WorldWideScience

Sample records for aux aleas logiques

  1. Development of Single-Event Upset hardened programmable logic devices in deep submicron CMOS; Developpement de circuits logiques programmables resistants aux aleas logiques en technologie CMOS submicrometrique

    Energy Technology Data Exchange (ETDEWEB)

    Bonacini, S

    2007-11-15

    The electronics associated to the particle detectors of the Large Hadron Collider (LHC), under construction at CERN, will operate in a very harsh radiation environment. Commercial Off-The-Shelf (COTS) components cannot be used in the vicinity of particle collision due to their poor radiation tolerance. This thesis is a contribution to the effort to cover the need for radiation-tolerant SEU-robust (Single Event Upset) programmable components for application in high energy physics experiments. Two components are under development: a Programmable Logic Device (PLD) and a Field-Programmable Gate Array (FPGA). The PLD is a fuse-based, 10-input, 8-I/O general architecture device in 0.25 {mu}m CMOS technology. The FPGA under development is a 32*32 logic block array, equivalent to {approx} 25 k gates, in 0.13 {mu}m CMOS. The irradiation test results obtained in the CMOS 0.25 {mu}m technology demonstrate good robustness of the circuit up to an LET (Linear Energy Transfer) of 79.6 cm{sup 2}*MeV/mg, which make it suitable for the target environment. The CMOS 0.13 {mu}m circuit has showed robustness to an LET of 37.4 cm{sup 2}*MeV/mg in the static test mode and has increased sensitivity in the dynamic test mode. This work focused also on the research for an SEU-robust register in both the mentioned technologies. The SEU-robust register is employed as a user data flip-flop in the FPGA and PLD designs and as a configuration cell as well in the FPGA design.

  2. ALEA: a toolbox for allele-specific epigenomics analysis.

    Science.gov (United States)

    Younesy, Hamid; Möller, Torsten; Heravi-Moussavi, Alireza; Cheng, Jeffrey B; Costello, Joseph F; Lorincz, Matthew C; Karimi, Mohammad M; Jones, Steven J M

    2014-04-15

    The assessment of expression and epigenomic status using sequencing based methods provides an unprecedented opportunity to identify and correlate allelic differences with epigenomic status. We present ALEA, a computational toolbox for allele-specific epigenomics analysis, which incorporates allelic variation data within existing resources, allowing for the identification of significant associations between epigenetic modifications and specific allelic variants in human and mouse cells. ALEA provides a customizable pipeline of command line tools for allele-specific analysis of next-generation sequencing data (ChIP-seq, RNA-seq, etc.) that takes the raw sequencing data and produces separate allelic tracks ready to be viewed on genome browsers. The pipeline has been validated using human and hybrid mouse ChIP-seq and RNA-seq data. The package, test data and usage instructions are available online at http://www.bcgsc.ca/platform/bioinfo/software/alea CONTACT: : mkarimi1@interchange.ubc.ca or sjones@bcgsc.ca Supplementary information: Supplementary data are available at Bioinformatics online. © The Author 2013. Published by Oxford University Press. All rights reserved. For Permissions, please e-mail: journals.permissions@oup.com.

  3. Logiques et contradictions du trafic transalpin dans le contexte politique et social européen

    Directory of Open Access Journals (Sweden)

    Manfred Perlik

    2009-03-01

    Full Text Available Dans les régions alpines, deux intérêts contradictoires coexistent. Une part de la population se plaint du manque d’accessibilité et de mobilité, l’autre part de la population est correctement desservie par les axes routiers internationaux mais en subit des nuisances importantes. Ces régions argumentent qu’une bonne part de ces transports est superflue, voire inutile. Cet article rend compte d’une étude qui s’est intéressée aux points suivants : 1 - Est-ce que des transports superflus ou inutiles pourraient être déplacés sans être remplacés ? 2 - Est-ce que les politiques fondées sur des redistributions modales ou sur le marché, comme la tarification des passages, sont suffisantes pour réduire les transports et leurs impacts ? 3 - Sous quelles conditions le transport peut-il être réduit de la manière la plus complète ? Des réponses sont proposées ici en analysant trois champs pertinents pour comprendre l’augmentation du trafic : la logique politique, la logique économique, et la logique de développement spatial. Ces logiques sont interprétées selon une approche régulationiste. Chacune a son application en terme d’arguments normatifs. Néanmoins, il y a des contradictions entre les différents objectifs sociétaux et/ou politiques et les objectifs économiques, et plus particulièrement entre la recherche de compétitivité et le respect de conditions de vie équitables entre les différentes régions. De telles contradictions peuvent être expliquées par les processus d’unification européenne, par les intérêts divergents entre les acteurs majeurs et par les changements de valeur des trente dernières années, qui peuvent être caractérisés comme un changement de régime. Les trois logiques sont le fruit de rapports sociaux et sont donc sujettes à des changements sur le long terme par les acteurs. Selon les principes du développement durable, à un niveau global, et dans l

  4. Développement de circuits logiques programmables résistants aux alas logiques en technologie CMOS submicrométrique

    CERN Document Server

    Bonacini, Sandro; Kloukinas, Kostas

    2007-01-01

    The electronics associated to the particle detectors of the Large Hadron Collider (LHC), under construction at CERN, will operate in a very harsh radiation environment. Most of the microelectronics components developed for the first generation of LHC experiments have been designed with very precise experiment-specific goals and are hardly adaptable to other applications. Commercial Off-The-Shelf (COTS) components cannot be used in the vicinity of particle collision due to their poor radiation tolerance. This thesis is a contribution to the effort to cover the need for radiation-tolerant SEU-robust programmable components for application in High Energy Physics (HEP) experiments. Two components are under development: a Programmable Logic Device (PLD) and a Field-Programmable Gate Array (FPGA). The PLD is a fuse-based, 10-input, 8-I/O general architecture device in 0.25 micron CMOS technology. The FPGA under development is instead a 32x32 logic block array, equivalent to ~25k gates, in 0.13 micron CMOS. This wor...

  5. Les logiques d’engagement dans la guerre d’indépendance au Venezuela. Une autre face de la guerre civile (1812-1818

    Directory of Open Access Journals (Sweden)

    Véronique Hébrard

    2011-04-01

    Full Text Available L’objectif de cet article est d’appréhender, essentiellement à partir des archives judiciaires, les formes et les logiques d’engagement des populations civiles dans la guerre qui secoue le Venezuela à partir de 1812. Il s’agira également de tenter de rendre compte des systèmes de représentation des acteurs, au niveau collectif et individuel, ainsi que des dynamiques discursives et en actes, qui ont alimenté le conflit et contribué à la montée aux extrêmes qui le caractérise, notamment à travers la construction de la figure d’un ennemi à même de conjurer le caractère civil de la guerre. Pour ce faire, trois dimensions seront privilégiées : les logiques d’engagement à proprement parlé, le fonctionnement de la justice en temps de guerre et son usage par les acteurs.The aim of this article is to comprehend the forms and logic of civilian commitment in the war that shook Venezuela after 1812, through the examination of judicial archives. It also attempts to account for the actors’ systems of representation, at the individual and collective level, as well as discursive dynamics and acts, which fed the conflict and helped push it to extremes, notably by constructing an image of the enemy capable of warding off the civil character of the war. To do this, three aspects are given priority: the logic of commitment, the functioning of justice in time of war and its use by the actors.En este artículo se propone aprehender, esencialmente a partir de los archivos judiciales, las formas y lógicas de compromisos de las poblaciones civiles en la guerra que sacude Venezuela a partir de 1812. Se tratara igualmente de dar cuenta de los sistemas de representación de los actores, a nivel colectivo e individual, así como de las dinámicas discursivas y factuales, que alimentaron el conflicto y contribuyeron al aumento de los extremos que le caracteriza, en particular con la construcción de la figura del enemigo, capaz de conjurar

  6. Dynamiques de résistance aux normes révolutionnaires à Cuba

    OpenAIRE

    Geoffray, Marie-Laure

    2013-01-01

    Les normes du régime révolutionnaire sont, à Cuba, inscrites dans l’espace. Elles fonctionnent comme des signes performatifs qui à la fois rappellent constamment la présence du pouvoir et catégorisent les individus selon leur conformité aux normes. Mais, depuis la crise économique des années 1990, des logiques centrifuges à l’œuvre au sein de la société cubaine viennent remettre en question la capacité du régime à générer une socialisation révolutionnaire homogène. On observe des dynamiques s...

  7. Aux origines du monde

    CERN Multimedia

    2004-01-01

    "C'est l'histoire d'une aventure humaine, scientifique, international qui a vu le jour il y a cinquante ans, aux confins de la Suisse et du département de l'Ain. Le plus grand laboratoire de physique des particules du monde, le Cern, a été fondé en 1954. Les festivités organisées à l occasion de cet anniversaire connaîtront leur point d'orgue le 16 octobre prochain, avec portes-ouvertes, accueil de personallités et inauguration d'un monumnet spécifique, le Globe de l'innovation" (2 pages)

  8. Development of a diffuse element matrix in 'planar' technology. A particular application: logical gate with coupled emitter; Etude et realisation d'une matrice d'elements diffuses selon la technologie 'planar'. Application particuliere: porte logique a emetteurs couples

    Energy Technology Data Exchange (ETDEWEB)

    Rousseau, P [Commissariat a l' Energie Atomique, 38 - Grenoble (France). Centre d' Etudes Nucleaires

    1967-06-01

    In a first part, after a brief recall concerning 'planar' technology we discuss the various parasitic elements associated with integrated circuits components. Mathematical formulae of these elements are derived. In a second part, we present a matrix of 22 transistors and 12 resistors which has been realized. This matrix enables the integration of the major part of nuclear circuits. Some of the obtained circuits are shown, particularly an emitter coupled logic gate which presents good electrical behaviour. (author) [French] Dans uns premiere partie, apres un bref rappel de la technologie 'planar' nous etudions les divers elements parasites associes a tout composant d'un circuit integre. Un developpement sommaire des expressions mathematiques de ces elements est propose. Dans une seconde partie nous presentons la matrice de 22 transistors et 12 resistances que nous avons realisee. Cette matrice repond aux principaux besoins de l'electronique nucleaire. Nous proposons ensuite quelques exemples de circuits realises a partir de cette matrice dont notamment une porte logique a emetteurs couples de performances tres interessantes. (auteur)

  9. Deux modèles de fondation dans les Recherches logiques

    Directory of Open Access Journals (Sweden)

    Thomas Nenon

    2009-02-01

    Full Text Available Cette étude essaye d’établir qu’il y a deux notions très différentes de « fondation » à l’œuvre dans les Recherches logiques de Husserl. Dans la IIIème Recherche, où le terme est formellement introduit, lorsqu’il se demande quels sont les contenus qui peuvent exister d’une manière autonome (indépendants et lesquels peuvent exister uniquement en tant que moments d’autre chose (dépendants, Husserl suit ce que j’appelle un « modèle ontologique ». Selon ce modèle, le concret possède une priorité sur à l’abstrait qui est fondé en lui. Dans la VIème Recherche, en revanche, Husserl s’oriente principalement sur un « modèle gnoséologique » qui voit le complexe comme fondé sur ce qui est relativement simple, étant donné que les expériences d’ordre supérieur (telles les perceptions de types d’objets plus complexes sont « fondées sur » des expériences plus simples, bien qu’elles ne puissent pas y être réduites. L’exemple principal ici est celui des intuitions catégoriales : fondées sur les intuitions sensibles, elles n’y sont pas réductibles. Mais cette distinction entre deux sens différents du terme de « fondation » peut également nous aider à mieux comprendre de nombreuses thèses husserliennes plutôt controversées. Par exemple, elle peut nous permettre de mieux comprendre dans quelle mesure faire l’expérience d’un être humain comme un tout se fonde sur l’expérience d’un corps physique, et cela même si l’étant que nous rencontrons inclut à la fois des aspects corporels et des aspects spirituels – les deux étant vus, d’une manière essentielle, comme des moments de cette unique personne qui fait l’objet de notre expérience.This essay attempts to establish that there are two very different notions of “foundation” at work in Husserl’s Logical Investigation. In the Third Investigation where the term is formally introduced, Husserl is using what

  10. Sentarse a la mesa del Señor. Metaforizaciones y conflictos en La última cena de Tomás Gutiérrez Alea

    Directory of Open Access Journals (Sweden)

    Flavio Fiorani

    2011-11-01

    Full Text Available La última cena by Gutiérrez Alea is based on an actual event that took place in Cuba: one Holy Thursday at the end of the Eighteen century the owner of a sugar plantation invites twelve of his slaves to dinner and shows them the path to salvation through the message of Christian Redemption. In particular, the film shows how during the Easter rite the messianic event and the metaphoric language of salvation lead to shifts in meaning that the slaves interpret as the concrete possibility for them to be free. The sacred of the liturgical act as an “action” that can be performed by the guests at the Lord’s table in order to reach freedom is reproduced by the very cinematographic language. Actually, the slaves oppose to the Christian account an “open word”, thus debunking the project of disciplining them and stirring a rebellion in which the contamination of the sacred with the profane becomes the epiphany of a new life: no more a celestial one, but a worldly and free life in the isle of Cuba.

  11. Au-delà de la croissance rapide : combiner le paradoxe et la logique dominante pour un modèle d’hypercroissance durable

    OpenAIRE

    Chanut-Guieu , Cécile; Guieu , Gilles; Tannery , Franck; Dana , Léo-Paul

    2014-01-01

    International audience; Au-delà de la croissance rapide: Combiner le paradoxe et la logique dominant pour un modèle d'hypercroissance durable Résumé : Lorsque la PME est en croissance rapide, les enjeux qu'elle doit relever sont nombreux et exigeants. Ceci est encore plus vrai pour les PME en hypercroissance, dont le rythme de développement les amène à doubler de taille en quatre années. A travers l'analyse longitudinale et multi-méthodes de la constitution d'un groupe de taille moyenne (600 ...

  12. Aux marges du monde arabe

    Directory of Open Access Journals (Sweden)

    Hélène Thiollet

    2004-09-01

    Full Text Available L’étude des migrations contemporaines des Érythréens vers le Yémen au tournant des années quatre-vingt-dix permet d’observer les transformations des dynamiques régionales à l’œuvre dans le monde arabe. Les migrations sont un phénomène sensible aux différents aspects (politiques, économiques, culturels, géographiques de l’intégration régionale. Celle si est envisagée dans cet article à travers une approche doublement marginale : -la marginalité géographique de l’Érythrée arabo-africaine et du Yémen, économi­quement isolé dans la péninsule Arabique, -l’étude des migrations formelles et informelles, élément souvent marginal dans l’étude des institutions et des échanges qui constituent un système régional intégré. Cette étude est fondée sur une série d’entretiens menés au Yémen entre février et avril 2002 auprès des administrations yéménites et de la population érythréenne.

  13. L'adaptation aux changements climatiques

    International Development Research Centre (IDRC) Digital Library (Canada)

    Cathy Egan

    plus équitables et plus prospères. Centre de recherches pour le développement international, CP 8500, Ottawa (Ontario) Canada K1G 3H9. Tél. : 613-236-6163 • Télécopieur : 613-238-7230 • Courriel : info@crdi.ca. L'ADAPTATION AUX. CHANGEMENTS CLIMATIQUES. LE RECOURS AUX. ONDES. Les petits exploitants ...

  14. Création d’une aire protégée et logiques d’action de l’état et du milieu : analyse d’une irréconciabilité constructive à l’œuvre

    Directory of Open Access Journals (Sweden)

    Marie Lequin

    2011-08-01

    Full Text Available Cet article analyse les interactions socioculturelles d’acteurs multiples ayant des intérêts divergents en regard de la reconnaissance d’un espace naturel à titre d’aire protégée, plus particulièrement le Parc marin du Saguenay–Saint-Laurent (PMSSL, situé au Québec à l’embouchure de la rivière Saguenay. Compris dans le sens d’espace socialisé et investi de valeurs parfois contradictoires, ce territoire constitue le cas empirique sur lequel repose l’analyse des logiques d’acteurs. La perspective ici mise de l’avant repose à la fois sur une décision de l’État de créer et de mettre en valeur une aire marine ainsi que sur la participation active des collectivités territoriales dans la gestion du patrimoine environnemental et culturel lié à leur identité propre. Si la participation des communautés locales apparaît comme un élément essentiel et démocratique dans la reconnaissance d’un espace naturel protégé, il apparaît tout aussi capital de bien saisir la logique qui sous-tend les actions de l’État et du milieu. Les résultats empiriques montrent deux logiques d’action distinctes à l’œuvre, une logique classique de planification et implantation stratégique de l’état réservant une espace de participation programmée pour la communauté et une logique stratégique communautaire à caractère émergent, de portée moins englobante mais adaptable aux nouvelles réalités et contraintes gouvernementales. Les résultats peuvent être représentés sous forme d’un processus de gouvernance à l’œuvre, un caractérisé par une participation de base, mais un qui suggère qu’un processus plus hautement démocratique nécessiterait un plus haut degré de vigilance dans la perspective communautaire, suffisante pour produire une meilleure symétrie de pouvoir démocratique entre l’État.This paper analyzes the socio-cultural dynamic between multiple stakeholders with divergent interests

  15. Evaluation du risque d’accident vasculaire cérébral à l’aide de la logique floue.

    OpenAIRE

    BENCHERIF, Farah Nezha

    2015-01-01

    Ce projet s’inscrit dans le cadre d’une stratégie de prévention-santé publique par le suivi et l’évaluation du risque, une approche d’intelligence artificielle basée sur la logique floue a été mise en œuvre ,dans ce cadre une application informatique d’aide au diagnostique baptisée « eRisk » : « evaluation of eRisk » a été réalisée et évaluée à partir de données préexistantes ainsi que l’avis expert du médecin , les résultats encourageants ainsi obtenus sont une ébauche vers la...

  16. Bourse du CRDI aux chercheurs candidats au doctorat 2017 | CRDI ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Cet appel à propositions s'adresse aux citoyens canadiens, aux résidents permanents du Canada et aux citoyens de pays en développement inscrits au doctorat dans une université canadienne. Qui peut présenter une demande. Pour être admissible, vous devez remplir les conditions suivantes : Être citoyen canadien ou ...

  17. Aux origines de la science moderne

    CERN Document Server

    Rossi, Paolo

    1999-01-01

    Aux origines de la science moderne. " Lorsque l'on aborde l'étude d'une pensée qui n'est plus la nôtre, il est important de chercher à oublier ce que nous savons ou croyons savoir. " Pour appréhender cette période fondatrice que fut la Révolution scientifique du XVIIe siècle en Europe, Paolo Rossi nous replonge dans des atmosphères intellectuelles et des modes de pensée depuis longtemps disparus. Des secrets hermétiques aux calculs mathématiques, de la magie au magnétisme et des cabinets de curiosité aux premières académies des sciences défilent ainsi des notions et des individus qui, remis en toute simplicité dans le contexte de leur époque, retrouvent une épaisseur et un sens nouveaux. Ainsi racontée sous la forme d'une histoire des idées, l'histoire des sciences devient accessible à tous.

  18. L'Anse Aux Meadows, Newfoundland

    Science.gov (United States)

    2008-01-01

    L'Anse aux Meadows is a site on the northernmost tip of the island of Newfoundland, located in the Province of Newfoundland and Labrador, Canada, where the remains of a Viking village were discovered in 1960 by the Norwegians Helge and Anne Ingstad. The only authenticated Viking settlement in North America outside Greenland, it was the site of a multi-year archaeological dig that found dwellings, tools and implements that verified its time frame. The settlement, dating more than five hundred years before Christopher Columbus, contains the earliest European structures in North America. Named a World Heritage site by UNESCO, it is thought by many to be the semi-legendary 'Vinland' settlement of explorer Leif Ericson around AD 1000. The settlement at L'Anse aux Meadows consisted of at least eight buildings, including a forge and smelter, and a lumber yard that supported a shipyard. The largest house measured 28.8 by 15.6 m and consisted of several rooms. Sewing and knitting tools found at the site indicate women were present at L'Anse aux Meadows The image was acquired on September 14, 2007, covers an area of 14.2 x 14.6 km, and is located at 51.5 degrees north latitude, 55.6 degrees west longitude. The U.S. science team is located at NASA's Jet Propulsion Laboratory, Pasadena, Calif. The Terra mission is part of NASA's Science Mission Directorate.

  19. Administration des subventions aux institutions Dépenses de projet ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    IDRC CRDI

    Consultants. Cette catégorie comprend toutes les dépenses engagées pour retenir les services d'un consultant aux ... déplacement, d'hébergement et de subsistance, ainsi qu'aux services de soutien retenus directement ... le transport aérien et les autres dépenses afférentes aux déplacements du personnel du projet à.

  20. Fables et métaphores comme arguments logiques du discours politique dans la Rhétorique d'Aristote

    Directory of Open Access Journals (Sweden)

    Jean-Louis Labarrière

    2001-12-01

    Full Text Available Aristote considère que, au sein des preuves morales, la preuve par le caractère est la plus adaptée au discours politique tandis que celle cherchant à exciter les passions des auditeurs est plus adaptée au discours judiciaire. Cette preuve (pistis, qui a pour fin de faire paraître l'orateur d'une certaine qualité, rend la harangue plus noble que le plaidoyer. Mais en ce qui concerne les preuves logiques, le plaidoyer a l'avantage du fait que, portant sur le passé, il peut user d'enthymèmes. La harangue, portant sur I'avenir, use des exemples (paradeigmata, qui sont de deux types: les exemples historiques, qui devraient être les plus forts, ou les fables et paraboles, auxquelles l'orateur a recours car l'histoire est souvent muette. C'est cette utilisation des fables qui est ici interrogée: il ne faut en user que si l'on sait apercevoir les ressemblances, trait qui caractérise celui qui sait faire des métaphores.

  1. Le recours aux archives judiciaires pour étudier les habitudes de sommeil

    Directory of Open Access Journals (Sweden)

    Guillaume Garnier

    2009-10-01

    Full Text Available Les archives judiciaires possèdent de nombreux attraits, et certains sont parfois insoupçonnés. Les faits relatés dans les actes d’accusation par exemple, mais aussi les déclarations de témoins recèlent de petits détails sur les habitudes de sommeil qui passent souvent inaperçus aux yeux des historiens. Dans un corpus très large (du XVIIIe au xixe siècle on peut ainsi tenter de comprendre les logiques de sommeil : heures de coucher et lever, durée du sommeil, l’apparente vulnérabilité du repos nocturne, les déviances nocturnes, le lieu de sommeil. Mais dans une vue plus globale, les archives aident aussi à déterminer les rythmes nocturnes et notamment la place qu’y tient le sommeil. Les contraintes sociales et politiques, la dureté du travail et de la vie, l’importance de la religion transparaissent aussi pour former une culture spécifique du sommeil préindustriel.Judiciary records have many appealing aspects, some of which one would not suspect. What is related in indictment documents for instance, as well as in evidence statements, contains small details about sleeping habits that often go unnoticed by historians. Out of a very large corpus (from the xviiith till the xixth century, one can try and work out the rationale behind sleep: at what time people go to sleep or wake up, for how long, how vulnerable night sleep seems to be, nocturnal deviances, or where people sleep. But to a larger extent, records also help to determine nocturnal rhythms and more specifically the place that sleep holds in them. Social and political constraints, harshness of working and living conditions, the importance of religion, all show through and convey a specific culture of pre-industrial sleep.

