; Forty, R; Frei, C; Gao, R; Gys, T; Harnew, N; Piedigrossi, D; Rademacker, J; Ros García, A; van Dijk, M

    2017-01-01

    TORCH is a large-area precision time-of-flight detector based on the DIRC principle. The DIRC bar boxes of the BaBar experiment at SLAC could possibly be reused to form a part of the TORCH detector time-of-flight wall area, proposed to provide positive particle identification of low momentum kaons in the LHCb experiment at CERN. For a potential integration of BaBar bar boxes into TORCH, new imaging readout optics are required. From the several designs of readout optics that have been considered, two are used in this paper to study the effect of BaBar bar optical imperfections on the detector reconstruction performance. The kaon-pion separation powers obtained from analysing simulated photon hit patterns show the performance reduction for a BaBar bar of non-square geometry compared to a perfectly rectangular cross section.

  2. Electrorheological Particles Composed of PolyanilineCore and BaTiO3 Layer Shell

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    Composite particles consisting of polyaniline(PAn) core and barium titanate (BaTiO3) layer shell were synthesized.The PAn-BaTiO3 composites particles were characterized with TEM and XRD.The dielectric behavior of particles was tested and the electrorheological(ER) behavior of the suspensions of PAn/BaTiO3 particles in chlorinated paraffin oil with a 20vol% was investigated under DC electric field.The results show that the ER effect of composite particle is far stronger than that of pure polyaniline and barium titanate which were synthesized by the same method.pH and thickness of BaTiO3 have an important influence on the ER effects.

  3. Influence Cr on Crystallization and the Phase Transformations of the Bronze BA1044

    Directory of Open Access Journals (Sweden)

    B. P. Pisarek

    2007-07-01

    Full Text Available The investigations were introduced in the paper, method of thermal and derivative analysis (TDA, the process of crystallization and phase transformation in the solid state of the aluminium bronze CuA110Fe4Ni4 (BA1044 and with the addition 0.3% Cr. Two intermetallic phase were identified in the microstructure of the bronze BA1044: κFel - rich in Fe and Cu and κFe2 - rich in Fe, and in the microstructure of the bronze BA1044+0.3 % Cr only one phase κFel - rich in Fe, Cu and Cr. The presence of chrome in the bronze BA1044 reduce size the primary crystals of the phase β, reduces the dynamics of the processes of thermal phase transformation in the solid state and lengthens the time their of duration.

  4. Some properties of Ba spaces%Ba空间的一些性质

    Institute of Scientific and Technical Information of China (English)

    魏文展; 董鸽

    2005-01-01

    讨论由一列线性赋范空间生成的Ba空间的几个性质.首先证明Ba空间既是囿空间又是桶形空间,并指出若X是线性赋范空间,则X*是Ba空间,接着又给出Ba空间等度连续、可分、局部一致凸等的几个充要条件.%Several properties of Ba spaces, which are produced by a sequence of linearly normed spaces, are discussed. It is shown that Ba spaces are both Bornological spaces and barrel spaces, and if X is a normed space, then X* is a Ba space. Thereby, some necessary and sufficient conditions under which Ba spaces are equicontinuous, separable and locally uniformly convex are given, respectively.

  5. First-principles calculations on the four phases of BaTiO3.

    Science.gov (United States)

    Evarestov, Robert A; Bandura, Andrei V

    2012-04-30

    The calculations based on linear combination of atomic orbitals basis functions as implemented in CRYSTAL09 computer code have been performed for cubic, tetragonal, orthorhombic, and rhombohedral modifications of BaTiO(3) crystal. Structural and electronic properties as well as phonon frequencies were obtained using local density approximation, generalized gradient approximation, and hybrid exchange-correlation density functional theory (DFT) functionals for four stable phases of BaTiO(3). A comparison was made between the results of different DFT techniques. It is concluded that the hybrid PBE0 [J. P. Perdew, K. Burke, M. Ernzerhof, J. Chem. Phys. 1996, 105, 9982.] functional is able to predict correctly the structural stability and phonon properties both for cubic and ferroelectric phases of BaTiO(3). The comparative phonon symmetry analysis in BaTiO(3) four phases has been made basing on the site symmetry and irreducible representation indexes for the first time.

  6. Ground state of the quasi-1D correlated electronic system BaVS{sub 3}

    Energy Technology Data Exchange (ETDEWEB)

    Foury-Leylekian, Pascale, E-mail: pascale.foury@u-psud.fr [Laboratoire de Physique des Solides, UMR 8502, CNRS, Universite Paris-Sud, F- 91405, Orsay Cedex (France); Leininger, Philippe [Max-Planck-Insitut furFestkoerperforschung, Heisenbergstrasse 1, D-70569 Stuttgart (Germany); Ilakovac, Vita [LCP-MR, Universite Pierre et Marie Curie, UMR 7614, CNRS, F-75321 Paris, France and Universite Cergy-Pontoise, F-95031, Cergy-Pontoise (France); Joly, Yves [Institut Neel, CNRS-UJF, BP 166, F-38042 Grenoble Cedex 9 (France); Bernu, Sylvain; Fagot, Sebastien; Pouget, Jean-Paul [Laboratoire de Physique des Solides, UMR 8502, CNRS, Universite Paris-Sud, F- 91405, Orsay Cedex (France)

    2012-06-01

    In this paper we review the salient features of the different instabilities exhibited by the quasi-1D system BaVS{sub 3} and show that there is a subtle interplay between the different phases stabilized. The analysis of the Peierls instability shows that the mobile dz Superscript-Two electrons are more localized than calculated because of their strong correlation with the localized e(t{sub 2g}) electrons. The complex AF magnetic structure of BaVS{sub 3} incorporates the magnetization of the e(t{sub 2g}) electrons with the Peierls pairing of the dz Superscript-Two electrons into magnetic singlets. Finally, we propose that the zig-zag disorder remaining after an incomplete orthorhombic phase transition could change the sign of the magnetic coupling and thus help to stabilize the canted ferromagnetism observed in non stoichiometric BaVS{sub 3-{delta}} and Sr and Ba substituted compounds.

  7. NO2 adsorption on BaO/Al2O3: the nature of nitrate species.

    Science.gov (United States)

    Szanyi, Janós; Kwak, Ja Hun; Kim, Do Heui; Burton, Sarah D; Peden, Charles H F

    2005-01-13

    Temperature programmed desorption, infrared spectroscopy, and (15)N solid state NMR spectroscopy were used to characterize the nature of the nitrate species formed on Al(2)O(3) and BaO/Al(2)O(3) NO(x) storage/reduction materials. Two distinctly different nitrate species were found: surface nitrates that are associated with a monolayer BaO on the alumina support, and a bulk-like nitrate that forms on this thin BaO layer. The surface nitrates desorb as NO(2) at lower temperatures than do the bulk-like nitrates, which decompose as NO+O(2) at higher temperatures. The amount of NO(x) stored in the monolayer nitrate is proportional to the surface area of the catalyst, while that in the bulk nitrate increases with BaO coverage.

  8. Data of evolutionary structure change: 1ELTA-2V0BA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1ELTA-2V0BA 1ELT 2V0B A A VVGGRVAQPNSWPWQISLQYKSGSSYYHTCGGSLIRQGW...VGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNDGTEQYVGVQKIVVHPY...E EEEEEEEEEEEE EEEEEEGG HHHHHHHHH 0 1ELT... A 1ELTA

  9. BA- proposal made in collaboration between students and clinical practitioner at the OT-program

    DEFF Research Database (Denmark)

    Hove, Anne

    2014-01-01

    -project. At the OT education at Metropolitan University College, Copenhagen, we have for several years had an online portal – matchpol.dk – across all BA-programmes where companies, institutions and other practitioners can upload project proposals for potential BA-projects. Experience has shown that some places......Presentation 24 BA- proposal made in collaboration between students and clinical practitioner at the OT-program Anne Hove (Metropolitan University College, Denmark) At the OT education a key aim is to ensure the students develop their BA-projects in a concrete collaboration with the practice field...... three workshops around three burning platforms in OT: -Day to day rehabilitation -Work centered rehabilitation -Bridging sectors We invite representatives from the field of practice to each workshop and they will in close collaboration with the students develop a range of proposals for relevant problem...

  10. Aggregation Behaviour of Cationic Diblock Copolymer (MTAC)10(BA)16: MesoDyn Simulation Study

    Institute of Scientific and Technical Information of China (English)

    CAO Xiao-Rong; TAN Ye-Bang; XU Gui-Ying

    2007-01-01

    The aggregation behaviour of an amphiphilic cationic block copolymer (MTAC)10(BA)16 in aqueous solution is investigated by MesoDyn simulation. Simulation results show that (MTAC)10(BA)16 can form spherical, irregular and network aggregates with the increasing volume fraction. The time evolution of order parameter shows that the process of aggregate formation can be divided into diffusion control stage and hydrophobic interaction control stage, while the time evolution of energy indicates that the aggregate formation is driven by enthalpy but not entropy. The order parameter of the hydrophobic blocks BA increases with the increasing (MTAC)10(BA)16 concentration, while the time needed for system balance has the contrary trend.

  11. A study on biological media of ultrasonic nonlinear parameter B/A

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Jeong Koo; Jung, Hong Ryang; Lim, Cheong Hwan [Hanseo Univ, Seosan (Korea, Republic of)

    2001-06-01

    This study deals with the relationship between the magnitude of ultrasonic nonlinear parameter B/A, and sound speed of amount of fat present in biological media to measure B/A system using a wide band ultrasonic transducer. To represent this case, mixtures of egg whites and egg yolk were studied. Even though the differences in density and sound speed of the two egg components were in the range of 1%, B/A increase parabolically as a function of the fat density, which is not in agreement with the Yoshizumi et al.'s suggestion. In skim, milk that dose not contain fat, both the B/A and the sound speed increase with the solubility. It is considered that protein could affect these values.

  12. Combustion synthesis and characterization of Ba2NdSbO6 nanocrystals

    Indian Academy of Sciences (India)

    V T Kavitha; R Jose; S Ramakrishna; P R S Wariar; J Koshy

    2011-07-01

    Nanocrystalline Ba2NdSbO6, a complex cubic perovskite metal oxide, powders were synthesized by a self-sustained combustion method employing citric acid. The product was characterized by X-ray diffraction, differential thermal analysis, thermogravimetric analysis, Fourier transform infrared spectroscopy, transmission electron microscopy and scanning electron microscopy. The as-prepared powders were single phase Ba2NdSbO6 and a mixture of polycrystalline spheroidal particles and single crystalline nanorods. The Ba2NdSbO6 sample sintered at 1500°C for 4 h has high density (∼ 95% of theoretical density). Sintered nanocrystalline Ba2NdSbO6 had a dielectric constant of ∼ 21; and dielectric loss = 8 × 10-3 at 5 MHz.

  13. Synthesis and Characterization of Bowl-Like Single-Crystalline BaTiO3 Nanoparticles

    Directory of Open Access Journals (Sweden)

    Pei Xinmei

    2010-01-01

    Full Text Available Abstract Novel bowl-like single-crystalline BaTiO3 nanoparticles were synthesized by a simple hydrothermal method using Ba(OH2·8H2O and TiO2 as precursors. The as-prepared products were characterized by XRD, Raman spectroscopy, SEM and TEM. The results show that the bowl-like BaTiO3 nanoparticles are single-crystalline and have a size about 100–200 nm in diameter. Local piezoresponse force measurements indicate that the BaTiO3 nanoparticles have switchable polarization at room temperature. The local effective piezoelectric coefficient is approximately 28 pm/V.

  14. Synthesis and Characterization of BaBiO 3 Perovskite through ...

    African Journals Online (AJOL)

    Science, Technology and Arts Research Journal ... BaBiO3 (perovskite) polycrystalline semiconducting material was synthesised by ... studied by using Scanning Electron Microscope (SEM) and Energy Dispersive X-Ray Spectrometry (EDS).

  15. Structural Studies of BaTiO 3 Ferroelectric Material Prepared by ...

    African Journals Online (AJOL)

    Structural Studies of BaTiO 3 Ferroelectric Material Prepared by Green Chemistry ... Science, Technology and Arts Research Journal ... The microstructure of the samples was investigated by using Scanning electron microscope (SEM).

  16. The abnormal sensitivity and its mechanism of (Ba, Pb)TiO3 semiconductor ceramics

    Institute of Scientific and Technical Information of China (English)

    TIAN Yuming; XU Mingxia; HUANG Ping; E Lei; HAO Huzai; CUI Cai'e

    2005-01-01

    The resistance-temperature properties of porous (Ba, Pb)TiO3 semiconductor ceramic were systematically studied. It was found that the resistance of (Ba, Pb)TiO3 ceramic having been placed in the air for a long time was abnormally increased with the increase of the temperature from the room temperature to 70℃ prior to the Curie point. Further research showed that this abnormal resistance-temperature property was linked to its humidity sensitivity. When the relative humidity changed from 11% to 93%, the resistance of (Ba, Pb)TiO3 ceramic decreased three orders of magnitude. Furthermore, the humidity-resistance was approximately linear in single logarithm coordinate. According to the surface adsorption, grain-boundary potential barrier and ferroelectric-paraelectric phase transformation, the specific sensitive mechanism of (Ba, Pb)TiO3 ceramic was analyzed qualitatively.

  17. Adsorption property of citrate dispersant on BaTiO3 particles in aqueous solution

    Institute of Scientific and Technical Information of China (English)

    SU Tao-long; ZHUANG Zhi-qiang

    2007-01-01

    Dispersion behavior of ultra fine BaTiO3 particles in the aqueous solution of ammonium citrate (NH4-CA) or citric acid lanthanum chelate (NH4-La-CA) was investigated. The dispersion property was characterized with sedimentation value. It is easier to obtain well dispersed slurry with NH4La-CA than NH4-CA. In an attempt to better understand the role of citric acid radical,simulation of the dispersant adsorption on BaTiO3 particle was performed with universal force field (UFF). It is demonstrated that the interaction between citric acid radical and BaTiO3 particle surface is a weak chemical adsorption. Trivalent citric acid radical is adsorbed on BaTiO3 particle surface with maximal adsorption energy. And, larger molecules of NH4-La-CA formed by adding La3+ lead to better dispersion property than NH4-CA.

  18. Growth, structure and upconversion mechanisms of Ba2ErCl7 crystal

    Institute of Scientific and Technical Information of China (English)

    2000-01-01

    The methods to grow a novel upconversion crystal Ba2ErCl7 are reported in this note. Ba2ErCl7 material was synthesized with Er2O3, BaCl2.2H2O and NH4Cl by using a so-called "direct synthesis method". High quality Ba2ErCl7 single crystals with size up to 4 mm×8 mm×15 mm were grown by using the Czochralski and the Bridgman methods. Intense yellow-green luminescence was detected when the crystal was pumped by an 803 laser diode (LD). Transmittance spectrum was measured by using HITACH U-3500 spectrophotometer at room temperature for the first time, in which one can see that the transmittance is high in the range from 350 to 1 600 nm and the cut-off wavelength of the crystal was 230 nm. The upconversion mechanisms were discussed.

  19. Role of Ba2+ Ion in the Crystal Growth of Sr(NO3)2

    Institute of Scientific and Technical Information of China (English)

    WU Li-Jun; LI Chao-Rong; CHEN Wan-Chun; LIANG Jing-Kui

    2000-01-01

    A series of crystals of BaxSr1-x(NO3)2 (x=0-0.98) were grown from aqueous solutions by the evaporation method and characterized by x-ray powder diffraction and high resolution x-ray diffraction. All diffraction data are well indexed according to simple cubic structure. The variation of lattice constants with the concentrations of Ba2+ in the crystals accorded quite well to the Vegard's Law. The results of high-resolution x-ray diffraction show that the crystalline quality of BaxSr1-x(NO3)2 decreases with x increasing. The distribution of Ba2+ between the solution and solid phase indicated that Ba2+ is enriched in the solid phase. It could be attributed to the solubility of Ba(NO3)2 in water being less than that of Sr(NOs)2.

  20. Effect of thermal stabilizers (Ba/Cd/Zn metal salts carboxylate and ...

    African Journals Online (AJOL)

    The IR spectroscopic analysis has shown that during processing (to produce the films), the Ba/Cd/Zn carboxylate salt reacts almost completely with PVC while the dibasic lead stearate ... complex growing absorption band centered around.

  1. Formation and Photocatalytic Activity of BaTiO3 Nanocubes via Hydrothermal Process

    Directory of Open Access Journals (Sweden)

    Xinrun Xiong

    2015-01-01

    Full Text Available We reported a facile hydrothermal approach to synthesize BaTiO3 nanocubes with controlled sizes for degradation of methylene blue (MB. The nanocubes with reaction time of 48 hours exhibited the highest photocatalytic efficiency, owing to their narrower size distribution and better crystallinity compared to those of 24 hours and, at the meantime, smaller particle size than those of 72 hours. This work also demonstrated the degradation of methylene orange (MO using BaTiO3 nanocubes synthesized for 48 hours. Compared with the removal of MB, BaTiO3 had lower photocatalytic activity on MO, mainly due to the poorer absorption behavior of MO on the surface of BaTiO3 nanocubes. The degradation efficiency for each photocatalytic reaction was calculated. The possible mechanism of the photocatalytic decomposition on MB has been addressed as well.

  2. Separation of Sr from Ca, Ba and Ra by means of Ca(OH)2 and Ba(Ra)Cl2 or Ba(Ra)SO4 for the determination of radiostrontium

    DEFF Research Database (Denmark)

    Chen, Q.J.; Hou, Xiaolin; Yu, Y.X.

    2002-01-01

    be completed. The new separation procedure has been successfully used for the determination of Sr-90 in samples with high Ca content, such as 451 of seawater and 2001 of drinking water. The analytical quality of the results is comparable to that of the traditional method using fuming nitric acid and BaCrO4...

  3. NO2 uptake under practically relevant conditions on BaO/Pt(111)

    Energy Technology Data Exchange (ETDEWEB)

    Mudiyanselage, Kumudu; Szanyi, János

    2012-02-01

    The formation of nitrites and nitrates (Ba(NOx)2) under practically relevant conditions (PNO2 up to 1.0 Torr and T = 500 K) and their thermal decomposition on BaO (>20 monolayer equivalent (MLE))/Pt(1 1 1) were studied using temperature programmed desorption (TPD), infrared reflection absorption (IRA), and Xray photoelectron (XP) spectroscopies. The exposure of BaO to 1.0 × 10-8 Torr NO2 at 500 K leads to the formation of a Ba(NOx)2 layer with small, disordered crystalline nitrate clusters. Under these conditions (PNO2 = 1.0 × 10-8 Torr and T = 500 K) only the top portion of the BaO layer converts to Ba(NOx)2 and the nitrites in this Ba(NOx)2 layer stay without converting completely to nitrates even after 100 min of NO2 exposure. In the thermal decomposition of Ba(NOx)2, first nitrites decompose, releasing NO and then the decomposition of nitrates occurs via two pathways releasing NO2 and NO + O2. At 500 K and PNO2 ≥ 1.0 × 10-7 Torr, first NO2 reacts with BaO to form small disordered crystalline Ba(NO3)2 particles and then these particles agglomerate to form large, well-ordered (bulk-like) crystalline nitrates as the NO2 exposure increases. The thermal decomposition of these well-ordered, bulk-like crystalline nitrate aggregates occurs in two steps releasing NO2 and NO + O2 in each step in two different temperature regions. NO2 pressure ≥1.0 × 10-5 Torr is required for the complete oxidation of initially formed nitrites to nitrates and the full nitration of the BaO layer at 500 K sample temperature. We gratefully acknowledge the US Department of Energy (DOE), Office of Basic Energy Sciences, Division of Chemical Sciences for the support of this work. The research described in this paper was performed at the Environmental Molecular Sciences Laboratory (EMSL), a national scientific user facility sponsored by the DOE Office of Biological and Environmental Research and located at Pacific Northwest National Laboratory (PNNL). PNNL is operated for the US DOE by

  4. Bulk superconductivity in Tl 2Ba 2CaCu 2O 8 and TlBa 2Ca 2Cu 3O 9 phases

    Science.gov (United States)

    Sulpice, A.; Giordanengo, B.; Tournier, R.; Hervieu, M.; Maignan, A.; Martin, C.; Michel, C.; Provost, J.

    1988-09-01

    Well-crystallized Tl 2Ba 2CaCu 2O 8 phases have been observed superconducting or normal below 108 K depending on their stoichiometry. This observation is an evidence that a (Cu IL&.zbnd;O -) mixed valence induced by vacancies or substitution on different sites gives rise to superconductivity in this phase. The new phase TlBa 2Ca 2CuO 9 which intrinsically contains a mixed valence has been observed as having a sharp transition to bulk superconductivity in the Meissner effect at a critical temperature of 120 K. This temperature is much higher than the recently observed one.

  5. Moessbauer spectroscopic analysis of the BaNbFe based compound; Analise por espectroscopia Moessbauer do composto a base de BaNbFe

    Energy Technology Data Exchange (ETDEWEB)

    Silva, Manoel Ribeiro da; Araujo, Fabiana F. de; Gontijo, Marcelo R.F.; Polegato, Paulo H. [Universidade Federal de Itajuba (UNIFEI), MG (Brazil). Dept. de Fisica e Quimica], e-mail: mrsilva@unifei.edu.br

    2008-07-01

    This work presents the synthesis and the results resulting from the application of Moessbauer spectroscopy for the investigation of the compound containing BaNb{sub x}Fe{sub 2-x}O{sub 4}. The synthesis used the chemical compounds Fe{sub 2}, Nb{sub 2}O{sub 3} and BaCO{sub 3}. The Moessbauer spectroscopy shows that the central doublets are characteristically of Fe{sup 3+} in the paramagnetic mineral structures or Fe{sup 2+} oxides in the superparamagnetic state. The studied material is a strong candidate for the application studies of superparamagnetic materials.

  6. Effect of conductive BaPbO3 electrode on the structural and dielectric properties of (Pb,Ba)ZrO3 films

    Science.gov (United States)

    Wu, Lin-Jung; Wu, Jenn-Ming

    2007-08-01

    Highly (1 1 1)-oriented (Pb,Ba)ZrO3 (PBZ) thin films were deposited on BaPbO3(BPO) electrode at different deposition temperatures and different thicknesses. As the deposition temperature increased, the dielectric constant and tunability increased from 150 and 4% to 500 and 56%, respectively. A current transient peak observed prior to dielectric degradation can be related to oxygen vacancy migration (redistribution) with space-charge-limited current transient or modulation of the electric conductivity. We infer that an interfacial layer lying between the PBZ and BPO effectively increases the oxygen vacancy (density ~1020 cm-3) mobility by Pb4+ diffusing into the PBZ films.

  7. Hydrogen content in doped and undoped BaPrO3 and BaCeO3 by cold neutron prompt-gamma activation analysis

    OpenAIRE

    Jones, Camille Y.; WU, Jian; Li, Liping; Haile, Sossina M.

    2005-01-01

    Proton uptake in undoped and Y-doped BaPrO3 has been measured by cold neutron prompt-gamma activation analysis, and compared to the proton uptake in Gd-doped BaCeO3, as determined by the same technique. The conventional proton incorporation model of perovskites in which oxygen ion vacancies, generated by the introduction of the trivalent dopant onto the tetravalent perovskite site, are filled with hydroxyl groups upon exposure of the sample to H2O containing atmospheres, predicts that the pro...

  8. XAFS study of BaCe1-xTixO3 and Ba1-yCe1-xYxO3 protonic solid electrolytes

    Science.gov (United States)

    Seremak-Peczkis, P.; Schneider, K.; Zajączkowski, W.; Kapusta, Cz.; Zając, D. A.; Pasierb, P.; Bućko, M.; Drożdż-Cieśla, E.; Rękas, M.

    2009-10-01

    The paper reports on the doping-influenced evolution of the local structure in a new class of solid electrolytes, BaCe1-xTixO3 and Ba1-yCe1-xYxO3 perovskites, to be used in intermediate temperature fuel cells. The local environments of the Ti, Y and Ce cations were studied by means of X-ray absorption spectroscopy. The Ti XAFS spectra reveal a decrease of the local symmetry of titanium site with increasing doping. The Ce and Y EXAFS functions show a larger amount of oxygen vacancies created by Y doping than that caused by barium understoichiometry.

  9. Measurements of the CKM Angle Alpha at BaBar

    Energy Technology Data Exchange (ETDEWEB)

    Stracka, Simone; /Milan U. /INFN, Milan

    2012-04-04

    The authors present improved measurements of the branching fractions and CP-asymmetries fin the B{sup 0} {yields} {pi}{sup +}{pi}{sup -}, B{sup 0} {yields} {pi}{sup 0}{pi}{sup 0}, and B{sup +} {yields} {rho}{sup +}{rho}{sup 0} decays, which impact the determination of {alpha}. The combined branching fractions of B {yields} K{sub 1}(1270){pi} and B {yields} K{sub 1}(1400){pi} decays are measured for the first time and allow a novel determination of {alpha} in the B{sup 0} {yields} {alpha}{sub 1}(1260){sup {+-}}{pi}{sup {-+}} decay channel. These measurements are performed using the final dataset collected by the BaBar detector at the PEP-II B-factory. The primary goal of the experiments based at the B factories is to test the Cabibbo-Kobayashi-Maskawa (CKM) picture of CP violation in the standard model of electroweak interactions. This can be achieved by measuring the angles and sides of the Unitarity Triangle in a redundant way.

  10. Distributed Offline Data Reconstruction in BaBar

    Energy Technology Data Exchange (ETDEWEB)

    Pulliam, Teela M

    2003-07-25

    The BaBar experiment at SLAC is in its fourth year of running. The data processing system has been continuously evolving to meet the challenges of higher luminosity running and the increasing bulk of data to re-process each year. To meet these goals a two-pass processing architecture has been adopted, where 'rolling calibrations' are quickly calculated on a small fraction of the events in the first pass and the bulk data reconstruction done in the second. This allows for quick detector feedback in the first pass and allows for the parallelization of the second pass over two or more separate farms. This two-pass system allows also for distribution of processing farms off-site. The first such site has been setup at INFN Padova. The challenges met here were many. The software was ported to a full Linux-based, commodity hardware system. The raw dataset, 90 TB, was imported from SLAC utilizing a 155 Mbps network link. A system for quality control and export of the processed data back to SLAC was developed. Between SLAC and Padova we are currently running three pass-one farms, with 32 CPUs each, and nine pass-two farms with 64 to 80 CPUs each. The pass-two farms can process between 2 and 4 million events per day. Details about the implementation and performance of the system will be presented.

  11. Extremal limits and Ba\\~nados-Silk-West effect

    CERN Document Server

    Pradhan, Parthapratim

    2016-01-01

    A fascinating property of extremal Kerr black hole (BH) is that it could be act as a particle accelerator with infinite high center-of-mass (CM) energy \\cite{bsw}. In this note, we would like to discuss about such fascinating result and to point out that this infinite energy at the event horizon comes solely due \\emph{to the singular nature of the extremal limit}. We also show that a non-extremal Kerr BH can \\emph{not} transform into extremal Kerr BH by the Ba\\~{n}ados-Silk-West mechanism. Moreover, we discuss about three possible geometries (near extremal, purely extremal and near horizon of extremal Kerr) of this mechanism. We further prove that near extremal geometry and near horizon geometry, precisely extremal geometry of extremal Kerr BHs are qualitatively different. Near extremal geometry and near horizon geometry gives the CM energy is finite, whereas precisely extremal geometry gives the diverging energy. Thus, we can argue that extremal Kerr BH and non-extremal Kerr BH are quite distinct objects. Fi...

  12. The BaBar Data Reconstruction Control System

    Energy Technology Data Exchange (ETDEWEB)

    Ceseracciu, A

    2005-04-20

    The BaBar experiment is characterized by extremely high luminosity and very large volume of data produced and stored, with increasing computing requirements each year. To fulfill these requirements a Control System has been designed and developed for the offline distributed data reconstruction system. The control system described in this paper provides the performance and flexibility needed to manage a large number of small computing farms, and takes full benefit of OO design. The infrastructure is well isolated from the processing layer, it is generic and flexible, based on a light framework providing message passing and cooperative multitasking. The system is distributed in a hierarchical way: the top-level system is organized in farms, farms in services, and services in subservices or code modules. It provides a powerful Finite State Machine framework to describe custom processing models in a simple regular language. This paper describes the design and evolution of this control system, currently in use at SLAC and Padova on {approx}450 CPUs organized in 9 farms.

  13. 137Ba Double Gamma Decay Measurement with GAMMASPHERE

    Directory of Open Access Journals (Sweden)

    Merchán E.

    2015-01-01

    Full Text Available The study of the electromagnetic moments (EM, and decay probability, provides detailed information about nuclear wave functions. The well-know properties of EM interactions are good for extracting information about the motion of nucleons. Higher order EM processes always occur, but are usually too weak to be measured. In the case of a 0+ → 0+ transitions [1, 2], where a single gamma transition is forbidden, the simultaneous emission of two γ-rays has been studied. An interesting opportunity to further investigate 2-photon emission phenomena is by using a standard 137Cs source populating, via β-decay, the Jπ = 11/2− isomeric state at 662 keV in 137Ba. In this case, two photon process can have contributions from quadrupole-quadrupole or dipole-octupole multipolarities in direct competition with the high multipolarity M4 decay. Since the yield of the double gamma decay is around six orders of magnitude less than the first order transition, very good statistics are needed in order to observe the phenomena and great care must be taken to suppress the first-order decay. The Gammasphere array is ideal since its configuration allows a good coverage of the angular distribution and the Compton events can be suppressed. Nevertheless the process to understand and eliminate the Compton background is a challenge. Geant4 simulations were carried out to help understand and correct for those factors.

  14. Measurements of the CKM Angle Alpha at BaBar

    Energy Technology Data Exchange (ETDEWEB)

    Stracka, Simone; /Milan U. /INFN, Milan

    2012-04-04

    The authors present improved measurements of the branching fractions and CP-asymmetries fin the B{sup 0} {yields} {pi}{sup +}{pi}{sup -}, B{sup 0} {yields} {pi}{sup 0}{pi}{sup 0}, and B{sup +} {yields} {rho}{sup +}{rho}{sup 0} decays, which impact the determination of {alpha}. The combined branching fractions of B {yields} K{sub 1}(1270){pi} and B {yields} K{sub 1}(1400){pi} decays are measured for the first time and allow a novel determination of {alpha} in the B{sup 0} {yields} {alpha}{sub 1}(1260){sup {+-}}{pi}{sup {-+}} decay channel. These measurements are performed using the final dataset collected by the BaBar detector at the PEP-II B-factory. The primary goal of the experiments based at the B factories is to test the Cabibbo-Kobayashi-Maskawa (CKM) picture of CP violation in the standard model of electroweak interactions. This can be achieved by measuring the angles and sides of the Unitarity Triangle in a redundant way.

  15. New oxybromide cobaltites with layered perovskite-related structures: 18R-Ba(6)Co(5)BrO(14) and 14H-Ba(7)Co(6)BrO(17).

    Science.gov (United States)

    Kauffmann, Matthieu; Roussel, Pascal

    2007-08-01

    Single crystals of the title compounds were prepared by solid-solid reaction using BaBr(2) flux at 1373 K. The structures of these two new cobaltites were solved and refined. The two compounds are built from a close-packing of [BaO(3)] and [BaOBr] layers with stacking sequences (c'chhcc')(3) and (c'chhhcc')(2) for the 18R and 14H structures, respectively, which create Co(3)O(12) trimers or Co(4)O(15) tetramers of face-sharing octahedra connected at their extremities to isolated tetrahedra by corner-sharing. These new materials are strongly related to the 5H-Ba(5)Co(5)O(14)/12H-Ba(0.9)CoO(2.6) and 10H-Ba(5)Co(5)ClO(13)/6H-Ba(6)Co(6)ClO(16) materials, with the existence of common blocks. In Ba(6)Co(5)BrO(14) and Ba(7)Co(6)BrO(17), all the atoms in the vicinity of the [BaOBr] layers are disordered, whereas the rest of the structure is perfectly ordered.

  16. Thermal expansion of BaCeO{sub 3}-based solid electrolytes with proton conductivity

    Energy Technology Data Exchange (ETDEWEB)

    Gorelov, V.P.; Arestova, N.B.; Kurumchin, E.Kh.; Vdovin, G.K. [Institute of High Temperature Electrochemistry, Ekaterinburg (Russian Federation)

    1995-03-01

    Solid electrolytes based on barium cerate BaCeO{sub 3} display high proton conductivity in hydrogen atmospheres at elevated temperatures. These materials can be used as electrolytes for fuel cells, for hydrogen and moisture sensor cells, and for separating gas mixtures, etc. Knowledge of the properties of particular ceramics is required for solving some problems related to structural materials. This work is devoted to studying the thermal expansion of BaCeO{sub 3} ceramics.

  17. New records of agaricoid fungi (Basidiomycota from Paraíba, Brazil

    Directory of Open Access Journals (Sweden)

    Altielys Casale Magnago

    2015-07-01

    Full Text Available http://dx.doi.org/10.5007/2175-7925.2015v28n4p9  This work presents a list of eighteen species of agaricoid fungi collected in the Atlantic Forest in the state of Paraíba. Hygrocybe subcaespitosa and Marasmius similis are new records for Brazil. Sixteen species are new records for Paraíba.

  18. Local environment analysis of Fe ions in BaMgSiO4

    Science.gov (United States)

    Kase, Junya; Shingaki, Yoshihiro; Inaba, Yuta; Meguro, Kazune; Murata, Hidenobu; Okajima, Toshihiro; Yamamoto, Tomoyuki

    2016-08-01

    Polycrystalline Fe-doped BaMgSiO4 is synthesized by the conventional solid state reaction method, which shows strong photochromism. Photochromic property of the synthesized specimens is investigated by measuring the diffuse reflectance spectrum. Local environment of doped Fe ions in BaMgSiO4 has been studied by the analysis of the X-ray absorption near-edge structure (XANES) spectrum with the aid of the first-principles calculations.

  19. BaCO3 mediated modifications in structural and magnetic properties of natural nanoferrites

    Science.gov (United States)

    Widanarto, W.; Jandra, M.; Ghoshal, S. K.; Effendi, M.; Cahyanto, W. T.

    2015-04-01

    Preparing M-type barium hexaferrite and improving the magnetic response of natural ferrites by incorporating barium carbonate (BaCO3) is ever-demanding. Series of barium carbonate doped ferrites with composition (100-x)Fe3O4·xBaCO3 (x=0, 10, 20, 30 wt%) are prepared through solid state reaction method and sintered gradually at temperatures of 800 and 1000 °C. Nanoparticles of natural ferrite and commercial BaCO3 are used as raw materials. Impacts of BaCO3 on structural and magnetic properties of these synthesized ferrites are inspected. The obtained ferrites are characterized using scanning electron microscopy (SEM), X-ray diffraction (XRD) and vibrating sample magnetometer (VSM) at room temperature. Uniform barium hexaferrite particles in terms of both morphology and size are not achieved. The average crystallite size of BaFe12O19 is observed to be within 30-600 nm. The sintering process results phase transformation from Fe3O4 (magnetite) to α-Fe2O3 (hematite) and the formation of hexagonal barium ferrite crystals. The occurrence of barium crystal is found to enhance with the increase of BaCO3 concentrations up to 20 wt% and suddenly drop at 30 wt%. Saturation and remanent magnetization of the doped ferrites are significantly augmented up to 16.37 and 8.92 emu g-1, respectively compared to their pure counterpart. Furthermore, the coercivity field is slightly decreased as BaCO3 concentrations are increased. BaCO3 mediated improvements in the magnetic response of natural ferrites are demonstrated.

  20. Pulsed Field Waveforms for Magnetization of HTS Gd-Ba-Cu-O Bulk Magnets

    Energy Technology Data Exchange (ETDEWEB)

    Ida, T [Department of Electronic Control Engineering, Hiroshima National College of Maritime Technology, 4272-1, Higashino, Ohsakikamijima-cho, Toyota-gun, Hiroshima 725-0231 (Japan); Matsuzaki, H [Department of Marine Electronics and Mechanical Engineering, Tokyo University of Marine Science and Technology, 2-1-6, Etchu-jima, Koto-ku, Tokyo 135-8533 (Japan); Morita, E [Department of Marine Electronics and Mechanical Engineering, Tokyo University of Marine Science and Technology, 2-1-6, Etchu-jima, Koto-ku, Tokyo 135-8533 (Japan); Sakashita, H [Department of Electronic Control Engineering, Hiroshima National College of Maritime Technology, 4272-1, Higashino, Ohsakikamijima-cho, Toyota-gun, Hiroshima 725-0231 (Japan); Harada, T [Department of Electronic Control Engineering, Hiroshima National College of Maritime Technology, 4272-1, Higashino, Ohsakikamijima-cho, Toyota-gun, Hiroshima 725-0231 (Japan); Ogata, H [Department of Marine Electronics and Mechanical Engineering, Tokyo University of Marine Science and Technology, 2-1-6, Etchu-jima, Koto-ku, Tokyo 135-8533 (Japan); Kimura, Y [Department of Marine Electronics and Mechanical Engineering, Tokyo University of Marine Science and Technology, 2-1-6, Etchu-jima, Koto-ku, Tokyo 135-8533 (Japan); Miki, M [Kitano Seiki Co. Ltd., 7-13-7, Chuo, Ohta-ku, Tokyo 143-0024 (Japan); Kitano, M [Kitano Seiki Co. Ltd., 7-13-7, Chuo, Ohta-ku, Tokyo 143-0024 (Japan); Izumi, M [Department of Marine Electronics and Mechanical Engineering, Tokyo University of Marine Science and Technology, 2-1-6, Etchu-jima, Koto-ku, Tokyo 135-8533 (Japan)

    2006-06-01

    Progress in pulse magnetization technique for high-temperature superconductor bulks of melt-textured RE-Ba-Cu-O with large diameter is important for the realization of power applications. We studied the pulsed power source and pulsed field waveforms to enhance to improve the magnetization properties for Gd-Ba-Cu-O bulk. The risetime and duration of pulse waveform effectively varied distribution of magnetic flux.

  1. Prepared GdBa2 Cu3Oy Single Domain Superconducting Bulks in Air

    Institute of Scientific and Technical Information of China (English)

    Zheng Minghui; Xiao Ling; Ren Hongtao; Jiao Yulei; Xu Bin; Fang Yuan

    2004-01-01

    The preparation of the single domain GBCO bulk with 25 mm in diameter in air was reported. In order to avoid the Gd ions substituted the Ba sites, different BaCuO2 contents was added into the precursor powders. Tc of the samples achieved 94.3 K. The magnetization hysteresis loops of the samples were measured at 77 K. It is shown that the irreverswas obtained.

  2. Structural Distortion Stabilizing the Antiferromagnetic and Semiconducting Ground State of BaMn2As2

    Directory of Open Access Journals (Sweden)

    Ekkehard Krüger

    2016-09-01

    Full Text Available We report evidence that the experimentally found antiferromagnetic structure as well as the semiconducting ground state of BaMn 2 As 2 are caused by optimally-localized Wannier states of special symmetry existing at the Fermi level of BaMn 2 As 2 . In addition, we find that a (small tetragonal distortion of the crystal is required to stabilize the antiferromagnetic semiconducting state. To our knowledge, this distortion has not yet been established experimentally.

  3. Nuclear electric dipole moments for the lowest 1/2+ states in Xe and Ba isotopes

    Science.gov (United States)

    Yoshinaga, N.; Higashiyama, K.; Arai, R.; Teruya, E.

    2014-04-01

    The electric dipole moments for the lowest 1/2+ states of Xe and Ba isotopes are calculated in terms of the nuclear shell model, which includes two-body nucleon interactions violating parity and time-reversal invariance. Using the wave functions thus obtained, the nuclear electric dipole moments arising from the intrinsic nucleon electric dipole moments and also from asymmetric charge distribution are calculated. The upper limits for the nuclear electric dipole moments of Xe and Ba isotopes are estimated.

  4. The analog front-end section of the BaBar silicon vertex tracker readout IC

    Energy Technology Data Exchange (ETDEWEB)

    Manfredi, P.F.; Leona, A.; Mandelli, E.; Re, V.; Svelto, F. [Pavia Univ. (Italy). Dipartimento di Elettronica]|[INFN, Sezione di Pavia, Via Bassi 6, 27100 Pavia (Italy); Kipnis, I.; Luo, L.; Momayezi, M.; Nyman, M.; Pedrali-Noy, M.; Roe, N. [E.O. Lawrence Berkeley National Laboratory, Berkeley, CA 94720 (United States)

    1998-02-01

    This paper describes the evolution in the analog section of the vertex detector readout chip for the BaBar experiment. In order to optimize its behaviour, an intermediate chip reproducing the analog part alone was developed and tested. It provided some useful design hints that provided the basis for the final conception of the analog front-end as it is now operational in the complete BaBar chip. (orig.). 6 refs.

  5. Electron-hole asymmetry, Dirac fermions, and quantum magnetoresistance in BaMnBi2

    OpenAIRE

    Li, Lijun; Wang, Kefeng; Graf, D.; Wang, Limin; Wang, Aifeng; Petrovic, C.

    2016-01-01

    We report two-dimensional quantum transport and Dirac fermions in BaMnBi2 single crystals. BaMnBi2 is a layered bad metal with highly anisotropic conductivity and magnetic order below 290 K. Magnetotransport properties, nonzero Berry phase, small cyclotronmass, and the first-principles band structure calculations indicate the presence of Dirac fermions in Bi square nets. Quantum oscillations in the Hall channel suggest the presence of both electron and hole pockets, whereas Dirac and paraboli...

  6. Plastic debris ingestion by sea turtle in Paraíba, Brazil.

    Science.gov (United States)

    Mascarenhas, Rita; Santos, Robson; Zeppelini, Douglas

    2004-08-01

    Coastal gill net entanglement and debris intake are important threats to the survival of sea turtles. Two sea turtles (Lepidochelys olivacea and Chelonia mydas) were found stranded along the coast of Paraíba. After necropsy, plastic debris were found in the stomach. The debris is described. This is the first record of this sort of problem for the Paraíba littoral.

  7. Exploring the potential of semiconducting BaSi2 for thin-film solar cell applications

    Science.gov (United States)

    Suemasu, Takashi; Usami, Noritaka

    2017-01-01

    Semiconducting barium disilicide (BaSi2), which is composed of earth-abundant elements, has attractive features for thin-film solar cell applications. Both a large absorption coefficient comparable to copper indium gallium diselenide and a minority-carrier diffusion length much larger than the grain size of BaSi2 can be used to improve solar cell properties. In this review article, we explore the potential of semiconducting BaSi2 film for thin-film solar cell applications. We start by describing its crystal and energy band structure, followed by discussing thin-film growth techniques and the optical and electrical properties of BaSi2 films. We use a first-principles calculation based on density-functional theory to calculate the position of the Fermi level to predict the carrier type of impurity-doped BaSi2 films using either a group 13 or 15 element, and compare the calculated results with the experimental ones. Special attention was paid to the minority-carrier properties, such as minority-carrier lifetime, minority-carrier diffusion length, and surface passivation. The potential variations across the grain boundaries measured by Kelvin-probe force microscopy allowed us to detect a larger minority-carrier diffusion length in BaSi2 on Si(1 1 1) compared with BaSi2 on Si(0 0 1). Finally, we demonstrate the operation of p-BaSi2/n-Si heterojunction solar cells and discuss prospects for future development.

  8. THE SYNTHESIS AND CHARACTERIZATION OF Ba-CROSSLINKED POLYMER ANTI-RADIATION MATERIALS

    Institute of Scientific and Technical Information of China (English)

    XU Wenying; CUI Jingrong; WANG Yuesheng; PEI Zhonghua

    1990-01-01

    Crosslinked poly( methyl methacrylate) and polystyrene with barium dimethacrylate [Ba( MA)2]as crosslinking agent have been synthesized. The relationship between X-ray absorbability and the content of Ba(MA)2 in polymers was investigated. TGA and DSC results indicated that the crosslinked polymers containing barium dimethacrylate have a much better heat stability than pure PMMA or PS. The mechanical properties of the polymers containing barium are improved in comparison with the pure PMMA.

  9. CoRoBa, a Multi Mobile Robot Control and Simulation Framework

    Directory of Open Access Journals (Sweden)

    Eric Colon

    2008-11-01

    Full Text Available This paper describes on-going development of a multi robot control framework named CoRoBa. CoRoBa is theoretically founded by reifying Real Time Design Patterns. It uses CORBA as its communication Middleware and consequently benefits from the interoperability of this standard. A multi-robot 3D simulator written in Java3D integrates seamlessly with this framework. Several demonstration applications have been developed to validate the design and implementation options.

  10. B Mixing and Lifetime Measurements with the BaBar Detector

    OpenAIRE

    Bozzi, C.

    2001-01-01

    Recent BaBar measurements on lifetime and mixing of B mesons are reported. Various techniques are used, ranging from the full reconstruction of hadronic B decays, to partial reconstruction techniques, and to a totally inclusive approach with dilepton events. The results presented are based on a data sample collected by BaBar during the 1999-2000 data taking, and should be considered as preliminary.

  11. Eu2+ Luminescence in BaZnAl10O17∶ Eu Phosphor

    Institute of Scientific and Technical Information of China (English)

    曾冬铭; 胡爱平; 舒万艮

    2002-01-01

    Eu2+-doped BaZnAl10O17 phosphor was successfully obtained by coprecipitation method, in which oxalic acid and ammonia were used as precipitants, and precipitates were calcined at 1400 ℃ for 3 h. Its luminescent intensity was much stronger than the one obtained by solid-state reaction at high temperature. According to XRD, the crystal was identified as BaZnAl10O17 with β-Al2O3 structure.

  12. Superconductivity in the Sn-Ba-Sr-Y-Cu-O system

    Science.gov (United States)

    Aleksandrov, K. S.; Khrustalev, B. P.; Krivomazov, S. N.; Petrov, M. I.; Vasilyev, A. D.; Zwegintsev, S. A.

    1991-01-01

    After the discovery of high-T(sub c) superconductivity in the La-Ba-Cu-O compound, several families of superconducting oxides were synthesized. Here, researchers report the results of the search for superconductivity in the compounds based on tin which has a lone electron pair like Bi, Tl, and Pb. The following compounds were synthesized: Sn1Ba1Sr1Cu3O(sub x), Sn1Ba1Ca1Cu3O(sub x), Sn1Ba1Mg1Cu3O(sub x), Sn1Sr1Ca1Cu3O(sub x), Sn1Sr1Mg1Cu3O(sub x), and Sn1Ca1Mg1Cu3O(sub x). The initial components were oxides and carbonates of the appropriate elements. A standard firing-grinding procedure was used. Final heating was carried out at 960 C during 12 hours. Then the samples were cooled inside the furnace. All the synthesis cycles were carried out in air atmosphere. Among the synthesized compounds only Sn1Ba1Sr1Cu3O(sub x) showed remarkable conductivity. Other compounds were practically dielectrics. Presence of a possible superconductivity in Sn1Ba1Sr1Cu3O(sub x) was defined by using the Meissner effect. At low temperature a deviation from paramagnetic behavior is observed. The hysteresis loops obtained at lower temperature undoubtly testify to the presence of a superconductive phase in the sample. However, the part of the superconductive phase in the Sn1Ba1Sr1Cu3O(sub x) ceramic turned out to be small, less than 2 percent, which agrees with the estimation from magnetic data. In order to increase the content of the superconductive phase, two-valent cations Ba and Sr were partially substituted by univalent (K) and three-valent ones (Y).

  13. Crystallography and Physical Properties of BaCo2As2, Ba0.94K0.06Co2As2, and Ba0.78K0.22Co2As2

    Energy Technology Data Exchange (ETDEWEB)

    Anand, V K [Ames Laboratory; Quirinale, Dante G [Ames Laboratory; Lee, Yongbin [Ames Laboratory; Harmon, Bruce N [Ames Laboratory; Furukawa, Yuji [Ames Laboratory; Ogloblichev, V V [Ural Division of Russian Academy of Science; Huq, A [Oak Ridge National Laboratory; Abernathy, D L [Oak Ridge National Laboratory; Stephens, P W [SUNY of Stony Brook; McQueeney, Robert J [Ames Laboratory; Kreyssig, Aandreas [Ames Laboratory; Goldman, Alan I [Ames Laboratory; Johnston, David C [Ames Laboratory

    2014-08-01

    The crystallographic and physical properties of polycrystalline and single crystal samples of BaCo2As2 and K-doped Ba{1-x}K{x}Co2As2 (x = 0.06, 0.22) are investigated by x-ray and neutron powder diffraction, magnetic susceptibility chi, magnetization, heat capacity Cp, {75}As NMR and electrical resistivity rho measurements versus temperature T. The crystals were grown using both Sn flux and CoAs self-flux, where the Sn-grown crystals contain 1.6-2.0 mol% Sn. All samples crystallize in the tetragonal ThCr2Si2-type structure (space group I4/mmm). For BaCo2As2, powder neutron diffraction data show that the c-axis lattice parameter exhibits anomalous negative thermal expansion from 10 to 300 K, whereas the a-axis lattice parameter and the unit cell volume show normal positive thermal expansion over this T range. No transitions in BaCo2As2 were found in this T range from any of the measurements. Below 40-50 K, we find rho ~ T^2 indicating a Fermi liquid ground state. A large density of states at the Fermi energy D(EF) ~ 18 states/(eV f.u.) for both spin directions is found from low-T Cp(T) measurements, whereas the band structure calculations give D(EF) = 8.23 states/(eV f.u.). The {75}As NMR shift data versus T have the same T dependence as the chi(T) data, demonstrating that the derived chi(T) data are intrinsic. The observed {75}As nuclear spin dynamics are consistent with the presence of ferromagnetic and/or stripe-type antiferromagnetic spin fluctuations. The crystals of Ba{0.78}K{0.22}Co2As2 were grown in Sn flux and show properties very similar to those of undoped BaCo2As2. On the other hand, the crystals from two batches of Ba{0.94}K{0.06}Co2As2 grown in CoAs self-flux show evidence of weak ferromagnetism at T < 10 K with small ordered moments at 1.8 K of 0.007 and 0.03 muB per formula unit, respectively.

  14. Photoresponse properties of BaSi2 film grown on Si (100) by vacuum evaporation

    Science.gov (United States)

    Thi Trinh, Cham; Nakagawa, Yoshihiko; Hara, Kosuke O.; Takabe, Ryota; Suemasu, Takashi; Usami, Noritaka

    2016-07-01

    We have succeeded in the observation of high photoresponsivity of orthorhombic BaSi2 film grown on crystalline Si by a vacuum evaporation method, raising the prospect of its promising application in high-efficiency thin-film solar cells. Photocurrent was observed at photon energies larger than 1.28 eV, which corresponds to the band gap of evaporated BaSi2 film, indicating that the photoresponsivity originates from the BaSi2 film. The effect of the substrate temperature on the film’s properties was also investigated. The films grown at a substrate temperature larger than 500 °C are single-phase polycrystalline BaSi2 films, while those grown at a substrate temperature of 400 °C is a mixture of phases. We confirmed that undoped evaporated BaSi2 films are an n-type material with high carrier concentration. High carrier lifetime of 4.8 and 2.7 μs can be found for the films grown at 500 °C and 400 °C, respectively. BaSi2 film grown at a substrate temperature of 500 °C, which is crack-free and single-phase, shows the best photoresponsivity. The maximum value of photocurrent was obtained at photon energy of 1.9 eV, corresponding to an external quantum efficiency of 22% under reverse applied voltage of 2 V.

  15. Luminescence and scintillation properties of BaF2sbnd Ce transparent ceramic

    Science.gov (United States)

    Luo, Junming; Sahi, Sunil; Groza, Michael; Wang, Zhiqiang; Ma, Lun; Chen, Wei; Burger, Arnold; Kenarangui, Rasool; Sham, Tsun-Kong; Selim, Farida A.

    2016-08-01

    Cerium doped Barium Fluoride (BaF2sbnd Ce) transparent ceramic was fabricated and its luminescence and scintillation properties were studied. The photoluminescence shows the emission peaks at 310 nm and 323 nm and is related to the 5d-4f transitions in Ce3+ ion. Photo peak at 511 keV and 1274 keV were obtained with BaF2sbnd Ce transparent ceramic for Na-22 radioisotopes. Energy resolution of 13.5% at 662 keV is calculated for the BaF2sbnd Ce transparent ceramic. Light yield of 5100 photons/MeV was recorded for BaF2sbnd Ce(0.2%) ceramic and is comparable to its single crystal counterpart. Scintillation decay time measurements shows fast component of 58 ns and a relatively slow component of 434 ns under 662 keV gamma excitation. The slower component in BaF2sbnd Ce(0.2%) ceramic is about 200 ns faster than the STE emission in BaF2 host and is associated with the dipole-dipole energy transfer from the host matrix to Ce3+ luminescence center.

  16. Narrow Bandgap in beta-BaZn2As2 and Its Chemical Origins

    CERN Document Server

    Xiao, Zewen; Ueda, Shigenori; Toda, Yoshitake; Ran, Fan-Yong; Guo, Jiangang; Lei, Hechang; Matsuishi, Satoru; Hosono, Hideo; Kamiya, Toshio

    2015-01-01

    Beta-BaZn2As2 is known to be a p-type semiconductor with the layered crystal structure similar to that of LaZnAsO, leading to the expectation that beta-BaZn2As2 and LaZnAsO have similar bandgaps; however, the bandgap of beta-BaZn2As2 (previously-reported value ~0.2 eV) is one order of magnitude smaller than that of LaZnAsO (1.5 eV). In this paper, the reliable bandgap value of beta-BaZn2As2 is determined to be 0.23 eV from the intrinsic region of the tem-perature dependence of electrical conductivity. The origins of this narrow bandgap are discussed based on the chemi-cal bonding nature probed by 6 keV hard X-ray photoemission spectroscopy, hybrid density functional calculations, and the ligand theory. One origin is the direct As-As hybridization between adjacent [ZnAs] layers, which leads to a secondary splitting of As 4p levels and raises the valence band maximum. The other is that the non-bonding Ba 5dx2-y2 orbitals form unexpectedly deep conduction band minimum (CBM) in beta-BaZn2As2 although the CBM of L...

  17. Impedance spectroscopy and investigation of conduction mechanism in BaMnO{sub 3} nanorods

    Energy Technology Data Exchange (ETDEWEB)

    Hayat, Khizar [Nanostructured Materials and Devices Group, Department of Chemicals and Materials Engineering, Pakistan Institute of Engineering and Applied Sciences, P.O. Nilore, Islamabad 45650 (Pakistan); Rafiq, M.A., E-mail: fac221@pieas.edu.p [Nanostructured Materials and Devices Group, Department of Chemicals and Materials Engineering, Pakistan Institute of Engineering and Applied Sciences, P.O. Nilore, Islamabad 45650 (Pakistan); Durrani, S.K. [Material Division, Pakistan Institute of Nuclear Science and Technology, P.O. Nilore, Islamabad 45650 (Pakistan); Hasan, M.M. [Nanostructured Materials and Devices Group, Department of Chemicals and Materials Engineering, Pakistan Institute of Engineering and Applied Sciences, P.O. Nilore, Islamabad 45650 (Pakistan)

    2011-02-01

    BaMnO{sub 3} nanorods were synthesized at 200 {sup o}C and atmospheric pressure using the composite-hydroxide mediated method. X-ray diffraction, scanning electron microscopy and energy dispersive X-ray spectroscopy were used to investigate the structure, size, morphology, phase purity and elemental composition of BaMnO{sub 3} nanorods. Electrical characterization of BaMnO{sub 3} pellet was performed at 300-400 K and in the frequency range 200 Hz-2 MHz. Temperature dependence of AC conductivity suggests that the BaMnO{sub 3} pellet behaves as a semiconducting material and conduction across the pellet can be explained by the correlated barrier hopping model. Impedance analysis was performed using the equivalent circuit model (R{sub 1}Q{sub 1}C{sub 1})(R{sub 2}C{sub 2}) and it suggests a single relaxation process in the BaMnO{sub 3} pellet at a particular temperature. The analysis reveals that the BaMnO{sub 3} pellet behaves like an n-type semiconductor material due to the presence of oxygen vacancies and some disorder. Modulus spectroscopy also supports the impedance results.

  18. Dispersing and Doping of BaTiO3 Powder by Adsorption

    Institute of Scientific and Technical Information of China (English)

    SU Taolong

    2008-01-01

    Dispersing and doping of BaTiO3 powder by adsorption method were investigated.Ultrafine BaTiO3 powders were dispersed in the aqueous with ammoniumized citrate (NH4-CA) or ammoniumized citric Ianthanum chelate (NH4-La-CA) as dispersant by ultrasonic bath. Better dispersion of BaTiO3 slurry was obtained in the aqueous with NH4-La-CA than that of NH4-CA when the mass ratio of citric acid (CA) to BaTiO3.Was less than 0.007. The pH value hardly affects the dispersion property of BaTiO3 suspension dispersed by NH4-La-CA. BaTiO3 powder could be well dispersed (median size D50=0.45 μm) and also doped with high uniformity of added components by adsorbing citric acid chelate on surface. Compared with solid mixing, better microstructure and properties of La/Mn codoped ceramics were obtained by adsorption method.

  19. [Effects of BaP exposure on ultrastructures of hepatic cells of Boleophthalmus pectinirostris].

    Science.gov (United States)

    Feng, Tao; Zheng, Weiyun; Ouyang, Gaoliang; Hong, Wanshu

    2003-10-01

    The changes of ultrastructures of hepatic cells of Boleophthalmus pectinirostris were investigated after the fish were exposed under benzo(a) pyrene in different concentrations under experimental condition. The results showed that the organelles in hepatic cells of B. pectinirostris were damaged to different extents after the fish was exposed under lower concentration of BaP (0.5 mg.L-1) for up to 7 d, in which, mitochondria and endoplasmic reticulum were the chief organelles affected by BaP exposure. While the fish was exposed under higher concentration of BaP (5 mg.L-1) for 2 h, almost all of the organelles including mitochondria and endoplasmic reticulum in hepatic cells of B. pectinirostr were affected by BaP exposure. The structures of liver cells were seriously damaged. It was demonstrated that BaP could produce multiorganalle lesions in hepatic cells of B. pectinirostris, and the severity extent of such lesions was dependent on the concentration level of BaP.

  20. Synthesis, crystal structure, bonding, and properties of (Ba6O)(OsN3)2.

    Science.gov (United States)

    Schmidt, Carsten L; Wedig, Ulrich; Dinnebier, Robert; Jansen, Martin

    2008-11-13

    The new barium nitridoosmate oxide (Ba(6)O)(OsN(3))(2) was prepared by reacting elemental barium and osmium (3:1) in nitrogen at 815-830 degrees C. The crystal structure of (Ba(6)O)(OsN(3))(2) as determined by laboratory powder X-ray diffraction (R3, No 148: a = b = 8.112(1) A, c = 17.390(1) A, V = 991.0(1) A(3), Z = 3), consists of sheets of trigonal OsN(3) units and trigonal-antiprismatic Ba(6)O groups, and is structurally related to the "313 nitrides" AE(3)MN(3) (AE = Ca, Sr, Ba, M = V-Co, Ga). Density functional calculations, using a hybrid functional, likewise indicate the existence of oxygen in the Ba(6) polyhedra. The oxidation state 4+ of osmium is confirmed, both by the calculations and by XPS measurements. The bonding properties of the OsN(3)(5-) units are analyzed and compared to the Raman spectrum. The compound is paramagnetic from room temperature down to T = 10 K. Between room temperature and 100 K it obeys the Curie-Weiss law (mu = 1.68 mu(B)). (Ba(6)O)(OsN(3))(2) is semiconducting with a good electronic conductivity at room temperature (8.74x10(-2) ohms(-1) cm(-1)). Below 142 K the temperature dependence of the conductivity resembles that of a variable-range hopping mechanism.

  1. Reversible Decomposition of Secondary Phases in BaO Infiltrated LSM Electrodes-Polarization Effects

    DEFF Research Database (Denmark)

    Traulsen, Marie Lund; McIntyre, Melissa D.; Norrman, Kion

    2016-01-01

    In operando Raman spectroscopy is used to study ceramic La0.85Sr0.15MnO3±δ electrodes infiltrated with BaO. The aim of this work is to clarify why BaO infiltration reduces the polarization resistance in oxygen containing atmospheres. Prior to the in operando experiments, ex situ X-ray diffraction...... and Raman spectroscopy reveal the formation of a secondary phase, Ba3Mn2O8, on the electrode. During the in operando Raman investigation of the BaO-infiltrated La0.85Sr0.15MnO3±δ electrodes, experiments are performed at 300 and 500 °C with oxygen partial pressure 0.1 atm and with −1 or +1 V Applied...... potential. A changing electrode surface is observed during operation as the Ba3Mn2O8 secondary phase decomposes and manganese oxide accumulates on the electrode surface during cathodic polarization. The observed changes are reversible. These results suggest that the formation of Ba3Mn2O8 is responsible...

  2. Brief Behavioural Activation (Brief BA) for Adolescent Depression: A Pilot Study.

    Science.gov (United States)

    Pass, Laura; Lejuez, Carl W; Reynolds, Shirley

    2017-07-31

    Depression in adolescence is a common and serious mental health problem. In the UK, access to evidence-based psychological treatments is limited, and training and employing therapists to deliver these is expensive. Brief behavioural activation for the treatment of depression (BATD) has great potential for use with adolescents and to be delivered by a range of healthcare professionals, but there is limited empirical investigation with this group. To adapt BATD for depressed adolescents (Brief BA) and conduct a pilot study to assess feasibility, acceptability and clinical effectiveness. Twenty depressed adolescents referred to the local NHS Child and Adolescent Mental Health service (CAMHs) were offered eight sessions of Brief BA followed by a review around one month later. Self- and parent-reported routine outcome measures (ROMs) were collected at every session. Nineteen of the 20 young people fully engaged with the treatment and all reported finding some aspect of Brief BA helpful. Thirteen (65%) required no further psychological intervention following Brief BA, and both young people and parents reported high levels of acceptability and satisfaction with the approach. The pre-post effect size of Brief BA treatment was large. Brief BA is a promising innovation in the treatment of adolescent depression. This approach requires further evaluation to establish effectiveness and cost effectiveness compared with existing evidence-based treatments for adolescent depression. Other questions concern the effectiveness of delivery in other settings and when delivered by a range of professionals.

  3. About room temperature ferromagnetic behavior in BaTiO{sub 3} perovskite

    Energy Technology Data Exchange (ETDEWEB)

    Alvarez, G., E-mail: memodin@yahoo.com [Departamento de Física, CINVESTAV-IPN, A.P. 14-740, México DF 07360, México (Mexico); Escuela Superior de Física y Matemáticas del Instituto Politécnico Nacional, U.P.A.L.M, Edificio 9, Av. Instituto Politécnico Nacional S/N, San Pedro Zacatenco, México DF 07738, México (Mexico); Conde-Gallardo, A. [Departamento de Física, CINVESTAV-IPN, A.P. 14-740, México DF 07360, México (Mexico); Montiel, H. [Centro de Ciencias Aplicadas y Desarrollo Tecnológico de la Universidad Nacional Autónoma de México, Cd. Universitaria, A.P. 70-186, México DF 04510, México (Mexico); Zamorano, R. [Escuela Superior de Física y Matemáticas del Instituto Politécnico Nacional, U.P.A.L.M, Edificio 9, Av. Instituto Politécnico Nacional S/N, San Pedro Zacatenco, México DF 07738, México (Mexico)

    2016-03-01

    A ferromagnetic behavior at room temperature is detected in micro-, submicro- and nano-powders of BaTiO{sub 3} perovskite by means of magnetization measurements, where the magnetic response is originated of different sources, depending on nature of the sample. For BaTiO{sub 3} micropowders is associated with the presence of a magnetic impurity, while for submicro- and nano-powders of BaTiO{sub 3} perovskite, the ferromagnetism is due to magnetic moments arising from the oxygen vacancies on the particles surface. We carry out an additional experimental confirmation of our asseverations by means of the electron paramagnetic resonance (EPR) and the low-field microwave absorption (LFMA), at X-band (8.8–9.8 GHz) and 300 K, indicating the presence of a magnetic impurity in BaTiO{sub 3} micropowders and the existence of oxygen vacancies in BaTiO{sub 3} nanopowders. - Highlights: • Ferromagnetism at 300 K is detected in diverse powders of BaTiO{sub 3} perovskite. • EPR and LFMA techniques are used to investigate the origin of this ferromagnetism. • We discuss on presence of a magnetic impurity and oxygen vacancies in these powders.