  2. The Tokomak of Fontenay-aux-Roses

    International Nuclear Information System (INIS)

    Ginot, P.; Torossian, A.

    1975-01-01

    The Tokomak of Fontenay-aux-Roses (TFR) has been built in order to increase the performances got with the same type of machine by the Soviet physicists. The current induced into the plasma has reached 0.4MA, the main magnetic field being 60kG. A plasma with a mean electron density of 4.5 10 13 cm -3 , a maximum electron temperature of 2.5keV and a maximum ion temperature of 1keV has been obtained in hydrogen and deuterium. The discharge duration has attained 0.5sec. These results agree with those obtained before [fr

  3. Le tourisme international dans le monde : logiques des flux et confins de la touristicité

    Directory of Open Access Journals (Sweden)

    Corina Tatar

    2008-09-01

    Full Text Available L’histoire du tourisme international des cinquante dernières années peut être décomposée en trois temps : 1/ les décennies de 1950 à 1980, caractérisées par une démocratisation progressive du tourisme soutenue par une croissance économique inégalée ; 2/ la dernière décennie du vingtième siècle, celle d’une euphorie touristique qui voit les frontières s’ouvrir. La fin d’un monde bipolaire annonce bien des espoirs naïfs. Le champ des territoires ouverts au tourisme ne cesse de s’élargir. 3/ La fin du siècle annonce l’âge de maturité du tourisme. Après l’euphorie, les illusions et les désillusions d’un espace touristique mondial sans frontières, les faits, souvent dramatiques ont fait prendre conscience aux touristes la complexité d’un monde où les guerres n’ont jamais cessé. L’espace touristique mondial est articulé autour de trois bassins régionaux : plus de 75% des flux touristiques internationaux, impulsés par les riches métropoles européennes, nord-américaines et asiatique, se cantonnent à dans leur espace régional d’origine. La distribution des flux touristiques dessine une organisation en trois bassins distincts : par ordre d’importance, 1/ le bassin euro-méditerranéen, centré sur la Mer méditerranée, 2/ le bassin Asie orientale-Pacifique, autour des rivages de la mer de Chine, 3/ le bassin Amérique du Nord -Caraïbes, organisé autour de la « Méditerranée américaine ». Les discontinuités s’affirment entre des périphéries mal stabilisées, des prolongements très sélectifs, des marges oubliées ou exclues. Les climats d’insécurité qui touchent certains territoires touristiques visent à fragiliser des périphéries plus sensibles et contraignent l’espace touristique international à se rétracter.The history of international tourism of the last fifty years can be divided  into three stages: 1 / decades from 1950 to 1980, characterized by a

  4. Les agriculteurs s'adaptent aux changements climatiques en Tunisie ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    23 août 2011 ... Les eaux grises et la culture en serre augmentent la production alimentaire en Tunisie ... Des chercheurs insistent sur l'importance de favoriser la résilience aux ... Vulnérabilité et adaptation aux changements climatiques des ...

  5. La responsabilité comme mode de gouvernement néolibéral : l’exemple des programmes d’aide aux familles aux États-Unis de 1980 à nos jours

    Directory of Open Access Journals (Sweden)

    Philippe Fournier

    2015-01-01

    Full Text Available Le point de départ de ma proposition est que la responsabilité est un terme plus approprié que la vertu pour désigner les exhortations au devoir civique dans l’ère contemporaine. De même, à défaut de voir l’implication citoyenne comme l’expression de la rationalité individuelle ou de la conscience morale dans la sphère publique, je propose de comprendre la responsabilité comme une matrice discursive et gouvernementale qui perpétue des modèles comportementaux bien spécifiques. J’entends ainsi démontrer que la responsabilité est devenue une modalité indispensable du « gouvernement de la conduite » au sein d’une rationalité néolibérale. En plus de constituer une série de dispositions morales qui remédierait aux failles et aux lacunes de l’individualisme (néolibéral, la responsabilité se matérialise dans les incitations à une citoyenneté active et participe de ce fait à la rationalisation du retranchement de l’État de la sphère sociale. Comme l’illustrent des courants aussi divers que le néoconservatisme, le communautarisme et l’économie sociale, la responsabilité se présente moins comme une solution de rechange aux créneaux du néolibéralisme qu’une série de techniques et de standards comportementaux visant à compléter et renforcer l’application élargie d’une logique micro-économique. Je montrerai que le recours à la notion de responsabilité est particulièrement visible dans les politiques d’aide sociale et au sein des nouveaux partenariats entre l’État, le milieu communautaire et les communautés locales. En effet, l’aide étatique est de plus en plus conditionnelle à la démonstration de certaines dispositions morales et psychologiques comme la volonté, la ténacité et la probité. L’article se divise en quatre parties. La première s’attarde à définir brièvement la « gouvernementalité », concept initialement développé par Michel Foucault. La deuxième se

  6. Thermodynamique des moteurs thermiques aux structures dissipatives

    CERN Document Server

    Prigogine, Ilya

    1999-01-01

    Ce livre constitue à la fois une présentation complète de la thermodynamique et une introduction scientifique à l'œuvre de Prigogine. Les auteurs innovent en montrant comment la thermodynamique du non-équilibre est un prolongement naturel de la thermodynamique de l'équilibre. Elle constitue ainsi la science des processus irréversibles - " la flèche du temps " - dont les structures dissipatives sont les témoignages les plus éclatants. Les développements historiques en font, non seulement un texte de référence, mais aussi un livre de culture. Les nombreux exemples et exercices, comme les programmes informatiques et les références aux sites Internet en font un outil de travail irremplaçable.

  7. Donner aux travailleurs du sexe les moyens de consigner les ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Dans la plupart des sociétés, le travail du sexe est fortement stigmatisé, et ceux qui le pratiquent sont en butte aux reproches, à la désapprobation et à la discrimination. Par conséquent, la violence faite aux travailleurs du sexe se voit peu, et dans certains contextes, elle est même tolérée. On dispose donc de très peu de ...

  8. Communications en cas de catastrophe faisant appel aux TIC pour ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Communications en cas de catastrophe faisant appel aux TIC pour les collectivités vulnérables des Caraïbes. De récents événements survenus dans les Caraïbes ont mis en relief les insuffisances des mesures régionales et nationales de préparation aux catastrophes. On manque particulièrement de systèmes d'alerte ...

  9. Communication des risques reliés aux changements climatiques en ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    1 janv. 2012 ... Il incombe bien sûr aux gouvernements locaux et nationaux de prendre les décisions relatives à l'adaptation aux changements climatiques; ils doivent toutefois les communiquer aux ménages, aux groupes communautaires et aux entreprises privées afin que ceux-ci prennent les décisions qui s'imposent ...

  10. Appui aux transitions dans le monde arabe | IDRC - International ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    étudieront l'évolution du rôle de l'État face aux enjeux économiques et sociaux; - appuieront les ... ARI Centre pour une initiative arabe de réforme. Institution Country. France ... New funding opportunity for gender equality and climate change.

  11. Adaptation aux changements climatiques dans le bassin versant de ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    ... hydrologiques et agronomiques, les chercheurs étudieront l'évolution de la ... de coopération scientifique et technologique en appui aux projets de recherche ... de l'Institut d'étude du développement international de l'Université McGill.

  12. Recherche sur l'adaptation aux changements climatiques

    International Development Research Centre (IDRC) Digital Library (Canada)

    Corey Piccioni

    consortiums travaillent dans des zones vulnérables aux changements climatiques en Afrique et en Asie, notamment dans les bassins hydrographiques alimentés .... Le projet de recherche Pathways to Resilience in Semi-Arid Economies (PRISE) vise à réduire les risques et à opti- miser les possibilités de développement ...

  13. Inobservance therapeutique aux anti-retroviraux chez les personnes ...

    African Journals Online (AJOL)

    Buts : Rechercher les facteurs psychologiques ou psychosociaux responsables de l'inobservance thérapeutique (IBT) aux antiretroviraux (ARV) Méthodologie : Il s'agit d'une étude transversale sur 06 mois (mai - octobre 2008) menée au centre de promotion sociale à Lomé chez les personnes vivant avec le VIH (PVVIH) ...

  14. AUX: a scripting language for auditory signal processing and software packages for psychoacoustic experiments and education.

    Science.gov (United States)

    Kwon, Bomjun J

    2012-06-01

    This article introduces AUX (AUditory syntaX), a scripting syntax specifically designed to describe auditory signals and processing, to the members of the behavioral research community. The syntax is based on descriptive function names and intuitive operators suitable for researchers and students without substantial training in programming, who wish to generate and examine sound signals using a written script. In this article, the essence of AUX is discussed and practical examples of AUX scripts specifying various signals are illustrated. Additionally, two accompanying Windows-based programs and development libraries are described. AUX Viewer is a program that generates, visualizes, and plays sounds specified in AUX. AUX Viewer can also be used for class demonstrations or presentations. Another program, Psycon, allows a wide range of sound signals to be used as stimuli in common psychophysical testing paradigms, such as the adaptive procedure, the method of constant stimuli, and the method of adjustment. AUX Library is also provided, so that researchers can develop their own programs utilizing AUX. The philosophical basis of AUX is to separate signal generation from the user interface needed for experiments. AUX scripts are portable and reusable; they can be shared by other researchers, regardless of differences in actual AUX-based programs, and reused for future experiments. In short, the use of AUX can be potentially beneficial to all members of the research community-both those with programming backgrounds and those without.

  15. Sensibilisation aux gestes et postures de travail - French version only

    CERN Multimedia

    2004-01-01

    Nous vous proposons un nouveau cours de sécurité lié aux manutentions manuelles (durée 1 jour) : Sensibilisation aux gestes et postures de travail. Si vous êtes amené à manipuler régulièrement des charges lourdes ou volumineuses, cette formation peut vous aider à prévenir les lésions musculaires ou dorsales. A l'issue de cette formation, vous serez capable d'adopter et d'appliquer les principes de base de sécurité physique et d'économie d'efforts dans les manipulations d'objets. Les cours sont pris en charge par la Commission de Sécurité. L'inscription EDH est obligatoire. Pour plus d'information, veuillez consulter les pages Formation & Développement (Groupe Sécurité)

  16. La recherche-action participative facilite l'adaptation aux ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Ces travaux comprenaient un riche portefeuille de recherches sur l'adaptation aux changements climatiques dans le secteur de l'agriculture. La méthodologie privilégiée dans le cadre du programme, la recherche-action participative, s'est avérée fructueuse et a permis de mettre au point et de déployer des solutions ...

  17. Accroissement du recours aux politiques fiscales dans la lutte ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Incidence de la hausse des taxes sur le tabac et du prix des produits du tabac en Ukraine, en Russie et au Bélarus. La recherche destinée aux responsables des politiques de l'Ukraine, de la Russie et du Bélarus mettra en évidence la façon dont les mesures de taxation des produits du tabac peuvent contribuer.

  18. Foire aux questions: Bourse de recherche 2018 du CRDI | CRDI ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Vous remarquerez que d'importantes modifications ont été apportées aux critères d'admissibilité dans les deux dernières années. 2) Je suis étudiant à la maîtrise. Suis-je admissible à une bourse de recherche ? En principe oui. Toutefois, il est important de lire les spécifications du programme qui vous intéresse, car les ...

  19. Aspects Phenotypiques De La Resistance Aux Β- Lactamines Des ...

    African Journals Online (AJOL)

    Conclusion: L'identification des phénotypes de résistance de P.aeruginosa par la technique d'antibiogramme en milieu gélosé constitue une alternative pour les laboratoires de bactériologie médicale dans les pays aux ressources limitées comme le Togo, où les techniques de biologie moléculaire ne sont pas disponibles ...

  20. Adaptation aux changements climatiques des bassins versants en ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Les résultats de recherche seront diffusés dans des publications scientifiques à comité de lecture, dans le cadre d'une interaction critique avec la sphère des politiques, ainsi qu'à l'occasion d'un institut d'été destiné aux chercheurs et ... The Trustees of Ashoka Trust for Research in Ecology and the Environment (ATREE).

  1. CRDI foire aux questions | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    1. Quels sont les éléments importants à mentionner dans ma demande d'emploi ? Il importe de démontrer, au moyen d'exemples concrets, de quelle façon vos qualifications correspondent aux exigences du poste en ce qui concerne les études, l'expérience et la langue. 2. Comment saurai-je si ma demande d'emploi a bel ...

  2. Aquaculture intérieure et adaptation aux changements climatiques ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Ce projet porte sur l'élevage du tilapia dans de petits étangs fermiers ou des cages flottantes dans les rivières et les réservoirs du nord de la Thaïlande. Les chercheurs exploreront des façons d'adapter les pratiques aquacoles aux changements climatiques et analyseront la valeur de l'aquaculture comme stratégie ...

  3. Adapter l'information climatique aux besoins des utilisateurs | IDRC ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    29 mars 2011 ... Cet exposé politique résume les leçons tirées du forum d'apprentissage du programme ACCA entitulé " Faciliter l'accès aux prévisions météorologiques saisonnières et savoir mieux les exploiter" qui a pris lieux à Nairobi, Kenya en mars 1010.

  4. Théories à processus duaux et théories de l’éducation : le cas de l’enseignement de la pensée critique et de la logique

    Directory of Open Access Journals (Sweden)

    Guillaume Beaulac

    2011-05-01

    Full Text Available Plusieurs théories de l’enseignement de la logique et de la pensée critique prennent pour acquis que l’apprentissage théorique, celui des règles formelles par exemple, et son application pratique sont suffisants pour maîtriser les outils enseignés et pour prendre l’habitude de les mettre en usage. Toutefois, tout indique que cet enseignement n’est pas efficace, une conclusion supportée par plusieurs travaux en sciences cognitives. Approcher l’étude de la cognition évolutionnairement avec les théories à processus duaux permet une explication de ces insuffisances, tout en offrant des pistes pour aborder l’enseignement de la pensée critique et de la logique de manière plus efficace. Dans cet article, nous souhaitons présenter cette approche et explorer ces pistes de solution afin de faire quelques recommandations pédagogiques et mettre en place un cadre théorique. Nous présenterons un exemple d’application de ce programme de recherche avec la philosophie pour enfants.Many theories about the teaching of logic and critical thinking take for granted that theoretical learning, the learning of formal rules for example, and its practical application are sufficient to master the tools taught and to take the habit of using them. However, this way of teaching is not efficient, a conclusion supported by much work in cognitive science. Approaching cognition evolutionarily with dual-process theories allows for an explanation of these insufficiencies and offers clues on how we could teach critical thinking and logic more efficiently. In this article, we want to present this approach and explore these leads in order to make some pedagogical recommendations and lay the foundations of a framework. We will put forward an example of the application of this research program with philosophy for children

  5. Foire aux questions: Bourse de recherche 2017 du CRDI | CRDI ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    1) Si l'on décide de m'attribuer une bourse de recherche, aurai-je besoin d'un permis de travail ? Veuillez lire les détails sur ce sujet sous la rubrique Admissibilité à la page Web de l'appel. Vous remarquerez que d'importantes modifications ont été apportées aux critères d'admissibilité cette année. 2) Je suis étudiant à la ...

  6. Safety Training: Sensibilisation aux gestes et postures de travail

    CERN Multimedia

    Laetitia Laddada

    2004-01-01

    If you wish to participate in one of the following courses, please discuss with your supervisor and apply electronically directly from the course description pages that can be found on the Web at: http://www.cern.ch/Training/ or fill in an 'application for training' form available from your Divisional Secretariat or from your DTO (Divisional Training Officer). Applications will be accepted in the order of their receipt.Nous vous proposons un nouveau cours de sécurité lié aux manutentions manuelles (durée 1 jour) : Sensibilisation aux gestes et postures de travail. Si vous êtes amené à manipuler régulièrement des charges lourdes ou volumineuses, cette formation peut vous aider à prévenir les lésions musculaires ou dorsales. A l'issue de cette formation, vous serez capable d'adopter et d'appliquer les principes de base de sécurité physique et d'&e...

  7. Safety Training: Sensibilisation aux gestes et postures de travail

    CERN Multimedia

    Laetitia Laddada

    2004-01-01

    Nous vous proposons un nouveau cours de sécurité lié aux manutentions manuelles (durée 1 jour) : Sensibilisation aux gestes et postures de travail. Si vous êtes amené à manipuler régulièrement des charges lourdes ou volumineuses, cette formation peut vous aider à prévenir les lésions musculaires ou dorsales. A l'issue de cette formation, vous serez capable d'adopter et d'appliquer les principes de base de sécurité physique et d'économie d'efforts dans les manipulations d'objets. Les cours sont pris en charge par la Commission de Sécurité. L'inscription EDH est obligatoire. Pour plus d'information, veuillez consulter les pages Formation & Développement (Groupe Sécurité). FORMATION EN SECURITE SAFETY TRAINING Laetitia Laddada 73811 - 79236 safety.training@cern.ch

  8. Maladies reliées aux loisirs aquatiques

    Science.gov (United States)

    Sanborn, Margaret; Takaro, Tim

    2013-01-01

    Résumé Objectif Passer en revue les facteurs de risque, la prise en charge et la prévention des maladies reliées aux loisirs aquatiques en pratique familiale. Sources des données Des articles originaux et de synthèse entre janvier 1998 et février 2012 ont été identifiés à l’aide de PubMed et des expressions de recherche en anglais water-related illness, recreational water illness et swimmer illness. Message principal Il y a un risque de 3 % à 8 % de maladies gastrointestinales (MGI) après la baignade. Les groupes à risque élevé de MGI sont les enfants de moins de 5 ans, surtout s’ils n’ont pas été vaccinés contre le rotavirus, les personnes âgées et les patients immunodéficients. Les enfants sont à plus grand risque parce qu’ils avalent plus d’eau quand ils nagent, restent dans l’eau plus longtemps et jouent dans l’eau peu profonde et le sable qui sont plus contaminés. Les adeptes des sports dans lesquels le contact avec l’eau est abondant comme le triathlon et le surf cerf-volant sont aussi à risque élevé et même ceux qui s’adonnent à des activités impliquant un contact partiel avec l’eau comme la navigation de plaisance et la pêche ont un risque de 40 % à 50 % fois plus grand de MGI par rapport à ceux qui ne pratiquent pas de sports aquatiques. Il y a lieu de faire une culture des selles quand on soupçonne une maladie reliée aux loisirs aquatiques et l’échelle clinique de la déshydratation est utile pour l’évaluation des besoins de traitement chez les enfants affectés. Conclusion Les maladies reliées aux loisirs aquatiques est la principale cause de MGI durant la saison des baignades. La reconnaissance que la baignade est une source importante de maladies peut aider à prévenir les cas récurrents et secondaires. On recommande fortement le vaccin contre le rotavirus chez les enfants qui se baignent souvent.

  9. L’ethnologue aux prises avec les archives - Introduction

    Directory of Open Access Journals (Sweden)

    Marie-Dominique Mouton

    2008-08-01

    Full Text Available Les textes présentés ici invitent à une réflexion sur les matériaux de terrain et plus largement sur la relation qui unit l’ethnologue aux archives, qu’il s’agisse des siennes, données vivantes, inspiratrices de sa recherche, de celles de ses aînés, devenues objets d’étude après leur dépôt dans une institution, ou de toutes les autres archives, constituées et rassemblées, à différentes époques, dans des perspectives administratives, juridiques, historiques ou religieuses, envisagées ici au tr...

  10. Results from the Tokamak Fontenay-aux-Roses

    International Nuclear Information System (INIS)

    Ginot, P.

    1975-01-01

    It became clear in 1969 that confinement and heating in Tokomaks offered great possibilities and the Fontenay-aux-Roses Tokamak (TFR) was built for research on their improved efficiency. A plasma of mean density 4.5.10 13 cm -3 and of maximum electron and ion temperatures 2.5 and 1 keV respectively was obtained. The current induced in the gas reached 0.4MA and discharges were maintained for more than 0.5s. The ion assembly seems to behave according to the mechanism predicted by theory, that of electrons suffers an abnormal energy loss. These results confirm and add to those obtained earlier. The machine is now being used for the detailed study of an energy balance and of the most plausible loss mechanisms (turbulence, impurities) and for the development of new heating methods [fr

  11. Monsieur Etienne Blanc Premier vice-président de la Région Auvergne-Rhône-Alpes Délégué aux finances, à l'administration générale, aux économies budgétaires et aux politiques transfrontalières

    CERN Multimedia

    Bennett, Sophia Elizabeth

    2017-01-01

    Monsieur Etienne Blanc Premier vice-président de la Région Auvergne-Rhône-Alpes Délégué aux finances, à l'administration générale, aux économies budgétaires et aux politiques transfrontalières

  12. Intertitre et film narratif de fiction : Genèses, développements, et logiques d’un procédé filmographique, 1895-1916. L'exemple de la production aux Etats-Unis et le cas d’Intolerance (D. W. Griffith, 1916)

    NARCIS (Netherlands)

    Dupré la Tour, C.M.S.

    2016-01-01

    The silent film intertitle has long been ignored by cinema history and theory, and by film archives; or regarded as an intruder, a palliative to the absence of sound, which became obsolete after the invention of talking pictures. The teleology imbued in this historiographical trend, influenced by

  13. Development of NbN Josephson junctions with Ta{sub x}N semi-metal barrier; application to RSFQ circuits; Etude et realisation de jonction Josephson en NbN a barriere semi-metallique en Ta{sub x}N; application aux circuits logiques RSFQ

    Energy Technology Data Exchange (ETDEWEB)

    Setzu, R

    2007-11-15

    This thesis research, brought to the development and optimization of SNS (Superconductor / Normal Metal / Superconductor) Josephson junctions with NbN electrodes and a high resistivity Ta{sub x}N barrier. We were able to point out Josephson oscillations for frequencies above 1 THz and operation temperatures up to 10 K, which constituted the original goal of the project. This property makes these junctions unique and well adapted for realizing ultra-fast RSFQ (Rapid Single Flux Quantum) logic circuits suitable for spatial telecommunications. We showed a good reproducibility of Ta{sub x}N film properties as a function of the sputtering parameters. The NbN/Ta{sub x}N/NbN tri-layers exhibit high critical temperature (16 K). The junctions showed a clear dependence of the R{sub n}I{sub c} product as a function of the partial nitrogen pressure inside the reactive plasma; the R{sub n}I{sub c} is the product between the junction critical current and its normal resistance, and indicates the upper limit Josephson frequency. We have also obtained some really high R{sub n}I{sub c} products, up to 3.74 mV at 4.2 K for critical current densities of about 15 kA/cm{sup 2}. Junctions show the expected Josephson behaviors, respectively Fraunhofer diffraction and Shapiro steps. up to 14 K. This allows expecting good circuit operations in a relaxed cryogenics environment (with respect to the niobium circuits limited at 4.2 K). The junctions appear to be self-shunted. The SNOP junctions J{sub c}-temperature dependence has been fitted by using the long SNS junction model in the dirty limit, which gives a normal metal coherence length of about 3.8 nm at 4.2 K. We have finally studied a multilayer fabrication process, including a common ground plane and bias resistors, suitable for RSFQ logic basic circuits. To conclude we have been able to show the performance superiority of NbN/Ta{sub x}N/NbN junctions over the actual niobium junctions, as well as their interest for realizing compact RSFQ logic circuits. In fact these junctions do not need external shunt-resistors as the Nb junctions, and can operate at clock frequencies above 150 GHz up to 10 K (against 50 GHz at 4.2 K for the Nb technology). (author)

  14. La qualité du lait entre logiques des coopératives et logiques des éleveurs et éleveuses. Introduction d’un analyseur de qualité du lait dans des coopératives laitières du Gharb

    Directory of Open Access Journals (Sweden)

    Hafsa Bensidi

    2014-11-01

    Full Text Available La filière laitière au Maroc demande de plus en plus que les éleveurs fournissent un lait de qualité. Les coopératives de collecte de lait ont souvent à faire face à un problème d’écrémage du lait, qu’elles ne pouvaient pas par le passé gérer faute d’équipements de contrôle adaptés. La Centrale Laitière a accompagné des coopératives de collecte de lait dans l’acquisition d’appareils de mesure rapide de la qualité du lait, qui mesurent entre autres le taux de matière grasse. La présente étude analyse la modification du dispositif de contrôle de qualité suite à l’installation des analyseurs, les effets de cette modification au niveau des coopératives et l’acceptation du nouveau dispositif au niveau des exploitations familiales. L’étude a été effectuée dans trois coopératives du Gharb. Des éleveurs, des éleveuses ainsi que les leaders et personnels des coopératives ont été enquêtés. L’installation de l’analyseur a permis, grâce à la baisse de la pratique de l’écrémage, une baisse des pénalités imposées par la Centrale Laitière aux coopératives, et une augmentation des primes liées à la bonne qualité. Les pratiques d’écrémage ont diminué mais n’ont pas disparu. Les éleveurs et éleveuses se déclarent majoritairement favorables au nouveau dispositif, car il permet une équité entre les éleveurs. Cependant, le fait de livrer du lait non écrémé conduit aussi à une baisse du revenu que certaines femmes obtenaient en vendant elles-mêmes le beurre au marché. Par ailleurs, la Centrale Laitière ne communique pas de façon détaillée les résultats de ses mesures de qualité. Ceci limite la capacité des coopératives à s’engager dans un paiement à la qualité, ce qui constituerait pourtant un élément clé pour garantir la durabilité d’un tel système de contrôle de la qualité.