  4. Crystal habit for upconversion laser crystal of BaY2F8

    Institute of Scientific and Technical Information of China (English)

    LI Guanghui; RUAN Yongfeng; ZHANG Shouchao; SUN Wei

    2008-01-01

    BaY2F8 crystals had a relatively low symmetry, and its XRD data showed that those strong diffractions occurred in a narrow angle range, so it was difficult to orientate the single crystals of BaY2F8. In this paper, based on the structure characteristics and XRD data, the crystal habit of BaY2F8 was analyzed. The strong bond in crystal structure of BaY2F8 was Y-F2-Y, which stretched to the shape of chain along the direction of [001]. And this was an advantaged direction for the crystal growth. The steady shapes of BaY2F8 were composed of rhombic prism {130} and {021}. The crystal showed an axial habit in the direction of [001]. The analysis of the crystal slice obtained by temperature gradient technique verified the above conclusion. The BaY2F8 crystal was grown by compulsive methods such as Czochralski method.

  5. Effects of Heat-treatment on Microstructure and Magnetic Properties of Ba Ferrite Ultrafine Powders Prepared by Sol-gel

    Institute of Scientific and Technical Information of China (English)

    KONG Xiao-dong; Zhu Mei-wu; ZHENG Jia-sheng

    2004-01-01

    Barium (Bag) ferrite ultra fine powders were synthesized by using sol-gel in which polyethylene glycol200(PEG200) was used as gelling agent. The transition of Ba ferrite was studied by thermal gravimetric and differential thermal analysis (TG-DTA) technology. The micro structural changes were analyzed using X-ray diffraction (XRD) and atomic force microscopy (AFM) for the specimens annealed at different temperatures. The transition temperatures were 414.55 ℃ and 755.78 ℃ separately corresponding to BaFe2O4 and BaFe12O19. There were three types of microstructures for Ba ferrite ultrafine powder specimen annealed at 800℃. For the specimens annealed at different temperatures, there were different kinds of Ba ferrites. The ferrite powder consists of BaFe12O19 and BaFe2O4 for the specimen annealed at 800℃,and only BaFe12O19 can be found in the specimen annealed at 1000℃. The magnetic properties, σ s and H c of BaFe12O19ultrafine powders are different from that of BaFe12O19 bulk material.Key Words: Barium ferrite; ultrafine powder; microstructure; AFM; magnetic property

  6. Nd-doped barium titanate ceramics with various Ti/Ba ratios prepared by sol-gel method

    Institute of Scientific and Technical Information of China (English)

    SHI Qizhen; CUI Bin; WANG Hui; TIAN Jing; CHANG Zhuguo; HOU Yudong

    2005-01-01

    The Nd-doped BaTiO3 nanocrystalline powders and ceramics with different Ti/Ba ratios were prepared by sol-gel method. Phases and microstructures of the Nd-doped BaTiO3based powders and ceramics were characterized by XRD, SEM and TEM methods. The results revealed that the powders synthesized by sol-gel method were nanometer scale (30-60 nm)and were mainly composed of cubic BaTiO3 with a small amount of BaCO3. After sintering at high temperature, both cubic BaTiO3 and BaCO3 were transformed into tetrahedron BaTiO3 phase.The dielectric properties of the ceramics were also determined and the influence of Ti/Ba ratio on the dielectric properties was discussed. The Tc did not change with the variation of Ti/Ba ratio,while the εmax increased firstly and then decreased. The excess TiO2 is benefit for the modification of ceramics' microstructure and dielectric properties.

  7. Cage-forming compounds in the Ba-Rh-Ge system: from thermoelectrics to superconductivity.

    Science.gov (United States)

    Falmbigl, M; Kneidinger, F; Chen, M; Grytsiv, A; Michor, H; Royanian, E; Bauer, E; Effenberger, H; Podloucky, R; Rogl, P

    2013-01-18

    Phase relations and solidification behavior in the Ge-rich part of the phase diagram have been determined in two isothermal sections at 700 and 750 °C and in a liquidus projection. A reaction scheme has been derived in the form of a Schulz-Scheil diagram. Phase equilibria are characterized by three ternary compounds: τ(1)-BaRhGe(3) (BaNiSn(3)-type) and two novel phases, τ(2)-Ba(3)Rh(4)Ge(16) and τ(3)-Ba(5)Rh(15)Ge(36-x), both forming in peritectic reactions. The crystal structures of τ(2) and τ(3) have been elucidated from single-crystal X-ray intensity data and were found to crystallize in unique structure types: Ba(3)Rh(4)Ge(16) is tetragonal (I4/mmm, a = 0.65643(2) nm, c = 2.20367(8) nm, and R(F) = 0.0273), whereas atoms in Ba(5)Rh(15)Ge(36-x) (x = 0.25) arrange in a large orthorhombic unit cell (Fddd, a = 0.84570(2) nm, b = 1.4725(2) nm, c = 6.644(3) nm, and R(F) = 0.034). The body-centered-cubic superstructure of binary Ba(8)Ge(43)□(3) was observed to extend at 800 °C to Ba(8)Rh(0.6)Ge(43)□(2.4), while the clathrate type I phase, κ(I)-Ba(8)Rh(x)Ge(46-x-y)□(y), reveals a maximum solubility of x = 1.2 Rh atoms in the structure at a vacancy level of y = 2.0. The cubic lattice parameter increases with increasing Rh content. Clathrate I decomposes eutectoidally at 740 °C: κ(I) ⇔ (Ge) + κ(IX) + τ(2). A very small solubility range is observed at 750 °C for the clathrate IX, κ(IX)-Ba(6)Rh(x)Ge(25-x) (x ∼ 0.16). Density functional theory calculations have been performed to derive the enthalpies of formation and densities of states for various compositions Ba(8)Rh(x)Ge(46-x) (x = 0-6). The physical properties have been investigated for the phases κ(I), τ(1), τ(2), and τ(3), documenting a change from thermoelectric (κ(I)) to superconducting behavior (τ(2)). The electrical resistivity of κ(I)-Ba(8)Rh(1.2)Ge(42.8)□(2.0) increases almost linearly with the temperature from room temperature to 730 K, and the Seebeck coefficient is negative

  8. New insights into BaP-induced toxicity: role of major metabolites in transcriptomics and contribution to hepatocarcinogenesis.

    Science.gov (United States)

    Souza, Terezinha; Jennen, Danyel; van Delft, Joost; van Herwijnen, Marcel; Kyrtoupolos, Soterios; Kleinjans, Jos

    2016-06-01

    Benzo(a)pyrene (BaP) is a ubiquitous carcinogen resulting from incomplete combustion of organic compounds and also present at high levels in cigarette smoke. A wide range of biological effects has been attributed to BaP and its genotoxic metabolite BPDE, but the contribution to BaP toxicity of intermediary metabolites generated along the detoxification path remains unknown. Here, we report for the first time how 3-OH-BaP, 9,10-diol and BPDE, three major BaP metabolites, temporally relate to BaP-induced transcriptomic alterations in HepG2 cells. Since BaP is also known to induce AhR activation, we additionally evaluated TCDD to source the expression of non-genotoxic AhR-mediated patterns. 9,10-Diol was shown to activate several transcription factor networks related to BaP metabolism (AhR), oxidative stress (Nrf2) and cell proliferation (HIF-1α, AP-1) in particular at early time points, while BPDE influenced expression of genes involved in cell energetics, DNA repair and apoptotic pathways. Also, in order to grasp the role of BaP and its metabolites in chemical hepatocarcinogenesis, we compared expression patterns from BaP(-metabolites) and TCDD to a signature set of approximately nine thousand gene expressions derived from hepatocellular carcinoma (HCC) patients. While transcriptome modulation by TCDD appeared not significantly related to HCC, BaP and BPDE were shown to deregulate metastatic markers via non-genotoxic and genotoxic mechanisms and activate inflammatory pathways (NF-κβ signaling, cytokine-cytokine receptor interaction). BaP also showed strong repression of genes involved in cholesterol and fatty acid biosynthesis. Altogether, this study provides new insights into BaP-induced toxicity and sheds new light onto its mechanism of action as a hepatocarcinogen.

  9. Preparation of LTCC materials with adjustable permittivity based on BaO–B{sub 2}O{sub 3}–SiO{sub 2}/BaTiO{sub 3} system

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Kai-tuo; He, Yan; Liang, Zhong-yuan; Cui, Xue-min, E-mail: cui-xm@tsinghua.edu.cn

    2015-05-15

    Graphical abstract: The dielectric constant (ϵ) of the sintered BaO–B{sub 2}O{sub 3}–SiO{sub 2}/BaTiO{sub 3} glass/ceramics (the sintered samples with line shrinkage of 10%) changed from 5 to 30 and the dielectric losses (tanδ) was lower than 0.05 at 100 MHz with the amount of BaTiO{sub 3} additive increment from 60 wt% to 90 wt% fraction. - Highlights: • The ϵ of BaO–B{sub 2}O{sub 3}–SiO{sub 2} glass can be adjusted from 5 to 30 by adding BaTiO{sub 3}. • The influence factors on dielectric are the secondary phase and microstructure. • BaO–B{sub 2}O{sub 3}–SiO{sub 2}/BaTiO{sub 3} system can fabricate LTCC when BaTiO{sub 3} located in 60–80 wt%. - Abstract: This paper studied the preparation and characterization of LTCC (low temperature co-fired ceramics) materials based on BaO–B{sub 2}O{sub 3}–SiO{sub 2}/BaTiO{sub 3} glass–ceramics, where the sintering temperature was about 900 °C and dielectric constant was effectively adjustable from 5 to 30 by changing the BaTiO{sub 3} fraction from 60 wt% to 90 wt%. X-ray diffractometer (XRD), scanning electron microscopy (SEM) were used to examine the effect of different amounts additive on the dielectric properties of this LTCC system and the crystal structure change. The results indicated that BaTiO{sub 3} can be used as a dielectric additive aim to adjust the permittivity of BaO–B{sub 2}O{sub 3}–SiO{sub 2} glass, which the main influence factors on dielectric are the contents of the secondary phase, the BaTiO{sub 3} phase fraction and the porous structure of the sintered body. Therefore, the microstructure and dielectric property of BaO–B{sub 2}O{sub 3}–SiO{sub 2}/BaTiO{sub 3} glass–ceramics composites could be controlled by adjusting the content of BaTiO{sub 3} additive.

  10. Bismuthates: BaBiO{sub 3} and related superconducting phases

    Energy Technology Data Exchange (ETDEWEB)

    Sleight, Arthur W., E-mail: arthur.sleight@oregonstate.edu

    2015-07-15

    Highlights: • BaBiO{sub 3} has the perovskite structure, but tilting of the BiO{sub 6} octahedra destroy the ideal cubic symmetry except at temperatures above 820 K. BaBiO{sub 3} is a diamagnetic semiconductor due to a CDW, which is equivalent to a Ba{sub 2}Bi{sup 3+}Bi{sup 5+}O{sub 6} representation. • Recent calculations and experimental results confirm that there is no significant deviation from the oxidation states of 3+ and 5+. • Superconductivity with a T{sub c} as high as 13 K occurs for BaPb{sub 1−x}Bi{sub x}O{sub 3} phases where the 6s band is about 25% filled, and superconductivity with a T{sub c} as high as 34 K occurs for Ba{sub 1−x}K{sub x}BiO{sub 3} phases where the 6s band is about 35% filled. • These two solid solutions can have cubic, tetragonal, or orthorhombic symmetry. • However, superconductivity has only been observed when the symmetry is tetragonal. - Abstract: BaBiO{sub 3} has the perovskite structure, but tilting of the BiO{sub 6} octahedra destroy the ideal cubic symmetry except at temperatures above 820 K. BaBiO{sub 3} is a diamagnetic semiconductor due to a charge density wave (CDW), which is equivalent to a Ba{sub 2}Bi{sup 3+}Bi{sup 5+}O{sub 6} representation. Recent calculations and experimental results confirm that there is no significant deviation from the oxidation states of 3+ and 5+. Superconductivity with a T{sub c} as high as 13 K occurs for BaPb{sub 1−x}Bi{sub x}O{sub 3} phases where the 6s band is about 25% filled, and superconductivity with a T{sub c} as high as 34 K occurs for Ba{sub 1−x}K{sub x}BiO{sub 3} phases where the 6s band is about 35% filled. Structures in these two solid solutions can have cubic, tetragonal, orthorhombic, or monoclinic symmetry. However, superconductivity has only been observed when the symmetry is tetragonal.

  11. Ca, Sr and Ba stable isotopes reveal the fate of soil nutrients along a tropical climosequence

    Science.gov (United States)

    Bullen, Thomas D.; Chadwick, Oliver A.

    2016-01-01

    Nutrient biolifting is an important pedogenic process in which plant roots obtain inorganic nutrients such as phosphorus (P) and calcium (Ca) from minerals at depth and concentrate those nutrients at the surface. Here we use soil chemistry and stable isotopes of the alkaline earth elements Ca, strontium (Sr) and barium (Ba) to test the hypothesis that biolifting of P has been an important pedogenic process across a soil climosequence developed on volcanic deposits at Kohala Mountain, Hawaii. The geochemical linkage between these elements is revealed as generally positive site-specific relationships in soil mass gains and losses, particularly for P, Ba and Ca, using the ratio of immobile elements titanium and niobium (Ti/Nb) to link individual soil samples to a restricted compositional range of the chemically and isotopically diverse volcanic parent materials. At sites where P is enriched in surface soils relative to abundances in deeper soils, the isotope compositions of exchangeable Ca, Sr and Ba in the shallowest soil horizons (materials and trend toward those of plants growing on fresh volcanic deposits. In contrast the isotope composition of exchangeable Ba in deeper soil horizons (> 10 cm depth) at those sites is consistently heavier than the volcanic parent materials. The isotope compositions of exchangeable Ca and Sr trend toward heavier compositions with depth more gradually, reflecting increasing leakiness from these soils in the order Ba recycling flux returned to the surface as litterfall. This observation implicates an uptake flux from an additional source which we attribute to biolifting. We view the heavy exchangeable Ba relative to soil parent values in deeper soils at sites where P is enriched in surface soils, and indeed at all but the wettest site across the climosequence, to represent the complement of an isotopically light Ba fraction removed from these soils by plant roots consistent with the biolifting hypothesis. We further suggest that

  12. High-pressure BaCrO{sub 3} polytypes and the 5H–BaCrO{sub 2.8} phase

    Energy Technology Data Exchange (ETDEWEB)

    Arévalo-López, Angel M.; Paul Attfield, J., E-mail: j.p.attfield@ed.ac.uk

    2015-12-15

    Polytypism of BaCrO{sub 3} perovskites has been investigated at 900–1100 °C and pressures up to 22 GPa. Hexagonal 5H, 4H, and 6H perovskites are observed with increasing pressure, and the cubic 3C perovskite (a=3.99503(1) Å) is observed in bulk form for the first time at 19–22 GPa. An oxygen-deficient material with limiting composition 5H–BaCrO{sub 2.8} is synthesised at 1200 °C under ambient pressure. This contains double tetrahedral Cr{sup 4+} layers and orders antiferromagnetically below 260 K with a (0 0 1/2) magnetic structure. - Graphical abstract: Hexagonal 5H, 4H, and 6H perovskites polytypes of BaCrO{sub 3} are observed with increasing pressure and the cubic 3C perovskite is stabilised in bulk form for the first time at 19–22 GPa. Oxygen-deficient 5H–BaCrO{sub 2.8} synthesised at ambient pressure contains double tetrahedral Cr{sup 4+} layers and orders antiferromagnetically below 260 K with a (0 0 1/2) magnetic structure.

  13. Enhanced ferroelectricity and magnetoelectricity in 0.75BaTiO3-0.25BaFe12O19 by spark plasma sintering

    Directory of Open Access Journals (Sweden)

    Adiraj Srinivas

    2013-03-01

    Full Text Available Spark Plasma Sintering (SPS technique was employed to synthesize 0.75BaTiO3-0.25BaFe12O19 composite. X-ray diffraction studies revealed that the composite consisted of both BaTiO3 (ferroelectric phase andBaFe12O19 (ferrimagnetic phase, respectively. The SPS treated sample showed improved ferroelectric nature when compared to conventional sintered (CS sample. Transformation from hard to soft magnetic nature was envisaged by magnetization measurements for SPS sample. A slim hysteresis loop was recorded with a low coercivity values (390 Oe when compared to CS sample (3900 Oe. Mossbauer spectroscopy analysis indicated that the existence of a partial amount of γ-Fe2O3 phase in the lattice, giving rise to soft magnetic nature. The SPS sample showed slightly higher value of magnetoelectric output of 2.95 mV/cm at 3 kOe magnetic field when compared to the CS sample (1.45 mV/cm at 3 kOe. The present investigation compares the spark plasma sintered sample with the conventional sintered sample.

  14. Flora do Pico do Jabre, Paraíba, Brasil: Cactaceae juss Flora of the Pico do Jabre, Paraíba, Brazil: Cactaceae juss

    Directory of Open Access Journals (Sweden)

    Emerson Antonio Rocha

    2002-01-01

    Full Text Available Neste trabalho realizou-se o tratamento sistemático das Cactaceae do Pico do Jabre, Paraíba, Brasil. A área de estudo é o ponto mais alto do Nordeste setentrional, constitui-se de um enclave de mata serrana, sendo considerada um dos poucos representantes da Paraíba incluídos no domínio da Mata Atlântica. No Pico do Jabre, as Cactaceae estão representadas por três gêneros e quatro espécies: Cereus jamacaru DC., Melocactus ernestii Vaupel, Pilosocereus chrysostele (VaupelByles & Rowley e Pilosocereus gounellei (F.A.C.WeberByles & Rowley.This work constitutes a systematic treatment of the Cactaceae family found in the "Pico do Jabre", Paraíba, Brazil. The study-area is the highest peak in the Northern part of Northeastern Brazil and consists of an isolated portion of humid forest, one of the few in the State of Paraíba, included in the the domain of the Atlantic Forest. In the "Pico do Jabre" the Cactaceae family is represented by three genera and four species: Cereus jamacaru DC., Melocactus ernestii Vaupel, Pilosocereus chrysostele (Vaupel Byles & Rowley and Pilosocereus gounellei (F.A.C.WeberByles & Rowley.

  15. Novel behaviour and structure of new glasses of the type Ba-Al-O and Ba-Al-Ti-O produced by aerodynamic levitation and laser heating

    Energy Technology Data Exchange (ETDEWEB)

    Skinner, L B [HH Wills Physics Laboratory, Tyndall Avenue, Bristol BS8 1TL (United Kingdom); Barnes, A C [HH Wills Physics Laboratory, Tyndall Avenue, Bristol BS8 1TL (United Kingdom); Crichton, W [European Synchrotron Radiation Facility, 6 rue Jules Horowitz, BP 220, Grenoble Cedex, F-38043 (France)

    2006-08-16

    Novel barium aluminate (BaAl{sub 2}O{sub 4}) and barium alumino-titanate (BaAl{sub 2}TiO{sub 6}) glasses have been produced by aerodynamic levitation and laser heating. BaAl{sub 2}O{sub 4} forms a clear and colourless glass under containerless and rapid quenching conditions. Under similar rapid quenching conditions BaAl{sub 2}TiO{sub 6} forms an opaque and black glass, while under slower and controlled quenching conditions it is possible to form a clear and colourless glass. The formation of the opaque or clear glass is reversible and purely dependent on the quench rate used. By slowing the quench rate further, it is possible to produce a milky glass suggestive of liquid-liquid phase separation in the liquid before glassification. High-energy x-ray diffraction experiments confirm the glassy state of these materials and show coordination structures and bond distances similar to their crystalline analogues. (letter to the editor)

  16. Toughening PVC with VC-BA/nano-CaCO3 masterbatch%VC-BA/纳米CaCO3复合母粒增韧PVC

    Institute of Scientific and Technical Information of China (English)

    王士财; 李宝霞; 楼涛; 张晓东

    2007-01-01

    采用氯乙烯-丙烯酸丁酯共聚弹性体(VC-BA)和经表面处理的纳米碳酸钙(nano-CaCO3)制备VC-BA/nano-CaCO3复合母粒,再用该复合母粒与聚氯乙烯(PVC)共混,制备了VC-BA/nano-CaCO3复合母粒增韧的PVC复合材料.复合母粒中m(VC-BA)/m(nano-CaCO3)为2 : 3时,增韧效果最佳.nano-CaCO3与VC-BA有协同增韧作用,且nano-CaCO3能够补强.当PVC和复合母粒质量比为100:20时,材料的冲击强度达到49.5 kJ/m2,是纯PVC的10 倍,拉伸强度为51.0 MPa.

  17. Layered perovskite-related ruthenium oxychlorides: crystal structure of two new compounds Ba 5Ru 2Cl 2O 9 and Ba 6Ru 3Cl 2O 12

    Science.gov (United States)

    Tancret, N.; Roussel, P.; Abraham, F.

    2004-03-01

    Single crystals of the title compounds were prepared using a BaCl 2 flux and investigated by X-ray diffraction methods using Mo Kα radiation and a charge coupled device (CCD) detector. The crystal structures of these two new compounds were solved and refined in the hexagonal symmetry with space group P6 3/ mmc, a=5.851(1) Å, c=25.009(5) Å, ρcal=4.94 g cm -3, Z=2 to a final R1=0.069 for 20 parameters with 312 reflections for Ba 5Ru 2Cl 2O 9 and space group P 3¯m1 , a=5.815(1) Å, c=14.915(3) Å, ρcal=5.28 g cm -3, Z=1 to a final R1=0.039 for 24 parameters with 300 reflections for Ba 6Ru 3Cl 2O 12. The structure of Ba 5Ru 2Cl 2O 9 is formed by the periodic stacking along [001] of three hexagonal close-packed BaO 3 layers separated by a double layer of composition Ba 2Cl 2. The BaO 3 stacking creates binuclear face-sharing octahedra units Ru 2O 9 containing Ru(V). The structure of Ba 6Ru 3Cl 2O 12 is built up by the periodic stacking along [001] of four hexagonal close-packed BaO 3 layers separated by a double layer of composition Ba 2Cl 2. The ruthenium ions with a mean oxidation degree +4.67 occupy the octahedral interstices formed by the four layers hexagonal perovskite slab and then constitute isolated trinuclear Ru 3O 12 units. These two new oxychlorides belong to the family of compounds formulated as [Ba 2Cl 2][Ba n+1 Ru nO 3 n+3 ], where n represents the thickness of the octahedral string in hexagonal perovskite slabs.

  18. Insulator-to-semiconductor transition of nanocrystalline BaTiO3 at temperatures ≤200 °C.

    Science.gov (United States)

    Guo, Xin

    2014-10-14

    As a classic dielectric material, BaTiO3 is one of the most important materials used in electronic applications. In this work, highly dense BaTiO3 ceramics with an average grain size of 35 nm were prepared, and dielectric and electrical properties were investigated. Microcrystalline BaTiO3 is an insulator at low temperatures; however, nanocrystalline BaTiO3 shows considerable semiconductivity with an activation energy of only 0.27 eV at temperatures ≤200 °C. At room temperature, the conductivity of nanocrystalline BaTiO3 is about fourteen orders of magnitude higher than that of the microcrystalline counterpart. Only by decreasing the grain size, one can transform BaTiO3 from an insulator to a semiconductor.

  19. Nuclear structure of even 120-136Ba under the framework of IBM, IVBM and new method (SEF)

    Science.gov (United States)

    Al-Jubbori, Mushtaq A.; Kassim, Huda H.; Sharrad, Fadhil I.; Hossain, I.

    2016-11-01

    The positive and negative-state bands of even-even 120-136Ba nuclei have been studied. The energy levels for the ground-state band of 120-136Ba have been calculated using Interacting Boson Model (IBM), Interacting Vector Boson Model (IVBM) and a new method called Semi-Empirical Formula (SEF). The negative parity band of even-even 120-136Ba isotopes has been also calculated using (IVBM) and (SEF). The γ and β-bands of even-even 120-136Ba isotopes have been calculated using IBM and SEF. The parameters of the best fit to the measured data are determined. The reduced transition probabilities B (E 2) of these nuclei was calculated. The critical points have been determined for 134,136Ba isotopes. The potential energy surfaces for even-even Ba isotopes are studied using the simplified form of Interacting Boson Model (IBM) with an intrinsic coherent state.

  20. Novel perovskite-related barium tungstate Ba 11W 4O 23

    Science.gov (United States)

    Hong, Seung-Tae

    2007-11-01

    Ba 11W 4O 23 was synthesized at 1300 °C, followed by quenching with liquid nitrogen. The crystal structure, which was known to be cryolite-related but has remained unclear, was initially determined by single-crystal X-ray diffraction for the isostructural Ru-substituted compound Ba 11(W 3.1Ru 0.9)O 22.5, which was discovered during exploratory synthesis in the Ba-Ru-O system. The structure of Ba 11W 4O 23 was refined by a combined powder X-ray and neutron Rietveld method ( Fd-3 m, a=17.1823(1) Å, Z=8, Rp=3.09%, Rwp=4.25%, χ2=2.8, 23 °C). The structure is an example of A-site vacancy-ordered 4×4×4 superstructure of a simple perovskite ABO 3, and it may be written as (Ba 1.75□ 0.25)BaWO 5.75□ 0.25, emphasizing vacancies on both metal and anion sites. The local structure of one of two asymmetric tungsten ions is the WO 6 octahedron, typical of perovskite. The other tungsten, however, is surrounded by oxygen and anionic vacancies statistically distributed over three divided sites to form 18 partially occupied oxygen atoms (˜30% on average), represented as WO 18/3. The A-site cation-vacancies are ordered at the 8a ( {1}/{8}, {1}/{8}, {1}/{8}) site in between adjoining WO 18/3 polyhedra which form 1-D arrangements along [110] and equivalent directions. In situ high-temperature XRD data have shown that the quenched Ba 11W 4O 23 at room temperature is isostructural to the high-temperature phase at 1100 °C.

  1. Barium isotope fractionation during witherite (BaCO3) dissolution, precipitation and at equilibrium

    Science.gov (United States)

    Mavromatis, Vasileios; van Zuilen, Kirsten; Purgstaller, Bettina; Baldermann, Andre; Nägler, Thomas F.; Dietzel, Martin

    2016-10-01

    This study examines the behavior of Ba isotope fractionation between witherite and fluid during mineral dissolution, precipitation and at chemical equilibrium. Experiments were performed in batch reactors at 25 °C in 10-2 M NaCl solution where the pH was adjusted by continuous bubbling of a water saturated gas phase of CO2 or atmospheric air. During witherite dissolution no Ba isotope fractionation was observed between solid and fluid. In contrast, during witherite precipitation, caused by a pH increase, a preferential uptake of the lighter 134Ba isotopomer in the solid phase was observed. In this case, the isotope fractionation factor αwitherite-fluid is calculated to be 0.99993 ± 0.00004 (or Δ137/134Bawitherite-fluid ≈ -0.07 ± 0.04‰, 2 sd). The most interesting feature of this study, however, is that after the attainment of chemical equilibrium, the Ba isotope composition of the aqueous phase is progressively becoming lighter, indicating a continuous exchange of Ba2+ ions between witherite and fluid. Mass balance calculations indicate that the detachment of Ba from the solid is not only restricted to the outer surface layer of the solid, but affects several (∼7 unit cells) subsurface layers of the crystal. This observation comes in excellent agreement with the concept of a dynamic system at chemical equilibrium in a mineral-fluid system, denoting that the time required for the achievement of isotopic equilibrium in the witherite-fluid system is longer compared to that observed for chemical equilibrium. Overall, these results indicate that the isotopic composition of Ba bearing carbonates in natural environments may be altered due to changes in fluid composition without a net dissolution/precipitation to be observed.

  2. Adsorption of Ba{sup 2+} by Ca-exchange clinoptilolite tuff and montmorillonite clay

    Energy Technology Data Exchange (ETDEWEB)

    Chavez, M.L., E-mail: marilu@servidor.unam.mx [Facultad de Quimica, Universidad Nacional Autonoma de Mexico, Cd. Universitaria, 04510 Mexico, D. F. (Mexico); Pablo, L. de, E-mail: liberto@servidor.unam.mx [Instituto de Geologia, Universidad Nacional Autonoma de Mexico, Cd. Universitaria, 04510 Mexico, D. F. (Mexico); Garcia, T.A., E-mail: nenaquim@hotmail.com [Facultad de Quimica, Universidad Nacional Autonoma de Mexico, Cd. Universitaria, 04510 Mexico, D. F. (Mexico)

    2010-03-15

    The adsorption of barium by Ca-exchanged clinoptilolite and montmorillonite is presented. The kinetics of adsorption of Ba{sup 2+} were evaluated contacting 1 g portion of each adsorber with 100 mL 0.1N BaCl{sub 2} for 200 h. Adsorption by Ca-clinoptilolite is defined by second-order kinetics of rate constant K{sub v} 8.232 x 10{sup -2} g mg{sup -1} h{sup -1} and maximum removal of 71.885 mg g{sup -1}. It is a two-stage process initiated by a rapid uptake of Ba{sup 2+} followed by more moderate kinetics. The adsorption isotherms were determined contacting 0.2 g of each adsorber with 10 mL 0.1-0.005N BaCl{sub 2} + CaCl{sub 2} solution, Ba{sup 2+}/Ca{sup 2+} ratio 1, for periods of 7 days for the tuff and 2 days for the clay. The equilibrium adsorption is described by the Langmuir model, of equilibrium constant K 0.0151 L mg{sup -1} and maximum adsorption of 15.29 mg g{sup -1}. The adsorption of Ba{sup 2+} by Ca-exchanged montmorillonite also follows a second-order reaction of rate constant K{sub v} 3.179 x 10{sup -2} g mg{sup -1} h{sup -1}, and calculated separation of 36.74 mg g{sup -1}; the Langmuir isotherm is defined by the constant K 0.034 L mg{sup -1} and maximum adsorption of 15.29 mg g{sup -1}. X-ray diffraction shows that the exchange of Ba{sup 2+} modifies the d{sub 001} of Ca-montmorillonite from 15.4 to 12.4 A.

  3. Solution based approaches for the morphology control of BaTiO3 particulates

    Directory of Open Access Journals (Sweden)

    Florentina Maxim

    2010-09-01

    Full Text Available Within the action COST 539 - ELENA our contribution was aimed at studying solution based approaches for the morphology control of BaTiO3 particulates. Initially, our kinetic analysis and systematic structural and morphological studies, demonstrated that during hydrothermal synthesis from layered titanate nanotubes (TiNTS, BaTiO3 forms via two mechanisms depending on the temperature and time. At low temperatures (90°C, “wild” type BaTiO3 dendritic particles with cubic structure were formed through a phase boundary topotactic reaction. At higher temperatures and/or for longer times time, the reaction is controlled by a dissolution precipitation mechanism and “seaweed” type BaTiO3 dendrites are formed. Our results unambiguously elucidated why TiNTs do not routinely act as templates for the formation of 1D BaTiO3.In our subsequent investigations, the effect of additives on the aqueous and hydrothermal synthesis of BaTiO3 was assessed. We reported that although the tested additives influenced the growth of BaTiO3, their behaviour varied; poly(acrylic acid (PAA adsorbed on specific crystallographic faces changing the growth kinetics and inducing the oriented attachment of the particles; poly(vinyl pyrrolidone (PVP, sodium dodecylsulfate (SDS and hydroxypropylmethylcellulose (HPMC act as growth inhibitors rather than crystal habit modifiers; and DFructose appeared to increase the activation energy for nucleation, resulting in small crystals (26 nm. Our work clearly indicates that the synthesis of 1D nanostructures of complex oxides by chemical methods is non trivial.

  4. Stabilisation des phases monocristallines quadratique et cubique dans BaTiO3

    Science.gov (United States)

    Amami, J.; Goutaudier, C.; Trabelsi-Ayadi, M.; Boulon, G.

    2004-12-01

    Single crystals of Ba1-xYbxTiO3 and Ba1-xSrxTiO3 with tetragonal structure were grown by the floating zone (FZ) method using an LHPG (Laser Heated Pedestal Growth) technique. The grown crystals, typically 1 mm in diameter and 8 mm in length, were yellowish transparent. Substitution of more than 2.5 at % Sr for Ba in BaTiO3 and addition of 3 to 5 at % Ln (Ln= Yb, Eu), were effective in preventing the formation of the hexagonal phase. The Eu3+ emission spectra recorded at room temperature demonstrate a significant intensity enhancement of the 5D0 → 7F1 magnetic dipolar transition compared to the 5D0 → 7F2 electric dipolar transition. Les fibres monocristallines de Ba1-xYbxTiO3 et Ba1-xSrxTiO3 de structure quadratique ont été préparées par la méthode de la zone flottante (FZ) en utilisant la technique LHPG (Laser Heated Pedestal Growth). Les échantillons élaborés, de dimensions 1mm x 8 mm, sont jaunâtres et transparentes. La substitution du baryum par plus de 2,5 mol% de Sr dans BaTiO3 et le dopage de 3 à 5 mol% de Ln (Ln = Yb, Eu) évitent la formation de la phase hexagonale. Le spectre d’émission de Eu3+ enregistré à température ambiante montre le changement de structure traduit par la forte intensité de la transition dipolaire magnétique 5D0 → 7F1 comparée à celle de la transition dipolaire électrique 5D0 → 7F2.

  5. High temperature transport properties of BaZn{sub 2}Sn{sub 2}

    Energy Technology Data Exchange (ETDEWEB)

    Aydemir, U., E-mail: uaydemir@caltech.edu [Department of Materials Science, California Institute of Technology, 1200 E California Blvd., Pasadena (United States); Department of Chemistry, Koç University, Rumelifeneri Yolu, Sariyer, Istanbul (Turkey); Zevalkink, A.; Bux, S. [Thermal Energy Conversion Technologies Group, Jet Propulsion Laboratory, 4800 Oak Grove Drive, Pasadena (United States); Snyder, G.J. [Department of Materials Science, California Institute of Technology, 1200 E California Blvd., Pasadena (United States)

    2015-02-15

    Highlights: • BaZn{sub 2}Sn{sub 2} is obtained from the solid state reaction and Sn flux methods. • BaZn{sub 2}Sn{sub 2} structure contains PbO-like {ZnSn_4_/_4} and anti-PbO-like {SnZn_4_/_4} layers. • Weak or nonbonding interaction in BaZn{sub 2}Sn{sub 2} may lead to partially filled orbitals. • BaZn{sub 2}Sn{sub 2} displays a metal-like electronic and thermal transport properties. - Abstract: BaZn{sub 2}Sn{sub 2} (space group P4/nmm, a = 4.7459(5) Å, c = 11.330(2) Å, Z = 2) crystallizes in the CaBe{sub 2}Ge{sub 2} structure type with a polyanionic framework comprising alternately stacked PbO-like {ZnSn_4_/_4} and anti-PbO-like {SnZn_4_/_4} layers along the c-axis. BaZn{sub 2}Sn{sub 2} samples were obtained by either direct solid state reaction of the elements or from a Sn-flux method in very high yield with very small amount of β-Sn as the secondary phase. The samples were characterized by powder X-ray diffraction (PXRD) and scanning electron microscopy (SEM). The chemical compositions were determined to be off-stoichiometric with Zn/Sn ratio lower than 1.0 and Sn2 atoms in the crystal structure were found to be either loosely bonded or not bonded which might lead to an incomplete charge balance. Electrical and thermal transport measurements have been performed in the temperature range 300-773 K. BaZn{sub 2}Sn{sub 2} displays the electrical resistivity of a metal (or semimetal) along with very low Seebeck coefficients and relatively high thermal conductivity.

  6. Magnetic properties of anisotropic Ba-Zn-Li system W-type hexagonal ferrites; Ihosei Ba-Zn-Li kei W gata ropposho ferrite no jiki tokusei

    Energy Technology Data Exchange (ETDEWEB)

    Yamamoto, H.; Chono, M. [Meiji University, Tokyo (Japan). School of Science and Technology

    1997-06-15

    This paper describes effects of composition and in-air sintering conditions of anisotropic Ba-Zn-Li system W-type ferrites on their magnetic and mechanical properties. Single W-phase was obtained during semi-sintering by displacing 2Zn{sup 2+} with Li{sup +} and Fe{sup 3+} in the Ba[Zn2(1-x)(LiFe)x]Fe(18)O(27) compound. Phases except W-phase were formed during sintering of the obtained specimen. When the displacement amount of LiFe, x=0.3, the magnetic property (BH)max reached the maximum value. There was not a remarkable improvement compared with the case without displacement. When BaO was added after semi-sintering, the single W-phase could be obtained at lower temperature and the (BH)max value became larger than that before its addition. When the displacement amount of LiFe, x=0.3 in Ba[Zn2(1-x)(LiFe)x]Fe(18)O(27) and 3wt% BaO was added after the semi-sintering, the optimum magnetic property was obtained. For the fabrication conditions, the semi-sintering was conducted at 1275degC for 1 hour in air, and the sintering was conducted at 1225degC for 0.5h in air. A value of (BH)max, 20.40 kJ/m{sup 3} was obtained. 20 refs., 9 figs., 3 tabs.

  7. Comparison of rheological, mechanical, electrical properties of HDPE filled with BaTiO3 with different polar surface tension

    Science.gov (United States)

    Su, Jun; Zhang, Jun

    2016-12-01

    In this work, three types of coupling agents: isopropyl trioleic titanate (NDZ105), vinyltriethoxysilane (SG-Si151), 3-aminopropyltriethoxysilane (KH550) were applied to modify the surface tension of Barium titanate (BaTiO3) particles. The Fourier transform infrared (FT-IR) spectra confirm the chemical adherence of coupling agents to the particle surface. The long hydrocarbon chains in NDZ105 can cover the particle surface and reduce the polar surface tension of BaTiO3 from 37.53 mJ/m2 to 7.51 mJ/m2, turning it from hydrophilic to oleophilic properties. The short and non-polar vinyl groups in SG-Si151 does not influence the surface tension of BaTiO3, but make BaTiO3 have both hydrophilic and oleophilic properties. The polar amino in KH550 can keep BaTiO3 still with hydrophilic properties. It is found that SG-Si151 modified BaTiO3 has the lowest interaction with HDPE matrix, lowering the storage modulus of HDPE composites to the greatest extent. As for mechanical properties, the polar amino groups in KH550 on BaTiO3 surface can improve the adhesion of BaTiO3 with HDPE matrix, which increases the elongation at break of HDPE composites to the greatest extent. In terms of electrical properties, the polar amino groups on surface of BaTiO3 can boost the dielectric properties of HDPE/BaTiO3 composites and decrease the volume resistivity of HDPE/BaTiO3 composites. The aim of this study is to investigate how functional groups affect the rheological, mechanical and electrical properties of HDPE composites and to select a coupling agent to produce HDPE/BaTiO3 composites with low dielectric loss, high dielectric constant and elongation at break.

  8. Anomalous Ba/Ca signals associated with low temperature stresses in Porites corals from Daya Bay, northern South China Sea

    Institute of Scientific and Technical Information of China (English)

    Tianran Chen; Kefu Yu; Shu Li; Tegu Chen; Qi Shi

    2011-01-01

    Barium to calcium (Ba/Ca) ratio in corals has been considered as a useful geochemical proxy for upwelling,river flood and other oceanic processes.However,recent studies indicated that additional environmental or biological factors can influence the incorporation of Ba into coral skeletons.In this study,Ba/Ca ratios of two Porites corals collected from Daya Bay,northern South China Sea were analyzed.Ba/Ca signals in the two corals were 'anomalous' in comparison with Ba behaviors seen in other near-shore corals influenced by upwelling or riverine runoff.Our Ba/Ca profiles displayed similar and remarkable patterns characterized by low and randomly fluctuating background signals periodically interrupted by sharp and large synchronous peaks,clearly indicating an environmental forcing.Further analysis indicated that the Ba/Ca profiles were not correlated with previously claimed environmental factors such as precipitation,coastal upwelling,anthropogenic activities or phytoplankton blooms in other areas.The maxima of Ba/Ca appeared to occur in the period of Sr/Ca maxima,coinciding with the winter minimum temperatures,which suggests that the anomalous high Ba/Ca signals were related to winter-time low sea surface temperature.We speculated that the Ba/Ca peaks in corals of the Daya Bay were most likely the results of enrichment of Ba-rich particles in their skeletons when coral polyps retracted under the stresses of anomalous winter low temperatures.In this case,Ba/Ca ratio in relatively high-latitude corals can be a potential proxy for tracing the low temperature stress.

  9. Jumping the gun: Smoking constituent BaP causes premature primordial follicle activation and impairs oocyte fusibility through oxidative stress

    Energy Technology Data Exchange (ETDEWEB)

    Sobinoff, A.P.; Pye, V. [Reproductive Science Group, School of Environmental and Life Sciences, University of Newcastle, Callaghan, NSW2308 (Australia); Nixon, B.; Roman, S.D. [Reproductive Science Group, School of Environmental and Life Sciences, University of Newcastle, Callaghan, NSW2308 (Australia); ARC Centre of Excellence in Biotechnology and Development, University of Newcastle, Callaghan, NSW2308 (Australia); McLaughlin, E.A., E-mail: eileen.mclaughlin@newcastle.edu.au [Reproductive Science Group, School of Environmental and Life Sciences, University of Newcastle, Callaghan, NSW2308 (Australia); ARC Centre of Excellence in Biotechnology and Development, University of Newcastle, Callaghan, NSW2308 (Australia)

    2012-04-01

    Benzo(a)pyrene (BaP) is an ovotoxic constituent of cigarette smoke associated with pre-mature ovarian failure and decreased rates of conception in IVF patients. Although the overall effect of BaP on female fertility has been documented, the exact molecular mechanisms behind its ovotoxicity remain elusive. In this study we examined the effects of BaP exposure on the ovarian transcriptome, and observed the effects of in vivo exposure on oocyte dysfunction. Microarray analysis of BaP cultured neonatal ovaries revealed a complex mechanism of ovotoxicity involving a small cohort of genes associated with follicular growth, cell cycle progression, and cell death. Histomorphological and immunohistochemical analysis supported these results, with BaP exposure causing increased primordial follicle activation and developing follicle atresia in vitro and in vivo. Functional analysis of oocytes obtained from adult Swiss mice treated neonatally revealed significantly increased levels of mitochondrial ROS/lipid peroxidation, and severely reduced sperm-egg binding and fusion in both low (1.5 mg/kg/daily) and high (3 mg/kg/daily) dose treatments. Our results reveal a complex mechanism of BaP induced ovotoxicity involving developing follicle atresia and accelerated primordial follicle activation, and suggest short term neonatal BaP exposure causes mitochondrial leakage resulting in reduced oolemma fluidity and impaired fertilisation in adulthood. This study highlights BaP as a key compound which may be partially responsible for the documented effects of cigarette smoke on follicular development and sub-fertility. -- Highlights: ► BaP exposure up-regulates canonical pathways linked with follicular growth/atresia. ► BaP causes primordial follicle activation and developing follicle atresia. ► BaP causes oocyte mitochondrial ROS and lipid peroxidation, impairing fertilisation. ► Short term neonatal BaP exposure compromises adult oocyte quality.

  10. A light-modified ferroelectric resistive switching behavior in Ag/BaMoO4/FTO device at ambient temperature

    Science.gov (United States)

    Zhao, W. X.; Sun, B.; Liu, Y. H.; Wei, L. J.; Li, H. W.; Chen, P.

    2014-12-01

    BaMoO4 powder was prepared by a facile hydrothermal synthesis. And the BaMoO4/FTO device was fabricated by a spin-coated method, in which the thickness of BaMoO4 layer is about 20 μm. The bipolar resistive switching effect has been observed in Ag/BaMoO4/FTO device. Moreover, the resistive switching effect of the device is greatly improved by white light irradiation. The resistive switching behavior is explained by the polarization reversal that changes the charge distribution and modulates the Schottky barriers.

  11. Synthesis of BaTiO3 powder from barium titanyl oxalate (BTO) precursor employing microwave heating technique

    Indian Academy of Sciences (India)

    Y S Malghe; A V Gurjar; S R Dharwadkar

    2004-06-01

    Cubic barium titanate (BaTiO3) powder was synthesized by heating barium titanyl oxalate hydrate, BaTiO(C2O4)$_{2}\\cdot$4H2O (BTO) precursor in microwave heating system in air at 500°C. Heating BTO in microwave above 600°C yielded tetragonal form of BaTiO3. Experiments repeated in silicon carbide furnace showed that BaTiO3 was formed only above 700°C. The product obtained was cubic.

  12. Effect of Low Molecule Polyamide and Nano-SiO2 on Properties of the Poly (MMA/BA/MAA)

    Institute of Scientific and Technical Information of China (English)

    Wenjun ZOU; Bo LIAO; Jin PENG; Linqi ZHANG; Yun YANG; Furen XIAO

    2007-01-01

    Effects of Iow molecule polyamide (LMPA) and namometer SiO2 particles on the properties of the poly (MMA/BA/MAA) adhesive for wearable and nonskid PVC (polyvinyl carbazole) materials were investigated. The experimental results show that the shear strength of poly (MMA/BA/MAA)/LMPA is increased, when the LMPA is added into poly (MMA/BA/MAA). The optimum addition of LMPA is about 4 wt pct. By adding 3 wt pct nano-SiO2 into poly (MMA/BA/MAA)/LMPA adhesive, its properties such as the shear strength,thermal stability, wear resistance and sea waterproof resistance are increased too.

  13. Ba-ion extraction from a high pressure Xe gas for double-beta decay studies with EXO

    CERN Document Server

    Brunner, T; Sabourov, A; Varentsov, V L; Gratta, G; Sinclair, D

    2013-01-01

    An experimental setup is being developed to extract Ba ions from a high-pressure Xe gas environment. It aims to transport Ba ions from 10 bar Xe to vacuum conditions. The setup utilizes a converging-diverging nozzle in combination with a radio-frequency (RF) funnel to move Ba ions into vacuum through the pressure drop of several orders of magnitude. This technique is intended to be used in a future multi-ton detector investigating double-beta decay in $^{136}$Xe. Efficient extraction and detection of Ba ions, the decay product of Xe, would allow for a background-free measurement of the $^{136}$Xe double-beta decay.

  14. Luminescence properties of BaB8O13:Eu under UV and VUV excitation

    Institute of Scientific and Technical Information of China (English)

    HE Ling; WANG Yuhua; SUN Weimin

    2009-01-01

    The phosphor BaB8O13:Eu3+ were synthesized by solid-state reaction, and their luminescent properties were studied under 254 and 147 nm excitation. The excitation spectrum showed two broad bands in the range of 100-300 nm: one was the host lattice absorption with the maxima at 160 nm and the other was Ba-O absorption overlapped with the CT band of Eu3+, which indicated that the energy of the host lat-tice absorption could be efficiently transferred to the Eu3+. The overlapped bands were tended to separate when monitored by different wave-length, which indicated that at least two Ba2+ sites were available in BaB8O13. The emissions of Eu3+ (612 nm) and Eu2+ (405 nm) were both observed in the emission spectra of BaB8O13:Eu3+ under the excitation of either 254 or 147 nm. With the doping concentration of Eu3+ in-creasing, the 612 nm emission was enhanced while 405 nm emission was decreased under 254 nm excitation, which was due to the persistent energy transfer from Eu2+ to Eu3+. While under 147 nm excitation, the 612 nm emission was quenched and the 405 nm emission was en-hanced. It was concluded that the preferential excitation of Eu2+ under 147 nm excitation was one of the reasons for this facts.

  15. Large linear magnetoresistance in a new Dirac material BaMnBi2

    Science.gov (United States)

    Wang, Yi-Yan; Yu, Qiao-He; Xia, Tian-Long

    2016-10-01

    Dirac semimetal is a class of materials that host Dirac fermions as emergent quasi-particles. Dirac cone-type band structure can bring interesting properties such as quantum linear magnetoresistance and large mobility in the materials. In this paper, we report the synthesis of high quality single crystals of BaMnBi2 and investigate the transport properties of the samples. BaMnBi2 is a metal with an antiferromagnetic transition at T N = 288 K. The temperature dependence of magnetization displays different behavior from CaMnBi2 and SrMnBi2, which suggests the possible different magnetic structure of BaMnBi2. The Hall data reveals electron-type carriers and a mobility μ(5 K) = 1500 cm2/V·s. Angle-dependent magnetoresistance reveals the quasi-two-dimensional (2D) Fermi surface in BaMnBi2. A crossover from semiclassical MR ˜ H 2 dependence in low field to MR ˜ H dependence in high field, which is attributed to the quantum limit of Dirac fermions, has been observed in magnetoresistance. Our results indicate the existence of Dirac fermions in BaMnBi2. Project supported by the National Natural Science Foundation of China (Grant No. 11574391), the Fundamental Research Funds for the Central Universities, and the Research Funds of Renmin University of China (Grant No. 14XNLQ07).

  16. Phase equilibria of Ba-R-Cu-O for coated conductor applications (R lanthanides and Y)

    Energy Technology Data Exchange (ETDEWEB)

    Wong-Ng, W.; Cook, L.P.; Levin, I.; Suh, J.; Feenstra, R.; Haugan, T.; Barnes, P

    2004-08-01

    Phase diagrams of the Ba{sub 2}RCu{sub 3}O{sub 6+x}(R = Nd, Sm, Gd, Y, and Er) superconductors, prepared under 100 Pa O{sub 2} at 810 deg. C, reflect the trend of the lanthanide contraction. The single-phase regions of Ba{sub 2-x}(Nd{sub 1+x-y}R{sup '}{sub y})Cu{sub 3}O{sub 6+z} for R{sup '} = Gd, Y and Yb, and of Ba{sub 2-x}(R{sub 1+x-y}Y{sub y})Cu{sub 3}O{sub 6+z} for R = Eu and Gd were determined. Using these data, both flux-pinning and melting properties can be tailored and optimized. The presence of a low temperature melt during formation of the Ba{sub 2}YCu{sub 3}O{sub 6+x} phase from barium fluoride amorphous precursor films is deemed important for producing quality tapes, and hence for rapid advancement of second-generation RABiTS/IBAD coated conductor technology. Our search for low melting liquid has focused on compositional vectors within the Ba, Y, Cu-O, F reciprocal system.

  17. The low Sr/Ba ratio on some extremely metal-poor stars

    CERN Document Server

    Spite, M; Bonifacio, P; Caffau, E; François, P; Sbordone, L

    2014-01-01

    It has been noted that, in classical extremely metal-poor (EMP) stars, the abundance ratio of Sr and Ba, is always higher than [Sr/Ba] = -0.5, the value of the solar r-only process; however, a handful of EMP stars have recently been found with a very low Sr/Ba ratio. We try to understand the origin of this anomaly by comparing the abundance pattern of the elements in these stars and in the classical EMP stars. Four stars with very low Sr/Ba ratios were observed and analyzed within LTE approximation through 1D (hydrostatic) model atmosphere, providing homogeneous abundances of nine neutron-capture elements. In CS 22950-173, the only turnoff star of the sample, the Sr/Ba ratio is, in fact, found to be higher than the r-only solar ratio, so the star is discarded. The remaining stars (CS 29493-090, CS 30322-023, HE 305-4520) are cool evolved giants. They do not present a clear carbon enrichment. The abundance patterns of the neutron-capture elements in the three stars are strikingly similar to a theoretical s-pro...

  18. Stable and Vibrational Octupole Modes in Mo, Xe, Ba, La, Ce and Nd

    Energy Technology Data Exchange (ETDEWEB)

    Gore, P.M.; Hamilton, J.H.; Hwang, J.K.; Jones, E.F.; Peker, L.K.; Ramayya, A.V.; Zhang, X.Q.; Zhu, S.J.

    1998-05-18

    Evidence is presented for stable octupole deformation in neutron-rich nuclei, bounded by Z = 54-58 and N = 85-92. To either side of this region negative parity bands built on more vibrational type octupole modes are observed in {sup 140}Ba and {sup 152,154}Nd. The largest stable octupole deformation ({beta}{sub s} {approximately} 0.1) is found in {sup 144}Ba{sub as}. The theoretically predicted quenching ({beta}{sub s} {approximately} 0) of stable octupole deformation at higher spins is found in {sup 140}Ba. There is good agreement between theory and experiment for the strongly varying electric dipole moments as a function of mass for {sup 142-141}Ba. In odd-A {sup 142}Ba and odd-Z {sup 140}La, we observe parity doublets, two pairs of positive and negative parity bands with opposite spins. In {sup 145}La a strong coupled ground band with symmetric shape coexists with the asymmetric octupole shape which stabilizes above about spin 19/2. In {sup 145,147}La a strong reduction in E2 strength around 25/2 from band crossing is observed. The isotope {sup 109}Mo was identified and a new region of stable uctpole deformation is identified in {sup 107,108}Mo centered around N = 64-66 as earlier predicted. This is the first case of stable uctpole deformation involving only one pair of orbitals.

  19. BaTiO3 and polypropylene nanocomposites for capacitor applications

    Science.gov (United States)

    Dong, Daxuan; Tang, Longxiang; Zhu, Lei; Lee, Je; Case Western Reserve University Collaboration; Agiltron, Inc Collaboration

    2013-03-01

    A novel strategy to uniformly disperse 70-nm BaTiO3 ferroelectric nanoparticles in a dielectric polypropylene (PP) matrix is developed in order to achieve high dielectric constant and high energy density for capacitor applications. By modifying BaTiO3 surface with a bis-phosphonic acid-terminated polyhedral oligomeric selsisquioxane (POSS), a nanocomposite with BaTiO3@POSS uniformly dispersed in PP matrix was achieved. The nanocomposite film containing a high nanoparticle content of 30 vol.% exhibited a high dielectric constant of 32 and a breakdown voltage of 220 MV/m, but with a high energy loss. Improvement of this nanocomposite by understanding the interfacial polarization is carried out in this work. The dielectric constant difference between BaTiO3 and PP can generate interfacial polarization and subsequent internal conduction in BaTiO3 particles upon bipolar polarization. Reduction of this internal conduction mechanism will significantly reduce the hysteresis loss in polymer nanodielectrics.

  20. Preparation and microwave-absorbing property of EP/BaFe12O19/PANI composites

    Science.gov (United States)

    Feng, Huixia; Bai, Dezhong; Tan, Lin; Chen, Nali; Wang, Yueyi

    2017-07-01

    In this paper, we introduced expanded perlite (EP) into the system of ferrite composites for the first time. By sol-gel self-propagating combustion method, expanded perlite/barium ferrite (EP/BaFe12O19) was prepared, and then ternary composites of expanded perlite/barium ferrite/polyaniline (EP/BaFe12O19/PANI) were obtained by in-situ oxidative polymerization of aniline on EP/BaFe12O19 mixture. Although, as is well known, the values of saturation magnetization (Ms), remnant magnetization (Mr) and coercivity (Hc) of composites are all lower than the pure BaFe12O19 particles owing to the existence of the nonmagnetic EP and PANI, the EP/BaFe12O19/PANI composites exhibit absorption characteristics at the range of 2-18 GHz, the effective absorption bandwidth (less than -4 dB) reached 12.12 GHz and the minimum reflection loss of -5.66 dB at 8.48 GHz with only 2 mm thickness of absorbing layer. So the composites could resist urban electromagnetic pollution, such as wireless network, communication and so on, effectively.

  1. Size dependent magnetic and electrical properties of Ba-doped nanocrystalline BiFeO3

    Directory of Open Access Journals (Sweden)

    Mehedi Hasan

    2016-03-01

    Full Text Available Improvement in magnetic and electrical properties of multiferroic BiFeO3 in conjunction with their dependence on particle size is crucial due to its potential applications in multifunctional miniaturized devices. In this investigation, we report a study on particle size dependent structural, magnetic and electrical properties of sol-gel derived Bi0.9Ba0.1FeO3 nanoparticles of different sizes ranging from ∼ 12 to 49 nm. The substitution of Bi by Ba significantly suppresses oxygen vacancies, reduces leakage current density and Fe2+ state. An improvement in both magnetic and electrical properties is observed for 10 % Ba-doped BiFeO3 nanoparticles compared to its undoped counterpart. The saturation magnetization of Bi0.9Ba0.1FeO3 nanoparticles increase with reducing particle size in contrast with a decreasing trend of ferroelectric polarization. Moreover, a first order metamagnetic transition is noticed for ∼ 49 nm Bi0.9Ba0.1FeO3 nanoparticles which disappeared with decreasing particle size. The observed strong size dependent multiferroic properties are attributed to the complex interaction between vacancy induced crystallographic defects, multiple valence states of Fe, uncompensated surface spins, crystallographic distortion and suppression of spiral spin cycloid of BiFeO3.

  2. Innovative treatment trains of bottom ash (BA) from municipal solid waste incineration (MSWI) in Germany.

    Science.gov (United States)

    Holm, Olaf; Simon, Franz-Georg

    2017-01-01

    The industrial sector of bottom ash (BA) treatment from municipal solid waste incineration (MSWI) in Germany is currently changing. In order to increase the recovery rates of metals or to achieve a higher quality of mineral aggregates derived from BA, new procedures have been either implemented to existing plants or completely new treatment plants have been built recently. Three treatment trains, which are designated as entire sequences of selected processing techniques of BA, are introduced and compared. One treatment train is mainly characterized by usage of a high speed rotation accelerator whereas another is operating completely without crushing. In the third treatment train the BA is processed wet directly after incineration. The consequences for recovered metal fractions and the constitution of remaining mineral aggregates are discussed in the context of legislative and economical frameworks. Today the recycling or disposal options of mineral residues still have a high influence on the configuration and the operation mode of the treatment trains of BA despite of the high value of recovered metals.

  3. Oxygen behavior in Y1-xZrxBaCo4O7+δ

    Directory of Open Access Journals (Sweden)

    Delin Yang

    2011-06-01

    Full Text Available Y1-xZrxBaCo4O7+δ (x = 0.0, 0.05, 0.1, 0.2, 0.4, 0.6 samples were synthesized by the solid state reaction method. The effects of Zr substitution for Y on the oxygen uptake/release properties of these samples were investigated by thermogravimetric (TG from room temperature to 1150°C. The results show that there exists an optimizing Zr doping amount. The Y0.9Zr0.1BaCo4O7+δ sample can uptake more oxygen than the undoped YBaCo4O7+δ sample at 360°C. Especially, in an oxygen uptake/release cycles between 340°C and 410°C, the mass change of the doped Y0.9Zr0.1BaCo4O7+δ sample can reach 5.3 % of its original mass and show a stable oxygen uptake/release reproducibility. In addition, in the oxygen uptake/release cycles switched between oxygen and nitrogen atmosphere at 350°C, Y0.9Zr0.1BaCo4O7+δ can also adsorb more oxygen. These properties of Y1-xZrxBaCo4O7+δ make them to be a potential candidate in the field of gas purification and separation.

  4. Superconductivity in the ternary iridium-arsenide BaIr2As2

    Science.gov (United States)

    Wang, Xiao-Chuan; Ruan, Bin-Bin; Yu, Jia; Pan, Bo-Jin; Mu, Qing-Ge; Liu, Tong; Chen, Gen-Fu; Ren, Zhi-An

    2017-03-01

    Here we report the synthesis and discovery of superconductivity in a novel ternary iridium-arsenide compound BaIr2As2. The polycrystalline BaIr2As2 sample was first synthesized by a high temperature and high pressure method. Crystal structural analysis indicates that BaIr2As2 crystallizes in the ThCr2Si2-type layered tetragonal structure with space group I4/mmm (No. 139), and the lattice parameters were refined to be a = 4.052(9) Å and c = 12.787(8) Å. By the electrical resistivity and magnetic susceptibility measurements we found type-II superconductivity in the new BaIr2As2 compound with a T c (critical temperature) of 2.45 K, and an upper critical field μ 0 H c2(0) about 0.2 T. Low temperature specific heat measurements gave a Debye temperature of about 202 K and a distinct specific jump with ΔC e /γT c = 1.36, which is close to the value of BCS weak coupling limit and confirms the bulk superconductivity in this new BaIr2As2 compound.

  5. Microstructure and Cs Behavior of Ba-Doped Aluminosilicate Pollucite Irradiated with F+ Ions

    Energy Technology Data Exchange (ETDEWEB)

    Jiang, Weilin; Kovarik, Libor; Zhu, Zihua; Varga, Tamas; Engelhard, Mark H.; Bowden, Mark E.; Nenoff, Tina M.; Garino, Terry

    2014-06-24

    Radionuclide 137Cs is one of the major fission products that dominate heat generation in spent fuels over the first 300 hundred years. A durable waste form for 137Cs that decays to 137Ba is needed to minimize its environmental impact. Aluminosilicate pollucite CsAlSi2O6 is selected as a model waste form to study the decay-induced structural effects. While Ba-containing precipitates are not present in charge-balanced Cs0.9Ba0.05AlSi2O6, they are found in Cs0.9Ba0.1AlSi2O6 and identified as monoclinic Ba2Si3O8. Pollucite is susceptible to electron irradiation induced amorphization. The threshold density of the electronic energy deposition for amorphization is determined to be ~235 keV/nm3. Pollucite can be readily amorphized under F+ ion irradiation at 673 K. A significant amount of Cs diffusion and release from the amorphized pollucite is observed during the irradiation. However, cesium is immobile in the crystalline structure under He+ ion irradiation at room temperature. The critical temperature for amorphization is not higher than 873 K under F+ ion irradiation. If kept at or above 873 K all the time, the pollucite structure is unlikely to be amorphized; Cs diffusion and release are improbable. A general discussion regarding pollucite as a potential waste form is provided in this report.

  6. Preparation and electrical properties of BaPbO3 thin film

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    BaPbO3 thin films were deposited on Al2O3 substrates by sol-gel spin-coating and rapid thermal annealing. The microstructure and phase of BaPbO3 thin films were determined by X-ray diffractometry, scanning electrons microscopy and energy dispersive X-ray spectrometry. The influence of annealing temperature and annealing time on sheet resistance of the thin films was investigated. The results show that heat treatment, including annealing temperature and time, causes notable change in molar ratio of Pb to Ba, resulting in the variations of sheet resistance. The variation of electrical properties demonstrates that the surface state of the film changes from two-dimensional behavior to three-dimensional behavior with the increase of film thickness. Crack-free BaPbO3thin films with grain size of 90 nm can be obtained by a rapid thermal annealing at 700 ℃ for 10 min. And the BaPbO3 films with a thickness of 2.5 μm has a sheet resistance of 35 Ω.□-1.

  7. Review of a New IR Nonlinear Optical BaGa4Se7 Crystal

    Institute of Scientific and Technical Information of China (English)

    Wen-Tao Xu; De-Gang Xu; Yu-Ye Wang; Peng-Xiang Liu; Wei Shi; Jian-Quan Yao

    2016-01-01

    A newly grown BaGa4Se7 crystal has been synthesized via the Bridgman-Stockbarger technique. This new crystal has advantages of high nonlinear optics (NLO) coefficients, high laser damage thresholds, and wide transparent regions. The BaGa4Se7 crystal has bright application prospects as a nonlinear gain medium in mid-infrared and terahertz regions. In this paper, the crystalline structure and synthetic method of the BaGa4Se7 crystal are introduced. The refractive indices and absorption coefficients along three dielectric axes between 0.1THz and 1.0THz are also obtained. The terahertz difference frequency generation (THz-DFG) characteristics based on the BaGa4Se7 crystal in the frequency range of 0.1THz to 1.0THz are analyzed theoretically and the phase-matching conditions are calculated. The application of BaGa4Se7 crystals in terahertz wave generation is also discussed.