  15. Apports et limites des programmes de recherche aux sciences de gestion

    OpenAIRE

    Jeanjean, Thomas; Tixier, Julie

    2001-01-01

    Dans cet article, nous étudions la méthodologie des programmes de recherche de Lakatos (1978) et ses apports aux sciences sociales et en particulier à la recherche en gestion. Notre objectif est triple. Il s'agit d’abord de préciser la nature des programmes de recherche, de les critiquer et de les situer par rapport aux thèses défendues par Popper, Feyerabend et Kuhn. Par ailleurs, nous étudions la transférabilité de la méthodologie de Lakatos aux sciences sociales. Enfin, nous analysons l’in...

  16. DREAM IT, un programme de recherche aux fins d'autonomisation ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    DREAM IT, un programme de recherche aux fins d'autonomisation de tous les Mongols grâce aux TIC ... Plus précisément, la recherche visera l'amélioration de la prestation des services d'éducation dans les régions éloignées grâce aux téléphones mobiles, à la télévision et à Internet; la conception d'un système ...

  17. Les logiques spatiales monégasques

    Directory of Open Access Journals (Sweden)

    Jean-Christophe GAY

    1996-06-01

    Full Text Available La prospérité de la Principauté de Monaco s'explique par la valorisation ou la création de plusieurs abris emboîtés (climatique, fiscal, urbanistique se cumulant. De part et d'autre du «Rocher», triplement abrité, le territoire monégasque s'organise suivant deux axes conceptuels opposés.

  18. La fabrique des sciences des institutions aux pratiques

    CERN Document Server

    Benninghoff, Martin; Crettaz von Roten, Fabienne; Merz, Martina

    2006-01-01

    Aujourd'hui, les façons de produire, d'organiser, d'évaluer et d'utiliser les savoirs sont en profond débat. De plus en plus, l'Etat, la société civile et l'économie tentent d'influencer les activités des universités et des laboratoires de recherche. Ces développements mettent à l'épreuve tout à la fois les fondements des systèmes d'enseignement supérieur et de recherche, l'autonomie des institutions scientifiques, la définition des frontières des savoirs et l'acceptation des sciences. Dans des contextes suisses et européens, cet ouvrage s'intéresse aux manières dont les sciences et les technologies sont fabriquées, en analysant leurs institutions et les pratiques. A partir d'une approche relationnelle, les sciences et les technologies sont conçues comme des phénomènes profondément sociaux, culturels et politiques. Une telle démarche déstabilise les visions parfois idéalisées et stéréotypées de la construction des savoirs. Des études de cas détaillées décrivent des phénomè...

  19. Aux limites de la physique les paradoxes quantiques

    CERN Document Server

    Rothen, François

    2012-01-01

    Dans l’esprit des pères fondateurs de la science moderne, les phénomènes matériels se déroulent selon un schéma unique. La cause précède nécessairement l’effet, et la connaissance de l’effet permet de remonter à la cause. Sur la scène de la nature, le hasard n’occupe qu’une place congrue. On ne fait appel à lui que pour pallier notre ignorance. Dans les années 1920, la révolution quantique bouleverse ce cadre rigide. Elle accorde une place de choix au hasard, si malmené jusqu’alors, puis elle met en scène une constellation de phénomènes inexplicables aux yeux de la science dite classique. Après une courte introduction historique, l’auteur met ses lecteurs au contact de certains de ces phénomènes si contraires à l’intuition. Refusant l’aide du langage mathématique, il les convie à pénétrer dans un monde quantique qui déconcerte le novice avant de l’éblouir par sa nouveauté et sa cohérence. Un accent particulier est mis sur une application nouvelle de la physiqu...

  20. Introduction aux études sur le genre. - 2e éd. revue et augm.

    NARCIS (Netherlands)

    Bereni, L.; Chauvin, S.; Jaunait, A.; Revillard, A.

    2012-01-01

    Pourquoi offre-t-on des poupées aux filles et des voitures aux garçons ? Pourquoi les femmes gagnent-elles moins que les hommes ? Comment expliquer qu’elles effectuent les deux tiers du travail domestique ? Pourquoi est-ce si mal vu pour un homme d’être efféminé ? Le pouvoir est-il intrinsèquement

  1. Les déchets militaires : De la conception aux impacts territoriaux

    OpenAIRE

    Charriere, Elodie; Baudoui, Remi

    2017-01-01

    Classiquement, la notion de déchet est articulée autour de deux concepts distincts : les déchets ménagers et les déchets industriels. Etant donné le polymorphisme de cette notion et les nombreuses représentations lui incombant, le terme de déchet s’est construit autour de diverses catégories établies dans une triple logique : (i) en fonction de leurs sources de production – déchets industriels, déchets agricoles, déchets hospitaliers, déchets ménagers ; (ii) en fonction de leur consistance – ...

  2. Aux/IAA Gene Family in Plants: Molecular Structure, Regulation, and Function

    Directory of Open Access Journals (Sweden)

    Jie Luo

    2018-01-01

    Full Text Available Auxin plays a crucial role in the diverse cellular and developmental responses of plants across their lifespan. Plants can quickly sense and respond to changes in auxin levels, and these responses involve several major classes of auxin-responsive genes, including the Auxin/Indole-3-Acetic Acid (Aux/IAA family, the auxin response factor (ARF family, small auxin upregulated RNA (SAUR, and the auxin-responsive Gretchen Hagen3 (GH3 family. Aux/IAA proteins are short-lived nuclear proteins comprising several highly conserved domains that are encoded by the auxin early response gene family. These proteins have specific domains that interact with ARFs and inhibit the transcription of genes activated by ARFs. Molecular studies have revealed that Aux/IAA family members can form diverse dimers with ARFs to regulate genes in various ways. Functional analyses of Aux/IAA family members have indicated that they have various roles in plant development, such as root development, shoot growth, and fruit ripening. In this review, recently discovered details regarding the molecular characteristics, regulation, and protein–protein interactions of the Aux/IAA proteins are discussed. These details provide new insights into the molecular basis of the Aux/IAA protein functions in plant developmental processes.

  3. Des tables pascales aux tables astronomiques et retour.

    Directory of Open Access Journals (Sweden)

    Max Lejbowicz

    2006-05-01

    Full Text Available L’article étudie la naissance et le développement du calendrier ecclésiastique chrétien, i. e. le comput, depuis les premiers témoignages de la célébration annuelle de la résurrection de Jésus jusqu’aux traductions des tables astronomiques arabes au xiie siècle. Il privilégie les procédures qui aboutissent à la détermination des dates pascales et à leur mise en forme tabulaire. Les analyses sont conduites à partir d’un double point de vue. L’un est scientifique. Il s’appuie sur les données astronomiques retenues par Ptolémée et sur l’apport de la tradition mathématique grecque au calcul par approximations. Les cycles soli-lunaires sont posés à partir des fractions continues et le cycle soli-hebdomadaire à partir du plus petit commun multiple. Le second point de vue est social : l’unification du comput participe à celle de la chrétienté comprise comme une configuration politico-religieuse. Deux conclusions s’imposent. Quelle que soit l’importance que la civilisation médiévale a attribuée au comput, il reste que : 1 / les Pâques sont porteuses de significations irréductibles aux techniques chronométriques qui inscrivent cette fête dans le déroulement de l’année ; 2 / ces techniques ont toutefois marqué profondément les curiosités intellectuelles des Latins et les ont préparé à accueillir avec ferveur les zīj et la numération de position.The article studies the birth and development of the Christian ecclesiastical calendar, i.e. the computus, from the first witnesses to the yearly celebration of the resurrection of Jesus to the translations of arabic astronomical tables in the 12th century. It focuses on the procedures which resulted in determinig the dates of Easter and their being put into tabular form. These analyses were undertaken from two perspectives. One was scientific, relying on the astronomical data preserved by Ptolemy and on the contribution of the Greek mathematical

  4. Landry Ebang, La logique de l’enquête en science sociale. Sortir d’une méthodologie du mimétisme expérimental

    OpenAIRE

    Ogorzelec-Guinchard, Laetitia

    2014-01-01

    L’auteur présente cet ouvrage comme un « traité de méthodologie » explicitement adossé à une démarche de philosophie des sciences. Il s’agit pour lui de procéder à un examen de l’intégralité du processus de recherche en sciences sociales. La première partie du livre cherche surtout à nous expliquer à quel point la « méthode expérimentale » propre aux sciences « nomologiques » (c’est-à-dire capables de formuler des lois et d’en tirer toutes les conséquences dans leurs démarches de recherche) b...

  5. Occasions et difficultés associées aux activités commerciales dans ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    intégreront des reportages photo aux observations sur le terrain; - examineront les résultats à la lumière des Principes directeurs relatifs aux entreprises et aux droits de l'homme de l'ONU, de la théorie du droit, de la théorie du développement et des codes de conduite en matière de responsabilité sociale de l'entreprise.

  6. Formation en TIC destinée aux personnes handicapées en ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Formation en TIC destinée aux personnes handicapées en Amérique latine. En Amérique latine et dans les Caraïbes, les personnes handicapées représentent environ 10 % de la population. La population de cette région affiche des taux de pauvreté et de chômage élevés; assurer des moyens de subsistance décents aux ...

  7. Pourquoi la philosophie indienne ne doit pas être laissée aux seuls philosophes

    OpenAIRE

    Bronkhorst, Johannes

    2017-01-01

    Des historiens de l’astronomie, de la linguistique ou de la médecine indiennes anciennes, on attend généralement qu’ils soient familiers des contreparties occidentales modernes de ces disciplines. Mais qu’en est-il de la philosophie ? Et tout d’abord, existe-t-il en Inde ancienne quelque chose comme une philosophie dont on pourrait faire l’histoire ? Et si oui, qui en sera le meilleur exégète ? Le philosophe attentif aux enjeux systématiques, ou l’historien sensible aux contextes de productio...

  8. Report of transparency and nuclear safety 2007 CEA Fontenay aux Roses; Rapport transparence et securite nucleaire 2007 CEA Fontenay aux Roses

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2007-07-01

    This report presents the activities of the CEA Center of Fontenay aux roses for the year 2007. After many years of decommissioning and dismantling of nuclear installations, the Center is now devoted (since 2005) to the development of research programmes on biology and biomedical technologies. The actions concerning the safety, the radiation protection, the significant events, the release control and the environmental impacts and the wastes stored on the center are discussed. (A.L.B.)

  9. Adaptation aux répercussions de l'élévation du niveau de la mer ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    , la pollution, l'utilisation intensive des terres, la croissance démographique et la dégradation des écosystèmes. Elles sont par ailleurs exposées aux répercussions de la hausse du niveau de la mer et notamment aux inondations. Réduire la ...

  10. Identification and gene expression analysis of AUX1 influencing adventitious root induction in olive cuttings (Olea europaea L.

    Directory of Open Access Journals (Sweden)

    Seyed Mehdi Hosseini Mazinani

    2014-12-01

    Full Text Available Olive is one of the most important fruit crops throughout the Mediterranean Basin, mainly propagated by cuttings. The adventitious root development is a key stage in vegetative propagation however the low rooting capacity of some cultivars severely affects the efficiency of olive clonal propagation. Auxin Influx Carrier gene (AUX1, plays a key role in lateral root formation in many plant species promoting the export of IAA from newly developing leaves to lateral root primordia. Putative olive homologues were amplified by using degenerate primers designed on the conserved regions of AUX1 transcripts identified in other plants. Transcript and amino acid sequences in root (OeAUX1R and base of cutting (OeAUX1B were different causes of polymorphisms relating to possible distinct roles in these tissues. In order to investigate the gene expression patterns, Real-time PCR was performed on cuttings during the rooting stage collected from genotypes characterized by high and low rooting ability. Moreover, the gene expression was investigated on different olive tissues. Preliminary results showed that the expression of OeAUX1B and OeAUX1R in base of cuttings and roots of the high-rooting genotype were higher which suggests the hypothesis of the involvement of OeAUX1 in olive rooting. Bioinformatics analysis revealed that AUX1 gene had 8 exons in olive and the sequence of this gene in plant was conserved during evolution.

  11. Evolution Analysis of the Aux/IAA Gene Family in Plants Shows Dual Origins and Variable Nuclear Localization Signals

    Directory of Open Access Journals (Sweden)

    Wentao Wu

    2017-10-01

    Full Text Available The plant hormone auxin plays pivotal roles in many aspects of plant growth and development. The auxin/indole-3-acetic acid (Aux/IAA gene family encodes short-lived nuclear proteins acting on auxin perception and signaling, but the evolutionary history of this gene family remains to be elucidated. In this study, the Aux/IAA gene family in 17 plant species covering all major lineages of plants is identified and analyzed by using multiple bioinformatics methods. A total of 434 Aux/IAA genes was found among these plant species, and the gene copy number ranges from three (Physcomitrella patens to 63 (Glycine max. The phylogenetic analysis shows that the canonical Aux/IAA proteins can be generally divided into five major clades, and the origin of Aux/IAA proteins could be traced back to the common ancestor of land plants and green algae. Many truncated Aux/IAA proteins were found, and some of these truncated Aux/IAA proteins may be generated from the C-terminal truncation of auxin response factor (ARF proteins. Our results indicate that tandem and segmental duplications play dominant roles for the expansion of the Aux/IAA gene family mainly under purifying selection. The putative nuclear localization signals (NLSs in Aux/IAA proteins are conservative, and two kinds of new primordial bipartite NLSs in P. patens and Selaginella moellendorffii were discovered. Our findings not only give insights into the origin and expansion of the Aux/IAA gene family, but also provide a basis for understanding their functions during the course of evolution.

  12. Evolution Analysis of the Aux/IAA Gene Family in Plants Shows Dual Origins and Variable Nuclear Localization Signals.

    Science.gov (United States)

    Wu, Wentao; Liu, Yaxue; Wang, Yuqian; Li, Huimin; Liu, Jiaxi; Tan, Jiaxin; He, Jiadai; Bai, Jingwen; Ma, Haoli

    2017-10-08

    The plant hormone auxin plays pivotal roles in many aspects of plant growth and development. The auxin/indole-3-acetic acid (Aux/IAA) gene family encodes short-lived nuclear proteins acting on auxin perception and signaling, but the evolutionary history of this gene family remains to be elucidated. In this study, the Aux/IAA gene family in 17 plant species covering all major lineages of plants is identified and analyzed by using multiple bioinformatics methods. A total of 434 Aux/IAA genes was found among these plant species, and the gene copy number ranges from three ( Physcomitrella patens ) to 63 ( Glycine max ). The phylogenetic analysis shows that the canonical Aux/IAA proteins can be generally divided into five major clades, and the origin of Aux/IAA proteins could be traced back to the common ancestor of land plants and green algae. Many truncated Aux/IAA proteins were found, and some of these truncated Aux/IAA proteins may be generated from the C-terminal truncation of auxin response factor (ARF) proteins. Our results indicate that tandem and segmental duplications play dominant roles for the expansion of the Aux/IAA gene family mainly under purifying selection. The putative nuclear localization signals (NLSs) in Aux/IAA proteins are conservative, and two kinds of new primordial bipartite NLSs in P. patens and Selaginella moellendorffii were discovered. Our findings not only give insights into the origin and expansion of the Aux/IAA gene family, but also provide a basis for understanding their functions during the course of evolution.

  13. De la frise magdalénienne in situ … au centre d’interprétation du Roc-aux-Sorciers : l’usage de la 3D

    Directory of Open Access Journals (Sweden)

    Geneviève Pinçon

    2012-04-01

    Full Text Available La base de données 3D réalisée dans le cadre de la recherche archéologique sur les sculptures pariétales magdaléniennes (il y a 15 000 ans a pu être exploitée également pour une reproduction grandeur nature des œuvres à destination du grand public dans le Centre d’interprétation du Roc-aux-Sorciers à Angles-sur-l’Anglin (Vienne, France. Cette réalisation originale est présentée par les différents acteurs du projet (maître d’ouvrage, maître d’œuvre, scientifiques, prestataire 3D offrant ainsi le déroulé de la mise en œuvre de la restitution à partir de la base de données 3D et faisant part des éléments du cahier des charges pour l’enregistrement laser tridimensionnel dont l’exploitation s’est avérée répondre à des utilités variées. Quand les problématiques de la recherche conduisent à utiliser la 3D, il paraît logique que ce même outil puisse aider à la restitution au grand public et puisse être partagé avec la communauté scientifique ou avec les restaurateurs chargés de la conservation de ce patrimoine, comme le montre cette réalisation. Les implications du choix d'un mode de restitution à partir d’une base de données 3D sont également évoquées avec l'exemple de la frise sculptée magdalénienne de la Chaire-à-Calvin (Charente, France dans le cadre d’un projet de valorisation.The creation of a 3D database within the framework of archaeological research on Magdalenian parietal sculptures (15,000 years old has also been usable for a full-size reproduction of the figures for the benefit of the general public in the Interpretation Centre of Le Roc-aux-Sorciers at Angles-sur-l'Anglin (Vienne, France. This unique production is presented by the various participants in the project (contracting authority, prime contractor, scientists, 3D provider, thus providing the whole story of the reconstruction's implementation from the 3D database, and providing information on the specifications

  14. La largeur de bande pourrait permettre aux universités africaines de ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2 févr. 2011 ... La meilleure politique une recherche en télécommunication dans une ... Toutefois, l'utilisation de HINARI exige un accès Internet fiable et assez .... à la conférence d'Internet2, qui a eu lieu aux États-Unis en septembre, et à ...

  15. Le marche aux fetiches (lantassime) d'Akodessewa a Lome (Togo ...

    African Journals Online (AJOL)

    ) est célèbre par les marchandises qui y sont vendues. Une démarche méthodologique basée sur la recherche documentaire, l'observation et les enquêtes par questionnaires a permis de montrer que le marché aux fétiches occupe des ...

  16. Monitoring the performance of Aux. Feedwater Pump using Smart Sensing Model

    Energy Technology Data Exchange (ETDEWEB)

    No, Young Gyu; Seong, Poong Hyun [Korea Advanced Institute of Science and Technology, Daejeon (Korea, Republic of)

    2015-10-15

    Many artificial intelligence (AI) techniques equipped with learning systems have recently been proposed to monitor sensors and components in NPPs. Therefore, the objective of this study is the development of an integrity evaluation method for safety critical components such as Aux. feedwater pump, high pressure safety injection (HPSI) pump, etc. using smart sensing models based on AI techniques. In this work, the smart sensing model is developed at first to predict the performance of Aux. feedwater pump by estimating flowrate using group method of data handing (GMDH) method. If the performance prediction is achieved by this feasibility study, the smart sensing model will be applied to development of the integrity evaluation method for safety critical components. Also, the proposed algorithm for the performance prediction is verified by comparison with the simulation data of the MARS code for station blackout (SBO) events. In this study, the smart sensing model for the prediction performance of Aux. feedwater pump has been developed. In order to develop the smart sensing model, the GMDH algorithm is employed. The GMDH algorithm is the way to find a function that can well express a dependent variable from independent variables. This method uses a data structure similar to that of multiple regression models. The proposed GMDH model can accurately predict the performance of Aux.

  17. Monitoring the performance of Aux. Feedwater Pump using Smart Sensing Model

    International Nuclear Information System (INIS)

    No, Young Gyu; Seong, Poong Hyun

    2015-01-01

    Many artificial intelligence (AI) techniques equipped with learning systems have recently been proposed to monitor sensors and components in NPPs. Therefore, the objective of this study is the development of an integrity evaluation method for safety critical components such as Aux. feedwater pump, high pressure safety injection (HPSI) pump, etc. using smart sensing models based on AI techniques. In this work, the smart sensing model is developed at first to predict the performance of Aux. feedwater pump by estimating flowrate using group method of data handing (GMDH) method. If the performance prediction is achieved by this feasibility study, the smart sensing model will be applied to development of the integrity evaluation method for safety critical components. Also, the proposed algorithm for the performance prediction is verified by comparison with the simulation data of the MARS code for station blackout (SBO) events. In this study, the smart sensing model for the prediction performance of Aux. feedwater pump has been developed. In order to develop the smart sensing model, the GMDH algorithm is employed. The GMDH algorithm is the way to find a function that can well express a dependent variable from independent variables. This method uses a data structure similar to that of multiple regression models. The proposed GMDH model can accurately predict the performance of Aux

  18. Élaboration de politiques nationales sur l'accès aux ressources ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Ce projet amènera des équipes de recherche expérimentées en provenance de ... des articles scientifiques, un livre et des documents de formation en anglais et ... Centre international de recherche agricole dans les zones arides ... de coopération scientifique et technologique en appui aux projets de recherche conjoints.

  19. Prévention du crime grâce aux pratiques communautaires au ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Selon les chiffres compilés par la police et l'ombudsman des droits de la personne, ... L'Association internationale de ressources en eau (IWRA), en étroite ... un accord de coopération scientifique et technologique en appui aux projets de ...

  20. Partenariat Canada-Caraïbes sur l'adaptation des collectivités aux ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Mettre en place des réseaux scientifiques et professionnels qui font progresser la ... climatiques en consolidant les structures institutionnelles et de gouvernance. ... ont conclu un accord de coopération scientifique et technologique en appui aux ... de l'Institut d'étude du développement international de l'Université McGill.

  1. De la recherche aux politiques - Établissement de liens entre l ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    La recherche sur les changements climatiques et leurs effets sur les populations vulnérables est assez avancée en Afrique australe. Toutefois, il y a peu de transfert des connaissances des scientifiques aux responsables des politiques. Ce projet vise à faciliter la traduction des résultats de la recherche en politiques de ...