  8. Nearly massless Dirac fermions hosted by Sb square net in BaMnSb2

    Science.gov (United States)

    Liu, Jinyu; Hu, Jin; Cao, Huibo; Zhu, Yanglin; Chuang, Alyssa; Graf, D.; Adams, D. J.; Radmanesh, S. M. A.; Spinu, L.; Chiorescu, I.; Mao, Zhiqiang

    2016-01-01

    Layered compounds AMnBi2 (A = Ca, Sr, Ba, or rare earth element) have been established as Dirac materials. Dirac electrons generated by the two-dimensional (2D) Bi square net in these materials are normally massive due to the presence of a spin-orbital coupling (SOC) induced gap at Dirac nodes. Here we report that the Sb square net in an isostructural compound BaMnSb2 can host nearly massless Dirac fermions. We observed strong Shubnikov-de Haas (SdH) oscillations in this material. From the analyses of the SdH oscillations, we find key signatures of Dirac fermions, including light effective mass (~0.052m0; m0, mass of free electron), high quantum mobility (1280 cm2V−1S−1) and a π Berry phase accumulated along cyclotron orbit. Compared with AMnBi2, BaMnSb2 also exhibits much more significant quasi two-dimensional (2D) electronic structure, with the out-of-plane transport showing nonmetallic conduction below 120 K and the ratio of the out-of-plane and in-plane resistivity reaching ~670. Additionally, BaMnSb2 also exhibits a G-type antiferromagnetic order below 283 K. The combination of nearly massless Dirac fermions on quasi-2D planes with a magnetic order makes BaMnSb2 an intriguing platform for seeking novel exotic phenomena of massless Dirac electrons. PMID:27466151

  9. Impacts of Mining and Urbanization on the Qin-Ba Mountainous Environment, China

    Directory of Open Access Journals (Sweden)

    Xinliang Xu

    2016-05-01

    Full Text Available The Qin-Ba Ecological Functional Zone is a component of China’s ecological security pattern designed to protect the regional ecosystem and maintain biodiversity. However, due to the impact of mining and urban encroachment, the plight of a sustainable ecosystem in the Qin-Ba mountainous area is deteriorating. This paper has used a remote sensing and geographic information system (GIS to examine the impacts of mining and urban encroachment on the environment in the Qin-Ba mountainous area. The results indicate that the total mined area in 2013 was 22 km2 and is predicted to escalate. Results also show that the ecosystems in Fengxian County, Shaanxi Province and Baokang County, Hubei Province were most severely affected by mining. Urbanization in the Qin-Ba mountainous area has seen an increase of 85.58 km2 in urban land use from 2010 to 2013. In addition, infrastructure development including airport construction, tourism resorts and real estate development in the Qin-Ba mountainous area has intensified environmental and biodiversity disturbances since large areas of forest have been cleared. Our results should provide insight and assistance to city planners and government officials in making informed decisions.

  10. Superconductivity in Yb-doped BaFe{sub 2}As{sub 2}

    Energy Technology Data Exchange (ETDEWEB)

    Chen, S.C. [Department of Physics, National Chung Cheng University, Ming-Hsiung, Chia-Yi 62199, Taiwan, ROC (China); Lee, W.H., E-mail: phywhl@ccu.edu.tw [Department of Physics, National Chung Cheng University, Ming-Hsiung, Chia-Yi 62199, Taiwan, ROC (China); Lan, M.D. [Department of Physics, National Chung Hsing University, Taichung, Taiwan, ROC (China)

    2015-02-15

    Highlights: • Single crystal of (Ba{sub 1−x}Yb{sub x})Fe{sub 2}As{sub 2} (x = 0–0.2) has been grown. • The grown crystals have pure tetragonal ThCr{sub 2}Si{sub 2}-type structure. • (Ba{sub 1−x}Yb{sub x})Fe{sub 2}As{sub 2} (0.05 ≦ x ≦ 0.15) showed a T{sub c,onset} 18–20 K. - Abstract: We report the discovery of superconductivity in Yb-doped BaFe{sub 2}As{sub 2}. Single-crystal specimens of (Ba{sub 1−x}Yb{sub x})Fe{sub 2}As{sub 2} (x = 0–0.2) were grown by using FeAs flux and a slow-cooling method. The superconducting transition temperature for the crystals was determined by dc magnetic susceptibility measurements with a commercial SQUID magnetometer. A clear phase transition from paramagnetic to perfect diamagnetic state was observed around 18–20 K for the samples with nominal composition (Ba{sub 1−x}Yb{sub x})Fe{sub 2}As{sub 2} (0.05 ≦ x ≦ 0.15)

  11. [Research on the degradation of BaP with potassium ferrate characterized by fluorescence].

    Science.gov (United States)

    Chen, Yu-Zhe; He, Qiang; Yu, Dan-Ni; Li, Si; Tan, Xue-Mei

    2012-07-01

    The degradation of Benzo(a)pyrene (BaP) by potassium ferrate was researched by means of multiple fluorescence spectroscopic methods such as synchronous, time-scan, excitation emission matrix (EEM) and photometry, under the optimal condition. Within the degradation process, the characteristics of the BaP's concentration at different time-intervals, and the kinetics of the degradation of BaP by potassium ferrate were discussed. From the experimental data, both synchronous and EEM spectra's results showed that the concentration of BaP was reduced 90% by potassium ferrate within 20 s after degradation, and the reaction process was very slow after 60 s. The degradation kinetic equation, ln(F0/Ft) = 0.563 2t + 0.171 2, (R2 = 0.994 2), was obtained through a convenient and fast way combining the time-scan fluorescence data and photometry data, and the photometry included the synchronous photometry and emission photometry. According to the kinetic equation, the degradation of BaP by potassium ferrate was in accord with the order of the first order reaction. So this article could provide a very useful conference for the research on the pollutant degradation by potassium ferrate, especially for the degradation process and the degradation mechanisms.

  12. Effects of binder addition on the mechanical properties of bulk Y-Ba-Cu-O superconductors

    Science.gov (United States)

    Seki, H.; Wongsatanawarid, A.; Kobayashi, S.; Ikeda, Y.; Murakami, M.

    2010-11-01

    We studied the effects of binder addition on the mechanical properties of bulk Y-Ba-Cu-O superconductors. We prepared YBa2Cu3Oy, Y2BaCuO5 powders and polyvinyl alcohol mixed with water as a binder. These raw materials were mixed, and the binder-added powders were pressed into pellets. The hardness of the green compacts with binder is higher than that without the binder. However, the hardness of green compacts with 8% binder is the same as that with 4% binder. The maximum compression strength of the precursor with binder is higher than that without binder. Equally, the maximum strength of the green compacts with 8% binder is higher than that with 4% binder. The differential thermal analysis measurements showed that the exothermic reaction due to the decomposition of the organic binder started at 550 °C and gradually proceeded with further heating. After de-binder treatment, BaCO3 powders were produced on the green compacts. The green compacts were subjected to melt-processing. We also measured trapped magnetic fields of binder-added bulk Y-Ba-Cu-O superconductors with a Hall probe scanning device. Trapped magnetic field of the bulk added with 4% is higher than that of the binder-free bulk. Hence, Y-Ba-Cu-O bulk with suitable amount of binder shows good influence for mechanical strength and trapped magnetic field.

  13. Thermoluminescence studies of bismuth doped Ba xCa 1- xS nanostructures

    Science.gov (United States)

    Singh, Surender; Lochab, S. P.; Kumar, Ravi; Singh, Nafa

    2011-01-01

    Bismuth doped Ba 1- xCa xS:Bi ( x=0-1) nanocrystallities have been prepared by the solid state reaction method and characterized by XRD and TEM. X-ray diffraction analysis shows the formation of the compounds in cubic structure at room temperature. Only partial replacement of Ba is possible and we found that Ba 0.5Ca 0.5S:Bi could not be prepared due to the difference between ionic radii of barium and calcium. Thermoluminescence studies of these samples after exposure to UV radiation have been carried out. The TL glow curve of Ba xCa 1 -xS:Bi has been found to be a simple structure with a single peak at 405, 428 and 503 K for x=1, 0.8 and 0, respectively. The kinetic parameters at various heating rates namely activation energy ( E), order of kinetics ( b) and frequency factor ( s) of the Ba 1- xCa xS:Bi ( x=0.2) (0.4 mol%) sample have been determined using Chen’s method. The deconvolution of curve was done using the GCD function suggested by Kitis. The effect of different heating rates and different amount of dose has also been discussed.

  14. The solubility of (Ba,Sr)SO 4 precipitates: Thermodynamic equilibrium and reaction path analysis

    Science.gov (United States)

    Felmy, Andrew R.; Rai, Dhanpat; Moore, Dean A.

    1993-09-01

    The solubility of (Ba,Sr)SO 4 precipitates, varying in SrSO 4 mole fraction from 0.05-0.90, was investigated at room temperature with an equilibration period extending to almost three years. The data show that on or before 315 days of equilibration the precipitates reach a reversible equilibrium with the aqueous solution. The reversibility of this equilibrium was verified both by the attainment of steady-state concentrations with time and by heating the samples to perturb the equilibrium and then observing the slow return to the initial equilibrium state. The dissolution of the (Ba,Sr)SO 4 precipitates does not, in general, follow limiting reaction paths as defined by the Lippmann solutus or stoichiometric dissolution curves. In addition, activity coefficient calculations for the BaSO 4 and SrSO 4 components of the solid phase, using either total bulk analysis or near-surface analysis of the component mole fractions, do not satisfy the Gibbs-Duhem equation, demonstrating that a single solid-solution phase does not control both the aqueous Ba and Sr concentrations. Instead, our long-term equilibration data can be explained by the unavoidable formation of small amounts of barite and substitution of Sr into a solid-solution phase with the BaSO 4 component of the solid-solution phase never reaching thermodynamic equilibrium with the aqueous phase.

  15. Molecular Dynamics Simulations for Melting Temperatures of SrF2and BaF2

    Institute of Scientific and Technical Information of China (English)

    Xiao-yu Huang; Xin-lu Cheng; Chao-lei Fan; Qiong Chen; Xiao-li Yuan

    2009-01-01

    The shell-model molecular dynamics method was applied to simulate the melting temper-atures of SrF2 and BaF2 at elevated temperatures and high pressures. The same method was used to calculate the equations of state for SrF2 and BaF2 over the pressure range of 0.1 MPa-3 GPa and 0.1 MPa-7 GPa. Compared with previous results for equations of state, the maximum errors are 0.3% and 2.2%, respectively. Considering the pre-melting in the fluorite-type crystals, we made the necessary corrections for the simulated melting temper-atures of SrF2 and BaF2. Consequently, the melting temperatures of SrF2 and BaF2 were obtained for high pressures. The melting temperatures of SrF2 and BaF2 that were obtained by the simulation are in good agreement with available experimental data.

  16. Hybrid molecular beam epitaxy for the growth of stoichiometric BaSnO{sub 3}

    Energy Technology Data Exchange (ETDEWEB)

    Prakash, Abhinav, E-mail: praka019@umn.edu; Dewey, John; Yun, Hwanhui; Jeong, Jong Seok; Mkhoyan, K. Andre; Jalan, Bharat, E-mail: bjalan@umn.edu [Department of Chemical Engineering and Materials Science, University of Minnesota, Minneapolis, Minnesota 55455 (United States)

    2015-11-15

    Owing to its high room-temperature electron mobility and wide bandgap, BaSnO{sub 3} has recently become of significant interest for potential room-temperature oxide electronics. A hybrid molecular beam epitaxy (MBE) approach for the growth of high-quality BaSnO{sub 3} films is developed in this work. This approach employs hexamethylditin as a chemical precursor for tin, an effusion cell for barium, and a radio frequency plasma source for oxygen. BaSnO{sub 3} films were thus grown on SrTiO{sub 3} (001) and LaAlO{sub 3} (001) substrates. Growth conditions for stoichiometric BaSnO{sub 3} were identified. Reflection high-energy electron diffraction (RHEED) intensity oscillations, characteristic of a layer-by-layer growth mode were observed. A critical thickness of ∼1 nm for strain relaxation was determined for films grown on SrTiO{sub 3} using in situ RHEED. Scanning transmission electron microscopy combined with electron energy-loss spectroscopy and energy dispersive x-ray spectroscopy confirmed the cube-on-cube epitaxy and composition. The importance of precursor chemistry is discussed in the context of the MBE growth of BaSnO{sub 3}.

  17. Hydrothermal synthesis of BaTiO 3 nanoparticles using a supercritical continuous flow reaction system

    Science.gov (United States)

    Hayashi, Hiromichi; Noguchi, Takio; Islam, Nazrul M.; Hakuta, Yukiya; Imai, Yusuke; Ueno, Nobuhiko

    2010-06-01

    Highly crystalline BaTiO 3 nanoparticle was synthesized rapidly by hydrothermal reaction in supercritical water using a continuous flow reactor. The reactants of TiO 2 sol (or TiCl 4)/Ba(NO 3) 2 mixed solution and KOH solution were used as starting materials and that was heated quickly up to 400 °C under the pressure of 30 MPa for 8 ms as reaction time. The XRD results revealed that the crystal phase of the obtained particles was cubic BaTiO 3, indicating that the hydrothermal reaction in supercritical water was successfully proceeded under present reaction conditions. Primarily particle size of the BaTiO 3 nanoparticle was determined by means of BET surface area, as small as less than 10 nm with decreasing the reaction pH. In contrast, dispersed particle size in solution measured by DLS (dynamic light scattering) technique decreased from 260 to 90 nm with increasing the reactants concentration. Aggregation of BaTiO 3 nanoparticles might be depressed in the presence of coexisting nitrate anions.

  18. Preparation and microwave absorption properties of Ag-doped BaTiO{sub 3} nanocomposites

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Meng; Zheng, Ji, E-mail: zheng_ji@tju.edu.cn; Liang, Lu; Jiang, Fei; Wang, Ying

    2014-11-15

    In this paper, a series of novel Ag doped BaTiO{sub 3} (Ba{sub 1−x}Ag{sub x}TiO{sub 3}) nanocomposites have been successfully synthesized via the sol-gel method. The XRD pattern indicates that the structure of the synthesized samples is exactly the same as the pure BaTiO{sub 3}, which belongs to the tetragonal system. Besides, the prepared materials were characterized by employing scanning electron microscope (SEM), of which the results show that the morphologies of the samples are closer to tetragonal with an average diameter below 100 nm. Moreover, for the sample with x equal to 0.8%, the maximum reflection loss of 26.8 dB is obtained at 14.8 GHz. Most importantly, for those samples with less than 1% Ag doped, the bandwidth with the loss above 10 dB are even wider than 2 GHz. - Highlights: • We synthesized Ba{sub 1−x}Ag{sub x}TiO{sub 3} nanocomposites using the sol–gel method. • The microwave absorption properties of Ba{sub 1−x}Ag{sub x}TiO{sub 3} samples were discussed. • The maximum reflection loss reaches 26.8 dB for the sample when x equals to 0.8%. • The bandwidth is wider than 2 GHz for samples with modicum Ag doping.

  19. Thermodynamics of phosphorus and sulfur in the BaO-MnO flux system between 1,573 and 1,673 K

    Energy Technology Data Exchange (ETDEWEB)

    Watanabe, Yoshinori (NKK, Kanagawa (Japan)); Kitamura, Katsuhiro (Honda R and D Co. Ltd., Tochigi (Japan)); Rachev, Ivan Petkov (Nippon Steel, Chiba (Japan)); Tsukihashi, Fumitaka; Sano, Nobuo (Univ. of Tokyo (Japan))

    1993-04-01

    The oxidative dephosphorization of carbon-saturated Fe-Mn alloys was successfully demonstrated by measuring the phosphorus partition ratio between BaO-MnO, BaO-MnO-BaF[sub 2], and BaO-CaO[sub satd.]-MnO fluxes and liquid Fe-Mn-C[sub satd.] alloy between 1,573 and 1,673 K. The phosphorus partition ratio increases with increasing BaO content of the flux. The phosphate capacity of the BaO-MnO flux is as high as that of the BaO-BaF[sub 2] flux and is far larger than those of CaO-bearing fluxes. Addition of BaF[sub 2] to the BaO-MnO flux increases BaO solubility, which increases the phosphate capacity. The manganese partition ratios between the BaO-MnO flux and Fe-Mn-C[sub satd.] alloy were approximately constant at 0.64, 0.33, and 0.23 at 1,573, 1,623, and 1,673 K, respectively. The carbon content of the BaO-MnO flux was measured as functions of slag composition, temperature, and partial pressure of CO. A stable species of carbon in the BaO-MnO flux was found to be BaC[sub 2] experimentally and thermodynamically. The sulfide capacity of the BaO-MnO system at 1,573 K has been shown to be far larger than any known flux systems and to be a few times larger than that for the BaO-BaF[sub 2] system.

  20. Antiperovskite Chalco-Halides Ba3(FeS4)Cl, Ba3(FeS4)Br, and Ba3(FeSe4)Br with Spin Super-Super Exchange

    Science.gov (United States)

    Zhang, Xian; Liu, Kai; He, Jian-Qiao; Wu, Hui; Huang, Qing-Zhen; Lin, Jian-Hua; Lu, Zhong-Yi; Huang, Fu-Qiang

    2015-11-01

    Perovskite-related materials have received increasing attention for their broad applications in photovoltaic solar cells and information technology due to their unique electrical and magnetic properties. Here we report three new antiperovskite chalco-halides: Ba3(FeS4)Cl, Ba3(FeS4)Br, and Ba3(FeSe4)Br. All of them were found to be good solar light absorbers. Remarkably, although the shortest Fe-Fe distance exceeds 6 Å, an unexpected anti-ferromagnetic phase transition near 100 K was observed in their magnetic susceptibility measurement. The corresponding complex magnetic structures were resolved by neutron diffraction experiments as well as investigated by first-principles electronic structure calculations. The spin-spin coupling between two neighboring Fe atoms along the b axis, which is realized by the Fe-S···S-Fe super-super exchange mechanism, was found to be responsible for this magnetic phase transition.

  1. Effect of Zr on dielectric, ferroelectric and impedance properties of BaTiO3 ceramic

    Indian Academy of Sciences (India)

    Sandeep Mahajan; O P Thakur; Chandra Prakash; K Sreenivas

    2011-12-01

    A polycrystalline sample of Zr-doped barium titanate (BaTiO3) was prepared by conventional solid state reaction method. The effect of Zr (0.15) on the structural and microstructural properties of BaTiO3 was investigated by XRD and SEM. The electrical properties (dielectric, ferroelectric and impedance spectroscopy) were measured in wide range of frequency and temperature. With substitutions of Zr, the structure of BaTiO3 changes from tetragonal to rhombohedral. Lattice parameters were found to increase with substitution. The room temperature dielectric constant increases from ∼ 1675 to ∼ 10586 and peak dielectric constant value increases from ∼ 13626 to ∼ 21023 with diffuse phase transition. Impedance spectroscopy reveals the formation of grain and grain boundary in the material and found to decrease with increase in temperature.

  2. Simulation of iron impurity in BaTiO{sub 3} crystals

    Energy Technology Data Exchange (ETDEWEB)

    Stashans, Arvids, E-mail: arvids@utpl.edu.e [Grupo de Fisicoquimica de Materiales, Instituto de Quimica Aplicada, Universidad Tecnica Particular de Loja, Apartado 11-01-608, Loja (Ecuador); Castillo, Darwin [Grupo de Fisicoquimica de Materiales, Instituto de Quimica Aplicada, Universidad Tecnica Particular de Loja, Apartado 11-01-608, Loja (Ecuador); Escuela de Electronica y Telecomunicaciones, Universidad Tecnica Particular de Loja, Apartado 11-01-608, Loja (Ecuador)

    2009-05-01

    Iron-doped barium titanate (BaTiO{sub 3}) has been simulated taking into account cubic and tetragonal crystallographic lattices of the crystal. A quantum-chemical method based on the Hartree-Fock formalism has been used throughout the study. The calculated equilibrium structures of Fe-doped crystals reveal the defect-inward displacements of the Ti and O atoms whereas the shifts for the Ba atoms are encountered to be away with respect to the Fe impurity. According to the analysis of electron density population and electron band structure it is found that some unusual chemical bonding might take place between the Fe atom and its six adjacent O atoms. The role of Fe impurity in the ferroelectric polarization of the tetragonal BaTiO{sub 3} crystal has been discussed too.

  3. Grain-size effects on thermal properties of BaTiO3 ceramics

    Indian Academy of Sciences (India)

    C J Xiao; Z X Li; X R Deng

    2011-07-01

    Dense nanocrystalline BaTiO3 ceramics are successfully prepared by the high pressure assisted sintering. Microstructures are observed by scanning electronic microscopes. The grain sizes are estimated to be about 30 and 150 nm. In comparison, BaTiO3 ceramics with the grain size of 600 nm and 1.5 m are fabricated by conventional pressure-less sintering. The thermal properties of BaTiO3 ceramics with different grain sizes are investigated by differential scanning calorimetry and thermal expansion. The results suggest that the enthalpy values for the tetragonal-cubic transition decreased and the thermal expansion values increased with decreasing grain size. Furthermore, the Curie temperature shifts to lower temperature with decreasing grain size.

  4. Pseudogap and anharmonic phonon behavior in Ba8Ga16Ge30: An NMR study

    Science.gov (United States)

    Sirusi, Ali A.; Ross, Joseph H.

    2016-08-01

    We have performed 69Ga, 71Ga, and 137Ba NMR on Ba8Ga16Ge30, a clathrate semiconductor which has been of considerable interest due to its large figure of merit for thermoelectric applications. In measurements from 4 K to 450 K, we used measurements on the two Ga nuclei to separate the magnetic and electric quadrupole hyperfine contributions and thereby gain information about the metallic and phonon behavior. The results show the presence of a pseudogap in the Ga electronic states within the conduction band, superposed upon a large Ba contribution to the conduction band. Meanwhile the phonon contributions to the Ga relaxation rates are large and increase more rapidly with temperature than typical semiconductors. These results provide evidence for enhanced anharmonicity of the propagative phonon modes over a wide range, providing experimental evidence for enhanced phonon-phonon scattering as a mechanism for the reduced thermal conductivity.

  5. High Water Content Material Based on Ba-Bearing Sulphoaluminate Cement

    Institute of Scientific and Technical Information of China (English)

    CHANG Jun; CHENG Xin; LU Lingchao; HUANG Shifeng; YE Zhengmao

    2005-01-01

    A new type of high water content material which is made up of two pastes is prepared, one is made from lime and gypsum, and another is based on Ba-bearing stdphoaluminate cement. It has excellent properties such as slow single paste solidifing,fast double pastes solidifing,fast coagulating and hardening, high early strength, good suspension property at high W/C ratio and low cost. Meanwhile, the properties and hydration mechanism of the material were analyzed by using XRD , DTA- TG and SEM. The hydrated products of new type of high water content material are Ba-bearing ettringite, BaSO4 , aluminum gel and C-S-H gel.

  6. Photoluminescence of Bi(2+)-doped BaSO4 as a red phosphor for white LEDs.

    Science.gov (United States)

    Cao, Renping; Peng, Mingying; Qiu, Jianrong

    2012-11-05

    Bi(2+)-doped BaSO(4) phosphor was synthesized in air via solid state reaction method. Three excitation bands and one emission band were observed at 260 nm ((2)P(1/2) → (2)S(1/2)), 452 nm ((2)P(1/2) → (2)P(3/2)(2)), 592 nm ((2)P(1/2) → (2)P(3/2)(1)), and 627 nm ((2)P(3/2)(1) → (2)P(1/2)), respectively. W-LEDs were demonstrated by using a blend composition of BaSO(4):Bi(2+) and YAG:Ce(3+) hosphors pumped with a 455 nm blue LEDs chip. The results indicate that BaSO(4):Bi(2+) phosphor is suitable as potential red phosphor for application in W-LEDs excited with blue LEDs chip.

  7. Structural study, photoluminescence, and photocatalytic activity of semiconducting BaZrO{sub 3}:Bi nanocrystals

    Energy Technology Data Exchange (ETDEWEB)

    Borja-Urby, R. [Grupo de Espectroscopia de Materiales Avanzados y Nanoestructurados (EMANA), Centro de Investigaciones en Optica A.C., Leon, Gto 37150 (Mexico); Diaz-Torres, L.A., E-mail: ditlacio@cio.mx [Grupo de Espectroscopia de Materiales Avanzados y Nanoestructurados (EMANA), Centro de Investigaciones en Optica A.C., Leon, Gto 37150 (Mexico); Salas, P. [Centro de Fisica Aplicada y Tecnologia Avanzada, Universidad Nacional Autonoma de Mexico, A.P. 1-1010, Queretaro 76000 (Mexico); Moctezuma, E. [Facultad de Ciencias Quimicas, Universidad Autonoma de San Luis Potosi, Av. Manuel Nava 6, San Luis Potosi, S.L.P., Mexico 78290 (Mexico); Vega, M. [Centro de Geociencias-UNAM, A.P. 1-1010, Queretaro 76000 (Mexico); Angeles-Chavez, C. [Instituto Mexicano del Petroleo, Ciudad de Mexico, D.F. 07730 (Mexico)

    2011-10-25

    Wide band gap nanocrystalline bismuth doped barium zirconate is synthesized by a facile hydrothermal method at 100 deg. C. The obtained cubic perovskites are characterized by powder X-ray diffraction (XRD), UV-VIS diffuse reflectance spectroscopy, photoluminescence (PL) spectroscopy, and photocatalytic activity. The estimated band gap in the 2.4-4.9 eV range, depending on Bi concentration, suggests nanocrystalline BaZrO{sub 3}:Bi as a useful visible-light activated photocatalyst under excitation wavelengths <800 nm. Displacement of main XRD pattern peaks suggest that bismuth ion mostly substitutes into Zr{sup 4+} sites within the BaZrO{sub 3} host lattice. It is found that BaZrO{sub 3}:Bi decomposes methylene blue (MB) under both UV and visible light irradiation. The photocatalyst efficiency depends strongly on Bi content and induced defects.

  8. Momentum-resolved electronic structure of the superconductor parent compound BaBiO3

    Science.gov (United States)

    Plumb, N. C.; Ristic, Z.; Park, J.; Wang, Z.; Matt, C. E.; Xu, N.; Lv, B. Q.; Gawryluk, D.; Pomjakushina, E.; Conder, K.; Wang, Y.; Johnston, S.; Mesot, J.; Shi, M.; Radovic, M.

    We use in situ angle-resolved photoemission to study thin films of BaBiO3, a parent compound of bismuthate superconductors with Tc up to 30 K. By simple electron counting, BaBiO3 should be metallic. However, in analogy with many unconventional and high-Tc superconductor families, it is instead insulating, and superconductivity emerges with doping. Our experiments reveal a folded band structure consistent with known BiO6 breathing distortions. However, charge ordering often thought to accompany the distortions is virtually nonexistent. The data combined with DFT calculations indicate that states near EF are primarily oxygen-derived. Hence BaBiO3 appears to be characterized by negative charge transfer energy. This can account for the seeming discrepancy between the atomic structure and ''missing'' charge order. It should also be relevant for understanding the doping evolution and superconductivity in bismuthates.

  9. In-beam γ-ray Spectroscopy of Level Structure in 134Ba

    Institute of Scientific and Technical Information of China (English)

    LuoPeng; LiuMinliang; LiuZhong; ZhangYuhu; ZhouXiaohong; GuoYingxiang; MaYingjun; Y.Sasaki; K.Yamada; H.Ohshima; S.Yokose; M.Ishizuka; T.Komatsubara; K.Furuno

    2003-01-01

    Excited states of 134Ba, populated via the heavy-ion induced 128Te(10B, 1p3n)134Ba reaction at 46 MeV beam energy, have been studied to medium and high spins by in-beam γ-ray spectroscopy techniques. The experiment was performed at the tandem accelerator laboratory in the University of Tsukuba, Japan. The target is an isotopically enriched 128Te metallic foil of 2.3mg/cm2 thickness with a 3mg/cm2 gold backing. Nine anti-Compton HPGe detectors were employed for the measurements of γ-γ-t coincidences. The level scheme of 134Ba, deduced from this study, was shown in Fig.1.

  10. Fabrication of BaTiO3 Inverse Opal Photonic Crystal

    Institute of Scientific and Technical Information of China (English)

    An XIANG; Jian Ping GAO; Hong Kui CHEN; Jiu Gao YU; Rui Xian LIU

    2004-01-01

    The colloidal crystal template or opal with a closed-packed face centered cubic (fcc) lattice, was prepared from monodisperse polystyrene (PS) spheres by gravity sedimentation. The template was used for the generation of photonic crystal. The template provided void space for infiltration of liquid precursor composed of titanium butyloxide, barium acetate, ethanol, and acetic acid. The opal composite was hydrolyzed, dried, sintered by heating for completely removing PS spheres to form BaTiO3 photonic crystals with inverse opal structure. The PS spheres were replaced by air spheres, which interconnected each other through the windows on the BaTiO3 wall. So both the BaTiO3 wall and air void constitute continuous phases.

  11. Photoluminescence of Bi(2+)-doped BaSO4 as a red phosphor for white LEDs.

    Science.gov (United States)

    Cao, Renping; Peng, Mingying; Qiu, Jianrong

    2012-11-05

    Bi(2+)-doped BaSO(4) phosphor was synthesized in air via solid state reaction method. Three excitation bands and one emission band were observed at 260 nm ((2)P(1/2) → (2)S(1/2)), 452 nm ((2)P(1/2) → (2)P(3/2)(2)), 592 nm ((2)P(1/2) → (2)P(3/2)(1)), and 627 nm ((2)P(3/2)(1) → (2)P(1/2)), respectively. W-LEDs were demonstrated by using a blend composition of BaSO(4):Bi(2+) and YAG:Ce(3+) phosphors pumped with a 455 nm blue LEDs chip. The results indicate that BaSO(4):Bi(2+) phosphor is suitable as potential red phosphor for application in W-LEDs excited with blue LEDs chip.

  12. Preparation of nanocrystalline ferroelectric BaNb2O6 by citrate gel method

    Indian Academy of Sciences (India)

    S P Gaikwad; Violet Samuel; Renu Pasricha; V Ravi

    2005-04-01

    A gel was formed when a aqueous solution of BaCl2, NbF5 and citric acid in stoichiometric ratio is heated on a water bath. This gel on decomposition at 600°C yielded the nano crystallites of BaNb2O6, as confirmed by X-ray diffraction study (XRD). This is a much lower temperature as compared to that prepared by traditional solid state method (1000°C) as reported for the formation of BaNb2O6. Transmission electron microscopic (TEM) investigations revealed that the average particle size is 50 nm for the calcined powders. The room temperature dielectric constant at 1 kHz is found to be 1000. The ferroelectric hysteresis loop parameters of these samples were also studied.

  13. Baço errante”, uma causa rara de abdomen agudo

    OpenAIRE

    2014-01-01

    Resumo: Baço “errante” é uma condição rara caracterizada por hipermobilidade esplénica devido à ausência ou laxidez dos seus ligamentos, podendo apresentar-se como abdómen agudo quando ocorre torção do seu próprio pedículo. Apresenta-se o caso de baço “errante” em jovem do sexo feminino, de quinze anos, com vómitos e dor abdominal na admissão hospitalar. Ocorreu deterioração do estado clínico com aparecimento de sinais clínicos de abdómen agudo, sendo realizada laparotomia com remoção do baço...

  14. Ab Initio Calculations for the BaTiO3 (001) Surface Structure

    Institute of Scientific and Technical Information of China (English)

    XUE Xu-Yan; WANG Chun-Lei; ZHONG Wei-Lie

    2004-01-01

    @@ The ab initio method within the local density approximation is applied to calculate cubic BaTiO3 (001) surface relaxation and rumpling for two different terminations (BaO and TiO2). Our calculations demonstrate that cubic perovskite BaTiO3 crystals possess surface polarization, accompanied by the presence of the relevant electric field.We analyse their electronic structures (band structure, density of states and the electronic density redistribution with emphasis on the covalency effects). The results are also compared with that of the previous ab initio calculations. Considerable increases of Ti-O chemical bond covalency nearby the surface have been observed.The band gap reduces especially for the TiO2 termination.