  2. Mettre un terme à la violence faite aux femmes | CRDI - Centre de ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    13 nov. 2012 ... Asia Justice and Rights (AJAR) ... La violence contre les femmes ne se résume pas aux gestes posés. ... Dans une culture admettant la violence à l'endroit des femmes, ce fait est important; ... Indian Institute of Management

  3. Saine diversification des repas servis dans les écoles grâce aux ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Saine diversification des repas servis dans les écoles grâce aux innovations en agriculture. 03 janvier 2018. Wendy-Ann Isaac, Gaius Eudoxie, Patrick Cortbaoui, Wayne Ganpat et Sylvia Borucki. Des élèves qui mangent un repas à l'école. Photo : Arne Hoel / Banque mondiale ...

  4. Vulnérabilité des troupeaux transhumants aux mutations climatiques ...

    African Journals Online (AJOL)

    Vulnérabilité des troupeaux transhumants aux mutations climatiques : analyse des perceptions et adaptations locales dans le bassin de la Sota à Malanville. S Zakari, BAH Tente, I Yabi, IT Imorou, T Tabou, F Afouda, B n'Bessa ...

  5. Prévalence et susceptibilité aux antibiotiques des souches de ...

    African Journals Online (AJOL)

    Cette étude a pour but de déterminer la prévalence et la susceptibilité des souches de Salmonella ... Les résultats des tests de sensibilité aux antibiotiques ont montré que : 92,68% des Salmonella ...... Kariuki S, Holt KE, Gordon MA, Harris.

  6. Le coût du crédit aux entreprises.

    OpenAIRE

    PARMENTIER, P.; THOMAS, J.

    2006-01-01

    La remontée des taux moyens des crédits aux entreprises amorcée au quatrième trimestre 2005 s’est poursuivie entre janvier et avril 2006 pour toutes les catégories de concours autres que l’escompte.

  7. Offrir un choix aux agriculteurs pauvres: Harsha de Silva (Sri Lanka ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    ans de nombreux pays en développement, les téléphones mobiles permettent aux pauvres de profiter des avantages des technologies de l'information et de la communication (TIC). Des travaux de recherche appuyés par le CRDI et dirigés par Learning Initiatives on Reforms for Network Economies (LIRNEasia), ...

  8. Tirer des connaissances de la recherche locale et les utiliser aux ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    gs

    La Carnegie Corporation of New York (CCNY) et le Centre de recherches pour le développement international (CRDI) annoncent le lancement d'une initiative de recherche concertée intitulée Tirer des connaissances de la recherche locale et les utiliser aux fins de la consolidation de la paix et du renforcement de l'État.

  9. Mise en place d'un réseau d'adaptation aux changements ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Ce projet a pour objectif de concevoir un mécanisme de gestion des risques accrus liés aux changements climatiques en appliquant le principe reconnu des ... Adaptation to Climate Change: Stakeholder engagement and understanding impacts - International Council for Local Environment Initiatives (ICLEI) (Section 21).

  10. Etude comparative de la flore aux abords des cours d'eau dans les ...

    African Journals Online (AJOL)

    Etude comparative de la flore aux abords des cours d'eau dans les zones hypo et hyper endémiques d'ulcère de Buruli en Côte d'Ivoire. C. Cisse Boni, E. Ehouman, D. Soro, M.W. Kone, A. Bakayoko, F. Dembele, K. Bauthire, M Dosso ...

  11. Penser aux/les limites de nos limites

    Directory of Open Access Journals (Sweden)

    Jacques Lévy

    2010-12-01

    Full Text Available Le mot « frontière » a beaucoup de succès, dans son sens propre mais plus encore comme métaphore d’une multitude de réalités qui ont à voir avec les limites, c’est-à-dire avec notre propension à découper le monde en objets séparables. Mais on constate une grande indétermination entre concept et métaphore et un usage trop facile de mélanges entre ceux-ci. Il faut donc d’abord admettre que la matérialité n’est qu’une des composantes de notre monde, mais que l’immatériel n’est pas l’irréel, le simulé ou le métaphorique. Après un détour par une théorie des limites et ses limites et une distinction entre le topographique (continu et le topologique (discontinu appliquée à l’intérieur et aux limites d’une aire, deux exemples sont développés qui visent à montrer que, si l’on trouve des frontières, ce n’est pas forcément là où on les attend et que l’appréciation juste de la place des frontières suppose la prise en compte de bien d’autres considérations que la seule limitation volontaire et brutale du franchissement d’une ligne imaginaire tracée au sol.Think about limits and the limits of our limitsThe word “boundary” has been very successful in its literal sense but even more so as a metaphor of a multitude of realities involving limits, that is, with regards to our tendency to divide the world into separable objects. However, one can observe a considerable uncertainty between the concept and the metaphor and an utilisation too easy of various mixtures of them. It becomes necessary therefore to first admit that materiality is only one of the components of our world whilst the immaterial is not unreal, simulated or metaphoric. After a detour consisting of examining a theory of limits and its limits and making the distinction between the topographic (continuous and the topologic (discontinuous applied to the interior and the limits of an area, two examples are developed which aim to

  12. First-principles study of the structural and elastic properties of AuxV1-x and AuxNb1-x alloys

    Science.gov (United States)

    Al-Zoubi, N.

    2018-04-01

    Ab initio total energy calculations, based on the Exact Muffin-Tin Orbitals (EMTO) method in combination with the coherent potential approximation (CPA), are used to calculate the total energy of AuxV1-x and AuxNb1-x random alloys along the Bain path that connects the body-centred cubic (bcc) and face-centred cubic (fcc) structures as a function of composition x (0 ≤ x ≤ 1). The equilibrium Wigner-Seitz radius and the elastic properties of both systems are determined as a function of composition. Our theoretical prediction in case of pure elements (x = 0 or x = 1) are in good agreement with the available experimental data. For the Au-V system, the equilibrium Wigner-Seitz radius increase as x increases, while for the Au-Nb system, the equilibrium Wigner-Seitz radius is almost constant. The bulk modulus B and C44 for both alloys exhibit nearly parabolic trend. On the other hand, the tetragonal shear elastic constant C‧ decreases as x increases and correlates reasonably well with the structural energy difference between fcc and bcc structures. Our results offer a consistent starting point for further theoretical and experimental studies of the elastic and micromechanical properties of Au-V and Au-Nb systems.

  13. La dévotion aux âmes du purgatoire à Rio de Janeiro

    OpenAIRE

    Augras, Monique

    2009-01-01

    La dévotion aux âmes du purgatoire est particulièrement vive à Rio de Janeiro. A peu près tolérée par l’Église catholique, elle réunit, chaque lundi, un nombre assez considérable de personnes qui viennent prier, allumer un cierge et déposer diverses offrandes afin de se ménager l’appui des « âmes » pour résoudre les problèmes les plus pressants. A la différence des saints du paradis, dont les vertus les éloignent peut-être du commun des gens, la dévotion aux âmes semble s’appuyer sur une nett...

  14. Le Carnaval de Schignano : un dernier salut aux émigrants

    Directory of Open Access Journals (Sweden)

    Cristina Del Biaggio

    2011-05-01

    Full Text Available Pour arriver à Schignano, il faut passer par una cürva al giazz e una cürva al suu [Un virage dans la glace et un virage au soleil], comme disent les mots en dialecte d’une récente chanson écrite par Davide Van De Sfroos, compositeur-interprète de la région. C’est dans ce petit hameau de la Vallée d’Intelvi, au-dessus du Lac de Côme, que, tous les ans, le carnaval anime le village. Une fête populaire spontanée, sans règles écrites, ni lois, qui survit grâce aux habitants qui l’animent, aux ar...

  15. L’évaluation de la police de proximité aux Pays-Bas

    OpenAIRE

    van der Vijver, Kees; Zoomer, Olga

    2003-01-01

    Cet article se propose de rendre compte des recherches effectuées en matière de police de proximité aux Pays-Bas. Avant d’aborder le problème de l’impact d’une stratégie de police de proximité, il décrit l’organisation du système policier hollandais sans la compréhension duquel il est difficile de suivre les évolutions qui se sont déroulées durant les dernières décennies jusqu’aux réformes en cours aujourd’hui. À partir des recherches déjà effectuées, il examine les résultats des différentes ...

  16. L’orthographe : des systèmes aux usages

    OpenAIRE

    Fayol, Michel; Jaffré, Jean-Pierre

    2016-01-01

    Ce texte propose un éclairage à la fois linguistique et psycholinguistique sur l’orthographe. Au-delà de la spécificité inhérente, par définition, aux deux domaines, il illustre la complémentarité épistémologique qui s’est développée entre eux au cours des dernières décennies. La psycholinguistique a très souvent fait appel aux descriptions linguistiques pour élaborer ses hypothèses de travail et, de son côté, la linguistique s’est inspirée à maintes reprises des observations psycholinguistiq...

  17. L'accès aux collections physiques de la Bpi

    OpenAIRE

    Etesse, Cécile

    2014-01-01

    L'objectif de l’étude est d'analyser l’accès des usagers aux collections physiques de la Bpi. La méthodologierepose sur des entretiens semi-directifs - une quarantaine réalisés auprès d’usagers en situation de recherche dans la bibliothèque, dans les rayons ou aux bureaux d’information et sur un benchmarking auprès d’une dizaine de bibliothèques - portant sur leurs pratiques en matière de supports d’information, signalétique, mise en espace des collections et choix de classification.Les princ...

  18. Systèmes locaux d'alerte précoce et de réponse aux urgences ...

    African Journals Online (AJOL)

    SARAH

    30 janv. 2015 ... initiative which contributes in improving the performance of the early warning system and response to .... types de structures locales demeurent une action qui va ... un appui accru aux organisations non gouvernementales.

  19. Solutions de remplacement à la culture du tabac et aux activités ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Solutions de remplacement à la culture du tabac et aux activités connexes (Inde) ... L'Inde fait toutefois partie du groupe de travail sur les activités de remplacement de la culture du tabac économiquement viables de l'Organisation mondiale de la santé (OMS) et dispose de ... India, Central Asia, Far East Asia, South Asia ...

  20. Gestion de la biodiversité agricole aux fins de la nutrition, de la ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Gestion de la biodiversité agricole aux fins de la nutrition, de la santé, des moyens de subsistance et des systèmes de production durable (Afrique). Les qualités nutritionnelles des aliments provenant des systèmes de production alimentaire de l'Afrique se dégradent, comme l'indiquent la prévalence accrue de carences en ...

  1. Decommissioning of the Nuclear Licensed Facilities at the Fontenay aux Roses CEA Center

    International Nuclear Information System (INIS)

    Jeanjacques, Michel; Piketty, Laurence; Mandard, Lionel; Pedron, Guy; Boissonneau, Jean Francois; Fouquereau, Alain; Pichereau, Eric; Lethuaire, Nathalie; Estivie, David; Binet, Cedric; Meden, Igor

    2008-01-01

    This is a summary of the program for the decommissioning of all the CEA's facilities in Fontenay aux Roses. The particularity of this center is that it is located in a built-up area. Taking into account the particularities of the various buildings and the levels of radioactivity in them, it was possible to devise a coherent, optimized program for the CEA-FAR licensed nuclear facility decommissioning operations

  2. Adaptation aux changements climatiques au Malawi grâce à l ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    28 avr. 2016 ... Depuis 2001, le programme Écosystèmes et santé humaine du CRDI finance au Malawi des recherches centrées sur les liens entre la fertilité des sols, ... L'équipe examine la façon dont la recherche participative peut guider l'élaboration de stratégies d'adaptation aux changements climatiques, dans un ...

  3. Accès aux TIC et leur utilisation en enseignement supérieur en ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Les politiques dans le domaine de l'enseignement supérieur en matière de technologies de l'information et de la communication (TIC) présument qu'un accès accru aux TIC encourage leur utilisation. Une première collecte de données effectuée en 2004 et 2007 fournit une base des plus nécessaires sur laquelle fonder la ...

  4. Renforcement de la capacité d'adaptation aux changements ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Ce projet vise à améliorer les mesures incitatives et les possibilités qui s'offrent aux ménages du sud de la Zambie et du sud-ouest du Zimbabwe pour composer avec les changements climatiques. Pour ce faire, les responsables investiront dans des technologies de production améliorées d'une grande valeur pratique ...

  5. TIC pour un accès équitable aux ressources humaines en sante en ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Ce projet vise à mieux comprendre comment les TIC peuvent faciliter la distribution équitable des ressources humaines en santé en renforçant et consolidant des activités ... Technologies de l'Information et de la Communication (TIC) pour un Accès équitable aux Ressources Humaines en santé qualifiées, motivées et bien ...

  6. Moyens que prennent les collectivités pour faire face aux souvenirs ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Moyens que prennent les collectivités pour faire face aux souvenirs traumatiques - enseignements tirés d'Aceh et du Timor-Leste. La province d'Aceh et l'État maintenant indépendant du Timor-Leste (auparavant le Timor oriental) ont vécu des décennies de conflit et des violations massives des droits de la personne sous la ...

  7. Réduire les risques et les pertes attribuables aux changements ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    22 août 2014 ... Entre-temps, dans les pays plus riches, comme le Japon et les États‑Unis, les bâtiments et l'infrastructure font l'objet de nouvelles conceptions visant à prévenir les conséquences des tremblements de terre. Quelle comparaison feriez‑vous entre les plans d'adaptation aux tremblements de terre et les ...

  8. Communiquer les risques associés au climat aux collectivités ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    13 mai 2015 ... Le Vietnam est particulièrement vulnérable aux changements climatiques et à la hausse du niveau des océans qui en découle, puisqu'une partie importante de sa population vit dans les basses terres des deltas et le long de la côte, des zones à haut risque. En 2011, d'importantes inondations ont ...

  9. Un partenariat pour lutter contre la résistance aux antimicrobiens ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    11 avr. 2018 ... Le CRDI et le Global AMR Innovation Fund du Royaume-Uni, qui sera géré par le Department of Health and Social Care (DHSC) du Royaume-Uni, rentre dans un nouveau partenariat pour une nouvelle initiative dont l'objectif est de réduire les risques émergents que pose la résistance aux antimicrobiens ...

  10. L’évaluation de la police de proximité aux Pays-Bas

    NARCIS (Netherlands)

    van der Vijver, Kees; Zoomer, Olga

    2003-01-01

    Cet article se propose de rendre compte des recherches effectuées en matière de police de proximité aux Pays-Bas. Avant d’aborder le problème de l’impact d’une stratégie de police de proximité, il décrit l’organisation du système policier hollandais sans la compréhension duquel il est difficile de

  11. Original Paper Les risques sanitaires liés aux sources d'eau de ...

    African Journals Online (AJOL)

    L'eau est une ressource naturelle precieuse et essentielle pour de multiples usages, mais sa qualité est confrontée à plusieurs problèmes dont la pollution liées aux actvités anthropiques, d'où la nécessité de contribuer à l'amélioration de la qualité de l'eau de consommation. Ainsi, une étude transversale, descriptive et.

  12. Amélioration de la sécurité alimentaire et nutritionnelle aux ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Les écoles offrent des voies stratégiques et ciblées pour fournir une alimentation nutritive aux enfants et, indirectement, à leurs familles et leurs collectivités. Un projet de recherche d'une durée de trois ans (de 2012 à 2015) a mis au point et à l'essai un modèle de nutrition intégrée en milieu scolaire comprenant du ...

  13. Renforcement des droits fonciers communautaires et réactions aux ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    De telles menaces qui planent sur les droits fonciers et environnementaux des collectivités sont un indice de tensions plus grandes au sein de l'appareil d'État et du système de justice. Dans ce ... Des droits internationaux aux pratiques locales : la réforme constitutionnelle et la participation en Amérique latine. Ce projet ...

  14. La vulnérabilité aux changements climatiques, une expérience ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    21 avr. 2011 ... Madagascar, la quatrième plus grande île au monde, héberge une multitude de formes de vie qu'on ne trouve nulle part ailleurs sur la planète. Dans la plupart des cas, cette biodiversité est extrêmement vulnérable aux changements climatiques, tout comme l'agriculture pluviale, la pêche et la foresterie, ...

  15. Decommissioning of the nuclear licensed facilities at the Fontenay aux Roses CEA center

    International Nuclear Information System (INIS)

    Jeanjacques, Michel; Piketty, Laurence; Letuhaire, Nathalie; Mandard, Lionel; Meden, Igor; Estivie, David; Boissonneau, Jean Francois; Fouquereau, Alain; Pichereau, Eric; Binet, Cedric

    2007-01-01

    Available in abstract form only. Full text of publication follows: The French Atomic Energy Commission (CEA) center at Fontenay aux Roses (CEN-FAR) is the Commission's oldest center is located in the southern suburbs of Paris. It was opened on 26 March 1946 to host the first French nuclear reactor ZOE that went critical on 12 December 1946. The first laboratories were installed in existing buildings on the site. (authors)

  16. Report of transparency and nuclear safety 2007 CEA Fontenay aux Roses

    International Nuclear Information System (INIS)

    2007-01-01

    This report presents the activities of the CEA Center of Fontenay aux roses for the year 2007. After many years of decommissioning and dismantling of nuclear installations, the Center is now devoted (since 2005) to the development of research programmes on biology and biomedical technologies. The actions concerning the safety, the radiation protection, the significant events, the release control and the environmental impacts and the wastes stored on the center are discussed. (A.L.B.)

  17. Des bananes plus nutritives et qui résistent aux maladies | CRDI ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    28 oct. 2010 ... Les petits agriculteurs jouissent de meilleurs revenus et d'une sécurité alimentaire accrue grâce à des variétés de bananes à haut rendement qui résistent aux maladies. Au cours des années 1980 et 1990, avec le soutien du CRDI, la Fundación Hondureña de Investigación Agricola (FHIA) a mis au point ...

  18. 10 Détermination des radionucléides dans le repas. Application aux ...

    African Journals Online (AJOL)

    ASIMANANA

    On réalise du tic au tac à l'Agriculture et un système expert des aides aux culinaires. Le Malgache a un art culinaire. Les étrangers, certes, connaissent seulement quelques plats. Malgaches à commencer par le Romazava et le Ravitoto. Or, on constatera que cette cuisine compte de nombreux plats. 2. Matériel et méthodes.

  19. Impact de la restructuration de la taxe d'accise sur le tabac aux ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Aux Philippines, le taux de tabagisme est élevé et les taxes sur les produits du tabac, peu élevées. La meilleure façon de redresser la situation consiste à adopter des lois qui aug- mentent considérablement les taxes. Une loi restructurant les taxes sur les produits du tabac, qui comporte une forte hausse de la taxe d'accise ...

  20. À la suite de la parution d'un rapport sur les subventions aux ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    7 juin 2016 ... A Senegalese boy standing behind a car tire. Scott Wallace / The World Bank. John Cockburn. La protection sociale par le truchement de transferts en espèces peut-elle aider le Ghana à réduire l'écart grandissant que ses subventions aux carburants ont contribué à créer entre les riches et les pauvres ?

  1. Étude sur l'escalade de la violence faite aux femmes en Amérique ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Étude sur l'escalade de la violence faite aux femmes en Amérique centrale. 21 juin 2016. Ana Carcedo. En Amérique centrale, on assiste à une escalade de la violence faite aux femmes et du nombre de meurtres de femmes (ou femicides). Or, il y a des lacunes sur le plan du signalement. Primo, malgré les efforts déployés ...

  2. Amélioration de l'accès à la justice et aux services essentiels dans ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Plus de la moitié des résidents de Nairobi, au Kenya, occupent des établissements spontanés, ou bidonvilles, dans des conditions difficiles. Leurs logements sont inadéquats et ils ont un accès insuffisant à l'eau potable, aux services d'assainissement, aux services de santé, à l'école et à d'autres services publics essentiels ...

  3. Ne réduisez pas les programmes destinés aux femmes. Intégrez-les ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    27 juil. 2017 ... Au cours des derniers mois, nous avons entendu dire que l'administration Trump a prévu de réduire le financement de plusieurs programmes s'adressant aux femmes, comme le Bureau des affaires mondiales relatives aux femmes du département d'État. Ce n'est pas le seul programme. Une évaluation ...

  4. The aux1 gene of the Ri plasmid is sufficient to confer auxin autotrophy in tobacco BY-2 cells.

    Science.gov (United States)

    Nemoto, Keiichirou; Hara, Masamitsu; Goto, Shingo; Kasai, Kouji; Seki, Hikaru; Suzuki, Masashi; Oka, Atsuhiro; Muranaka, Toshiya; Mano, Yoshihiro

    2009-05-01

    Tobacco (Nicotiana tabacum) Bright Yellow-2 (BY-2) cells are rapidly proliferating meristematic cells that require auxin for culture in vitro. We have established several transgenic BY-2 cell lines that carry the T-DNA of Agrobacterium rhizogenes 15834, which harbors an agropine-type root-inducing (Ri) plasmid. Two of these lines, BYHR-3 and BYHR-7, were used to test the role of auxin in the proliferation of plant cells. The lines grew rapidly in Linsmaier-Skoog (LS) medium lacking auxin and other phytohormones. The TR-DNA, containing the aux1 (tryptophan monooxygenase) and aux2 (indoleacetamide hydrolase) genes, was present in the genomes of both transgenic lines, whereas the TL-DNA, containing the rolA, B, C and D genes, was present in the genome of BYHR-7 but not BYHR-3. Since the introduction of the rolABCD genes alone did not affect the auxin requirement of BY-2 cells, the aux1 and aux2 genes, but not the rolABCD genes, appear to be relevant to the auxin autotrophy of these transgenic lines. Furthermore, the overexpression of aux1 allowed BY-2 cells to grow rapidly in the absence of auxin, suggesting the existence in plant cells of an unidentified gene whose product is functionally equivalent or similar to that of aux2 of the Ri plasmid.

  5. Développement d'immunoessais associés aux électrodes sérigraphiées: des particules superparamagnétiques aux nanobodies

    OpenAIRE

    Patris, Stéphanie

    2014-01-01

    Cette thèse a pour vocation de contribuer au développement de différents immunocapteurs ampérométriques associés aux électrodes sérigraphiées (SPE). Les immunocapteurs sont des dispositifs simples associant un anticorps ou un antigène qui assurent la sélectivité à un transducteur (ici une SPE) ;ce dernier transforme la liaison anticorps/antigène en un signal mesurable (ici ampérométrique).Le travail est divisé en deux volets principaux.Le premier est consacré à la mise en œuvre de différents ...

  6. Développement d'immunoessais associés aux électrodes sérigraphies: des particules superparamagnétiques aux nanobodies

    OpenAIRE

    Patris, Stéphanie

    2014-01-01

    Cette thèse a pour vocation de contribuer au développement de différents immunocapteurs ampérométriques associés aux électrodes sérigraphiées (SPE). Les immunocapteurs sont des dispositifs simples associant un anticorps ou un antigène qui assurent la sélectivité à un transducteur (ici une SPE) ;ce dernier transforme la liaison anticorps/antigène en un signal mesurable (ici ampérométrique). Le travail est divisé en deux volets principaux. Le premier est consacré à la mise en œuvre de dif...

  7. Methodes spectrales paralleles et applications aux simulations de couches de melange compressibles

    OpenAIRE

    Male , Jean-Michel; Fezoui , Loula ,

    1993-01-01

    La resolution des equations de Navier-Stokes en methodes spectrales pour des ecoulements compressibles peut etre assez gourmande en temps de calcul. On etudie donc ici la parallelisation d'un tel algorithme et son implantation sur une machine massivement parallele, la connection-machine CM-2. La methode spectrale s'adapte bien aux exigences du parallelisme massif, mais l'un des outils de base de cette methode, la transformee de Fourier rapide (lorsqu'elle doit etre appliquee sur les deux dime...

  8. Mortalite liee au VIH chez les enfants aux Chu campus et tokoin de ...

    African Journals Online (AJOL)

    Introduction. Le but de ce travail était d'étudier la mortalité liée au VIH chez les enfants séropositifs aux CHU-Campus et Tokoin de Lomé. Patients et méthode. Il s'est agi d'une étude prospective qui s'est déroulée dans les services de pédiatrie des CHU-Campus et Tokoin de Lomé et qui a couvert une période de 6 mois ...

  9. Evaluation of the radiology state at the CEA/Fontenay-aux-Roses and its environment

    International Nuclear Information System (INIS)

    2000-10-01

    Since 1946 the nuclear installations followed one other at the CEA of Fontenay-aux-Roses still their gradual stop the last ten years, except two installations INB34 and INB73, necessary for the wastes management. Today these installations form the subject of a drainage program. The public opinion is regularly informed on this program since 1999. This document presents the stock of the actions realized since this date: the track keeping of the sites activities impacts on the environment and the actions realized since 1999. (A.L.B.)

  10. Conference - Découvrez notre région - Aux bornes de Genève

    CERN Multimedia

    Staff Association

    2016-01-01

      Les premières bornes-frontière sont posées en 1816 aux confins du royaume de Sardaigne, d’autres feront leur apparition dès 1818 du côté du royaume de France. Deux cents ans plus tard, on retrouve toujours ces pierres, témoins de la naissance du canton et patrimoine partagé des communes genevoises, gessiennes et savoisiennes qui font notre région.  

  11. Perception des risques liés aux changements climatiques dans les ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    4 sept. 2014 ... L'équipe du projet Perception du risque et vulnérabilité des milieux humides sur la côte atlantique de l'Amérique du Sud, qui a commencé en 2012, privilégie une démarche de gestion intégrée des zones côtières et s'appuie sur les perceptions que les parties prenantes ont des risques liés aux ...

  12. Fertilisation et sensibilité des cultures de laitue et de tomate aux bioagresseurs

    OpenAIRE

    Julhia, L.; Nicot, Philippe C.

    2014-01-01

    Les producteurs de légumes sont confrontés à de nouveaux défis avec la réduction de l’usage des produits phytosanitaires. Limiter le recours aux moyens de lutte chimique conduit à revisiter les pratiques et à mettre en oeuvre des stratégies globales à moindre risque phytosanitaire. La fertilisation est examinée dans son action sur la santé des plantes et comme levier dans la gestion des bioagresseurs. L’étude porte sur deux cultures légumières majeures en France, en termes de surfaces, la lai...

  13. L’évolution de l’affirmative action aux États-Unis sous la présidence de George W. Bush Evolution of Affirmative Action in the United States during the Presidency of George W. Bush

    Directory of Open Access Journals (Sweden)

    Marie-Christine Pauwels

    2010-03-01

    Full Text Available L’offensive contre l’affirmative action engagée depuis les années 1980 s’est accrue pendant les deux mandats de la présidence Bush, et l’opinion publique s’est radicalisée, percevant désormais de plus en plus fréquemment ces programmes comme une série d’avantages indûment octroyés à un certain nombre de « privilégiés ». Tout programme d’affirmative action doit désormais être étayé par des disparity studies démontrant la réalité de la discrimination, et seules des mesures très ciblées (narrowly tailored sont autorisées pour y remédier. La charge de la preuve a été en quelque sorte inversée. Mais contrairement aux idées reçues, l’affirmative action n’est pas sur le point de disparaître aux États-Unis et malgré son hostilité de principe, le gouvernement Bush n’a pris aucune mesure concrète pour démanteler ces programmes. L’affirmative action connaît aujourd’hui plusieurs transformations majeures, l’évolution la plus marquante étant l’effacement du critère ethno-racial au profit de critères plus neutres et moins idéologiquement polarisants, essentiellement d’ordre géographique et territorial. Dans l’enseignement supérieur par exemple, des procédures d’admission codées ont vu le jour pour favoriser l’accès des minorités ethniques sous-représentées aux campus d’élite, et diverses stratégies de contournement ont été mises en place dans l’adjudication des marchés publics. Ces transformations sont également intéressantes à analyser d’un point de vue transnational, puisque l’on observe une convergence croissante avec le modèle français de discrimination positive, lui aussi fondé sur le camouflage et l’euphémisation de l’identité ethno-raciale et sur une logique de territoire.This article examines the fate of affirmative action in the United States during the eight years of the Bush administration. After a brief reminder of the major landmarks

  14. Pour un accès renouvelé aux collections : Une ethnographie de la BnF-site Richelieu et de ses publics

    OpenAIRE

    Roustan, Mélanie

    2013-01-01

    Dans le contexte de la rénovation en cours du site Richelieu de la Bibliothèque nationale de France, cette ethnographie conduite de février 2012 à mars 2013, à la demande de la BnF, visait à mieux comprendre les logiques d'usages des collections spécialisées (manuscrits, estampes et photographies, cartes et plans, monnaies et médailles, etc.) et d'en anticiper les évolutions dans les années à venir. Les observations et entretiens approfondis permettent de mieux comprendre le rapport des cherc...

  15. Safety Training: Sensibilisation aux gestes et postures de travail

    CERN Multimedia

    Laetitia Laddada

    2004-01-01

    Nous vous proposons un nouveau cours de sécurité lié aux manutentions manuelles (durée 1 jour) : Sensibilisation aux gestes et postures de travail. Si vous êtes amené à manipuler régulièrement des charges lourdes ou volumineuses, cette formation peut vous aider à prévenir les lésions musculaires ou dorsales. A l'issue de cette formation, vous serez capable d'adopter et d'appliquer les principes de base de sécurité physique et d'économie d'efforts dans les manipulations d'objets. Les cours sont pris en charge par la Commission de Sécurité. L'inscription EDH est obligatoire. Pour plus d'information, veuillez consulter les pages Formation & Développement (Groupe Sécurité). Formation & Développement (Groupe Sécurité) FORMATION EN SECURITE SAFETY TRAINING Laetitia Laddada 73811 - 79236 safety.training@cern.ch

  16. Safety Training: Sensibilisation aux gestes et postures de travail

    CERN Multimedia

    Laetitia Laddada

    2004-01-01

    Nous vous proposons un nouveau cours de sécurité lié aux manutentions manuelles (durée 1 jour) : Sensibilisation aux gestes et postures de travail. Si vous êtes amené à manipuler régulièrement des charges lourdes ou volumineuses, cette formation peut vous aider à prévenir les lésions musculaires ou dorsales. A l'issue de cette formation, vous serez capable d'adopter et d'appliquer les principes de base de sécurité physique et d'économie d'efforts dans les manipulations d'objets. Les cours sont pris en charge par la Commission de Sécurité. L'inscription EDH est obligatoire. Pour plus d'information, veuillez consulter les pages Formation & Développement (Groupe Sécurité). Formation & Développement (Groupe Sécurité) FORMATION EN SECURITE SAFETY TRAINING Laetitia Laddada 73811 - 79236 sa...

  17. Safety Training: Sensibilisation aux gestes et postures de travail

    CERN Multimedia

    Laetitia Laddada

    2004-01-01

    >Nous vous proposons un nouveau cours de sécurité lié aux manutentions manuelles (durée 1 jour) : Sensibilisation aux gestes et postures de travail. Si vous êtes amené à manipuler régulièrement des charges lourdes ou volumineuses, cette formation peut vous aider à prévenir les lésions musculaires ou dorsales. A l'issue de cette formation, vous serez capable d'adopter et d'appliquer les principes de base de sécurité physique et d'économie d'efforts dans les manipulations d'objets. Les cours sont pris en charge par la Commission de Sécurité. L'inscription EDH est obligatoire. Pour plus d'information, veuillez consulter les pages Formation & Développement (Groupe Sécurité). Formation & Développement (Groupe Sécurité) FORMATION EN SECURITE SAFETY TRAINING Laetitia Laddada 73811 - 79236 s...

  18. Safety Training: Sensibilisation aux gestes et postures de travail

    CERN Multimedia

    Laetitia Laddada

    2004-01-01

    If you wish to participate in one of the following courses, please discuss with your supervisor and apply electronically directly from the course description pages that can be found on the Web at: http://www.cern.ch/Training/ or fill in an 'application for training' form available from your Divisional Secretariat or from your DTO (Divisional Training Officer). Applications will be accepted in the order of their receipt. Nous vous proposons un nouveau cours de sécurité lié aux manutentions manuelles (durée 1 jour) : Sensibilisation aux gestes et postures de travail. Si vous êtes amené à manipuler régulièrement des charges lourdes ou volumineuses, cette formation peut vous aider à prévenir les lésions musculaires ou dorsales. A l'issue de cette formation, vous serez capable d'adopter et d'appliquer les principes de base de sécurité physique et d'économie d'efforts dans les manipulations...

  19. Systèmes locaux d'alerte précoce et de réponse aux urgences ...

    African Journals Online (AJOL)

    Le régime démocratique laisse souffler le vent qui fait apparaitre aux élus locaux et aux services déconcentrés de l'État un nouvel élan et d'état d'esprit soumis désormais entre les injonctions du DNPGCCA, les attentes des populations vulnérables, à l'empilement des missions d'évaluations sans suite concrètes en termes ...

  20. Amélioration de la capacité d'adaptation sociale et écologique aux ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    ... en plus intenses se multiplient en raison des phénomènes météorologiques extrêmes. ... d'établir des cartes de vulnérabilité aux changements climatiques et de ... intermédiaire et fonctionnaires des administrations locales et régionales.

  1. Localized iron supply triggers lateral root elongation in Arabidopsis by altering the AUX1-mediated auxin distribution.

    Science.gov (United States)

    Giehl, Ricardo F H; Lima, Joni E; von Wirén, Nicolaus

    2012-01-01

    Root system architecture depends on nutrient availability, which shapes primary and lateral root development in a nutrient-specific manner. To better understand how nutrient signals are integrated into root developmental programs, we investigated the morphological response of Arabidopsis thaliana roots to iron (Fe). Relative to a homogeneous supply, localized Fe supply in horizontally separated agar plates doubled lateral root length without having a differential effect on lateral root number. In the Fe uptake-defective mutant iron-regulated transporter1 (irt1), lateral root development was severely repressed, but a requirement for IRT1 could be circumvented by Fe application to shoots, indicating that symplastic Fe triggered the local elongation of lateral roots. The Fe-stimulated emergence of lateral root primordia and root cell elongation depended on the rootward auxin stream and was accompanied by a higher activity of the auxin reporter DR5-β-glucuronidase in lateral root apices. A crucial role of the auxin transporter AUXIN RESISTANT1 (AUX1) in Fe-triggered lateral root elongation was indicated by Fe-responsive AUX1 promoter activities in lateral root apices and by the failure of the aux1-T mutant to elongate lateral roots into Fe-enriched agar patches. We conclude that a local symplastic Fe gradient in lateral roots upregulates AUX1 to accumulate auxin in lateral root apices as a prerequisite for lateral root elongation.

  2. Diplomatie de Léopold II face aux puissances coloniales en Afrique. Contribution à l'histoire diplomatique du Congo

    OpenAIRE

    Baenda Fimbo, Zacharie

    2011-01-01

    Cet article essaie d'analyser les stratégies diplomatiques du roi Léopold II face aux grandes puissances de l'époque lors du partage du continent africains. Ces stratégies lui ont permis de gagner la Congo au centre de l'Afrique. Peer reviewed

  3. Mise en place des préalables aux essais randomisés d'interventions ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Mise en place des préalables aux essais randomisés d'interventions ... fund is to support applied research in areas vital to achieving long-term food security. ... The Science Granting Councils Initiative in sub-Saharan Africa wins Science ...

  4. A. Lacassagne : de l’archive mineure aux Archives d’anthropologie criminelle

    Directory of Open Access Journals (Sweden)

    Philippe Artières

    2005-01-01

    Full Text Available En 1921, le médecin Alexandre Lacassagne offre à la ville de Lyon ses archives et son importante bibliothèque. Depuis son installation au début des années 1880, Lacassagne qui y détient la chaire de médecine légale et de toxicologie, est devenu l’une des figures les plus célèbre de la ville. Il est intervenu à plusieurs reprises dans les affaires municipales et notamment en matière d’hygiène urbaine, il a surtout pris part comme expert aux grandes affaires criminelles ; il a ainsi fait de Lyo...

  5. Safety Training: Ergonomie - Sensibilisation aux gestes et postures de travail

    CERN Multimedia

    Laetitia Laddada

    2004-01-01

    Nous vous proposons un nouveau cours d'ergonomie (durée : 1 jour) Sensibilisation aux gestes et postures de travail. A l'issue de cette formation, vous serez capable d'adopter et d'appliquer les principes de base de sécurité physique et d'économie d'efforts dans les manipulations d'objets. Les cours sont pris en charge par la Commission de Sécurité. L'inscription EDH est obligatoire. Pour plus d'information, veuillez consulter les pages Formation & Développement (Groupe Sécurité). FORMATION EN SECURITE SAFETY TRAINING Laetitia Laddada 73811 - 79236 safety.training@cern.ch

  6. La Relativité restreinte expliquée aux enfants (de 7 à 107 ans)

    OpenAIRE

    Marle , Charles-Michel

    2014-01-01

    Ce texte est la version française de l'article "Relativity, the Special Theory, explained to Children (from 7 to 107 years old)". Il est un peu plus détaillé que la version anglaise: il comporte deux figures de plus et la démonstration détaillée du point le plus délicat.; L'auteur pense qu'il est possible d'expliquer aux enfants de 15 a 16 ans les idées essentielles de la théorie de la Relativité, sans aucun calcul compliqué, en n'utilisant que quelques notions très simples de géométrie affin...

  7. Report on nuclear safety and transparency 2011 - Fontenay-aux-Roses CEA centre

    International Nuclear Information System (INIS)

    2012-06-01

    After a brief presentation of the Fontenay-aux-Roses CEA centre, this report indicates the different safety measures in the different nuclear base installations (INB) of this site (measures related to different risks, to emergency situations, to inspections and audits). It describes measures related to radiation protection: organisation, dosimetry results. It presents the different significant events which occurred in 2011 and were declared to the ASN. It discusses the results of measurements of liquid, gaseous and chemical releases from the installations and their impact on the environment. It addresses the radioactive waste management (measures to limit their volume and to limit their impact on health and on the environment, notably on water and soils, type and quantities of wastes stored in INBs). It presents the different measures and actions related to information transparency

  8. EMC: a new equipment for repackaging the ancient waste from Fontenay-aux-Roses CEA site

    International Nuclear Information System (INIS)

    Ithurbide, A.; Masy, J.C.; Serrano, R.; Blanc, S.

    2017-01-01

    A new equipment called EMC (Equipment for measuring and packaging) is being built on the Fontenay-aux Roses site in the framework of the cleaning-up of this CEA site. Studies on irradiated fuels and on radio-chemical processes were performed till 1995 and a large quantity of radioactive waste were generated and have stayed on the site so far in storage pits. EMC purpose is to prepare high level radioactive waste for their removal towards the Diadem storing facility that is being built on the Marcoule CEA site. EMC will deal with α-emitter contaminated waste and will be able to recover ancient 50 l waste drums from storage pits, to characterize their radioactive content, to open them, to package them in CDD1 drum (each CDD1 drum can contain up to 5 ancient drums), and to load CDD1 drums in transport packing. EMC is expected to operate for 4 years. (A.C.)

  9. Decommissioning works are going on at Fontenay-aux-roses CEA center

    International Nuclear Information System (INIS)

    Anon.

    2003-01-01

    The CEA center of Fontenay-aux-roses is pursuing the dismantling operations of its nuclear installations. In 2003 120 glove boxes of the plutonium chemistry laboratory were disassembled and moved to the Cadarache CEA center. Hot cells from the Castor, Cyrano and Petrus lines are currently undergoing decontamination operations before being dismantled. As for the processing station of liquid effluents, the cutting works of the incinerator of low-level radioactive wastes and of the tanks began in 2003 and are expected to be over by end 2004. The Triton research reactor was decommissioned in 1982 and dismantling works on its hot cell and on its pool began at the end of 2003. (A.C.)

  10. Soins primaires aux adultes ayant une déficience développementale

    Science.gov (United States)

    Sullivan, William F.; Berg, Joseph M.; Bradley, Elspeth; Cheetham, Tom; Denton, Richard; Heng, John; Hennen, Brian; Joyce, David; Kelly, Maureen; Korossy, Marika; Lunsky, Yona; McMillan, Shirley

    2011-01-01

    Résumé Objectif Mettre à jour les lignes directrices canadiennes de 2006 sur les soins primaires aux adultes ayant une déficience développementale (DD) et présenter des recommandations pratiques fondées sur les connaissances actuelles pour traiter des problèmes de santé particuliers chez des adultes ayant une DD. Qualité des preuves Des professionnels de la santé expérimentés participant à un colloque et un groupe de travail subséquent ont discuté et convenu des révisions aux lignes directrices de 2006 en se fondant sur une recherche documentaire exhaustive, la rétroaction obtenue des utilisateurs du guide de pratique et les expériences cliniques personnelles. La plupart des preuves disponibles dans ce domaine viennent de l’opinion d’experts ou de déclarations consensuelles publiées (niveau III). Message principal Les adultes ayant une DD ont des problèmes de santé complexes, dont plusieurs diffèrent de ceux de la population en général. De bons soins primaires permettent d’identifier les problèmes de santé particuliers dont souffrent les adultes ayant une DD pour améliorer leur qualité de vie et leur accès aux soins de santé et prévenir la morbidité et le décès prématuré. Ces lignes directrices résument les problèmes de santé générale, physique, comportementale et mentale des adultes ayant une DD que devraient connaître les professionnels des soins primaires et présentent des recommandations pour le dépistage et la prise en charge en se basant sur les connaissances actuelles que les cliniciens peuvent mettre en pratique. En raison de l’interaction des facteurs biologiques, psychoaffectifs et sociaux qui contribuent à la santé et au bien-être des adultes ayant une DD, ces lignes directrices insistent sur la participation des aidants, l’adaptation des interventions, au besoin, et la consultation auprès de divers professionnels de la santé quand ils sont accessibles. Elles mettent aussi en évidence la

  11. Dreamlands : des parcs d’attractions aux cités du futur

    OpenAIRE

    Didelon, Valéry

    2012-01-01

    Comme l’exposition éponyme qui s’est tenue au Centre Pompidou au printemps et à l’été 2010, le catalogue Dreamlands entend nous éclairer sur ce qu’ont en commun les premières expositions universelles, Disneyland, Las Vegas et Dubaï. L’hypothèse est ainsi posée : depuis la fin du XIXe siècle, le parc d’attractions serait devenu aux yeux des artistes, des architectes et des urbanistes un modèle pour imaginer et construire la ville de demain. Comme le champ de foire avant lui, il est de facto un...

  12. Des furoncles résistants aux antibiotiques: penser à la myiase !!

    Science.gov (United States)

    Ajili, Faida; Abid, Rim; Bousseta, Najeh; Mrabet, Ali; Karoui, Ghazi; Louzir, Bassem; Battikh, Riadh; Othmani, Salah

    2013-01-01

    Les myiases sont des infections parasitaires par des larves de mouches. La localisation cutanée doit être évoquée de retour d'un pays tropical devant une évolution inhabituelle de lésions cutanées. Nous rapportons une observation d'un militaire tunisien, ayant séjourné en République Démocratique du Congo. Il était atteint de myiase cutanée simulatrice d'une furonculose résistante aux antibiotiques. L'intérêt de cette observation est de souligner l'importance d’évoquer la myiase dont le traitement est simple et rapide chez un patient de retour de zone d'endémie. PMID:24106569

  13. Observation spatiale et SIG: des outils pour cartographier les zones sensibles aux mouvements de terrain

    Directory of Open Access Journals (Sweden)

    Jean-Yves SCANVIC

    1994-12-01

    Full Text Available Les niveaux de sensibilité des sols aux mouvements de terrain ont été cartographiés dans différents bassins de risques en Bolivie, en Colombie et à Taïwan, selon une méthodologie développée au BRGM et fondée en partie sur l’extraction visuelle et numérique d’informations contenues dans les données de télédétection spatiale stéréoscopiques et leur gestion-valorisation dans un SIG. Ces cartes font apparaître l’intérêt de l’imagerie Spot pour la gestion du risque naturel.

  14. Marjane Satrapi’s Poulet aux Prunes: fetish, desire, and illusions

    Directory of Open Access Journals (Sweden)

    Stefania Rimini

    2013-07-01

    Full Text Available Il saggio si propone di individuare e descrivere le sfumature erotiche e sentimentali del film Poulet aux prunes di Marjane Satrapi, felice adattamento dell’omonima graphic novel. Il racconto procede per scarti, ellissi, anticipazioni e flasback, dando luogo a una narrazione labirintica dalla singolare trama arabescante. Le sottili dinamiche seduttive messe in campo dal complesso stile di regia di Satrapi-Paronnaud vengono analizzate alla luce delle categorie feticistiche individuate da Massimo Fusillo, che offrono interessanti modelli di interazione fra desiderio e creatività. L’esito di tale indagine consente di ampliare il dibattito relativo al rapporto di scambio e interferenza fra oggetti, pulsioni e sguardi nel cinema contemporaneo.