  15. Effects of Ba doping on physical properties of La-Ca-Mn-O thin films

    CERN Document Server

    Hong, N H; Sakai, J; Iwasaki, H

    2003-01-01

    Transport and magnetic properties of La-Ba-Ca-Mn-O thin films fabricated by the pulsed laser deposition technique had been investigated systematically to see the effects of substitution of the small atom Ca by Ba which is much bigger. The induced insulator-to-metal (IM) transition was obtained not only in compositions near 0.5 and 0.18 which are boundaries between metallic and insulating phases but also in the heavily doped region. In the region of x > 0.5, the Ba doping causes an anomalous response of the system to the magnetic field and a positive magnetoresistance was observed. Besides, our results concerning the vicinity of 0.5 imply the existence of phase separation. As for x < 0.5, the doping enhances remarkably the paramagnetism-ferromagnetism transition and the IM transition temperatures.

  16. Redetermination of Ba2CdTe3 from single-crystal X-ray data

    Directory of Open Access Journals (Sweden)

    Min Yang

    2012-10-01

    Full Text Available The previous structure determination of the title compound, dibarium tritelluridocadmate, was based on powder X-ray diffraction data [Wang & DiSalvo (1999. J. Solid State Chem. 148, 464–467]. In the current redetermination from single-crystal X-ray data, all atoms were refined with anisotropic displacement parameters. The previous structure report is generally confirmed, but with some differences in bond lengths. Ba2CdTe3 is isotypic with Ba2MX3 (M = Mn, Cd; X = S, Se and features 1∞[CdTe2/2Te2/1]4− chains of corner-sharing CdTe4 tetrahedra running parallel [010]. The two Ba2+ cations are located between the chains, both within distorted monocapped trigonal–prismatic coordination polyhedra. All atoms in the structure are located on a mirror plane.

  17. Rietveld refinement of Ba5(AsO43Cl from high-resolution synchrotron data

    Directory of Open Access Journals (Sweden)

    Wendy J. Harrison

    2008-09-01

    Full Text Available The apatite-type compound Ba5(AsO43Cl, pentabarium tris[arsenate(V] chloride, has been synthesized by ion exchange at high temperature from a synthetic sample of mimetite (Pb5(AsO43Cl with BaCO3 as a by-product. The results of the Rietveld refinement, based on high resolution synchrotron X-ray powder diffraction data, show that the title compound crystallizes in the same structure as other halogenoapatites with general formula A5(YO43X (A = divalent cation, Y = pentavalent cation, X = Cl, Br in space group P63/m. The structure consists of isolated tetrahedral AsO43− anions (m symmetry, separated by two crystallographically independent Ba2+ cations that are located on mirror planes and threefold rotation axes, respectively. The Cl− anions are at the 2b sites (overline{3} symmetry and are located in the channels of the structure.

  18. Electrochemical Oxidation of L-Cystenine in SDS/BA/H2O Microemulsion

    Institute of Scientific and Technical Information of China (English)

    LI Zhong-chun; LIU Tian-qing; GUO Rong

    2005-01-01

    The electrochemical oxidation of L-cysteine in an SDS/BA/H2O microemulsion system was studied with the methods of ultramicroelectrode cyclic voltammetry and AC impedance. The catalytic efficiency of the microemulsion on the electrochemical oxidation increases with the increase of BA or SDS content, but decreases with the increase of the water content because of the effects of BA, SDS and water on the solubilization of L-cysteine in the microemulsion. Furthermore, the catalytic efficiency of the bicontinuous structure is greater than that of an O/W microemulsion system. The results derived from both the rate constant k0 and Gibbs free energy ΔG≠ accord with those from the catalytic efficiency.

  19. Growth and characterizations of Ba2Ti2Fe2As4O single crystals

    Directory of Open Access Journals (Sweden)

    Yun-Lei Sun, Abduweli Ablimit, Jin-Ke Bao, Hao Jiang, Jie Zhou and Guang-Han Cao

    2013-01-01

    Full Text Available Single crystals of a new iron-based superconductor Ba2Ti2Fe2As4O have been grown successfully via a Ba2As3-flux method in a sealed evacuated quartz tube. Bulk superconductivity with Tc ~ 21.5 K was demonstrated in resistivity and magnetic susceptibility measurements after the as-grown crystals were annealed at 500 °C in vacuum for a week. X-ray diffraction patterns confirm that the annealed and the as-grown crystals possess the identical crystallographic structure of Ba2Ti2Fe2As4O. Energy-dispersive x-ray spectra indicate that partial Ti/Fe substitution exists in the [Fe2As2] layers and the annealing process redistributes the Ti within the Fe-plane. The ordered Fe-plane stabilized by annealing exhibits superconductivity with magnetic vortex pinned by Ti.

  20. Final Report BaBar Detector and Experimental at SLAC, September 30, 1998 - September 29, 1999

    CERN Document Server

    Judd, D J

    2000-01-01

    The Prairie View AandM University High Energy Physics Group with its contingent of three undergraduates physics majors, joined the BaBar Collaboration at SLAC in September 1994. BaBar is the experiment and detector running in the PEP-II ring at SLAC as part of the Asymmetric B Factory project there to study CP violation and heavy flavor physics. The focus of our effort before this year was with the Muon/Neutral Hadron Detector/Instrumented Flux Return (IFD) subgroup within the BaBar collaboration, and particularly with the GEANT simulation of the IFR-. With the GEANT3 simulation essentially FR-ozen, and the GEANT4 full simulation of the IFR- done, we have decided to redirect our efforts toward other areas.

  1. Structural and photocatalytic characterization of BaFe2O4 obtained at low temperatures

    Directory of Open Access Journals (Sweden)

    Silvana Da Dalt

    2011-12-01

    Full Text Available Barium monoferrite BaFe2O4 classified as permanent magnet stands out among other ceramic magnets due to its high chemical stability, corrosion resistance and low production cost. In addition, experiments conducted on photocatalytic degradation of methyl orange and UV transmittance by spectrophotometry have shown that this material has photocatalytic properties. The spinel ferrite is of importance in many technological areas such as computing, communications and security. Several techniques for synthesis have been studied to optimize the properties of this material. The synthesis of BaFe2O4 by conventional processes often occurs at temperatures above 1000 ºC. In this work, we obtained the phase BaFe2O4 at low temperatures (600 ºC from the combustion reaction using nitrates and maleic anhydride as metal complexing agent. Techniques of X-ray diffraction, specific surface area, thermogravimetry analysis and photocatalytic analysis were employed to characterize the products obtained.

  2. Synthesis and Dielectric Properties of Ba3NaBiNb10O30 Ceramics

    Institute of Scientific and Technical Information of China (English)

    2003-01-01

    A new niobate Ba3NaBiNb10O30 was synthesized by the solid state reaction.The reaction mixture was characterized by thermogravimetric and differential thermal analysis (TG-DTA),X-ray diffraction and dielectric constant measurements.The results show that Ba3NaBiNb10O30 has an orthorhombic tungsten bronze structure with space group Cmm2 and the unit cell parameters are a=1.7660(1) nm,a=1.7626(1) nm,c=0.78621(6) nm,Z=4.Ba3NaBiNb10O30 undergoes two phase transitions at 200℃ and 400℃,respectively.

  3. Synthesis, Crystal Structures and Characterization of Ba5LiTiNb9O30

    Institute of Scientific and Technical Information of China (English)

    LIU,Han-Xing(刘韩星); ZOU,Long(邹龙); ZHOU,Jian(周建); FANG,Liang(方亮); ZHANG,Gao-Ke(张高科); OUYANG,Shi-Xi(欧阳世翕)

    2004-01-01

    A new niobate compound with the chemical composition of Ba5LiTiNb9O30 was synthesized by doping Li+ into the system BaO-TiO2-Nb2O5 in conventional solid state reaction method.The crystalline structure was determined by X-ray diffraction analysis (XRD).The results showed that crystal structure of Ba5LiTiNb9O30 belongs to tetragonal tungsten bronze structure with space group P4bn and its unit cell parameters:a=b=l.2512(2) nm,c=0.4008(5) nm.The microstructure of reaction products was observed by scanning electron microscopy (SEM).

  4. Simulation of Cosmic Microwave Background Polarization Fields for AMiBA Experiment

    CERN Document Server

    Park, C G; Park, Chan-Gyung; Park, Changbom

    2002-01-01

    We have made a topological study of cosmic microwave background (CMB) polarization maps by simulating the AMiBA experiment results. A $\\Lambda$CDM CMB sky is adopted to make mock interferometric observations designed for the AMiBA experiment. CMB polarization fields are reconstructed from the AMiBA mock visibility data using the maximum entropy method. We have also considered effects of Galactic foregrounds on the CMB polarization fields. The genus statistic is calculated from the simulated $Q$ and $U$ polarization maps, where $Q$ and $U$ are Stokes parameters. Our study shows that the Galactic foreground emission, even at low Galactic latitude, is expected to have small effects on the CMB polarization field. Increasing survey area and integration time is essential to detect non-Gaussian signals of cosmological origin through genus measurement.

  5. High-mobility BaSnO3 grown by oxide molecular beam epitaxy

    Directory of Open Access Journals (Sweden)

    Santosh Raghavan

    2016-01-01

    Full Text Available High-mobility perovskite BaSnO3 films are of significant interest as new wide bandgap semiconductors for power electronics, transparent conductors, and as high mobility channels for epitaxial integration with functional perovskites. Despite promising results for single crystals, high-mobility BaSnO3 films have been challenging to grow. Here, we demonstrate a modified oxide molecular beam epitaxy (MBE approach, which supplies pre-oxidized SnOx. This technique addresses issues in the MBE of ternary stannates related to volatile SnO formation and enables growth of epitaxial, stoichiometric BaSnO3. We demonstrate room temperature electron mobilities of 150 cm2 V−1 s−1 in films grown on PrScO3. The results open up a wide range of opportunities for future electronic devices.

  6. High-mobility BaSnO{sub 3} grown by oxide molecular beam epitaxy

    Energy Technology Data Exchange (ETDEWEB)

    Raghavan, Santosh; Schumann, Timo; Kim, Honggyu; Zhang, Jack Y.; Cain, Tyler A.; Stemmer, Susanne, E-mail: stemmer@mrl.ucsb.edu [Materials Department, University of California, Santa Barbara, California 93106-5050 (United States)

    2016-01-01

    High-mobility perovskite BaSnO{sub 3} films are of significant interest as new wide bandgap semiconductors for power electronics, transparent conductors, and as high mobility channels for epitaxial integration with functional perovskites. Despite promising results for single crystals, high-mobility BaSnO{sub 3} films have been challenging to grow. Here, we demonstrate a modified oxide molecular beam epitaxy (MBE) approach, which supplies pre-oxidized SnO{sub x}. This technique addresses issues in the MBE of ternary stannates related to volatile SnO formation and enables growth of epitaxial, stoichiometric BaSnO{sub 3}. We demonstrate room temperature electron mobilities of 150 cm{sup 2} V{sup −1} s{sup −1} in films grown on PrScO{sub 3}. The results open up a wide range of opportunities for future electronic devices.

  7. Experimental and first principle studies on electronic structure of BaTiO{sub 3}

    Energy Technology Data Exchange (ETDEWEB)

    Sagdeo, Archna, E-mail: archnaj@rrcat.gov.in; Ghosh, Haranath, E-mail: archnaj@rrcat.gov.in; Chakrabarti, Aparna, E-mail: archnaj@rrcat.gov.in; Kamal, C., E-mail: archnaj@rrcat.gov.in; Ganguli, Tapas, E-mail: archnaj@rrcat.gov.in; Deb, S. K. [Indus Synchrotrons Utilization Division, Raja Ramanna Centre for Advanced Technology, Indore 452013 (India); Phase, D. M. [IUC-DAEF, University Campus, Khandwa Road, Indore-452017 (India)

    2014-04-24

    We have carried out photoemission experiments to obtain valence band spectra of various crystallographic symmetries of BaTiO{sub 3} system which arise as a function of temperature. We also present results of a detailed first principle study of these symmetries of BaTiO{sub 3} using generalized gradient approximation for the exchange-correlation potential. Here we present theoretical results of density of states obtained from DFT based simulations to compare with the experimental valence band spectra. Further, we also perform calculations using post density functional approaches like GGA + U method as well as non-local hybrid exchange-correlation potentials like PBE0, B3LYP, HSE in order to understand the extent of effect of correlation on band gaps of different available crystallographic symmetries (5 in number) of BaTiO{sub 3}.

  8. Synthesis and characterization of BaTiO{sub 3} nanoparticles in oxygen atmosphere

    Energy Technology Data Exchange (ETDEWEB)

    Fuentes, S., E-mail: sfuentes@ucn.c [Departamento de Quimica y Farmacia, Facultad de Ciencias, Universidad Catolica del Norte, Casilla 1280, Antofagasta (Chile); Center for the Development of Nanoscience and Nanotechnology, CEDENNA, Santiago (Chile); Zarate, R.A.; Chavez, E. [Departamento de Fisica, Facultad de Ciencias, Universidad Catolica del Norte, Casilla 1280, Antofagasta (Chile); Munoz, P. [Departamento de Quimica, Facultad de Ciencias, Universidad Catolica del Norte, Casilla 1280, Antofagasta (Chile); Center for the Development of Nanoscience and Nanotechnology, CEDENNA, Santiago (Chile); Ayala, M. [Departamento de Quimica, Facultad de Ciencias, Universidad Catolica del Norte, Casilla 1280, Antofagasta (Chile); Espinoza-Gonzalez, R. [Departamento de Ciencia de los Materiales, Facultad de Ciencias Fisicas y Matematicas, Universidad de Chile, Av. Tupper 2069, Santiago (Chile); Leyton, P. [Laboratorio de Fotofisica y Espectroscopia Molecular, Instituto de Quimica, Pontificia Universidad Catolica de Valparaiso, Av. Brasil 2950, Valparaiso (Chile)

    2010-09-03

    A new synthesis route to obtain high-purity barium titanate, BaTiO{sub 3}, using the sol-gel-hydrothermal reaction of TiCl{sub 4} and a BaCl{sub 2} solution in an oxygen atmosphere has been developed. The synthesized BaTiO{sub 3} nanoparticles are nearly spherical. Their grain sizes are determined by the reaction temperature, reaching values as low as 50 nm when the particles are synthesized at 200 {sup o}C; interestingly even those particles with the smallest grain sizes displayed a ferroelectric behavior as characterized by a polarization hysteresis loop. The microstructure and composition of the as-synthesized samples were investigated by X-ray diffraction (XRD), high-resolution TEM (HRTEM), Raman spectroscopy, atomic force microscopy (AFM) and energy-dispersive X-ray spectroscopy (EDS).

  9. Growing Small-World Networks Based on a Modified BA Model

    Institute of Scientific and Technical Information of China (English)

    XU Xin-Ping; LIU Feng; LI Wei

    2006-01-01

    @@ We modify the (Barabási-Albert) BA model for the evolution of small-world networks. It is introduced as a modified BA model in which all the edges connected to the new node are made locally to the old node and its nearest neighbours. It is found that this model can produce small-world networks with power-law degree distributions. Properties of our model, including the degree distribution, clustering, average path length and degree correlation coefficient are compared with that of the BA model. Since most real networks are both scale free and small-world networks, our model may provide a satisfactory description for empirical characteristics of real networks.

  10. AMiBA: Cluster Sunyaev-Zel’dovich Effect Observations with the Expanded 13-element Array

    Science.gov (United States)

    Lin, Kai-Yang; Nishioka, Hiroaki; Wang, Fu-Cheng; Locutus Huang, Chih-Wei; Liao, Yu-Wei; Proty Wu, Jiun-Huei; Koch, Patrick M.; Umetsu, Keiichi; Chen, Ming-Tang; Chan, Shun-Hsiang; Chang, Shu-Hao; Lucky Chang, Wen-Hsuan; Cheng, Tai-An; Duy, Hoang Ngoc; Fu, Szu-Yuan; Han, Chih-Chiang; Ho, Solomon; Ho, Ming-Feng; Ho, Paul T. P.; Huang, Yau-De; Jiang, Homin; Kubo, Derek Y.; Li, Chao-Te; Lin, Yu-Chiung; Liu, Guo-Chin; Martin-Cocher, Pierre; Molnar, Sandor M.; Nunez, Emmanuel; Oshiro, Peter; Pai, Shang-Ping; Raffin, Philippe; Ridenour, Anthony; Shih, Chia-You; Stoebner, Sara; Teo, Giap-Siong; Yeh, Jia-Long Johnny; Williams, Joshua; Birkinshaw, Mark

    2016-10-01

    The Yuan-Tseh Lee Array for Microwave Background Anisotropy (AMiBA) is a co-planar interferometer array operating at a wavelength of 3 mm to measure the Sunyaev-Zel’dovich effect (SZE) of galaxy clusters at arcminute scales. The first phase of operation—with a compact 7-element array with 0.6 m antennas (AMiBA-7)—observed six clusters at angular scales from 5\\prime to 23\\prime . Here, we describe the expansion of AMiBA to a 13-element array with 1.2 m antennas (AMiBA-13), its subsequent commissioning, and cluster SZE observing program. The most noticeable changes compared to AMiBA-7 are (1) array re-configuration with baselines ranging from 1.4 m to 4.8 m, allowing us to sample structures between 2\\prime and 10\\prime , (2) 13 new lightweight carbon-fiber-reinforced plastic (CFRP) 1.2 m reflectors, and (3) additional correlators and six new receivers. Since the reflectors are co-mounted on and distributed over the entire six-meter CFRP platform, a refined hexapod pointing error model and phase error correction scheme have been developed for AMiBA-13. These effects—entirely negligible for the earlier central close-packed AMiBA-7 configuration—can lead to additional geometrical delays during observations. Our correction scheme recovers at least 80 ± 5% of the point-source fluxes. We, therefore, apply an upward correcting factor of 1.25 to our visibilities to correct for phase decoherence, and a ±5% systematic uncertainty is added in quadrature with our statistical errors. We demonstrate the absence of further systematics with a noise level consistent with zero in stacked uv-visibilities. From the AMiBA-13 SZE observing program, we present here maps of a subset of 12 clusters with signal-to-noise ratios above five. We demonstrate combining AMiBA-7 with AMiBA-13 observations on Abell 1689, by jointly fitting their data to a generalized Navarro-Frenk-White model. Our cylindrically integrated Compton-y values for five radii are consistent with results from

  11. Electrical properties of Y-Ba-Na-Cu-O high Tc superconductors thin films

    Energy Technology Data Exchange (ETDEWEB)

    Verdyan, A. (Center for Theoretical Education Holon (Israel) Raymond and Beverly Sackler Faculty of Exact Sciences, School of Physics and Astronomy, Tel-Aviv Univ. (Israel)); Lapsker, I. (Center for Theoretical Education Holon (Israel) Raymond and Beverly Sackler Faculty of Exact Sciences, School of Physics and Astronomy, Tel-Aviv Univ. (Israel)); Azoulay, J. (Center for Theoretical Education Holon (Israel) Raymond and Beverly Sackler Faculty of Exact Sciences, School of Physics and Astronomy, Tel-Aviv Univ. (Israel))

    1993-04-20

    Y-Ba-Na-Cu-O high Tc superconductors thin films deposited on MgO substrate by resistive evaporation technique were found to have improved electrical properties as compared to pure Y-Ba-Cu-O thin films similarly prepared. A simple conventional inexpensive vacuum system housing a single resistively tungsten heated source was used for the deposition. Pulverized mixture of Y, BaF[sub 2], NaF and Cu in the appropriate atomic proportion was evaporated onto the substrates whose temperature was held constant at 400 C during the evaporation. In situ heat treatment has been carried out at 700 C under oxygen partial pressure of 7 pa. The films thus obtained were found to have the normal superconductors orthorhombic phase at room temperature without any further ex situ heat treatment. The films were characterized and analyzed by X-ray diffraction auger election spectroscopy and four point dc electrical measurements. (orig.)

  12. Electrical properties of Y-Ba-Na-Cu-O high Tc superconductors thin films

    Science.gov (United States)

    Verdyan, A.; Lapsker, I.; Azoulay, J.; Sackler, Raymond; Sackler, Beverly

    1993-04-01

    Y-Ba-Na-Cu-O high Tc superconductors thin films deposited on MgO substrate by resistive evaporation technique were found to have improved electrical properties as compared to pure Y-Ba-Cu-O thin films similarly prepared. A simple conventional inexpensive vacuum system housing a single resistively tungsten heated source was used for the deposition. Pulverized mixture of Y, BaF 2, NaF and Cu in the appropriate atomic proportion was evaporated onto the substrates whose temperature was held constant at 400°C during the evaporation. In situ heat treatment has been carried out at 700°C under oxygen partial pressure of 7 pa. The films thus obtained were found to have the normal superconductors orthorhombic phase at room temperature without any further ex situ heat treatment. The films were characterized and analyzed by x-ray diffraction auger electron spectroscopy and four point dc electrical measurements.

  13. Superconductivity in the Tl-Ca-Ba-Cu-O System:. Synthesis, Characterization and Mechanism

    Science.gov (United States)

    Ganguli, A. K.; Swamy, K. S. Nanjunda; Subbanna, G. N.; Rajumon, M. K.; Sarma, D. D.; Rao, C. N. R.

    Synthesis and characterization of some of the members of the Tl-Ca-Ba-Cu-O system are presented. Tc in both the TlCan-1Ba2CunO2n+3 and Tl2Can-1Ba2CunO2n+4 series increase with the number of Cu-O layers, n; Tc in the latter series with two Tl-O layers are generally higher than in the former with a single Tl-O layer. Tl in the cuprates is in the 3+ state while Cu is in the 1+ and 2+ states, showing the importance of oxygen holes. The concentration of these holes seems to increase with the number of Tl-O layers.

  14. Far-Infrared Study of BaTi4O9 Microwave Dielectric Ceramics

    Science.gov (United States)

    Huang, Xianli; Wang, Fuping; Song, Ying

    2006-02-01

    In this work, lattice vibrations in BaTi4O9 ceramic were investigated using far-infrared spectra (FIRS), which were transformed by Kramers-Kronig relations into the real and imaginary parts of permittivity spectra. Curve fitting of reflectance spectra shows that 32 vibration modes were observed, among which transverse vibrations at lower frequencies (stretching and bending vibration modes involving A-site cations and TiO6 octahedra) account for most dielectric loss. An evaluation of dielectric constants and quality factors using an extrapolation method was accomplished. The calculated dielectric constants agree well with the measured ones, while the calculated dielectric losses are about half the measured ones, indicating that noneigen elements such as defects and pores exist and play an important role in BaTi4O9 ceramics. A multimode behavior of vibration modes involving Ba-sites was proposed as the origin of dielectric loss.

  15. Raman sideband cooling of a 138Ba+ ion using a Zeeman interval

    CERN Document Server

    Seck, Christopher M; Dietrich, Matthew R; Odom, Brian C

    2016-01-01

    Motional ground state cooling and internal state preparation are important elements for quantum logic spectroscopy (QLS), a class of quantum information processing. Since QLS does not require the high gate fidelities usually associated with quantum computation and quantum simulation, it is possible to make simplifying choices in ion species and quantum protocols at the expense of some fidelity. Here, we report sideband cooling and motional state detection protocols for $^{138}$Ba$^+$ of sufficient fidelity for QLS without an extremely narrowband laser or the use of a species with hyperfine structure. We use the two S$_{1/2}$ Zeeman sublevels of $^{138}$Ba$^+$ to Raman sideband cool a single ion to the motional ground state. Because of the small Zeeman splitting, near-resonant Raman sideband cooling of $^{138}$Ba$^+$ requires only the Doppler cooling lasers and two additional AOMs. Observing the near-resonant Raman optical pumping fluorescence, we estimate a final average motional quantum number $\\bar{n}\\appro...

  16. Exploration on Crystallization Habit of Rare Earth Fluoride Crystal BaY2F8

    Institute of Scientific and Technical Information of China (English)

    Lin Junyi; Ruan Yongfeng; Wang Jun; Liu Jian; Huan Boxian

    2004-01-01

    Single rare earth fluoride crystal of BaY2F8 was grown by Czochralski method. The crystallization habit of BaY2F8 and the crystal growth technique, including temperature gradient, rotation and pulling rates, were investigated.The effects of growth parameters on the crystal quality were studied. Crystal growth procedure was optimized as the temperature gradient of 15 ~ 25 ℃ ·cm -1 , the rotation rate of 15 ~ 20 r ·min -1 and the pulling rate of 1.0 mm · h-1.The X-ray diffraction and the transparent spectrum of BaY2F8 crystal were measured and reported.

  17. The BaBar Event Building and Level-3 Trigger Farm Upgrade

    CERN Document Server

    Luitz, S; Dasu, S; Dubois-Felsmann, G P; Franek, B J; Hamilton, J; Jacobsen, R; Kotturi, D; Narsky, I; O'Grady, C; Perazzo, A; Rodríguez, R; Rosenberg, E I; Salnikov, A; Weaver, M; Wittgen, M; Group, for the BaBar Computing

    2003-01-01

    The BaBar experiment is the particle detector at the PEP-II B-factory facility at the Stanford Linear Accelerator Center. During the summer shutdown 2002 the BaBar Event Building and Level-3 trigger farm were upgraded from 60 Sun Ultra-5 machines and 100MBit/s Ethernet to 50 Dual-CPU 1.4GHz Pentium-III systems with Gigabit Ethernet. Combined with an upgrade to Gigabit Ethernet on the source side and a major feature extraction software speedup, this pushes the performance of the BaBar event builder and L3 filter to 5.5kHz at current background levels, almost three times the original design rate of 2kHz. For our specific application the new farm provides 8.5 times the CPU power of the old system.

  18. Particle morphology as a control of permeation in polymer films obtained from MMA/nBA colloidal dispersions.

    Science.gov (United States)

    Lestage, David J; Urban, Marek W

    2004-07-20

    The combination of precision-controlled weight loss measurements and spectroscopic surface FT-IR analysis allowed us to identify unique behaviors of poly(methyl methacrylate) (p-MMA). When MMA and n-butyl acrylate (nBA) are polymerized into p-MMA and p-nBA homopolymer blends, MMA/nBA random copolymers, and p-MMA/p-nBA core-shell morphologies, a controlled mobility and stratification of low molecular weight components occurs in films formed from coalesced colloidal dispersions. Due to different affinities toward water, p-MMA and p-nBA are capable of releasing water at different rates, depending upon particle morphological features of initial dispersions. As coalescence progresses, water molecules are released from the high free volume p-nBA particles, whereas p-MMA retains water molecules for the longest time due to its hydrophilic nature. As a result, water losses at extended coalescence times are relatively small for p-MMA. MMA/nBA copolymer and p-MMA/p-nBA blends follow the same trends, although the magnitudes of changes are not as pronounced. The p-MMA/p-nBA core-shell behavior resembles that of p-nBA homopolymer, which is attributed to significantly lower content of the p-MMA component in particles. Annealing of coalesced colloidal films at elevated temperatures causes migration of SDOSS to the F-A interface, but for films containing primarily p-nBA, reverse diffusion back into the bulk is observed. These studies illustrate that the combination of different particle morphologies and temperatures leads to controllable permeation processes through polymeric films. Copyright 2004 American Chemical Society

  19. Fabrication of high performance Gd-Ba-Cu-O single grains in air using a practical melt processing technique

    Energy Technology Data Exchange (ETDEWEB)

    Cardwell, D.A., E-mail: dc135@cam.ac.u [Engineering Department, Trumpington Street, University of Cambridge, CB2 1PZ (United Kingdom); Shi, Y. [Engineering Department, Trumpington Street, University of Cambridge, CB2 1PZ (United Kingdom); Hari Babu, N. [Engineering Department, Trumpington Street, University of Cambridge, CB2 1PZ (United Kingdom); BCAST, Brunel University, West London UB8 3PH (United Kingdom); Iida, K. [Engineering Department, Trumpington Street, University of Cambridge, CB2 1PZ (United Kingdom)

    2009-10-15

    A practical processing route for the fabrication of LRE-Ba-Cu-O single grain superconductors has been developed at the University of Cambridge based on a generic, Mg-doped Nd-123 melt textured seed and suppression of the formation of the solid solution phase in air by enriching the precursors with higher Ba concentration. The processing of high performance Gd-Ba-Cu-O single grains using this processing route is described. The Mg-doped generic seed crystal has been used effectively to promote heterogeneous nucleation via a cold-seeding process. The Gd/Ba solid solution has been suppressed by enriching Gd-Ba-Cu-O precursor powders with two different Ba-rich compositions. This involved adding BaO{sub 2} and GdBa{sub 6}Cu{sub 3}O{sub y} (Gd-163) (a novel Ba-rich second phase) to the precursor powders, respectively. The Gd-163 phase has been observed not only to suppress formation of the solid solution phase, but also to promote increased heterogeneous grain size. A detailed further study has been carried out with an initial aim of optimizing the BaO{sub 2} and Gd-163 phase content of the precursor composition to produce a single grain almost free of solid solution. Based on the optimized parameters, large single grain Gd-Ba-Cu-O superconductors have been fabricated in an air atmosphere and demonstrated to exhibit record trapped magnetic fields for this material melt processed in air in relatively small single grain samples. The trapped fields of samples produced in air atmosphere are at least comparable to those processed under reduced oxygen partial pressure.

  20. Factors influencing formation of highly dispersed BaTiO{sub 3} nanospheres with uniform sizes in static hydrothermal synthesis

    Energy Technology Data Exchange (ETDEWEB)

    Gao, Jiabing; Shi, Haiyue; Dong, Huina; Zhang, Rui; Chen, Deliang, E-mail: dlchen@zzu.edu.cn [Zhengzhou University, School of Materials Science and Engineering (China)

    2015-07-15

    Highly dispersed BaTiO{sub 3} nanospheres with uniform sizes have important applications in micro/nanoscale functional devices. To achieve well-dispersed spherical BaTiO{sub 3} nanocrystals, we carried out as reported in this paper the systematic investigation on the factors that influence the formation of BaTiO{sub 3} nanospheres by the static hydrothermal process, including the NaOH concentrations [NaOH], molar Ba/Ti ratios (R{sub Ba/Ti}), hydrothermal temperatures, and durations, with an emphasis on understanding the related mechanisms. Barium nitrate and TiO{sub 2} sols derived from tetrabutyl titanate were used as the starting materials. The as-synthesized BaTiO{sub 3} samples were characterized by X-ray diffraction, scanning electron microscopy, energy-dispersive X-ray analysis, thermogravimetry, differential thermal analysis, and FT-IR spectra. The highly dispersed BaTiO{sub 3} nanospheres (76 ± 13 nm) were achieved under the optimum hydrothermal conditions at 200 °C for 10 h: [NaOH] = 2.0 mol L{sup −1} and R{sub Ba/Ti} = 1.5. Higher NaOH concentrations, higher Ba/Ti ratios, higher hydrothermal temperatures, and longer hydrothermal durations are favorable in forming BaTiO{sub 3} nanospheres with larger fractions of tetragonal phase and higher yields; but too long hydrothermal durations resulted in abnormal growth and reduced the uniformity in particle sizes. The possible formation mechanisms for BaTiO{sub 3} nanocrystals under the static hydrothermal conditions were investigated.

  1. Using coral Ba/Ca records to investigate seasonal to decadal scale biogeochemical cycling in the surface and intermediate ocean.

    Science.gov (United States)

    LaVigne, M.; Cobb, K. M.; DeLong, K. L.; Freiberger, M. M.; Grottoli, A. G.; Hill, T. M.; Miller, H. R.; Nurhati, I. S.; Richey, J. N.; Serrato Marks, G.; Sherrell, R. M.