  15. Modelisation de la diffusion sur les surfaces metalliques: De l'adatome aux processus de croissance

    Science.gov (United States)

    Boisvert, Ghyslain

    Cette these est consacree a l'etude des processus de diffusion en surface dans le but ultime de comprendre, et de modeliser, la croissance d'une couche mince. L'importance de bien mai triser la croissance est primordiale compte tenu de son role dans la miniaturisation des circuits electroniques. Nous etudions ici les surface des metaux nobles et de ceux de la fin de la serie de transition. Dans un premier temps, nous nous interessons a la diffusion d'un simple adatome sur une surface metallique. Nous avons, entre autres, mis en evidence l'apparition d'une correlation entre evenements successifs lorsque la temperature est comparable a la barriere de diffusion, i.e., la diffusion ne peut pas etre associee a une marche aleatoire. Nous proposons un modele phenomenologique simple qui reproduit bien les resultats des simulations. Ces calculs nous ont aussi permis de montrer que la diffusion obeit a la loi de Meyer-Neldel. Cette loi stipule que, pour un processus active, le prefacteur augmente exponentiellement avec la barriere. En plus, ce travail permet de clarifier l'origine physique de cette loi. En comparant les resultats dynamiques aux resultats statiques, on se rend compte que la barriere extraite des calculs dynamiques est essentiellement la meme que celle obtenue par une approche statique, beaucoup plus simple. On peut donc obtenir cette barriere a l'aide de methodes plus precises, i.e., ab initio, comme la theorie de la fonctionnelle de la densite, qui sont aussi malheureusement beaucoup plus lourdes. C'est ce que nous avons fait pour plusieurs systemes metalliques. Nos resultats avec cette derniere approche se comparent tres bien aux resultats experimentaux. Nous nous sommes attardes plus longuement a la surface (111) du platine. Cette surface regorge de particularites interessantes, comme la forme d'equilibre non-hexagonale des i lots et deux sites d'adsorption differents pour l'adatome. De plus, des calculs ab initio precedents n'ont pas reussi a confirmer la

  16. Neutron moderation at very low temperatures (1691); Moderation des neutrons aux tres basses temperatures (1961)

    Energy Technology Data Exchange (ETDEWEB)

    Lacaze, A [Commissariat a l' Energie Atomique, Grenoble (France). Centre d' Etudes Nucleaires

    1961-04-15

    Starting from Harwell experiment carried out inside a low-power reactor, we intended to maintain a liquid hydrogen cell in a channel of the EL3 reactor (at Saclay) whose thermal neutrons flux is 10{sup 14} neutrons/cm{sup 2}/s. We tried to work out a device giving off an important beam of cold neutrons and able to operate in a way as automatic as possible during many consecutive day without a stop. Several circuits have already been achieved at very low temperatures but they brought out volumes and fluxes much lower than those we used this time. The difficulties we have met in carrying out such a device arose on the one hand from the very high energy release to which any kind of experiment is inevitably submitted when placed near the core of the reactor, on the other, hand from the very little room which is available in experimental channels of reactors. In such condition, it is necessary to use a moderator as effective as possible. This study is divided into three parts ; in the first part, we try to determine: a) conditions in which moderation takes place, hence the volume of the cell; b) materials likely to be used at low temperature and in pile; c) cooling system; hence we had to study fluid flow conditions at very low temperatures in very long ducts. The second part is devoted to the description of the device. The third part ventilates the results we have obtained. (author) [French] Partant de l'experience de Harwell faite dans une pile de faible puissance, nous nous sommes propose de maintenir une cellule d'hydrogene liquide dans un canal de la pile EL3 de Saclay dont le flux de neutrons thermiques est de 10{sup 14} neutrons par seconde et par cm{sup 2}. Nous avons cherche a realiser une installation donnant un faisceau de neutrons froids important, et pouvant fonctionner d'une maniere aussi automatique que possible, pendant des periodes de plusieurs jours sans arret. Plusieurs circuits aux tres basses temperatures ont deja ete realises, mais ils ne mettaient

  17. Contribution to the study of several chemical hazards in the Centre d'Etudes Nucleaires of Fontenay-aux-Roses; Contribution a l'etude de quelques nuisances chimiques au centre d'etudes nucleaires de Fontenay-aux-Roses

    Energy Technology Data Exchange (ETDEWEB)

    Megemont, C; Grau, C [Commissariat a l' Energie Atomique, Fontenay-aux-Roses (France). Centre d' Etudes Nucleaires

    1968-10-01

    From the checking of 2750 index cards of hazards, the study relates the distribution of the chemical hazards in the Centre d'Etudes Nucleaires of Fontenay-aux-Roses. Those concerning the greatest number of agents in the Centre are classified according to the categories corresponding to the different conditions of working. Thus, the most important are put forward. Then, the authors rapidly make a review of hazards which may have some special interest because they appear more specific of the nuclear energy or because they are the most frequently noted on the index cards of hazards. The case of the tributylphosphate is studied more precisely. (authors) [French] A partir de l'examen de 2750 fiches de nuisances, l'etude porte sur la repartition des nuisances chimiques au Centre d'Etudes Nucleaires de Fontenay-aux-Roses. Celles qui concernent le plus grand nombre d'agents du Centre sont classees selon les categories correspondant aux differentes conditions de travail. Les plus importantes d'entre elles sont ainsi mises en evidence. | Les auteurs passent ensuite en revue, rapidement, les nuisances qui peuvent presenter un interet particulier soit parce qu'elles semblent plus specifiques de l'Energie Nucleaire, soit parce qu'on les rencontre le plus frequemment sur les fiches de nuisances. Le cas du tributylphosphate est envisage de facon plus detaillee. (auteurs)

  18. Transition démographique, transition alimentaire. II De la logique démographique à la logique alimentaire

    OpenAIRE

    Philippe Collomb

    1989-01-01

    Collomb Philippe. - Demographic transition, transition in nutrition. II. From the logic of population growth to the logic of demand for food. In a world where migrations from poor to rich countries is too limited in scope to reduce social inequalities between peoples, the poor countries, each according to its means, are forced to resort to importing increasingly massive amounts of cereals. The proportion of agricultural producers within the active national population can be used to estimate t...

  19. Former aux TICE : entre compétences techniques et modèles pédagogiques

    Directory of Open Access Journals (Sweden)

    Jacques Béziat

    2012-01-01

    Full Text Available Cette contribution discute des enjeux et des limites d’une formation aux compétences techniques attendues des futurs enseignants d’école primaire. Une formation est certainement nécessaire pour espérer voir des pratiques pédagogiques avec les TICE se développer en classe. Mais ce n’est qu’un des leviers pour leur intégration dans les pratiques scolaires. Une formation aux TICE suppose que l’on mette l’accent sur l’analyse de pratiques. Plus que de former « simplement » à l’usage pédagogique d’outils numériques, il est indispensable de former à la complexité de leurs enjeux intellectuels et pratiques.

  20. Order of 30 March 1988 on licensing of gaseous radioactive effluent releases by the Fontenay-aux-Roses Nuclear Research Centre

    International Nuclear Information System (INIS)

    1988-01-01

    This Decree prescribes the documents and information the Fontenay-aux-Roses Nuclear Research Centre must provide to the Central Service for Protection against Ionizing Radiation (SCPRI) and lays down the permissible effluent release limits for the Centre [fr

  1. Preliminary dismantling for the decommissioning of nuclear licensed facilities at the CEA Centre in Fontenay aux Roses

    International Nuclear Information System (INIS)

    Estivie, D.; Bohar, M.P.; Jeanjacques, M.; Binet, C.

    2008-01-01

    Under the perimeter modification programme for the Nuclear Licensed Facilities (NLFs) of the French Atomic Energy Commission centre at Fontenay aux Roses (CEN-FAR), preliminary dismantling work proved necessary to decommission the buildings outside the nuclear perimeter and create interim storage areas for waste packages. This summary describes the dismantling of Buildings 07, 53 and 91/54, which are the most representative of the preliminary dismantling work. (author)

  2. Recours aux TIC pour résoudre les problèmes d'eau en Ouganda ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Les technologies de l'information et de la communication (TIC) peuvent grandement aider les collectivités à se préparer et à s'adapter aux effets des changements climatiques. Divers projets rendent compte de l'utilité de recourir à de nouvelles technologies (telles que le téléphone mobile) et à des technologies classiques ...

  3. Second meeting of the Atomic and Molecular Data Centre network. Fontenay aux Roses, 23-24 May 1980

    International Nuclear Information System (INIS)

    Katsonis, K.

    1980-11-01

    Summary report of the Second A+M Data Centre Network (DCN) meeting convened by the IAEA Nuclear Data Section at the CEA Laboratory at Fontenay-aux-Roses, France, 23-24 May 1980. The meeting was attended by 20 representatives from centres and groups from six Member States concerned with the coordinated international management of atomic and molecular data pertinent to controlled fusion research and technology

  4. Recours aux TIC pour résoudre les problèmes d'eau en Ouganda ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    15 janv. 2012 ... Les technologies de l'information et de la communication (TIC) peuvent grandement aider les collectivités à se préparer et à s'adapter aux effets des changements climatiques. Divers projets rendent compte de l'utilité de recourir à de nouvelles technologies (telles que le téléphone mobile) et à des ...

  5. Le résumé graphique fournit des conseils aux décideurs en vue de ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Le résumé graphique fournit des conseils aux décideurs en vue de réduire la criminalité et la violence. 04 août 2015. Image. FLACSO. Pourquoi les villes où il existe des conditions d'exclusion sociale similaires présentent-elles des degrés de violence différents ? Des chercheurs soutenus par le CRDI au Costa Rica et au ...

  6. Comparison of VITEK 2 YST Card and API 20C AUX system in identification of non- albicans Candida species

    Directory of Open Access Journals (Sweden)

    Süleyman Durmaz

    2012-03-01

    Full Text Available Objectives: In the present study, it was aimed to compare results obtained by using VITEK 2 YST Card (bioMérieux, France with those obtained by using API 20C AUX (bioMérieux, France for identification of non- albicans Candida species, which was isolated from various clinical samples, at level of species.Materials and methods: Forty-one non-albicans Candida isolates, which were isolated from 28 urine, 10 blood and 3 vaginal swab specimens, and found to be negative by germ tube test, were identified by using VITEK 2 YST Card (bioMérieux, France. In addition, microscopic morphology was assessed in corn-meal Tween 80 agar, while carbohydrate assimilation was assessed by using commercially available API 20C AUX kit (bioMérieux, France.Results: Thirty-four isolates (82.9% were identified as identical species by these 2 systems, while different results were obtained in 7 isolates (17.1%. 5 isolates, identified as Candida glabrata by API 20C AUX system, were identified as Candida tropicalis (n=2, Candida krusei, Candida lipolitica and Candida kefyr by VITEK 2 YST Card. One other isolate, identified as C.tropicalis, was identified as Candida parapsilosis; and additional one isolate, identified as C.parapsilosis, was identified as C.tropicalis.Conclusion: It was concluded that one should be cautious in the identification of C.glabrata, in particular, C.tropicalis and C.parapsilosis, although between VITEK 2 YST Card and API 20C AUX system results was found largely similarity in identification of non-albicans Candida spp.

  7. Approche concertée en matière de lutte contre la violence faite aux ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Un projet antérieur (no 104346) avait permis au North East Network (NEN), en collaboration avec les services de santé et les forces de l'ordre de l'État du Meghalaya, de consigner les points de vue sur la violence faite aux femmes dans ces deux secteurs. En se fondant sur les constatations ayant émané de la recherche, ...

  8. Droits des femmes et accès à l'eau et aux systèmes d ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    L'ONG Women in Cities International (WICI) tente de trouver des moyens de remédier à cette situation en Inde. Cette subvention lui permettra d'utiliser le ... Le CRDI aide l'Inde à s'adapter aux changements climatiques au moyen de données probantes, et en faisant preuve d'innovation. Le CRDI investit dans des solutions ...

  9. Trousse de suivi et d'évaluation destinée aux initiatives d'adaptation ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    En Afrique, bon nombre de pays, de régions et d'organismes se dotent de programmes d'adaptation aux changements climatiques. Pour que ces programmes portent leurs fruits, ils devront régulièrement faire l'objet d'un suivi et d'une évaluation. Cette subvention servira à financer l'intégration d'un volet suivi et évaluation ...

  10. Neutron distribution in the central cell and a peripheral cell of the Fontenay-aux-Roses pile

    International Nuclear Information System (INIS)

    Roullier, F.

    1958-01-01

    The distribution of the neutron density has been determined in the central cell and a peripheral cell of the pile at Fontenay-aux-Roses. This measurement was carried out by the autoradiographic method with manganese detectors. The neutron density distribution in the uranium rod has already been studied. The measurement was completed by the study of the neutron density in the complete cell by means of detectors placed in the uranium and in the heavy water. (author) [fr

  11. Cours Sécurité : Sensibilisation aux gestes et postures de travail

    CERN Multimedia

    DGS Unit

    2010-01-01

    Prochaine session le 21 octobre 2010. 12 places disponibles. Ce cours concerne toutes les personnes appelées à réaliser des manutentions manuelles dans le cadre de leurs activités. Contenu du cours : Théorie - Présentation des objectifs du programme ; - L'accident du travail (définition, coûts) ; - Statistiques CNAM ; - Notion d'anatomie (mécanique humaine) ; - Les différentes pathologies (lumbago, sciatique, hernie discale) ; - Discussion sur les problèmes particuliers rencontrés dans la vie courante. Pratique - Les efforts mécaniques sur la colonne dus aux mauvaises postures ; - Les principes de base de l'utilisation de la mécanique humaine ; - Exercices pratiques d'application (sur objets divers standards) ; - Prises de vues au caméscope des positions de chacun. Pour vous inscrire : https://edh.cern.ch/Document/Personnel/TRN?new=YES&...

  12. Report on transparency and nuclear safety 2015 - Fontenay-aux-Roses CEA centre

    International Nuclear Information System (INIS)

    2016-06-01

    This document proposes, first, a presentation of the Fontenay-aux-Roses CEA centre, of its activities and installations. Then it gives a rather detailed overview of measures related to safety and to radiation protection within these activities and installations. Next, it reports significant events related to safety and to radiation protection which occurred in 2015 and which have been declared to the French nuclear safety authority (ASN). It discusses the results of release measurements (liquid and gaseous effluents, radiological assessment, and chemical assessment for various installations) and the control of the chemical and radiological impact of these gaseous and liquid effluents on the environment. Finally, it addresses the issue of radioactive wastes which are stored in the different nuclear base installations of the Centre. It indicates the different measures aimed at limiting the volume of these warehoused wastes and addresses their impact on health and environment. Nature and quantities of warehoused wastes are specified. Remarks and recommendations of the Health, Safety and Working Conditions Committee (CHSCT) are given

  13. Report on transparency and nuclear safety - Fontenay-aux-Roses CEA centre - 2012

    International Nuclear Information System (INIS)

    2013-01-01

    This report presents the different nuclear base installations (INB) of the Fontenay-aux-Roses CEA centre, gives an overview of measures regarding safety within these installations (organisation, general arrangements, arrangements related to different risks, defence in-depth, management of emergency situations, inspections, audits and second-level controls, arrangements and main events specific to the different installations and buildings, issues related to transports, soil radiological assessment) and measures related to radiation protection (organisation and results). It reports the significant events related to safety and radiation protection which occurred in 2012 and were declared to the ASN, and discusses how the return-on-experience has been used. It reports and comments the results of measurements of radiological and chemical gaseous and liquid effluents, of surveys of the environment. It also evokes important events related to these measurement and survey processes, presents the environmental management approach. The next part addresses the management of radioactive wastes: arrangements aimed at limiting the volume of warehoused wastes, and at limiting their impact on health and on the environment, nature and quantities of warehoused wastes. The different arrangements regarding transparency and information are reviewed (TSN report, newsletter, and so on)

  14. Application of solar chargers to prospection instruments; Application des chargeurs solaires aux appareils de prospection

    Energy Technology Data Exchange (ETDEWEB)

    Caille, G [Commissariat a l' Energie Atomique, Saclay (France).Centre d' Etudes Nucleaires

    1960-07-01

    The use of conventional batteries has certain disadvantages, and for this reason high-voltage batteries have been gradually replaced in all prospection instruments by transistor supply systems, using less cumbersome sources of energy. All the same low voltages are still necessary, and in hot or damp countries the use of these batteries leads to consumptions out of all proportion to the services rendered. This is why the use of solar energy possesses real advantages. After a brief review of the basic ideas on semiconductors, this article describes a selenium solar battery which was developed by the Westinghouse brakes and signals society. (author) [French] L'utilisation de piles classiques presente certains inconvenients. C'est pourquoi, dans tous les appareils de prospection, les piles fournissant des tensions elevees ont ete remplacees au fur et a mesure par des alimentations a base de transistors, utilisant des sources d'energie moins encombrantes. Toutefois, il faut tout de meme avoir des tensions faibles et l'utilisation de ces piles entraine dans les pays chauds ou humides une consommation disproportionnee par rapport aux services rendus. C'est pourquoi l'emploi de l'energie solaire presente de reels avantages. Cet expose decrit, apres un rappel de notion de base sur les semi-conducteurs, une batterie solaire a base de selenium qui a ete realisee par la Societe des freins et signaux Westinghouse. (auteur)

  15. La formation des enseignants aux TIC : allier pédagogie et innovation

    Directory of Open Access Journals (Sweden)

    Marcel Lebrun

    2004-01-01

    Full Text Available Relativement au champ des technologies éducatives, nous souhaitons étayer l’hypothèse suivante : si généralement on attribue le fait d’apprendre aux étudiants, il est aussi vrai que les enseignants apprennent, que les sociétés apprennent. La cohérence et la préoccupation de ces différents niveaux (étudiants, enseignants, institutions autour de la question de l’apprentissage peuvent, selon nous, être considérées comme un guide et comme un signe d’une éducation de qualité. Dans ce cas, les modèles généraux de l’apprentissage et du développement de dispositifs pédagogiques peuvent être interrogés afin d’élaborer de nouveaux usages et de nouvelles méthodes d’enseignement et de formation des enseignants, pour promouvoir l’innovation technologique dans les institutions et pour en valider la qualité.

  16. Activation analysis using {gamma} photons; Analyse par activation aux photons {gamma}

    Energy Technology Data Exchange (ETDEWEB)

    Engelmann, Ch [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

    1967-07-01

    This report summarizes all the data required for using photonuclear reactions in the field of analysis. After a brief review of the elementary properties of nuclear reactions induced by photon irradiation, the main characteristics are given of high energy (E > 20 MeV) Bremsstrahlung sources. The principle of activation analysis based on the use of photons is given. Actual examples of the analytic possibilities are described in detail, in particular in the case of the determination of very small quantities (< 10{sup -6}) of C, N, O and F. The influence of interfering nuclear reactions is discussed. (author) [French] Ce rapport se propose de resumer l'ensemble des connaissances indispensables pour l'utilisation des reactions photonucleaires a des fins analytiques. Apres quelques rappels concernant les proprietes elementaires des reactions nucleaires induites par irradiation dans les photons, les principales caracteristiques des sources de rayonnement de freinage de haute energie (E > 20 MeV)| sont donnees. Le principe de l'analyse par activation aux photons est rappele. Des exemples concrets sur les possibilites analytiques sont developpes, particulierement en ce qui concerne la determination de quantites tres faibles (< 10{sup -6}) de C, N, O et F. L'influence des reactions nucleaires parasites est discutee. (auteur)

  17. Réponse équilibrée aux besoins en eau dans le bassin du Saïss au ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    ACCA

    par les changements climatiques. Ce projet du programme ACCA met l'accent sur l'agriculture, à l'origine de plus de 82 % de la consommation d'eau dans le bassin. Réponse équilibrée aux besoins en eaudans le bassin du Saïss au Maroc. De petits exploitants agricoles du bassin du Saïss font face aux pénuries d'eau ...

  18. Shoot-supplied ammonium targets the root auxin influx carrier AUX1 and inhibits lateral root emergence in Arabidopsis

    KAUST Repository

    Li, Baohai

    2011-03-24

    Deposition of ammonium (NH4 +) from the atmosphere is a substantial environmental problem. While toxicity resulting from root exposure to NH4 + is well studied, little is known about how shoot-supplied ammonium (SSA) affects root growth. In this study, we show that SSA significantly affects lateral root (LR) development. We show that SSA inhibits lateral root primordium (LRP) emergence, but not LRP initiation, resulting in significantly impaired LR number. We show that the inhibition is independent of abscisic acid (ABA) signalling and sucrose uptake in shoots but relates to the auxin response in roots. Expression analyses of an auxin-responsive reporter, DR5:GUS, and direct assays of auxin transport demonstrated that SSA inhibits root acropetal (rootward) auxin transport while not affecting basipetal (shootward) transport or auxin sensitivity of root cells. Mutant analyses indicated that the auxin influx carrier AUX1, but not the auxin efflux carriers PIN-FORMED (PIN)1 or PIN2, is required for this inhibition of LRP emergence and the observed auxin response. We found that AUX1 expression was modulated by SSA in vascular tissues rather than LR cap cells in roots. Taken together, our results suggest that SSA inhibits LRP emergence in Arabidopsis by interfering with AUX1-dependent auxin transport from shoot to root. © 2011 Blackwell Publishing Ltd.

  19. Du devenir de la notion de documentaire à l’ONF : des discours aux formes

    Directory of Open Access Journals (Sweden)

    Caroline Zéau

    2015-05-01

    Full Text Available Résumé La production documentaire fut toujours l’armature du mandat de l’Office national du film du Canada. Pour garantir la légitimité du cinéma auprès des instances publiques, son fondateur John Grierson a pris appui sur l’assise conceptuelle de l’Idée documentaire, une conception programmatique du cinéma qui soumettait celui-ci à la cause publique. Plus que jamais aujourd’hui, l’héritage de John Grierson est invoqué pour caractériser les valeurs associées à la mission de l’ONF, comme en témoignent les documents de communication produits par l’organisme. Plusieurs questions se posent alors : pourquoi la résurgence du lexique griersonien est-elle jugée pertinente aujourd’hui ? Et quelles sont les équivalences présupposées par ce retour aux sources ? Dans cet article, l’auteure se propose d’étudier la place et les valeurs aujourd’hui accordées à la notion de documentaire et aux objets qu’elle recouvre au sein des discours et des formes produits par l’ONF dans le cadre de la mutation technologique qui redéfinit sa mission et ses priorités depuis 2008. Ainsi seront examinées les déclinaisons terminologiques qui s’y rapportent—sur le site ONF.ca et les plans stratégiques 2008-2013 et 2013-2018—parallèlement à l’étude des formes nouvelles de documentaires produites pour les canaux de diffusion numériques qui définissent le champ de l’art interactif. Abstract Documentary production has always been central to the mandate of the National Film Board of Canada (NFB. To ensure the legitimacy of film among public authorities, its founder John Grierson built on the conceptual foundation of the Documentary Idea, a programmatic concept of cinema that places the latter at the service of the public. Today more than ever, the legacy of John Grierson is understood to characterize the values associated with the mission of the NFB, as evidenced by the institution’s communication documents

  20. Application du groupe de renormalisation aux conducteurs organiques quasi-unidimensionnels soumis a un champ magnetique

    Science.gov (United States)

    Hubert, Laurent

    Des conducteurs organiques fortement anisotropes presentent, sous l'effet d'un champ magnetique, une etonnante variete de proprietes physiques tel que: l'effet Shubnikov-de Haas, l'effet de Haas-van-Alphen, l'existence de cascades d'ondes de densite de spin apparentees a l'effet Hall quantique, reentrance vers la phase metallique pouvant provenir d'un 'breakdown' magnetique, et tout recemment la possibilite d'un confinement charge induit par le champ magnetique. A cela s'ajoute les nombreuses caracteristiques deja apparues en variant la pression hydrostatique ou la substitution chimique: separation spin-charge, localisation de la charge, transition spin-Peierls, antiferromagnetisme itinerant ou non, supraconductivite, et l'existence d'une frontiere commune entre les phases supraconductrice et antiferromagnetique. En vue de completer la description theorique du diagramme de phase generalise des conducteurs organiques, nous adaptons et elargissons la methode du groupe de renormalisation quantique (GRQ) au cas ou le champ magnetique est non nul. On sait deja que cette methode permet de resoudre le dilemme tout particulier des composes Q-1D, soit leur capacite de produire des transitions de phase malgre leur forte anisotropie et consequemment de leur faible dimensionalite. Cette methode est deja utilisee pour decrire le diagramme de phase temperature versus pression des sels de Bechgaard, de leurs analogues souffres et mixtes. Le GRQ permet aussi de comprendre comment des systemes anisotropes comme les conducteurs organiques peuvent se comporter comme des liquides de Luttinger a haute temperature et comme des liquides de Fermi ou condenses a basse temperature. Nous montrons que l'introduction d'un champ magnetique dans un regime de saut coherent interchai ne a deux particules n'apporte que de simples corrections aux lois d'echelles dans le canal zero son, alors qu'il introduit un mecanisme de brisure de paire dans le canal Cooper. Dans le regime de saut coherent a une

  1. The treatment of effluents; Ameliorations apportees aux traitements des residus radioactifs

    Energy Technology Data Exchange (ETDEWEB)

    Wormser, G; Rodier, J; Robien, E de; Fernandez, N [Commissariat a l' Energie Atomique, Grenoble (France). Centre d' Etudes Nucleaires

    1964-07-01

    For several years the French Atomic Energy Commission has been studying with interest problems presented by radio-active effluents. Since high activities have not yet received a definite solution we will deal only, in this paper, with the achievements and research concerning low and medium activity effluents. In the field of the achievements, we may mention the various effluent treatment stations which have been built in France; a brief list will be given together with an outline of their main new features. Thus in particular the latest treatment stations put into operation (Grenoble, Fontenay-aux-Roses, Cadarache) will be presented. From all these recent achievements three subjects will be dealt with in more detail. 1 - The workshop for treating with bitumen the sludge obtained after concentration of radionuclides. 2 - The workshop for treating radioactive solid waste by incineration. 3 - A unit for concentrating radio-active liquid effluents by evaporation. In the field of research, several topics have been undertaken, a list will be given. In most cases the research concerns the concentration of radionuclides with a view to a practical and low cost storage, a concentration involving an efficient decontamination of the aqueous liquids in the best possible economic conditions. For improving the treatments leading to the concentration of nuclides, our research has naturally been concerned with perfecting the treatments used in France: coprecipitation and evaporation. In our work we have taken into account in particular two conditions laid down in the French Centres. 1 - A very strict sorting out of the effluents at their source in order to limit in each category the volume of liquid to be dealt with. 2 - The necessity for a very complete decontamination due to the high population density in our country. In the last past we present two original methods for treating liquid effluents. 1 - The use of ion-exchange resins for liquids containing relatively many salts. The

  2. Exposition orale aux nanoparticules de dioxyde de titane (TiO2) : du franchissement de l’épithélium buccal et intestinal au devenir et aux effets dans l’organisme

    OpenAIRE

    Bettini, Sarah

    2014-01-01

    Face à l’utilisation exponentielle des nanomatériaux dans des produits de consommation courante, dont l’alimentation, les conséquences pour l’homme d’une exposition quotidienne aux faibles doses de nanoparticules posent des questions de santé publique. Parmi les différentes voies d’exposition, la voie orale reste la moins documentée, alors que des nanomatériaux sont couramment utilisés comme additifs alimentaires, ou incorporés `a des emballages au contact des aliments, de l’eau, pour b´en´ef...

  3. Canadian Environmental Assessment Act : A comprehensive study report on the partial diversion of the Sault aux Cochons River

    International Nuclear Information System (INIS)

    2002-04-01

    This report presents the results of an environmental assessment of Hydro-Quebec's proposed project to partially divert the waters of the Sault aux Cochons River to the Pipmuacan Reservoir through the Lionnet River. It also includes the results of public consultations conducted by Hydro-Quebec and of those held by the Bureau d'audience publiques sur l'environnement. The main environmental effects were summarized, including the cumulative effects and the effects caused by accidents and malfunctions that may occur. In addition, the terms and conditions of mitigation measures and follow-up programs were described and the significance of any environmental impacts were assessed. This project will increase the inflow of the Pipmuacan Reservoir, the main reservoir of the Bersimis complex on the Betsiamites River. The diverted water will produce more electricity when it is generated in the two power stations at the Bersimis complex than it does it does currently in the three power stations of the Sault aux Cochons River. Following mitigative measures, an average annual discharge of 6.5 m 3 /s will be diverted from the Sault aux Cochons River to the Lionnet River. A minimum flow of 1 m / s is anticipated. The proposal allows for more water to be diverted to the Pipmuacan reservoir to optimize the operation of existing power generating stations. This report outlined the current use of lands and resources for traditional purposes by Aboriginals. It also discussed the effects of natural events such as flooding, waves and climate that may cause damage to the facilities. It was determined that the project is not likely to cause significant effects on the renewable resources of the forest and the fisheries. The Department of Fisheries and Oceans, after having taking into account proposed mitigation measures, has rendered a preliminary conclusion which states that the project is not likely to have significant negative environmental effects. This decision will be reconsidered after

  4. Annual progress report of the Fontenay-aux-Roses Research Group. January 1 to December 31 1977

    International Nuclear Information System (INIS)

    1977 at Fontenay-aux-Roses was dominated by the assembly and starting up of TFR 600, whereas at Grenoble it coincided with a period of full scientific production on Petula and Wega. On TFR 600 a study was made on discharges in the absence of a conducting shell and on plasma purity. Tokamak physics covered the analysis of the mechanism of disruptions and the dynamics of impurities on TFR 400, and the neutral injection (circular periplasmatron). Simultaneously the heating experiments and the diagnostics for TFR 600 were actively prepared, as well as the Torre II project [fr

  5. Etude de l'auto-adaptivité du filtre actif parallèle aux variations de la ...

    African Journals Online (AJOL)

    ﮫـﻋ ﺔﯾﺮﻈﻧ. -ﻚـﻋ. Résumé. Cet article s'intéresse à l'amélioration des performances du filtre actif parallèle pour s'adapter d'une manière automatique aux variations de la charge. Ce filtre est un onduleur de tension à MLI destiné à éliminer les harmoniques de courant générés par un pont redresseur triphasé non commandé ...

  6. Genome-wide analysis of Aux/IAA gene family in Solanaceae species using tomato as a model.

    Science.gov (United States)

    Wu, Jian; Peng, Zhen; Liu, Songyu; He, Yanjun; Cheng, Lin; Kong, Fuling; Wang, Jie; Lu, Gang

    2012-04-01

    Auxin plays key roles in a wide variety of plant activities, including embryo development, leaf formation, phototropism, fruit development and root initiation and development. Auxin/indoleacetic acid (Aux/IAA) genes, encoding short-lived nuclear proteins, are key regulators in the auxin transduction pathway. But how they work is still unknown. In order to conduct a systematic analysis of this gene family in Solanaceae species, a genome-wide search for the homologues of auxin response genes was carried out. Here, 26 and 27 non redundant AUX/IAAs were identified in tomato and potato, respectively. Using tomato as a model, a comprehensive overview of SlIAA gene family is presented, including the gene structures, phylogeny, chromosome locations, conserved motifs and cis-elements in promoter sequences. A phylogenetic tree generated from alignments of the predicted protein sequences of 31 OsIAAs, 29 AtIAAs, 31 ZmIAAs, and 26 SlIAAs revealed that these IAAs were clustered into three major groups and ten subgroups. Among them, seven subgroups were present in both monocot and dicot species, which indicated that the major functional diversification within the IAA family predated the monocot/dicot divergence. In contrast, group C and some other subgroups seemed to be species-specific. Quantitative real-time PCR (qRT-PCR) analysis showed that 19 of the 26 SlIAA genes could be detected in all tomato organs/tissues, however, seven of them were specifically expressed in some of tomato tissues. The transcript abundance of 17 SlIAA genes were increased within a few hours when the seedlings were treated with exogenous IAA. However, those of other six SlIAAs were decreased. The results of stress treatments showed that most SIIAA family genes responded to at least one of the three stress treatments, however, they exhibited diverse expression levels under different abiotic stress conditions in tomato seedlings. SlIAA20, SlIAA21 and SlIAA22 were not significantly influenced by stress

  7. Genome-wide survey of Aux/IAA gene family members in potato (Solanum tuberosum): Identification, expression analysis, and evaluation of their roles in tuber development.

    Science.gov (United States)

    Gao, Junpeng; Cao, Xiaoli; Shi, Shandang; Ma, Yuling; Wang, Kai; Liu, Shengjie; Chen, Dan; Chen, Qin; Ma, Haoli

    2016-03-04

    The Auxin/indole-3-acetic acid (Aux/IAA) genes encode short-lived nuclear proteins that are known to be involved in the primary cellular responses to auxin. To date, systematic analysis of the Aux/IAA genes in potato (Solanum tuberosum) has not been conducted. In this study, a total of 26 potato Aux/IAA genes were identified (designated from StIAA1 to StIAA26), and the distribution of four conserved domains shared by the StIAAs were analyzed based on multiple sequence alignment and a motif-based sequence analysis. A phylogenetic analysis of the Aux/IAA gene families of potato and Arabidopsis was also conducted. In order to assess the roles of StIAA genes in tuber development, the results of RNA-seq studies were reformatted to analyze the expression patterns of StIAA genes, and then verified by quantitative real-time PCR. A large number of StIAA genes (12 genes) were highly expressed in stolon organs and in during the tuber initiation and expansion developmental stages, and most of these genes were responsive to indoleacetic acid treatment. Our results suggested that StIAA genes were involved in the process of tuber development and provided insights into functional roles of potato Aux/IAA genes. Copyright © 2016 Elsevier Inc. All rights reserved.

  8. Neutron distribution in the central cell and a peripheral cell of the Fontenay-aux-Roses pile; Repartition des neutrons dans la cellule centrale et une cellule peripherique de la pile de Fontenay-aux-Roses

    Energy Technology Data Exchange (ETDEWEB)

    Roullier, F [Commissariat a l' Energie Atomique, Fontenay-aux-Roses (France). Centre d' Etudes Nucleaires

    1958-07-01

    The distribution of the neutron density has been determined in the central cell and a peripheral cell of the pile at Fontenay-aux-Roses. This measurement was carried out by the autoradiographic method with manganese detectors. The neutron density distribution in the uranium rod has already been studied. The measurement was completed by the study of the neutron density in the complete cell by means of detectors placed in the uranium and in the heavy water. (author) [French] La repartition de la densite des neutrons a ete determinee dans la cellule centrale et une cellule peripherique de la pile de Fontenay-aux-Roses. Cette mesure a ete effectuee par la methode d'autoradiographie avec des detecteurs de manganese. La repartition de la densite des neutrons dans la barre d'uranium a deja ete etudiee. La mesure a ete completee par l'etude de la densite des neutrons dans la cellule complete a l'aide de detecteurs places dans l'uranium et dans l'eau lourde. (auteur)

  9. Cloning and characterization of an AUX/IAA gene in Populus davidiana x P. alba var. Pyramidalis and the correlation between its time-course expression and the levels of indole-3-acetic in saplings inoculated with Trichoderma

    International Nuclear Information System (INIS)

    Yao, Z.; Baloch, A.M.; Zhai, T.; Jiang, C.; Liu, Z.; Zhang, R.

    2018-01-01

    Poda AUX/IAA gene, encoding an early-stage responsive protein to auxin in Populus davidiana x P. alba var. pyramidalis (Shanxin poplar), was cloned. The length of mRNA transcript of Poda AUX/IAA was 741bp, encoding a 248-amino-acid protein product, Poda AUX/IAA ORF analysis suggested that Poda AUX/IAA contained one conserved domain (pfam02309). Predicted molecular weight of Poda AUX/IAA was found to be 27kDa and its theoretical isoelectric point was determined as 8.21. Poda AUX/IAA was predicted to be a hydrophilic nucleoprotein and its multi-sequence alignment analysis showed that it shares high identity in four conserved domains with eight AUX/IAA proteins in other Populus species and these sequences of Poda AUX/IAA shared highest similarity with Pt-IAA14.1 in P. trichocarpa. In this study, we found that Poda AUX/IAA was expressed in both leaves and roots of Shanxin poplar. Three strains of Trichoderma asperellum were used to inoculate Shanxin poplar saplings. Inoculated saplings were cultured for 72 h. It was then found that IAA levels in both leaves and roots of inoculated saplings gradually increased and time-course expression patterns of PodaAUX/IAA was changed along with IAA levels. Results of Pearson correlation analysis demonstrated a negative correlation between expression levels of Poda AUX/IAA and IAA levels in both leaves and roots of Shanxin poplar saplings when compared with control. Negative correlation in inoculated saplings were less significant, probably as a result of Trichoderma inducing. (author)

  10. Accessibilité aux emplois en France : le rôle de la distance à la ville

    Directory of Open Access Journals (Sweden)

    Mohamed Hilal

    2004-12-01

    Full Text Available L'objet de cet article est de modéliser les niveaux d’accessibilité potentielle aux emplois des communes françaises selon le rôle de la distance à la ville. Pour ce faire, nous présentons, tout d’abord, un modèle d’accessibilité et la méthode mise en œuvre pour calculer de façon systématique, à partir des données du réseau routier, une matrice des plus courts chemins, mesurés en temps, entre les communes françaises. Ensuite, dans la deuxième partie, ces distances sont intégrées dans le modèle d’accessibilité retenu afin de mesurer la disponibilité potentielle aux emplois selon la distance au pôle urbain le plus proche et selon les principales catégories d’espace du zonage en aires urbaines et de son complément rural. Enfin, la mesure d’accessibilité potentielle est comparée à plusieurs mesures d’accessibilité empirique.

  11. Genome-wide survey of Aux/IAA gene family members in potato (Solanum tuberosum): Identification, expression analysis, and evaluation of their roles in tuber development

    International Nuclear Information System (INIS)

    Gao, Junpeng; Cao, Xiaoli; Shi, Shandang; Ma, Yuling; Wang, Kai; Liu, Shengjie; Chen, Dan; Chen, Qin; Ma, Haoli

    2016-01-01

    The Auxin/indole-3-acetic acid (Aux/IAA) genes encode short-lived nuclear proteins that are known to be involved in the primary cellular responses to auxin. To date, systematic analysis of the Aux/IAA genes in potato (Solanum tuberosum) has not been conducted. In this study, a total of 26 potato Aux/IAA genes were identified (designated from StIAA1 to StIAA26), and the distribution of four conserved domains shared by the StIAAs were analyzed based on multiple sequence alignment and a motif-based sequence analysis. A phylogenetic analysis of the Aux/IAA gene families of potato and Arabidopsis was also conducted. In order to assess the roles of StIAA genes in tuber development, the results of RNA-seq studies were reformatted to analyze the expression patterns of StIAA genes, and then verified by quantitative real-time PCR. A large number of StIAA genes (12 genes) were highly expressed in stolon organs and in during the tuber initiation and expansion developmental stages, and most of these genes were responsive to indoleacetic acid treatment. Our results suggested that StIAA genes were involved in the process of tuber development and provided insights into functional roles of potato Aux/IAA genes. - Highlights: • A systematic analysis of the potato AUX/IAA gene family were performed. • StIAA genes were related to auxin perception and signal transduction. • Candidate StIAA genes likely related to tuber initiation and expansion were screened.

  12. Genome-wide survey of Aux/IAA gene family members in potato (Solanum tuberosum): Identification, expression analysis, and evaluation of their roles in tuber development

    Energy Technology Data Exchange (ETDEWEB)

    Gao, Junpeng [State Key Laboratory of Crop Stress Biology for Arid Areas, College of Agronomy, Northwest A& F University, Yangling, Shaanxi 712100 (China); Innovation Experimental College, Northwest A& F University, Yangling, Shaanxi 712100 (China); Cao, Xiaoli; Shi, Shandang [State Key Laboratory of Crop Stress Biology for Arid Areas, College of Agronomy, Northwest A& F University, Yangling, Shaanxi 712100 (China); Ma, Yuling [State Key Laboratory of Crop Stress Biology for Arid Areas, College of Agronomy, Northwest A& F University, Yangling, Shaanxi 712100 (China); Innovation Experimental College, Northwest A& F University, Yangling, Shaanxi 712100 (China); Wang, Kai; Liu, Shengjie [State Key Laboratory of Crop Stress Biology for Arid Areas, College of Agronomy, Northwest A& F University, Yangling, Shaanxi 712100 (China); Chen, Dan [School of Life Sciences and Technology, Xidian University, Xi' an, Shaanxi 710071 (China); Chen, Qin [State Key Laboratory of Crop Stress Biology for Arid Areas, College of Agronomy, Northwest A& F University, Yangling, Shaanxi 712100 (China); Ma, Haoli, E-mail: mahaoli@nwsuaf.edu.cn [State Key Laboratory of Crop Stress Biology for Arid Areas, College of Agronomy, Northwest A& F University, Yangling, Shaanxi 712100 (China)

    2016-03-04

    The Auxin/indole-3-acetic acid (Aux/IAA) genes encode short-lived nuclear proteins that are known to be involved in the primary cellular responses to auxin. To date, systematic analysis of the Aux/IAA genes in potato (Solanum tuberosum) has not been conducted. In this study, a total of 26 potato Aux/IAA genes were identified (designated from StIAA1 to StIAA26), and the distribution of four conserved domains shared by the StIAAs were analyzed based on multiple sequence alignment and a motif-based sequence analysis. A phylogenetic analysis of the Aux/IAA gene families of potato and Arabidopsis was also conducted. In order to assess the roles of StIAA genes in tuber development, the results of RNA-seq studies were reformatted to analyze the expression patterns of StIAA genes, and then verified by quantitative real-time PCR. A large number of StIAA genes (12 genes) were highly expressed in stolon organs and in during the tuber initiation and expansion developmental stages, and most of these genes were responsive to indoleacetic acid treatment. Our results suggested that StIAA genes were involved in the process of tuber development and provided insights into functional roles of potato Aux/IAA genes. - Highlights: • A systematic analysis of the potato AUX/IAA gene family were performed. • StIAA genes were related to auxin perception and signal transduction. • Candidate StIAA genes likely related to tuber initiation and expansion were screened.

  13. Application of the New Decommissioning Regulation to the Nuclear Licensed Facilities (NLF) at Fontenay-aux-Roses's Nuclear Center (CEA)

    International Nuclear Information System (INIS)

    Sauret, Josiane; Piketty, Laurence; Jeanjacques, Michel

    2008-01-01

    This abstract describes the application of the new decommissioning regulation on all Nuclear Licensed Facilities (NLF is to say INB in French) at Fontenay-aux-Roses's Center (CEA/FAR). The decommissioning process has been applied in six buildings which are out of the new nuclear perimeter proposed (buildings no 7, no 40, no 94, no 39, no 52/1 and no 32) and three buildings have been reorganized (no 54, no 91 and no 53 instead of no 40 and no 94) in order to increase the space for temporary nuclear waste disposal and to reduce the internal transports of nuclear waste on the site. The advantages are the safety and radioprotection improvements and a lower operating cost. A global safety file was written in 2002 and 2003 and was sent to the French Nuclear Authority on November 2003. The list of documents required is given in the paragraph I of this paper. The main goals were two ministerial decrees (one decree for each NLF) getting the authorization to modify the NLF perimeter and to carry out cleaning and dismantling activities leading to the whole decommissioning of all NLF. Some specific authorizations were necessary to carry out the dismantling program during the decommissioning procedure. They were delivered by the French Nuclear Safety Authority (FNSA) or with limited delegation by the General Executive Director (GED) on the CEA Fontenay-aux-Roses's Center, called internal authorization. Some partial dismantling or decontamination examples are given below: - evaporator for the radioactive liquid waste treatment station (building no 53): FNSA authorization: phase realised in 2002/2003. - disposal tanks for the radioactive liquid waste treatment station (building no 53) FNSA authorization: phase realised in 2004, - incinerator for the radioactive solid waste treatment station (building no 07): FNSA authorization: operation realised in 2004, - research equipments in the building no. 54 and building no. 91: internal authorization ; realised in 2005, - sample

  14. Slavery and Cinema in Cuba: The Case of Gutierrez Alea's The Last Supper.

    Science.gov (United States)

    West, Dennis

    1979-01-01

    "The Last Supper" deals with slavery and social stratification in late eighteenth century Cuba. In this article, the film is described in artistic and historical terms, and is discussed in relation to the larger body of theory on Latin American slavery. (EB)

  15. "Alea Iacta Est" (a case series report of problem and pathological gambling).

    Science.gov (United States)

    Koić, Elvira; Filaković, Pavo; Djordjević, Veljko; Nadj, Sanea

    2009-09-01

    Gambling or gaming is a common term for a group of various games, activities and behavior that involve wagering money on an event with an uncertain outcome with the primary intent of winning additional money, i.e., a player risks and hopes to get back what he/she had gambled, or to win more. When the player is unable to resist impulses to gamble, and gambling behavior harmfully affects him or the others, then he/she is suffering from the so called "pathological gambling", which is one of six categories of the "Impulse control disorders" in the International Classification of Diseases. Since, at present, there is no standardized program and approach to the problem of gambling in Croatia, and having in mind the arising accessibility and popularity of the "games of chance", the authors are presenting seven cases of problem and pathological gambling and call for broad public discussion on the problem from medical-psychiatric and forensic-point of view. The first patient was treated on an outpatient basis with cognitive-behavioral and family therapy for problem gambling; for the second patient was treated for impulse control disorders; for the third patient gambling was a symptom of psychotic form of depressive disorder; the fourth had primary diagnosis of personality disorder; and the fifth patient was prosecuted for armed robbery and evaluated by a psychiatric expert. The sixth and the seventh patients were women suffering from primary bipolar affective and major depressive disorder, respectively. The authors conclude that, due to the size of the problem and its consequences, the prevention of pathological gambling is very important. The prevention can be carried out primarily through screening at the school level and primary health care services, whereas secondary screening may be conducted through the system of psychiatric care. It is recommended to invest into research, education of a wider population, and development of preventive programs.

  16. The treatment of irradiated uranium fuel. Results obtained while operating the pilot plant at Fontenay-aux-Roses; Le traitement de l'uranium irradie. Resultats d'exploitation de l'usine-pilote de Fontenay-aux-Roses

    Energy Technology Data Exchange (ETDEWEB)

    Regnaut, P; Faugeras, P; Brut, A; Helou, R; Redon, A [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

    1958-07-01

    In this paper the results obtained from four years operation of the pilot plant when using bars of increasing activity, are summarised and compared with the results of parallel studies carried out in the laboratory. As a conclusion to the article, the optimum conditions for the different phases of a process based on solvent extraction are given. (author)Fren. [French] Cette conference resume les resultats obtenus durant quatre annees de fonctionnement de l'Usine-Pilote, avec des barreaux d'activite croissante et les compare aux resultats d'etudes conduites parallelement en laboratoire. En conclusion sont donnees les conditions optima pour les differentes phases d'un procede base sur l'extraction par solvant. (auteur)

  17. Resenha de: Recherches sur les effectifs des armées françaises des Guerres d'Italie aux Guerres de Religion

    Directory of Open Access Journals (Sweden)

    Eurípedes Simões de Paula

    1963-12-01

    Full Text Available LOT, Ferdinand. Recherches sur les effectifs des armées fran-çaises des Guerres d'Italie aux Guerres de Religion. Paris. S. E. V. P. E. N. École Pratique des Hautes Études. VIe Sec-tion. Collection Bibliothèque Générale.

  18. Sabine Dullin. La frontière épaisse: Aux origines des politiques soviétiques (1920-1940

    Directory of Open Access Journals (Sweden)

    Andrea Chandler

    2016-09-01

    Full Text Available Sabine Dullin. La frontière épaisse: Aux origines des politiques soviétiques (1920-1940. En temps & lieux 55. Paris: Éditions de l'École des hautes études en sciences sociales, 2014. 356 pp. Illustrations. Maps. Tables. Bibliography. Index of places. Index of names. Paper.

  19. Droit et accès des femmes à l'eau et aux systèmes d'assainissement ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2 mai 2012 ... Axe de recherche Le projet vise à améliorer les services d'approvisionnement en eau et d'assainissement fournis aux femmes vivant dans les collectivités à faible revenu de New Delhi, de même qu'à favoriser de meilleurs rapports entre les habitants et les administrations locales.