    2016-12-01

    Dissolved barium (BaSW), a bio-intermediate element, is linked to several biogeochemical processes such as the cycling and export of nutrients, organic carbon (Corg), and barite in surface and intermediate oceans. Dynamic BaSW cycling has been demonstrated in the water column on short timescales (days-weeks) while sedimentary records have documented geologic-scale changes in barite preservation driven by export production. Our understanding of how seasonal-decadal scale climate variability impacts these biogeochemical processes currently lacks robust records. Ba/Ca calibrations in surface and deep sea corals suggest barium is incorporated via cationic substitution in both aragonite and calcite. Here we demonstrate the utility of Ba/Ca for reconstructing biogeochemical variability using examples of surface and deep sea coral records. Century-long deep sea coral records from the California Current System (bamboo corals: 900-1500m) record interannual variations in Ba/Ca, likely reflecting changes in barite formation via bacterial Corg respiration or barite saturation state. A surface Porites coral Ba/Ca record from Christmas Island (central equatorial Pacific: 1978-1995) shows maxima during low productivity El Niño warm periods, suggesting that variations in BaSW are driven by biological removal via direct cellular uptake or indirectly via barite precipitation with the decomposition of large phytoplankton blooms at this location. Similarly, a sixteen-year long Siderastera siderea surface coral record from Dry Tortugas, FL (Gulf of Mexico: 1991-2007) shows seasonal Ba/Ca cycles that align with annual chlorophyll and δ13C. Taken together, these records demonstrate the linkages among Corg, nutrient cycling and BaSW in the surface and intermediate ocean on seasonal to decadal timescales. Multi-proxy paleoceanographic reconstructions including Ba/Ca have the potential to elucidate the mechanisms linking past climate, productivity, nutrients, and BaSW cycling in the past.

  2. Estudo mineralógico do sedimento de manguezal da baía de Camamu-Ba

    Directory of Open Access Journals (Sweden)

    Olívia Maria Cordeiro de Oliveira

    2002-04-01

    Full Text Available A baía de Camamu, importante pólo turístico, pesqueiro e mineiro, está localizada na Região Litoral Sul do Estado da Bahia. Esse corpo hídrico é bordejado por extensa floresta de manguezal e tem se tornado alvo de uma série de estudos geoambientais. O objetivo desse trabalho é apresentar parte dessas investigações, que corresponde a uma avaliação mineralógica nos sedimentos do manguezal estudado. O estudo semiquantitativo realizado mostrou que, nas estações próximas à zona de mineração, o sedimento é rico em quartzo, barita e argilas, além de pequeno percentual de pirita e jarosita. Nas demais estações, a mineralogia é composta predominantemente por quartzo e argilas, com percentuais variados de barita, pirita e gipsita em determinadas estações. Nos sedimentos de manguezal estudados, os minerais identificados parecem estar intimamente relacionados aos processos geológicos ocorrentes localmente: seja através de processos intempéricos da zona de alimentação ou processos antropogênicos com posterior transporte, seja através de modificações mineralógicas in situ provenientes das condições físico-químicas impostas ao ambiente.The Camamu Bay, an important fishing, mining and tourist site, is located at the South Coastal Region of the State of Bahia, Brazil. This large water body is surrounded by extensive mangrove forest and has been the object of many geo-environmental studies. The objective of this work is to present partial results of one of these studies, a mineralogical evaluation in the sediments of the Camamu Bay's mangrove. This semi-quantitative study showed that in the stations next the mining zone the sediment is rich in quartz, barite and clays, with small percentage of pyrite and jarosite. However, for the majority of the stations, the mineralogy is predominantly: quartz and clays, with a variety of percentages of barite, pyrite and crude gypsum in some stations. The results obtained in this work

  3. Synthesis and TL glow curve analysis of BaSO{sub 4}:Eu,Dy phosphor

    Energy Technology Data Exchange (ETDEWEB)

    Rangeela Devi, Y. [Department of Physics, Manipur University, Canchipur, Imphal 795003 (India); Pachhunga University College, Aizawl, Mizoram (India); Dorendrajit Singh, S., E-mail: dorendrajit@yahoo.co.in [Department of Physics, Manipur University, Canchipur, Imphal 795003 (India)

    2012-06-15

    The polycrystalline samples of Ba{sub 1-x-y}SO{sub 4}:Eu{sub x},Dy{sub y} (0{<=}x{<=}1, 0{<=}y{<=}1) have been prepared using the chemical co-precipitation technique. The thermoluminescence (TL) sensitivity of the samples have been found changing with the value of x and y and the highest TL intensity is for Ba{sub 96}SO{sub 4}:Eu{sub 02},Dy{sub 02}. The sample has been characterised by x-ray diffraction (XRD). The samples are found to have orthorhombic structure. For TL analysis Ba{sub 96}SO{sub 4}:Eu{sub 02},Dy{sub 02} is annealed at different temperatures ranging from 873 to 1173 K. Kinetic parameters of all the TL glow curves of Ba{sub 1-x-y}SO{sub 4}:Eu{sub x},Dy{sub y} for different values of x and y and also for the TL glow curves Ba{sub 96}SO{sub 4}:Eu{sub 02},Dy{sub 02} annealed at different temperatures have been found out using computerised glow curve deconvolution (CGCD) method. The activation energy for the most intense TL peak at (444-453 K) is found out to be 1.26 eV and order of kinetics is 1.35. - Highlights: Black-Right-Pointing-Pointer TL study of BaSO{sub 4}:Eu,Dy is reported for the first time. Black-Right-Pointing-Pointer The kinetic parameters are evaluated by CGCD. Black-Right-Pointing-Pointer Effect of concentration, annealing temperature and dose response curve discussed.

  4. Diamagnetic vortex barrier stripes in underdoped BaFe2(As1-xPx) 2

    Science.gov (United States)

    Yagil, A.; Lamhot, Y.; Almoalem, A.; Kasahara, S.; Watashige, T.; Shibauchi, T.; Matsuda, Y.; Auslaender, O. M.

    2016-08-01

    We report magnetic force microscopy (MFM) measurements on underdoped BaFe2(As1 -xPx)2 (x =0.26 ) that show enhanced superconductivity along stripes parallel to twin boundaries. These stripes of enhanced diamagnetic response repel superconducting vortices and act as barriers for them to cross. The width of the stripes is hundreds of nanometers, on the scale of the penetration depth, well within the inherent spatial resolution of MFM and implying that the width is set by the interaction of the superconductor with the MFM's magnetic tip. Unlike similar stripes observed previously by scanning SQUID in the electron doped Ba (Fe1 -xCox)2As2 , the stripes in the isovalently doped BaFe2(As1 -xPx)2 disappear gradually when we warm the sample towards the superconducting transition temperature. Moreover, we find that the stripes move well below the reported structural transition temperature in BaFe2(As1 -xPx)2 and that they can be much denser than in the Ba (Fe1 -xCox)2As2 study. When we cool in finite magnetic field we find that some vortices appear in the middle of stripes, suggesting that the stripes may have an inner structure, which we cannot resolve. Finally, we use both vortex decoration at higher magnetic field and deliberate vortex dragging by the MFM magnetic tip to obtain bounds on the strength of the interaction between the stripes and vortices. We find that this interaction is strong enough to play a significant role in determining the critical current in underdoped BaFe2(As1 -xPx)2 .

  5. Deficit in complex sequence processing after a virtual lesion of left BA45.

    Directory of Open Access Journals (Sweden)

    Emeline Clerget

    Full Text Available Although the contribution of Broca's area to motor cognition is generally accepted, its exact role remains controversial. A previous functional imaging study has suggested that Broca's area implements hierarchically organised motor behaviours and, in particular, that its anterior (Brodmann area 45, BA45 and posterior (BA44 parts process, respectively, higher and lower-level hierarchical elements. This function of Broca's area could generalize to other cognitive functions, including language. However, because of the correlative nature of functional imaging data, the causal relationship between Broca's region activation and its behavioural significance cannot be ascertained. To circumvent this limitation, we used on-line repetitive transcranial magnetic stimulation to disrupt neuronal processing in left BA45, left BA44 or left dorsal premotor cortex, three areas that have been shown to exhibit a phasic activation when participants performed hierarchically organised motor behaviours. The experiment was conducted in healthy volunteers performing the same two key-press sequences as those used in a previous imaging study, and which differed in terms of hierarchical organisation. The performance of the lower-order hierarchical task (Experiment #1 was unaffected by magnetic stimulation. In contrast, in the higher-order hierarchical task (Experiment #2, "superordinate" task, we found that a virtual lesion of the anterior part of Broca's area (left BA45 delayed the processing of the cue initiating the sequence in an effector-independent way. Interestingly, in this task, the initiation cue only informed the subjects about the rules to be applied to produce the appropriate response but did not allow them to anticipate the entire motor sequence. A second important finding was a RT decrease following left PMd virtual lesions in the superordinate task, a result compatible with the view that PMd plays a critical role in impulse control. The present study

  6. Frustration of Negative Capacitance in Al2O3/BaTiO3 Bilayer Structure

    Science.gov (United States)

    Kim, Yu Jin; Park, Min Hyuk; Lee, Young Hwan; Kim, Han Joon; Jeon, Woojin; Moon, Taehwan; Do Kim, Keum; Jeong, Doo Seok; Yamada, Hiroyuki; Hwang, Cheol Seong

    2016-01-01

    Enhancement of capacitance by negative capacitance (NC) effect in a dielectric/ferroelectric (DE/FE) stacked film is gaining a greater interest. While the previous theory on NC effect was based on the Landau-Ginzburg-Devonshire theory, this work adopted a modified formalism to incorporate the depolarization effect to describe the energy of the general DE/FE system. The model predicted that the SrTiO3/BaTiO3 system will show a capacitance boost effect. It was also predicted that the 5 nm-thick Al2O3/150 nm-thick BaTiO3 system shows the capacitance boost effect with no FE-like hysteresis behavior, which was inconsistent with the experimental results; the amorphous-Al2O3/epitaxial-BaTiO3 system showed a typical FE-like hysteresis loop in the polarization – voltage test. This was due to the involvement of the trapped charges at the DE/FE interface, originating from the very high field across the thin Al2O3 layer when the BaTiO3 layer played a role as the NC layer. Therefore, the NC effect in the Al2O3/BaTiO3 system was frustrated by the involvement of reversible interface charge; the highly stored charge by the NC effect of the BaTiO3 during the charging period could not be retrieved during the discharging process because integral part of the polarization charge was retained within the system as a remanent polarization.

  7. Electrochemical impedance spectroscopy of BaCeO{sub 3} modified by Ti and Y

    Energy Technology Data Exchange (ETDEWEB)

    Pasierb, P.; Wierzbicka, M.; Komornicki, S.; Rekas, M. [AGH University of Science and Technology, Faculty of Materials Science and Ceramics, Al. Mickiewicza 30, 30-059 Krakow (Poland)

    2009-10-20

    Barium cerate exhibits high protonic conductivity, especially when modified by trivalent dopant such as Y, Yb, Nd, Sm or Dy. Unfortunately, the poor chemical stability in the presence of CO{sub 2} is the main disadvantage of this material. One of the possible approach to get the stable protonic conductor is the preparation of solid solutions. For example, doping of BaCeO{sub 3} with Zr leads to the improvement of the chemical stability, but the electrical properties are simultaneously corrupted. In the present work the influence of Ti, per analogy to Zr, and Y dopants on electrical properties of BaCeO{sub 3} was investigated using the electrochemical impedance spectroscopy (EIS) technique. BaCe{sub 1-x}Ti{sub x}O{sub 3-{delta}} (0 {<=} x {<=} 0.3) and Ba(Ce{sub 0.95}Ti{sub 0.05}){sub 0.95}Y{sub 0.05}O{sub 3-{delta}} solid electrolytes were prepared by solid-state reaction method. It was found that the changes of electrical properties due to the introduction of Ti into the BaCeO{sub 3} lattice is caused predominantly by the modification of the grain boundary properties. The Ti doping leads to the substantial decrease of grain boundary electrical conductivity, comparing to undoped material. The introduction of yttrium dopant to the BaCe{sub 0.95}Ti{sub 0.05}O{sub 3} lattice has the opposite effect. The total electrical conductivity increases, due to significant modification of grain boundary electrical properties. (author)

  8. Enhancement of polarization property of silane-modified BaTiO3 nanoparticles and its effect in increasing dielectric property of epoxy/BaTiO3 nanocomposites

    Directory of Open Access Journals (Sweden)

    Thi Tuyet Mai Phan

    2016-03-01

    Full Text Available The surface modification of synthesized nano-BaTiO3 particles was carried out using γ-aminopropyl trimethoxy silane (γ-APS in an ethanol/water solution. The modified particles were characterized by FTIR, TGA, surface charge analysis, and by dielectric constant measurement. The silane molecules were attached to the surface of BaTiO3 particles through SiOBaTiO3 bonds. The γ-APS grafted on BaTiO3 made the dielectric constant of the particles increase at frequencies ≥0.3 kHz in a wide range of temperature (25 °C–140 °C, due to the presence of NH2 groups. The dependence of the polarization vs. electrical field was measured in order to elucidate the dielectric behavior of the silane treated BaTiO3 in comparison to untreated BaTiO3. The nanocomposite based on epoxy resin containing BaTiO3 nanoparticles untreated and treated with γ-APS was also prepared and characterized. The results indicated that the γ-APS-modified BaTiO3 surfaces significantly enhanced the dielectric property of the nanocomposite.

  9. Emergence of the sub-THz central peak at phase transitions in artificial BaTiO{sub 3}/(Ba,Sr)TiO{sub 3} superlattices

    Energy Technology Data Exchange (ETDEWEB)

    Tikhonov, Yu.A.; Razumnaya, A.G.; Torgashev, V.I.; Zakharchenko, I.N.; Yuzyuk, Yu.I. [Faculty of Physics, Southern Federal University, Rostov-on-Don (Russian Federation); El Marssi, M. [Laboratoire de Physique de la Matiere Condensee, Universite de Picardie Jules Verne, Amiens (France); Ortega, N.; Kumar, A.; Katiyar, R.S. [Department of Physics and Institute for Functional Nanomaterials, University of Puerto Rico, San Juan, PR (United States)

    2015-01-01

    A prominent central peak in the sub-THz frequency range was observed in the Raman spectra of BaTiO{sub 3}/(Ba,Sr)TiO{sub 3} (BT/BST) superlattice grown on (001)MgO substrate. Both soft and central mode show an anomaly around 200 K and 280 K, which can be correlated with orthorhombic to monoclinic phase transition of BST and BT, respectively. The observed temperature dependence of the central mode enabled us to explain rather broad temperature dependence of the dielectric permittivity previously observed in BT/BST superlattices. (copyright 2015 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (orig.)

  10. Oxygen vacancy induced magnetism in BaTiO3-δ and Nb:BaTiO3-δ thin films

    Institute of Scientific and Technical Information of China (English)

    2010-01-01

    The unusual magnetic properties are observed in oxygen deficient BaTiO3-δ(BTO) and Nb:BaTiO3-δ(BNTO) thin films fabricated on SrTiO3 substrates by laser molecular beam epitaxy.The distinct magnetic hysteresis loops are observed in the oxygen deficient BTO and BNTO thin films in a temperature range of 5 to 300 K,whereas the diamagnetism is observed in both BTO and BNTO annealed at 1 atm of oxygen.The dopant Nb only enhances the magnetization in BNTO thin films,but has little effect on the coercivity.The magnetism of BTO and BNTO films is proposed to be the oxygen vacancies by origin.

  11. Crystal structure and polarization hysteresis properties of ferroelectric BaTiO3 thin-film capacitors on (Ba,Sr)TiO3-buffered substrates

    Science.gov (United States)

    Maki, Hisashi; Noguchi, Yuji; Kutsuna, Kazutoshi; Matsuo, Hiroki; Kitanaka, Yuuki; Miyayama, Masaru

    2016-10-01

    Ferroelectric BaTiO3 (BT) thin-film capacitors with a buffer layer of (Ba1- x Sr x )TiO3 (BST) have been fabricated on (001) SrTiO3 (STO) single-crystal substrates by a pulsed laser deposition method, and the crystal structure and polarization hysteresis properties have been investigated. X-ray diffraction reciprocal space mapping shows that the BST buffer effectively reduces the misfit strain relaxation of the BT films on SrRuO3 (SRO) electrodes. The BT capacitor with the SRO electrodes on the BST (x = 0.3) buffer exhibits a well-saturated hysteresis loop with a remanent polarization of 29 µC/cm2. The hysteresis loop displays a shift toward a specific field direction, which is suggested to stem from the flexoelectric coupling between the out-of-plane polarization and the strain gradient adjacent to the bottom interface.

  12. BaFAlSi and BaFAlGe: First transition metal-free LaOAgS-type fluoride tetrelides

    Energy Technology Data Exchange (ETDEWEB)

    Charkin, Dmitri O., E-mail: charkin@inorg.chem.msu.ru; Plokhikh, Igor V.; Kuznetsov, Alexey N.; Kazakov, Sergey M.

    2015-04-05

    Highlights: • Two first tetrelide fluorides with the LaOAgS structure have been prepared. • They are also the first transition metal-free representatives of the structure type. • Contrary to pnictides, hydride tetrelides are predicted to have different structures. - Abstract: Studies of the LaOAgS-type compounds among alkaline earth – Al (Ga) fluoride tetrelides revealed the existence of two new compounds BaFAlSi and BaFAlGe which are the first representatives of fluoride tetrelides; they also are the first representatives of the structure type not involving transition metals. No compound of the structure type is formed for strontium and gallium. Quantum chemical calculations indicate that only these two compounds are thermodynamically stable; the structure is probably stabilized by ionic interactions in the FeSe-like anionic slabs, which are relatively weak for bonds formed between triels and tetrels that are close in electronegativity.

  13. Synthesis and crystal structure of barium indide Ba{sub 9}In{sub 4}

    Energy Technology Data Exchange (ETDEWEB)

    Smetana, Volodymyr; Simon, Arndt [Max-Planck-Institut fuer Festkoerperforschung, Stuttgart (Germany)

    2010-05-15

    A new binary compound in the system Ba-In has been synthesized and structurally characterized. According to singlecrystal X-ray diffraction data Ba9In4 crystallizes with tetragonal symmetry (I4/m, a = 13.948(2), c = 5.888(1) A, V = 1145.5(3) A{sup 3}, Z = 2, R1 = 0.037, wR2 = 0.071). The very moisture-sensitive compound could be obtained as single phase by reaction of metallic barium and indium at 350 C. (orig.)

  14. Luminescent and kinetic properties of the polystyrene composites based on BaF2 nanoparticles

    Science.gov (United States)

    Demkiv, T. M.; Halyatkin, O. O.; Vistovskyy, V. V.; Gektin, A. V.; Voloshinovskii, A. S.

    2016-02-01

    Luminescence-kinetic properties of polystyrene composites based on BaF2 nanoparticles were studied. The electron emission from the nanoparticles due to the photoelectric effect is the main luminescence excitation mechanism in the case of polystyrene composites loaded with small BaF2 nanoparticles (~20 nm). Scintillation pulse of polystyrene composites possesses only fast decay component with the time constant τ~2 ns, and its emission intensity considerably exceeds the one for pure polystyrene scintillator upon the X-ray excitations.

  15. Magnetic levitation and stiffness in melt-textured Y-Ba-Cu-O

    Science.gov (United States)

    Hull, J. R.; Mulcahy, T. M.; Salama, K.; Selvamanickam, V.; Weinberger, B. R.; Lynds, L.

    1992-09-01

    Magnetic levitation and stiffness have been measured in several systems composed of a permanent magnet elastically suspended above a stationary melt-textured sample of Y-Ba-Cu-O. The levitation force and vertical stiffness have been calculated on the basis of magnetization measurements of the same system, and the calculated results showed excellent agreement with the experimental measurements. Based on the force and magnetization measurements, it is predicted that the same Y-Ba-Cu-O material configured in a geometry suitable for magnetic bearings could produce a levitation pressure of 100-400 kPa at 20 K.

  16. Neutron diffraction studies on Ca1-BaZr4P6O24 solid solutions

    Indian Academy of Sciences (India)

    S N Achary; O D Jayakumar; S J Patwe; A B Shinde; P S R Krishna; S K Kulshreshtha; A K Tyagi

    2008-11-01

    Herein we report the results of detailed crystallographic studies of Ca1-BaZr4P6O24 compositions from combined Rietveld refinements of powder X-ray and neutron diffraction data. All the studied compositions crystallize in rhombohedral lattice (space group R-3 No. 148). A continuous solid solution is concluded from the systematic variation of unit cell parameters. The variation of unit cell parameters with the composition indicates decreasing trend in parameter with increasing Ba2+ concentration contrast to an increasing trend in parameter.

  17. Luminescent and kinetic properties of the polystyrene composites based on BaF{sub 2} nanoparticles

    Energy Technology Data Exchange (ETDEWEB)

    Demkiv, T.M.; Halyatkin, O.O.; Vistovskyy, V.V. [Ivan Franko National University of Lviv, 8a Kyryla i Mefodiya Street, 79005 Lviv (Ukraine); Gektin, A.V. [Institute for Scintillation Materials, NAS of Ukraine, 60 Lenina Avenue, 61001 Kharkiv (Ukraine); Voloshinovskii, A.S. [Ivan Franko National University of Lviv, 8a Kyryla i Mefodiya Street, 79005 Lviv (Ukraine)

    2016-02-21

    Luminescence-kinetic properties of polystyrene composites based on BaF{sub 2} nanoparticles were studied. The electron emission from the nanoparticles due to the photoelectric effect is the main luminescence excitation mechanism in the case of polystyrene composites loaded with small BaF{sub 2} nanoparticles (~20 nm). Scintillation pulse of polystyrene composites possesses only fast decay component with the time constant τ~2 ns, and its emission intensity considerably exceeds the one for pure polystyrene scintillator upon the X-ray excitations.

  18. Direct synthesis of ultrafine tetragonal BaTiO3 nanoparticles at room temperature

    Directory of Open Access Journals (Sweden)

    Hu Yong

    2011-01-01

    Full Text Available Abstract A large quantity of ultrafine tetragonal barium titanate (BaTiO3 nanoparticles is directly synthesized at room temperature. The crystalline form and grain size are checked by both X-ray diffraction and transmission electron microscopy. The results revealed that the perovskite nanoparticles as fine as 7 nm have been synthesized. The phase transition of the as-prepared nanoparticles is investigated by the temperature-dependent Raman spectrum and shows the similar tendency to that of bulk BaTiO3 materials. It is confirmed that the nanoparticles have tetragonal phase at room temperature.

  19. Spin-driven multiferroics in BaYFeO{sub 4}

    Energy Technology Data Exchange (ETDEWEB)

    Cong, Jun-Zhuang; Shen, Shi-Peng; Chai, Yi-Sheng; Yan, Li-Qin; Shang, Da-Shan; Wang, Shou-Guo; Sun, Young, E-mail: youngsun@iphy.ac.cn [Beijing National Laboratory for Condensed Matter Physics, Institute of Physics, Chinese Academy of Sciences, Beijing 100190 (China)

    2015-05-07

    We report on the spin-driven multiferroic property and magnetoelectric effect in the lately synthesized compound BaYFeO{sub 4}. Due to its peculiar crystal structure, the system exhibits complex magnetic phases with multiple transitions. The dielectric and pyroelectric measurements evidence a spin-driven multiferroic state raised by the cycloidal spin structure below T{sub 1} = 36 K. Strong magnetoelectric effect has also been observed in the multiferroic state. The origin of noncollinear cycloidal spin structure in BaYFeO{sub 4} is believed to arise from the interactions between low-dimensional magnetic columns.

  20. Emission probability determination of {sup 133}Ba by the sum-peak method

    Energy Technology Data Exchange (ETDEWEB)

    Silva, R.L. da; Almeida, M.C.M. de; Delgado, J.U.; Poledna, R.; Araujo, M.T.F.; Trindade, O.L.; Veras, E.V. de; Santos, A.; Rangel, J.; Ferreira Filho, A.L., E-mail: ronaldo@ird.gov.br, E-mail: marcandida@yahoo.com.br [Instituto de Radioprotecao e Dosimetria (IRD/CNEN-RJ), Rio de Janeiro, RJ (Brazil)

    2016-07-01

    The National Laboratory of Metrology Ionizing Radiation (LNMRI/IRD/CNEN) has several measurement methods in order to ensure low uncertainties about the results. Through gamma spectrometry analysis by sum-peak absolute method they were performed the standardization of {sup 133}Ba activity and your emission probability determination of different energies with reduced uncertainties. The advantages of radionuclides calibrations by absolute method are accuracy, low uncertainties and is not necessary the use of radionuclides reference standards. {sup 133}Ba is used in research laboratories on calibration detectors in different work areas. The uncertainties for the activity and for the emission probability results are lower than 1%. (author)

  1. Influence of BaO in perovskite electrodes for the electrochemical reduction of NOx

    DEFF Research Database (Denmark)

    Simonsen, Vibe Louise Ernlund; Johnsen, M.M.; Kammer Hansen, Kent

    2007-01-01

    Using the point electrode method, the effect of BaO on electrochemical reduction of NO (x) was investigated using the perovskites La0.85Sr0.15MnO3 (LSM15) and La0.85Sr0.15CoO3 (LSCo15) as electrode materials. The experiments were carried out in the temperature range 400-600 degrees C in 1% NO and...... favored oxygen reduction compared to reduction of nitric oxide. The LSCO15 electrode containing BaO reacted to form a K2NiF4-structure and was not tested further....

  2. New BaBrCl: Eu~(2+) phosphors for X-ray image recording

    Institute of Scientific and Technical Information of China (English)

    WANG YongSheng; MENG XianGuo; HE DaWei

    2009-01-01

    Photostimulated luminescence (PSL) is observed in BaBrCh Eu~(2+) after X-ray irradiation at room tem-perature. It is suggested by PSL stimulation spectrum and difference absorption spectrum (DAS) that F centers are formed upon X-ray irradiation and both spectra show two bands which are centered at about 550 nm and 675 nm respectively. This enables the use of semiconductor light-emitting diodes (LED) instead of gas lasers for photostimulation. The PSL intensity increases linearly with X-ray irra-diation dose increasing, and the conversion efficiency is 29% that for the standard commercial storage phosphor BaFBr:Eu from Fuji imaging plate.

  3. Local chemical composition of HgBaCaCuO high-temperature superconductors

    Science.gov (United States)

    Alméras, P.; Dell'Orto, T.; Coluzza, C.; Almeida, J.; Margaritondo, G.; Xue, Y. Y.; Meng, R. L.; Chu, C. W.

    1994-07-01

    The microchemical composition and the electronic structure of the two superconductors HgBa2Ca2Cu3O8+δ (Hg-1223) and HgBa2Ca1Cu2O6+δ (Hg-1212) were analyzed with the technique of photoemission with high spatial resolution. This enabled primary spectral peaks to be separated from their satellites due to local charging induced by the primary photon beam. Each sample contains superconducting and impurity phases with inhomogeneous spatial distributions. The oxygenation-induced increase in the critical temperature is related to a increase in the Cu-O plane carrier concentration.

  4. Optical properties of ZnO/BaCO3 nanocomposites in UV and visible regions

    OpenAIRE

    Zak, Ali Khorsand; Hashim, Abdul Manaf; Darroudi, Majid

    2014-01-01

    Pure zinc oxide and zinc oxide/barium carbonate nanoparticles (ZnO-NPs and ZB-NPs) were synthesized by the sol–gel method. The prepared powders were characterized by X-ray diffraction (XRD), ultraviolet–visible (UV–Vis), Auger spectroscopy, and transmission electron microscopy (TEM). The XRD result showed that the ZnO and BaCO3 nanocrystals grow independently. The Auger spectroscopy proved the existence of carbon in the composites besides the Zn, Ba, and O elements. The UV–Vis spectroscopy re...

  5. Crystal growth of Ba 3BP 3O 12 with BPO 4-NaF flux

    Science.gov (United States)

    Zhang, Zhi-Jun; Wang, Hong; Hu, Guan-Qin; Chen, Hao-Hong; Yang, Xin-Xin; Zhao, Jing-Tai

    2010-04-01

    Single crystals of Ba 3BP 3O 12 with size of 10×8×2 mm 3 have been grown by the top-seeded solution growth (TSSG) method using BPO 4-NaF mixture as the flux. The crystals were characterized by X-ray powder diffraction, field emission scanning electron microscopy (FE-SEM) and transmittance spectrum. Ba 3BP 3O 12 single crystal exhibits wide transparency in the range 250-800 nm. The preparation process of starting materials and the effect of flux on the crystal growth were discussed.

  6. Phase transitions and electrical properties of the ferroelectric K2Ba4Nb10O30

    Energy Technology Data Exchange (ETDEWEB)

    Cherner, IA.E.; Shpak, L.A.; Gol' tsov, IU.I.; Filip' ev, V.S.

    1987-03-01

    A transition of the second kind between two ferroelectric tetragonal phases was observed at a temperature of 290 K in K2Ba4Nb10O30. This transition is not connected with the appearance or modification of spontaneous polarization, and is accompanied by peaks of permittivity and dielectric losses. The anomaly in the temperature dependence of specific resistance observed previously in polycrystalline K2Ba4Nb10O30 at 220-410 K is connected with the formation and modification of the electrical state of barriers at intercrystalline boundaries. 10 references.

  7. Glow curves and the emission of flux grown BaFCl:Gd crystals

    Energy Technology Data Exchange (ETDEWEB)

    Somaiah, K.; Hari Babu, V. (Osmania Univ., Hyderabad (India). Dept. of Physics)

    1984-03-16

    Thermoluminescence output of the BaFCl is found to be enhanced enormously when it is doped with gadolinium. An incorporation of gadolinium in BaFCl produces additional glow peaks at 455 and 560 K, an optical absorption band at 660 nm, and glow emission bands at 315 and 450 nm. The 315 nm emission band is the characteristic emission of the gadolinium impurity. Since similar emission spectra are obtained for different glow peaks, they are attributed to the luminescent centers caused by the gadolinium impurity in the lattice. The trap depth and frequency factor of additional glow peaks are calculated employing different methods.

  8. Processing and properties of silver-clad Tl-Ba-Ca-Cu-O wires and tapes

    Science.gov (United States)

    Goretta, K. C.; Wu, C. T.; Lanagan, M. T.; Boling, M. A.; Shi, D.; Miller, D. J.; Chen, Nan; Hanewald, W. G.; Sengupta, S.; Wang, Z.

    1992-03-01

    TlBa2Ca2Cu3O(sub x) and Tl2Ba2Ca2Cu3O(sub x) powders were synthesized, loaded into Ag tubes, and worked into wires and tapes by drawing and rolling. All processing outside of furnaces was in a dry-N2 glovebox. All heat treatments were performed in O2. The Ag-clad wires fabricated from these powders exhibited onset of superconductivity at approx. 18 K and critical current densities at 77 K of 2 x 10(exp 3) to 4 x 10(exp 3) A/sq cm.

  9. Linear electro-optical properties of tetragonal BaTiO3

    Indian Academy of Sciences (India)

    P U Sastry

    2002-09-01

    Linear optical susceptibility and clamped linear electro-optical tensor coefficients of tetragonal BaTiO3 are calculated using a formalism based on bond charge theory. Calculated values are in close agreement with experimental data. The covalent Ti–O bonds constituting distorted TiO6 octahedral groups are found to be major contributors to the electro-optic coefficients making them more sensitive than the BaO12 groups for these properties. Orientations of chemical bonds play an important role in determining these properties.

  10. Theoretical investigation of the thermoelectric transport properties of BaSi2

    Institute of Scientific and Technical Information of China (English)

    Peng Hua; Wang Chun-Lei; Li Ji-Chao; Zhang Rui-Zhi; Wang Hong-Chao; Sun Yi

    2011-01-01

    The full-potential linear augmented plane wave method based on density functional theory is employed to investigate the electronic structure of BaSi2 With the constant relaxation time and rigid band approximation, the electrical conductivity, Seebeck coefficient and figure of merit are calculated by using Boltzmann transport theory, further evaluated as a function of carrier concentration. We find that the Seebeck coefficient is more anisotropic than electrical conductivity. The figure of merit of BaSi2 is predicted to be quite high at room temperature, implying that optimal doping may be an effective way to improve thermoelectric properties.

  11. Lattice sites of Cd in ferroelectric BaTiO$_3$

    CERN Document Server

    Dietrich, M; Deicher, M; Richter, F; Samokhvalov, V; Unterricker, S

    2002-01-01

    The radioactive isotope 111mCd was implanted into BaTiO3 in order to measure electric field gradients with Perturbed Angular Correlation spectroscopy (PAC). It is possible to anneal the implantation induced lattice damage to a certain extent. Then, 111mCd probes are positioned at two sites with distinct axially symmetric electric field gradients characterized by the quadrupole coupling constants of 33.9(9) and 69.8(9) MHz. These electric field gradients can be assigned to 111mCd at the Ti- and the Ba-sites.

  12. Structural study on phosphorus doping of BaSi{sub 2} epitaxial films by ion implantation

    Energy Technology Data Exchange (ETDEWEB)

    Hara, K.O., E-mail: k-hara@imr.tohoku.ac.jp [Institute for Materials Research, Tohoku University, 2-1-1 Katahira, Aoba-ku, Sendai 980-8577 (Japan); Core Research for Evolutional Science and Technology, Japan Science and Technology Agency, Gobancho, Chiyoda, Tokyo 102-0076 (Japan); Hoshi, Y. [Institute for Materials Research, Tohoku University, 2-1-1 Katahira, Aoba-ku, Sendai 980-8577 (Japan); Usami, N. [Institute for Materials Research, Tohoku University, 2-1-1 Katahira, Aoba-ku, Sendai 980-8577 (Japan); Core Research for Evolutional Science and Technology, Japan Science and Technology Agency, Gobancho, Chiyoda, Tokyo 102-0076 (Japan); Shiraki, Y. [Advanced Research Laboratories, Tokyo City University, 8-15-1 Todoroki, Setagaya, Tokyo 158-0082 (Japan); Nakamura, K.; Toko, K. [Institute of Applied Physics, University of Tsukuba, 1-1-1 Tennohdai, Tsukuba, Ibaraki 305-8573 (Japan); Suemasu, T. [Core Research for Evolutional Science and Technology, Japan Science and Technology Agency, Gobancho, Chiyoda, Tokyo 102-0076 (Japan); Institute of Applied Physics, University of Tsukuba, 1-1-1 Tennohdai, Tsukuba, Ibaraki 305-8573 (Japan)

    2013-05-01

    Phosphorus doping of BaSi{sub 2} epitaxial films by means of P implantation and rapid thermal annealing has been investigated from a structural viewpoint. Raman spectroscopy and X-ray diffraction show that the crystal structure of BaSi{sub 2} is destroyed, at least partially, by P implantation. This irradiation damage increases with increasing the P dose from 1.0 × 10{sup 13} to 1.0 × 10{sup 15} cm{sup −2} and can be removed by rapid thermal annealing for 30 s at 600–800 °C, as evidenced by the variation of the full width at half-maximum of the A{sub 1}-mode Raman peak. In addition to the recovery of the irradiation damage, the metastable trigonal phase of BaSi{sub 2}, which is metallic and undesirable to exist in the semiconductor film, is found to form by annealing at 800 °C after P implantation of 1.0 × 10{sup 15} cm{sup −2}. Furthermore, by annealing at 600 and 700 °C, P atoms have been revealed to segregate into the surface and BaSi{sub 2}/Si interface while the P segregation is suppressed at 800 °C, according to the depth profile of P determined by secondary ion mass spectroscopy. Thus, we have obtained a useful guide of the P implantation dose and annealing temperature to effectively dope P atoms into the semiconducting BaSi{sub 2} film. - Highlights: ► P doping of BaSi{sub 2} by ion implantation and rapid thermal annealing is studied. ► The crystal structure of BaSi{sub 2} is destroyed, at least partially, by P implantation. ► The annealing condition to remove the irradiation damage is revealed. ► The trigonal BaSi{sub 2} phase forms from the highly damaged film by annealing. ► P atoms segregate at 600–800 °C.

  13. Energy Calibration of the BaBar EMC Using the Pi0 Invariant Mass Method

    Energy Technology Data Exchange (ETDEWEB)

    Tanner, David J.; /Manchester U.

    2007-04-06

    The BaBar electromagnetic calorimeter energy calibration method was compared with the local and global peak iteration procedures, of Crystal Barrel and CLEO-II. An investigation was made of the possibility of {Upsilon}(4S) background reduction which could lead to increased statistics over a shorter time interval, for efficient calibration runs. The BaBar software package was used with unreconstructed data to study the energy response of the calorimeter, by utilizing the {pi}{sup 0} mass constraint on pairs of photon clusters.

  14. Optical properties of ZnO/BaCO3 nanocomposites in UV and visible regions

    OpenAIRE

    Zak, Ali Khorsand; Hashim, Abdul Manaf; Darroudi, Majid

    2014-01-01

    Pure zinc oxide and zinc oxide/barium carbonate nanoparticles (ZnO-NPs and ZB-NPs) were synthesized by the sol–gel method. The prepared powders were characterized by X-ray diffraction (XRD), ultraviolet–visible (UV–Vis), Auger spectroscopy, and transmission electron microscopy (TEM). The XRD result showed that the ZnO and BaCO3 nanocrystals grow independently. The Auger spectroscopy proved the existence of carbon in the composites besides the Zn, Ba, and O elements. The UV–Vis spectroscopy re...

  15. Growing small-world networks based on a modified BA model

    CERN Document Server

    Xu, Xinping; Li, Wei

    2006-01-01

    We propose a simple growing model for the evolution of small-world networks. It is introduced as a modified BA model in which all the edges connected to the new nodes are made locally to the creator and its nearest neighbors. It is found that this model can produce small-world networks with power-law degree distributions. Properties of our model, including the degree distribution, clustering, and the average path length are compared with that of the BA model. Since most real networks are both scale-free and small-world networks, our model may provide a satisfactory description for empirical characteristics of real networks.

  16. Substrate Temperature Study in the Crystallinity of BaTiO3 Thin Films

    Directory of Open Access Journals (Sweden)

    Márquez-Herrera Alfredo

    2013-06-01

    Full Text Available Ferroelectric thin films of BaTiO3(BTO were grown on quartz and nichrome substrates using a BaTiO3 target by RF-Sputtering technique. It was studied the effect of the substrate temperature in the crystallization of the material. These samples were compared with films deposited at room temperature and heat treated out of the growth Chamber. Their crystallinity were studied by X-ray diffraction. Additionally, the optical characterizations were carried out by UV-Vis spectrophotometer. The growth of thin films with substrate temperature allows the obtaining of crystalline materials at temperatures below those reported by other authors.

  17. Redox reactions and mechanism of luminescence in BaFCl:Eu

    CERN Document Server

    Upadeo, S V; Gundurao, T K

    1998-01-01

    The phenomenon of stimulable luminescence of phosphors pre-irradiated with high-energy radiation is widely used in the field of imaging. Phosphors such as BaFX:Eu (X = Cl, Br) are extensively used in x-ray screens for digital image processing. There is, however, divided opinion regarding the mechanism responsible for the luminescence process in these materials. In this paper we have discussed the role of Eu sup 3 sup +reversible Eu sup 2 sup + conversion in BaFCl:Eu phosphor using PL, TL, TL emission and ESR techniques. (author)

  18. PREPARATION AND SINTERING PROPERTIES OF BaTi4O9 BY CITRIC ACID GEL METHOD%单相BaTi4O9柠檬酸凝胶法制备及烧结特性

    Institute of Scientific and Technical Information of China (English)

    王伟; 张启龙; 杨辉

    2006-01-01

    本文采用柠檬酸凝胶法制备了单相的BaTi4O9.干凝胶在750℃煅烧得到了物相为BaTi5O11和Ba4Ti13O30、尺寸约为30~50nm前驱体粉体,纳米前驱体粉体在1200℃煅烧2h获得了单相的BaTi4O9.单相BaTi4O9粉体具有优良的烧结性能,在1250℃烧结保温4h,致密度达到了理论密度的97%.

  19. Elemental analysis of BaTi0.96Fe0.04O3 & BaTi0.96Co0.04O3

    Science.gov (United States)

    Mishra, Ashutosh; Mishra, Niyati; Mahalakshmi, Kanaka; Bisen, Supriya

    2014-09-01

    A finest possible sample of 4% Iron doped & cobalt doped BaTiO3 (BTO) with possible tetragonal & cubic structure via solid state route was prepared. Prepared samples were characterized by X-ray diffraction (XRD) using by Bruker D8 advance XRD instrument, the value of 2Θ is in between 200 to 800. X-ray photoelectron spectroscopy (XPS) spectra were measured using a VSW Scientific instruments at UGC-DAE CSR.

  20. Standardization of 137mCs+137mBa by Liquid Scintillation; Calibracion de 137Cs+137mBa por Centelleo Liquido

    Energy Technology Data Exchange (ETDEWEB)

    Rodriguez, L.; Los Arcos, J.M.; Grau, A.

    1995-07-01

    A procedure for the preparation of a stable, homogeneous solution of 137Cs+''137mBa, for use in liquid scintillation measurements, is described. Its count rate stability and spectral time evolution has been followed for several weeks. The solution has been standardised by the CIEMAT/NIST method in both Ultima-Gold and Insta-Gel, to a combined uncertainty lower than 0,51 % (k=l). (Author) 5 refs.

  1. Paleoenvironmental reconstitution of Motuca and Sambaíba formations, Permian-Triassic of the Parnaíba Basin in southwest Maranhão state, Brazil

    Directory of Open Access Journals (Sweden)

    Francisco Romério Abrantes Júnior

    2013-09-01

    Full Text Available The interval between the Late Paleozoic and Early Mesozoic was marked by paleogeographic and paleoclimatic global changes, partly attributed to catastrophic events. The intense continentalization of the supercontinent Pangaea of End-Permian propitiated the development of extensive deserts that succeeded the coastal and platform environments of Early Permian. The records of these events in northern Brazil are found in intracratonic basins, particularly in the Permo-triassic succession of the Parnaíba Basin. The facies and stratigraphic outcrops analysis of this succession allowed the individualization of 14 sedimentary facies grouped into four facies associations (FA: FA1 and FA2 related to deposits of Motuca Formation and, FA3 and FA4, representative of the base of Sambaíba Formation. The FA1 – Shallow lake/Mudflat consists of red laminated mudstone with lenses of gypsum, calcite and marl, besides lobes of sigmoidal sandstones. The FA2 – Saline pan consists of lenticular bodies of laminated gypsum, nodular gypsum and gypsarenite, overlapped by greenish mudstones with dolomite nodules and palygorskite. The FA3 – sand sheet and FA4 – dunes field are formed, respectively, for orange cream sandstones with even parallel stratification and medium- to large-scale cross-bedding. In the contact between Motuca and Sambaíba formations occurs a deformed interval, laterally continuous for hundreds of kilometers. Brecciated and contorted bedded siltstones and mudstone (Motuca Formation and sandstone with sinsedimentary faults/microfaults, convolute lamination and mud-filled injection dykes (Sambaíba Formation are interpreted as seismites triggered by high magnitude earthquakes (> 8 according Richter scale.

  2. Dosimetry of ultraviolet radiation with BaHfO{sub 3} powders; Dosimetria de radiacion ultravioleta con polvos de BaHfO{sub 3}

    Energy Technology Data Exchange (ETDEWEB)

    Barrera A, A. A.; Aguilar D, G. A.; Guzman M, J.; Rivera M, T. [IPN, Centro de Investigacion en Ciencia Aplicada y Tecnologia Avanzada, Av. Legaria 694, Col. Irrigacion, 11500 Ciudad de Mexico (Mexico); Ceron R, V., E-mail: abalba1@hotmail.com [Universidad de Guanajuato, 37670 Leon, Guanajuato (Mexico)

    2016-10-15

    Ceramic materials based on pure barium hafnate (BaHfO{sub 3}) have been obtained as a powder by the co-precipitation method. The powders obtained have a cubic structure that favors the thermoluminescent and optical properties, through which a better detection of the non-ionizing radiation is allowed. With these powders various tests were performed in the ultraviolet range at different exposure times. These thermoluminescent (Tl) studies were carried out using a Tl 3500 hand held reader which yielded a brightness curve that ranged from room temperature to the 350 degrees Celsius. This BaHfO{sub 3} response exhibits a broad brightness curve with a single peak centered around 225 degrees Celsius. Finally, is reported that there are materials of barium hafnate (BaHfO{sub 3}) doped with some rare earths (Eu, Tb) which, instead of improving the performance of the powders, decrease it, so that the use of intrinsic barium hafnate is the most appropriate. (Author)

  3. A study on the damping capacity of BaTiO3-reinforced Al-matrix composites

    Indian Academy of Sciences (India)

    C J XIAO

    2016-04-01

    To study the damping capacity of BaTiO$_3$/Al composites, Al composites reinforced with BaTiO$_3$ powder (average grain sizes: 100 and 1000 nm) were fabricated by the hot-pressing sintering method. The damping properties of pure Al and BaTiO$_3$/Al composites were investigated and compared based on the dynamic mechanical analysis over a wide range of temperatures (50–285$^{\\circ}$C). Compared with pure Al matrix, 1000 nm BaTiO$_3$/Al composites with 5 and 10% mass fractions of BaTiO$_3$ exhibited better damping capacity. For 100 nm BaTiO$_3$/Al composite, its damping capacity is slightly higher than that of pure Al below 145$^{\\circ}$C, while it becomes lower above this degree. The damping capacity enhancement of BaTiO$_3$/Al composites can be explained by the ferroelastic domain damping. Furthermore, 5 and 10% BaTiO$_3$/Al composites have higher bending strength and hardness than pure Al sample.

  4. Farmacokinetiek en biologische beschikbaarheid van benzo(a)pyreen (BaP) in de RIV:tox rat

    NARCIS (Netherlands)

    Lusthof KJ; Olling M; Kroese ED; Beenen J; Poelen MJ; Vaessen HAMG; Kamp CG van de

    1993-01-01

    Eight groups of six male RIV:tox rats received oral and intravenous doses of benzo(a)pyrene (BaP) in a parallel study plan. Intravenously and orally four dose levels were administered. BaF was dissolved in soybean oil for oral administration, and in glycofurol for intravenous administration. The dos

  5. Measurement of the e+e- Multihadronic Cross Sections below 4.5 GeV with BaBar

    OpenAIRE

    Achim Denig representing the BaBar collaboration

    2006-01-01

    We present a summary of the hadronic cross section measurements performed with BaBar at the PEP-II collider via radiative return. BaBar has performed measurements of exclusive final states containing 3, 4 and 6 hadrons via this complementary method, as well as a measurement of the proton form factor.

  6. Model of interatomic interaction and dynamic and thermodynamic properties of Tl 2CaBa 2Cu 2O 8

    Science.gov (United States)

    Belosludov, V. R.; Lavrent'ev, M. Yu.; Syskin, S. A.

    1991-12-01

    A model of interatomic interactions in Tl 2CaBa 2Cu 2O 8, which takes into account Coulombic interaction and covalent bonds, is presented. Using this model, calculations of lattice dynamics and lattice specific heat of Tl 2CaBa 2Cu 2O 8 are performed.

  7. Characterization of the insulator barrier and the superconducting transition temperature in GdBa{sub 2}Cu{sub 3}O{sub 7−δ}/BaTiO{sub 3} bilayers for application in tunnel junctions

    Energy Technology Data Exchange (ETDEWEB)

    Navarro, H., E-mail: henrynavarro@cab.cnea.gov.ar; Sirena, M.; Haberkorn, N. [Instituto Balseiro, Universidad Nacional de Cuyo and CNEA, 8400 Bariloche (Argentina); Centro Atómico Bariloche, Comisión Nacional de Energía Atómica. Av. Bustillo 9500, 8400 San Carlos de Bariloche (Argentina); Yang, Ilkyu [Department of Physics, Pohang University of Science and Technology, Pohang (Korea, Republic of); Kim, Jeehoon [Department of Physics, Pohang University of Science and Technology, Pohang (Korea, Republic of); CALDES, Institute for Basic Science, Pohang (Korea, Republic of)

    2015-07-28

    The optimization of the superconducting properties in a bottom electrode and the quality of an insulator barrier are the first steps in the development of superconductor/insulator/superconductor tunnel junctions. Here, we study the quality of a BaTiO{sub 3} tunnel barrier deposited on a 16 nm thick GdBa{sub 2}Cu{sub 3}O{sub 7−δ} thin film by using conductive atomic force microscopy. We find that the tunnel current is systematically reduced (for equal applied voltage) by increasing the BaTiO{sub 3} barrier thickness between 1.6 and 4 nm. The BaTiO{sub 3} layers present an energy barrier of ≈1.2 eV and an attenuation length of 0.35–0.5 nm (depending on the applied voltage). The GdBa{sub 2}Cu{sub 3}O{sub 7−δ} electrode is totally covered by a BaTiO{sub 3} thickness above 3 nm. The presence of ferroelectricity was verified by piezoresponse force microscopy for a 4 nm thick BaTiO{sub 3} top layer. The superconducting transition temperature of the bilayers is systematically suppressed by increasing the BaTiO{sub 3} thickness. This fact can be associated with stress at the interface and a reduction of the orthorhombicity of the GdBa{sub 2}Cu{sub 3}O{sub 7−δ}. The reduction in the orthorhombicity is expected by considering the interface mismatch and it can also be affected by reduced oxygen stoichiometry (poor oxygen diffusion across the BaTiO{sub 3} barrier)

  8. Crystal growth, differential gas adsorption, high thermal stability, and reversible coordination of two new barium-organic frameworks, Ba(SBA)(DMF){sub 4} and Ba{sub 2}(BTEC)(H{sub 2}O)

    Energy Technology Data Exchange (ETDEWEB)

    Halake, Shobha; Ok, Kang Min, E-mail: kmok@cau.ac.kr

    2015-11-15

    Single crystals of two barium-organic framework materials, Ba(SBA)(DMF){sub 4} (CAUMOF-15) and Ba{sub 2}(BTEC)(H{sub 2}O) (CAUMOF-16), have been grown through solvothermal reactions (H{sub 2}SBA=4,4′-sulfonyldibenzoic acid and H{sub 4}BTEC=1,2,4,5-benzenetetracarboxylic acid). The crystal structures of the reported frameworks have been determined by single-crystal X-ray diffraction. The materials have been fully characterized by powder X-ray diffraction (PXRD), elemental analyses, Infrared (IR) spectroscopy, and thermogravimetric analyses (TGA). CAUMOF-15 reveals a three-dimensional open-framework that comprises of an inorganic motif with one-dimensional chains and the SBA linkers. CAUMOF-16 shows another three-dimensional backbone consisting of layers of edge-shared BaO{sub 9} and BaO{sub 10} polyhedra, and BTEC pillars. Both of the 3D frameworks exhibit relatively high thermal stabilities. The PXRD and IR spectral data confirm that CAUMOF-15 and CAUMOF-16 reveal reversible coordinations of the respective solvent molecules, DMF and H{sub 2}O. Gas adsorption properties towards nitrogen, hydrogen, and carbon dioxide have been also investigated. - Graphical abstract: Crystals of two new barium-organic frameworks, Ba(SBA)(DMF){sub 4} and Ba{sub 2}(BTEC)(H{sub 2}O), exhibiting a differential gas adsorption, a high thermal stability, and a reversible coordination of solvent molecules have been grown. - Highlights: • Crystals of two new 3D Ba-MOFs are grown. • The two Ba-MOFs reveal very high thermal stabilities up to ca. 400 °C. • Ba(SBA)(DMF){sub 4} exhibits differential gas adsorption properties. • The two Ba-MOFs show reversible coordination of the solvent molecules.

  9. Preparation and Electromechanical Properties of PVDF Matrix Piezoelectric Composites Containing Highly Oriented BaTiO3 Whiskers

    Institute of Scientific and Technical Information of China (English)

    Xuetao LUO; Lifu CHEN; Xiaojun CHEN; Qianjun HUANG

    2004-01-01

    The piezoelectric composites containing highly oriented BaTiO3 whiskers as active phase and PVDF as matrix have been prepared by micro-hole extrusion and orientation in carried fibers. The morphology of oriented BaTiO3 whiskers and microstructure of the composites were observed by SEM. As for its electromechanical properties, it is found that the dielectric constant, piezoelectric constant and remnant of polarization in the BaTiO3 whisker-PVDF composite are considerably higher than that in the BaTiO3 powders-PVDF composite, while the loss factors follow the opposite trend. For the BaTiO3 whisker-PVDF composite, the values of ε, d33 and Pr parallel to the whisker orientation (normal specimen) are much higher than that perpendicular to the whisker orientation (parallel specimen). The significant effects of the connective passages of active phase on electromechanical properties of the piezoelectric composites has also been investigated.

  10. Electronic Band Structure of BaCo_{2}As_{2}: A Fully Doped Ferropnictide Analog with Reduced Electronic Correlations

    Directory of Open Access Journals (Sweden)

    N. Xu

    2013-01-01

    Full Text Available We report an investigation with angle-resolved photoemission spectroscopy of the Fermi surface and electronic band structure of BaCo_{2}As_{2}. Although its quasinesting-free Fermi surface differs drastically from that of its Fe-pnictide cousins, we show that the BaCo_{2}As_{2} system can be used as an approximation to the bare unoccupied band structure of the related BaFe_{2-x}Co_{x}As_{2} and Ba_{1-x}K_{x}Fe_{2}As_{2} compounds. However, our experimental results, in agreement with dynamical-mean-field-theory calculations, indicate that electronic correlations are much less important in BaCo_{2}As_{2} than in the ferropnictides. Our findings suggest that this effect is due to the increased filling of the electronic 3d shell in the presence of significant Hund’s exchange coupling.

  11. Synthesis and enhancement of visible light activities of nitrogen-doped BaTiO{sub 3}

    Energy Technology Data Exchange (ETDEWEB)

    Cao, Jiafeng, E-mail: cjf786@163.com [School of Mathematics and Physics, Anhui University of Technology, Maanshan, Anhui 243002 (China); Ji, Yuexia [School of Mathematics and Physics, Anhui University of Technology, Maanshan, Anhui 243002 (China); Tian, Chongbin; Yi, Zhiguo [Fujian Institute of Research on the Structure of Matter, Chinese Academy of Sciences, Fuzhou, Fujian 350002 (China)

    2014-12-05

    Highlights: • N-doped BaTiO{sub 3} photocatalyst was synthesized by urea addition solid state synthesis. • N-doped BaTiO{sub 3} shows improved photocatalytic activity irradiated by visible light. • Nitrogen dopant and oxygen vacancy are the main factors that enhance the activities. - Abstract: Regular nitrogen-doped BaTiO{sub 3} particles were synthesized by urea addition solid state sintering method. Compared with the undoped samples, the N-doped photocatalyst shows improved activities of photodegradation to Rhodamine-B under visible light irradiation (420 nm < λ < 780 nm). The obviously increased performance of N-doped BaTiO{sub 3} is mainly ascribed to the broadening of valence band (VB) width. Based on the analysis of absorption spectra and the illustration of photocatalytic role for N-doped BaTiO{sub 3}, nitrogen dopants and oxygen vacancies are both responsible for the improved photocatalytic activities.

  12. Magnetic properties of BaM /Pd-Pt double-layered thin film deposited at various substrate temperatures

    Science.gov (United States)

    Nahar Shams, Nazmun; Liu, Xiaoxi; Matsumoto, Mitsunori; Morisako, Akimitsu

    2005-05-01

    Crystallographic and magnetic properties of barium ferrite (BaM) thin films deposited onto Pt, Pd, and an alloy of Pd-Pt underlayers by sputtering at different substrate temperatures (Ts) from 400to600°C have been studied. It is found that the coercivity values in the perpendicular direction (Hcperp) of the BaM /Pd-Pt films are higher than those of the BaM films deposited on Pd and Pt underlayers. C-axis orientation of BaM /Pd-Pt film can be achieved at very low Ts of 450°C with a Hcperp of 2.1kOe for 30-nm BaM.

  13. Evidence for collisional depolarization of the \\ion{Ba}{ii} ${\\lambda}4554$ line in the low chromosphere

    CERN Document Server

    Derouich, M

    2008-01-01

    Context. Rigorous modeling of the \\ion{Ba}{ii} ${\\lambda}4554$ formation is potentially interesting since this strongly polarized line forms in the solar chromosphere where the magnetic field is rather poorly known. Aims. To investigate the role of isotropic collisions with neutral hydrogen in the formation of the polarized \\ion{Ba}{ii} ${\\lambda}4554$ line and, thus, in the determination of the magnetic field. Methods. Multipole relaxation and transfer rates of the $d$ and p-states of \\ion{Ba}{ii} by isotropic collisions with neutral hydrogen are calculated. We consider a plane parallel layer of \\ion{Ba}{ii} situated at the low chromosphere and anisotropically illuminated from below which produces linear polarization in the ${\\lambda}4554$ line by scattering processes. To compute that polarization, we solve the statistical equilibrium equations for \\ion{Ba}{ii} levels including collisions, radiation and magnetic field effects. Results. Variation laws of the relaxation and transfer rates with hydrogen number ...

  14. EROD activity and genotoxicity in the seabob shrimp Xiphopenaeus kroyeri exposed to benzo[a]pyrene (BaP) concentrations.

    Science.gov (United States)

    da Silva Rocha, Arthur José; Gomes, Vicente; Rocha Passos, Maria José de Arruda Campos; Hasue, Fabio Matsu; Alves Santos, Thaís Cruz; Bícego, Márcia Caruso; Taniguchi, Satie; Van Ngan, Phan

    2012-11-01

    Seabob shrimp Xiphopenaeus kroyeri is a marine species that lives in shallow waters of coastal environments, often impacted by polycyclic aromatic hydrocarbons (PAH) pollution. In the present study, seabob shrimp were exposed for 96 h to benzo[a]pyrene (BaP) at the nominal concentrations of 100, 200, 400 and 800 microg-L(-1). Animals of the control groups were exposed either to clean water or to the BaP-carrier (DMSO). At the end of the exposures, muscle tissues were sampled for BaP uptake assessment and hepatopancreas and hemolymph for EROD enzyme activity and hemocytes DNA damage, respectively. EROD activity and DNA damage increased significantly as a function of BaP exposure concentrations. Significant correlations between BaP uptake and both EROD activity and DNA damage suggest that they can be used as suitable tools for integrated levels of study on the biomarkers of PAH exposure.

  15. PREPARATION OF POLYIMIDE-BaTiO3 HYBRID FILMS BY A DISPERSION PROCESS AND THEIR MICROSTRUCTURE

    Institute of Scientific and Technical Information of China (English)

    Yue-sheng Li; Yue-jin Tong; Kai Jing; Meng-xian Ding

    2001-01-01

    Barium titanate (BaTiO3) powders with particle sizes of 30~50 nm were prepared from barium stearate, titanium alkoxides and stearic acid by stearic acid-gel method. Dispersing the agglomerate of BaTiO3 nanoparticles into poly(amic acid) solution followed by curing led to the formation of polyimide hybrid films. The hybrid films were transparent and well distributed with BaTiO3 nanoparticles when the BaTiO3 content was less than 1 wt%. Highly loaded hybrid film containing 30 wt % BaTiO3 was tough, had a smooth surface and possessed much higher dielectric and piezoelectric constants than the parent polyimide.

  16. Effect of flux on thermoluminescence in flux-grown BaFCl crystals. [X-and gamma-irradiation effects

    Energy Technology Data Exchange (ETDEWEB)

    Somaiah, K.; Babu, V.H. (Osmania Univ., Hyderabad (India). Dept. of Physics)

    1984-07-01

    BaFCl crystals have been grown using BaF/sub 2/ and BaCl/sub 2/ by flux technique. Glow curves, optical absorption, and TL emission spectra of X- or gamma irradiated crystals are studied. The results have been compared with those BaFCl crystals grown from NaF flux so as to study the effects of flux on these properties. It is found that crystals grown from BaF/sub 2/ flux are relatively purer. An additional TL glow peak at 460 K, an optical absorption band at 775 nm and TL emission band at 485 nm have been obtained in the presently grown crystals. The additional glow peak, optical absorption band have been attributed to F(F-bar) aggregate centers, whereas the 485 nm TL emission band to impurity centers.

  17. Elastic, electronic and magnetic properties of new oxide perovskite BaVO{sub 3}: A first-principles study

    Energy Technology Data Exchange (ETDEWEB)

    Bannikov, V.V., E-mail: bannikov@ihim.uran.ru

    2016-03-01

    The structural, elastic, magnetic properties, as well as electronic structure and chemical bonding picture of new oxide 3d{sup 1}-perovskite BaVO{sub 3}, recently synthesized, were systematically investigated involving the first-principles FLAPW-GGA calculations. The obtained results are discussed in comparison with available experimental data, as well as with those obtained before for isostructural and isoelectronic SrVO{sub 3} perovskite. - Highlights: • BaVO{sub 3} is more compressible, but stiffer with respect to shear than SrVO{sub 3}. • Maximal Young's modulus for BaVO{sub 3} is ∼303 GPa - in [111] direction. • BaVO{sub 3} is characterized with negative Cauchy pressure. • BaVO{sub 3} is so-called “exchange-enhanced” Pauli paramagnet.

  18. Zintl Salts Ba2P7X (X = Cl, Br, and I: Synthesis, Crystal, and Electronic Structures

    Directory of Open Access Journals (Sweden)

    Juli-Anna Dolyniuk

    2013-08-01

    Full Text Available Two barium phosphide halides, Ba2P7Br and Ba2P7I, were synthesized and structurally characterized by single crystal X-ray diffraction. Both compounds crystallize in the monoclinic space group P21/m (No. 11 and are isostructural to Ba2P7Cl. The crystal structures of Ba2P7X (X = Cl, Br, I feature the presence of heptaphosphanortricyclane P73− clusters along with halogen anions and barium cations. According to the Zintl concept, Ba2P7X compounds are electron-balanced semiconductors. Quantum-chemical calculations together with UV-Visible spectroscopy confirm the title compounds are wide bandgap semiconductors. The bonding in the P73− clusters was analyzed by means of electron localization function. The elemental compositions were confirmed using energy dispersive X-ray spectroscopy.

  19. Structural studies and c dependence in La2-DyCaBa2Cu4+O type mixed oxide superconductors

    Indian Academy of Sciences (India)

    S Rayaprol; Krushna Mavani; C M Thaker; D S Rana; Keka Chakravorty; S K Paranjape; M Ramanadham; Nilesh A Kulkarni; D G Kuberkar

    2002-05-01

    A new series of mixed oxide superconductors with the stoichiometric composition La2-DyCaBa2Cu4+O ( = 0.0 - 0.5, = 2) has been studied for structural and superconductiong properties. Our earlier studies on La2-(Y/Er)CaBa2Cu4+O series, show a strong dependence of c on hole concentration (sh). In the present work, the results of the analysis of the neutron diffraction measurements at room temprerature on = 0.3 and 0.5 samples are reported. It is interesting to know that Ca substitutes for both La and Ba site with concomitant displacement of La onto Ba site. Superconductivity studies show that maximum c is obtained for = 0.5, = 1.0 sample (c ∼ 75 K), for La1.5Dy0.5Ca1Ba2Cu5O (La-2125).

  20. Thermodynamic Study on BaO-CaO-CaF2 Slags for Dephosphorization of Molten Steel

    Institute of Scientific and Technical Information of China (English)

    TIAN Zhi-hong; CAI Kai-ke; WANG Xin-hua; ZHU Li-xin; WANG Tao; SHI Hong-zhi; YIN Xiao-dong

    2005-01-01

    The molten steel was dephosphorized by high basic BaO-based slags (BaO-CaO-CaF2) to achieve ultra low phosphorus level. The dephosphorization ability of the BaO-CaO-CaF2 slags was tested. The phosphate capacity of this slag system at 1 620 C varied from 1018.03 to 1019.11 with an activity coefficient of P2O5 ranging from 10-19.47 to 10-18.09. The effect of BaO content, initial phosphorus content and oxygen potential of molten steel on dephosphorization was discussed. The phosphorus pick-up by the BaO-based slags was studied.