  20. Localized Iron Supply Triggers Lateral Root Elongation in Arabidopsis by Altering the AUX1-Mediated Auxin Distribution[C][W][OA

    Science.gov (United States)

    Giehl, Ricardo F.H.; Lima, Joni E.; von Wirén, Nicolaus

    2012-01-01

    Root system architecture depends on nutrient availability, which shapes primary and lateral root development in a nutrient-specific manner. To better understand how nutrient signals are integrated into root developmental programs, we investigated the morphological response of Arabidopsis thaliana roots to iron (Fe). Relative to a homogeneous supply, localized Fe supply in horizontally separated agar plates doubled lateral root length without having a differential effect on lateral root number. In the Fe uptake-defective mutant iron-regulated transporter1 (irt1), lateral root development was severely repressed, but a requirement for IRT1 could be circumvented by Fe application to shoots, indicating that symplastic Fe triggered the local elongation of lateral roots. The Fe-stimulated emergence of lateral root primordia and root cell elongation depended on the rootward auxin stream and was accompanied by a higher activity of the auxin reporter DR5-β-glucuronidase in lateral root apices. A crucial role of the auxin transporter AUXIN RESISTANT1 (AUX1) in Fe-triggered lateral root elongation was indicated by Fe-responsive AUX1 promoter activities in lateral root apices and by the failure of the aux1-T mutant to elongate lateral roots into Fe-enriched agar patches. We conclude that a local symplastic Fe gradient in lateral roots upregulates AUX1 to accumulate auxin in lateral root apices as a prerequisite for lateral root elongation. PMID:22234997

  1. Self-assembly of bimetallic AuxPd1-x alloy nanoparticles via dewetting of bilayers through the systematic control of temperature, thickness, composition and stacking sequence

    Science.gov (United States)

    Kunwar, Sundar; Pandey, Puran; Sui, Mao; Bastola, Sushil; Lee, Jihoon

    2018-03-01

    Bimetallic alloy nanoparticles (NPs) are attractive materials for various applications with their morphology and elemental composition dependent optical, electronic, magnetic and catalytic properties. This work demonstrates the evolution of AuxPd1-x alloy nanostructures by the solid-state dewetting of sequentially deposited bilayers of Au and Pd on sapphire (0001). Various shape, size and configuration of AuxPd1‑x alloy NPs are fabricated by the systematic control of annealing temperature, deposition thickness, composition as well as stacking sequence. The evolution of alloy nanostructures is attributed to the surface diffusion, interface diffusion between bilayers, surface and interface energy minimization, Volmer-Weber growth model and equilibrium configuration. Depending upon the temperature, the surface morphologies evolve with the formation of pits, grains and voids and gradually develop into isolated semi-spherical alloy NPs by the expansion of voids and agglomeration of Au and Pd adatoms. On the other hand, small isolated to enlarged elongated and over-grown layer-like alloy nanostructures are fabricated due to the coalescence, partial diffusion and inter-diffusion with the increased bilayer thickness. In addition, the composition and stacking sequence of bilayers remarkably affect the final geometry of AuxPd1‑x nanostructures due to the variation in the dewetting process. The optical analysis based on the UV–vis-NIR reflectance spectra reveals the surface morphology dependent plasmonic resonance, scattering, reflection and absorption properties of AuxPd1‑x alloy nanostructures.

  2. Le vocabulaire de la maison privée aux xviie et xviiie siècles

    OpenAIRE

    Hanna, Nelly

    2008-01-01

    Depuis déjà un certain temps, les chercheurs qui travaillent sur l'habitat du Caire utilisent des fonds d'archives de différentes époques. Je signale en particulier les travaux de Jean-Claude Garcin, de Mona Zakariya et de Hazem-al-Sayyed. Le travail d'archives pose des problèmes liés au vocabulaire des éléments architecturaux, celui-ci étant sensiblement différent de celui qu'on utilise aujourd'hui. C'est grâce aux travaux de 'Adbul-Latif Ibrahim que ce domaine a commencé d'être exploité et ...

  3. Etude systématique et écologique de la faune associée aux moules ()

    OpenAIRE

    Fezzani, S.; Zghal, F.; Ben Amor, Z.; El Abed, A.

    2001-01-01

    Ce travail s’intéresse non seulement à la connaissance de la faune associée aux moules notamment : Mytilus galloprovincialis, mais aussi à une étude systématique et écologique de la faune récoltée. Cette étude a été réalisée dans le lac de Bizerte, à la station de mytiliculture de Menzel Jemil. Une partie de ce travail est consacrée à un examen systématique de la faune récoltée et qui nous a permis d’inventorier 6 embranchements dont les annélides qui sont représentés par 10 espèces de Po...

  4. Health physics around a controlled fusion research device: the Tokamak at Fontenay-aux-Roses (T.F.R.)

    International Nuclear Information System (INIS)

    1977-01-01

    The X and neutron dosimetry measurement near the magnetic confinement device for hot plasma, called T.F.R. (Tokamak, Fontenay-aux-Roses) are presented. The biological shielding consists of an ordinary concrete wall 30 cm thick; the dose rate is thus limited at 10 -1 mrem per discharge (corresponding to 10 mrem per day) in the whole area frequented by people during T.F.R. operation. A numerical calculation, taking into account the true geometry and X ray reflexion by the walls and roof, and normalized to the measurements, gives some indications on the electron beam which produces X rays. The photoneutron source (up to 10 10 neutrons per dischage) and the activation of the vacuum vessel result from high energy electrons (>= 10 MeV) supporting a 10 to 1,000 A current [fr

  5. Formation des etats $\\chi_1$ et $\\chi_2$ du charmonium dans l'annihilation $p\\bar{p}$ aux ISR

    OpenAIRE

    Fay , J.

    1986-01-01

    Un des buts de l'expérience R704 est l'étude des états $\\chi_1$ et $\\chi_2$ du charmonium $(c\\bar{c)}$ dans leur annihilation J/$\\psi$ + photon. Ces états sont formés par interaction d'un jet moléculaire d'hydrogène sur un faisceau refroidi d'antiprotons. L'importance du bruit de fond hadronique conduit à ne s'intéresser qu'aux états finaux électromagnétiques. L'appareillage de détection est essentiellement constitué de deux bras symétriques non magnétiques en deux parties. La première s'inté...

  6. Pollution durable des sols par la chlordécone aux Antilles : comment la gérer ?

    OpenAIRE

    Cabidoche, Yves-Marie; Lesueur-Jannoyer, Magali

    2011-01-01

    La chlordécone, insecticide organochloré de synthèse, était utilisée dans les bananeraies antillaises avant 1993. Pourtant, elle contamine encore les ressources en eau, certaines denrées, et des organismes aquatiques. Très tôt, la recherche agronomique s’est mobilisée pour répondre aux questions posées pour la gestion de cette crise : Où sont les sols pollués? Est-ce une pollution durable ? La molécule est peu mobile. Des cartes de risques, fondées sur leur occupation rétrospective en bananer...

  7. Marketers as Innovators: how ethnic marketing revisits ethnicity Marketing ethnique et innovation aux États-Unis

    Directory of Open Access Journals (Sweden)

    Marie-Christine Pauwels

    2009-10-01

    Full Text Available L’innovation aux États-Unis est ici vue sous un angle social et culturel. Il ne s’agit plus d’étudier l’innovation technologique, mais l’innovation en matière de produit. L’article aborde la création de valeur à travers la variable ethnique dans le domaine de la vente, du marketing et de la publicité. Les nouvelles tendances en matière d’ethno-marketing sont analysées, en particulier la manière dont les professionnels utilisent la notion d’ethnicité pour vendre des produits de consommation courante à un marché de consommateurs de plus en plus exigeants, soit en ayant recours à une segmentation de ces consommateurs en micro-marchés toujours plus étroits, soit en privilégiant un marketing multi- ou trans-culturel.

  8. The Politics of Religion in the United States Manifestations politiques de la religion aux États-Unis

    Directory of Open Access Journals (Sweden)

    Josef Braml

    2011-04-01

    Full Text Available Aux États-Unis, les attitudes religieuses ont plus d’influence sur les choix politiques que dans n’importe quelle autre démocratie occidentale. L’engagement religieux/moral de la droite chrétienne polarise les États-Unis, ce qui a des conséquences sur le plan électoral mais aussi sur les choix politiques réels. L’importance de la droite chrétienne dans la coalition électorale du Parti républicain oblige celui-ci à mettre l’accent sur les questions liées à la sécurité nationale, en particulier la lutte anti-terroriste, afin de mieux souder une coalition électorale hétérogène.

  9. Diversification and expression of the PIN, AUX/LAX and ABCB families of putative auxin transporters in Populus

    Directory of Open Access Journals (Sweden)

    Nicola eCarraro

    2012-02-01

    Full Text Available Intercellular transport of the plant hormone auxin is mediated by three families of membrane-bound protein carriers, with the PIN and ABCB families coding primarily for efflux proteins and the AUX/LAX family coding for influx proteins. In the last decade our understanding of gene and protein function for these transporters in Arabidopsis has expanded rapidly but very little is known about their role in woody plant development. Here we present a comprehensive account of all three families in the model woody species Populus, including chromosome distribution, protein structure, quantitative gene expression, and evolutionary relationships. The PIN and AUX/LAX gene families in Populus comprise 16 and 8 members respectively, and show evidence for the retention of paralogs following a relatively recent whole genome duplication. There is also evidence for differential expression across tissues within many gene pairs. The ABCB family is previously undescribed in Populus and includes 20 members, showing a much deeper evolutionary history including both tandem and whole genome duplication as well as probable loss. A striking number of these transporters are expressed in developing Populus stems and we suggest that evolutionary and structural relationships with known auxin transporters in Arabidopsis can point toward candidate genes for further study in Populus. This is especially important for the ABCBs, which is a large family and includes members in Arabidopsis that are able to transport other substrates in addition to auxin. Protein modeling, sequence alignment and expression data all point to ABCB1.1 as a likely auxin transport protein in Populus. Given that basipetal auxin flow through the cambial zone shapes the development of woody stems, it is important that we identify the full complement of proteins involved in this process. This work should lay the foundation for studies targeting specific proteins for functional characterization and in situ

  10. Recours aux médicaments et aux consultations psychologiques chez les Canadiens atteints d'un trouble de l'humeur et/ou d'anxiété

    Directory of Open Access Journals (Sweden)

    Siobhan O'Donnell

    2017-01-01

    Full Text Available Introduction : L'étude décrit le recours aux médicaments sur ordonnance et aux consultations psychologiques au cours des 12 derniers mois chez les Canadiens adultes ayant déclaré avoir reçu un diagnostic de trouble de l'humeur et/ou d'anxiété, les caractéristiques sociodémographiques et cliniques associées à ce recours et les raisons invoquées pour ne pas y recourir. Méthodologie : L'Enquête sur les personnes ayant une maladie chronique au Canada - Composante sur les troubles de l'humeur et d'anxiété de 2014 a été utilisée. L'échantillon de l'étude (n = 2 916 a été divisé en quatre sous-groupes de traitement : (1 prend des médicaments seulement; (2 a reçu des consultations psychologiques seulement; (3 prend des médicaments et a reçu des consultations psychologiques; ou (4 n'a eu recours à aucun de ces deux traitements. Nous avons combiné les trois premiers sous-groupes et effectué des analyses descriptives et de régression logistique multivariée pour comparer ceux qui prenaient des médicaments et/ou avaient reçu des consultations psychologiques par rapport à ceux n'ayant pas eu recours à ces deux traitements. Nous avons pondéré toutes les estimations afin que les données soient représentatives de la population canadienne adulte vivant en logement privé dans l'une des 10 provinces et ayant déclaré avoir reçu un diagnostic de troubles de l'humeur et/ou d'anxiété. Résultats : La majorité (81,8 % des Canadiens adultes ayant déclaré avoir reçu un diagnostic de trouble de l'humeur et/ou d'anxiété ont indiqué prendre des médicaments et/ou avoir reçu des consultations psychologiques (47,6 % prenaient des médicaments seulement, 6,9 % avaient reçu des consultations psychologiques seulement et 27,3 % avaient eu recours aux deux modalités de traitement. Après ajustement des caractéristiques individuelles, le recours aux médicaments et/ou aux consultations psychologiques était significativement

  11. Purification and final concentration of the plutonium obtained by treatment of irradiated uranium at the Fontenay-aux-Roses pilot plant; Purification et concentration finales du plutonium en fin de traitement de l'uranium irradie a l'usine-pilote de Fontenay-aux-Roses

    Energy Technology Data Exchange (ETDEWEB)

    Prevot, I; Corpel, J; Regnaut, P [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

    1958-07-01

    This paper consists of: 1- a recapitulation of the laboratory tests which led to the choice of the method; 2- a description of the latter, with the results obtained at the Fontenay-aux-Roses pilot plant; 3- the analytical methods used for checking and verifying the purity of the plutonium. (author)Fren. [French] Cet expose comprend: 1- le rappel des essais de laboratoire qui ont conduit au choix du procede; 2- la description de ce dernier, avec les resultats obtenus a l'Usine-Pilote de Fontenay-aux-Roses; 3- les methodes analytiques utilisees pour le controle et pour la verification de la purete du plutonium. (auteur)

  12. Arabidopsis SHR and SCR transcription factors and AUX1 auxin influx carrier control the switch between adventitious rooting and xylogenesis in planta and in in vitro cultured thin cell layers.

    Science.gov (United States)

    Della Rovere, F; Fattorini, L; D'Angeli, S; Veloccia, A; Del Duca, S; Cai, G; Falasca, G; Altamura, M M

    2015-03-01

    Adventitious roots (ARs) are essential for vegetative propagation. The Arabidopsis thaliana transcription factors SHORT ROOT (SHR) and SCARECROW (SCR) affect primary/lateral root development, but their involvement in AR formation is uncertain. LAX3 and AUX1 auxin influx carriers contribute to primary/lateral root development. LAX3 expression is regulated by SHR, and LAX3 contributes to AR tip auxin maximum. In contrast, AUX1 involvement in AR development is unknown. Xylogenesis is induced by auxin plus cytokinin as is AR formation, but the genes involved are largely unknown. Stem thin cell layers (TCLs) form ARs and undergo xylogenesis under the same auxin plus cytokinin input. The aim of this research was to investigate SHR, SCR, AUX1 and LAX3 involvement in AR formation and xylogenesis in intact hypocotyls and stem TCLs in arabidopsis. Hypocotyls of scr-1, shr-1, lax3, aux1-21 and lax3/aux1-21 Arabidopsis thaliana null mutant seedlings grown with or without auxin plus cytokinin were examined histologically, as were stem TCLs cultured with auxin plus cytokinin. SCR and AUX1 expression was monitored using pSCR::GFP and AUX1::GUS lines, and LAX3 expression and auxin localization during xylogenesis were monitored by using LAX3::GUS and DR5::GUS lines. AR formation was inhibited in all mutants, except lax3. SCR was expressed in pericycle anticlinally derived AR-forming cells of intact hypocotyls, and in cell clumps forming AR meristemoids of TCLs. The apex was anomalous in shr and scr ARs. In all mutant hypocotyls, the pericycle divided periclinally to produce xylogenesis. Xylary element maturation was favoured by auxin plus cytokinin in shr and aux1-21. Xylogenesis was enhanced in TCLs, and in aux1-21 and shr in particular. AUX1 was expressed before LAX3, i.e. in the early derivatives leading to either ARs or xylogenesis. AR formation and xylogenesis are developmental programmes that are inversely related, but they involve fine-tuning by the same proteins, namely SHR

  13. Du sport aux activités physiques de loisir : des formes culturelles et sociales bigarrées

    Directory of Open Access Journals (Sweden)

    Éric Dugas

    2007-07-01

    Full Text Available L'espace ludique des formes sociales des pratiques physiques accepte maintes variations. Du jeu informel et libre aux activités physiques institutionnelles (les sports, plusieurs catégories de situations motrices, distinctes des unes des autres, jalonnent l'espace des jeux sportifs. Après avoir défini et délimité, dans un premier temps, les contours et la richesse de l'univers des pratiques physiques ludiques, nous essayons, dans un second temps de mettre au jour le type de pratiques qui coïncident le mieux aux aspirations des pratiquants du xxie siècle. On s'aperçoit actuellement que malgré l'hégémonie du sport au sein de l'espace médiatique et économique, il se dessine néanmoins une tendance forte : la prédominance d’activités physiques ludiques de plus en plus autocontrôlées qui laissent l'initiative aux pratiquants et dans lesquelles les institutions sportives ne sont plus totalement ou pas du tout maître du jeu.From sport to leisure physical activities: mixed cultural and social formsThe game space of physical activities' social forms accepts many variations. From informal and free games to institutional physical activities (sports, several motor situation categories, distinct from each other, punctuate the space of physical games. After having specified and delimited the contours and richness of the world of playful physical activities, we will try to bring to light the kind of practices which coincide best with the 21st century's players or sports (women. Currently, we can see that in spite of sport's hegemony within the media and the economic spheres, a strong tendency is becoming apparent: the predominance of more and more self-controlled playful physical activities, which leave the initiative to players and in which governing bodies are not totally or not at all in command any more.Del deporte a las actividades de ocio: una mezcolanza en las formas culturales y socialesEl espacio lúdico de las formas sociales de

  14. X-ray topography of uranium alloys; Topographie aux rayons X d'alliages d'uranium

    Energy Technology Data Exchange (ETDEWEB)

    Le Naour, L [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

    1968-07-01

    A description of the structure of uranium alloys has been made using the data obtained by X-ray diffraction techniques derived from the Berg-Barrette method. In the first.stage the use of a monochromatic beam of X-rays having a very low divergence makes it possible to obtain very reproducible and exact numerical data concerning the grain and sub-grain sizes, and also the distribution of the sizes. It is thereby possible to detect any disorientation greater than 30 seconds of arc.The results obtained have been completed using a variable incidence device which- gives simultaneously an overall picture of a grain and an idea of the importance of internal disorientations; a more rigorous measurement of this latter parameter is then deduced from the Debye-Scherrer diagrams obtained using a fine-focus equipment. Observations are carried out on various one-phase or two phase uranium alloys which are compared successively to technical and to high-purity uranium. It is shown that the use of X-ray topographies, although limited in certain respects, allows a quantitative characterization of the structure. (author) [French] Une description des structures d'alliages d'uranium a ete faite a partir des donnees fournies par des techniques de diffraction de rayons X derivees de la methode de BERG--BARRETT. Dans une premiere etape, l'utilisation d'un faisceau de rayons X monochromatique et de tres faible divergence permet d'obtenir des donnees numeriques precises et tres reproductibles, relatives aux dimensions des grains, des sous-grains et a la distribution de ces grandeurs. Toute desorientation superieure a 30 secondes d'arc peut ainsi etre decelee. Les resultats obtenus ont ete completes en utilisant un montage a incidence variable, qui fournit simultanement l'image globale d'un grain et l'ordre de grandeur des desorientations internes; une mesure plus rigoureuse de ce dernier parametre se deduit ensuite de diagrammes DEBYE SHERRER realises avec un montage a foyer fin. Des

  15. Mécanismes d’activation et interactions fonctionnelles hétérologues des récepteurs aux chimiokines

    OpenAIRE

    de Poorter, Cédric

    2012-01-01

    Mécanismes d’activation et conséquences fonctionnelles de la dimérisation des récepteurs aux chimiokinesLes chimiokines sont de petites protéines qui régulent la migration des cellules immunitaires. Elles exercent leur action en se liant à des récepteurs appartenant à la famille des récepteurs couplés aux protéines G (RCPG) dont la fonction est intimement liée à la régulation des cellules immunitaires. Notre laboratoire étudie depuis plusieurs années les relations reliant la structure et la f...

  16. Étude de délimitation aux fins de l'Initiative régionale pour la lutte ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Étude de délimitation aux fins de l'Initiative régionale pour la lutte contre le tabac en Afrique. Financée par le CRDI et la Fondation Bill et Melinda Gates, l'initiative Analyses situationnelles de la lutte antitabac en Afrique (ASTA) a pour objectif de permettre de comprendre les facteurs déterminants du succès de la lutte ...

  17. ÉTUDE DE CAS – Côte d'Ivoire : De la forêt aux champs en Côte d ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    11 janv. 2011 ... Aujourd'hui, Buyo fait partie de la « nouvelle ceinture du café et du cacao » de la Côte d'Ivoire et est devenu un pôle d'attraction pour les immigrants. La plupart y viennent en quête de terres où s'adonner aux cultures marchandes. Certains trouvent du travail dans lesexploitations forestières ou dans les ...

  18. Flora Tristan: De la nécessité de faire bon accueil aux femmes étrangères

    Directory of Open Access Journals (Sweden)

    Martine Reid

    2014-10-01

    Full Text Available Dans son traité De la nécessité de faire bon accueil aux femmes étrangères (1835, Flora Tristan (1803-1844, l’écrivaine française qui adopte l’état psychologique d’une étrangère dans son propre pays, traite de la situation des femmes “étrangères” qui voyagent seules en France et/ou commencent une nouvelle vie dans le pays, en particulier à Paris. Politiquement engagée auprès des plus défavorisés à partir du socialisme, Tristan propose la création d’une association pour ces femmes. En assimilant les deux groupes d'"étrangères” (nationales et non nationales, car elle pense que le même type d’accueil doit être fourni à toutes, Tristan préconise l’aide à la voisine nécessiteuse, voisine qui est à la fois un sujet national ou un sujet en transit, une femme sans-papiers ou une réfugiée.

  19. De Cultura aux MOOCs de communication interculturelle : quelles opportunités pour l’apprentissage interculturel à distance?

    Directory of Open Access Journals (Sweden)

    Virginie Tremion

    2018-05-01

    Full Text Available L’objectif de cet article est d’identifier des dimensions de la formation à distance qui pourraient influencer le développement de rencontres interculturelles ‘renouvelées’, et de discuter des stratégies à soutenir sur un plan éducatif. Les auteurs convoquent les résultats d’une étude centrée sur le rôle de la communication en ligne dans la rencontre de l’autre dans le modèle pédagogique Cultura. En guise de contraste, les tensions inhérentes à la rencontre interculturelle sont examinées dans un MOOC de communication interculturelle. Le MOOC, par ses caractéristiques, permet-il aux participants d’approcher l’interculturel de façon dialogique, critique et réflexive –marques d’un interculturel ‘renouvelé’ en éducation ?

  20. Les ecarts de financement en matiere d'adaptation aux changements climatiques - avec la perspective des CPDN

    DEFF Research Database (Denmark)

    Olhoff, Anne; Bee, Skylar; Puig, Daniel

    En 2014, le Programme des Nations Unies pour l’Environnement (PNUE) a publié son premier rapport sur les écarts entre besoins et perspectives en matière d’adaptation (AGR 2014) (PNUE, 2014), lequel a permis de poser un cadre préliminaire pour évaluer ces écarts et d’établir une évaluation...... rapport sur les écarts financiers et les options permettant de les combler. Le rapport sera publié au printemps 2016. Cette mise à jour doit contribuer aux débats lors de la 21ème session de la Conférence des Parties (COP 21) à la Convention-Cadre des Nations Unies sur les Changements Climatiques (CCNUCC...... les besoins de financement présentes dans les composantes adaptation des Contributions Prévues Déterminées au niveau National (CPDN) (INDC) – soit les engagements post 2020 que les pays se proposent mettre en oeuvre dans le cadre d’un nouvel accord mondial sur les changements climatiques....

  1. De la théorie des opérateurs aux fondements de la mécanique quantique

    CERN Document Server

    Rinkel, Jean-Marc

    2016-01-01

    Ce livre est destiné aux étudiants en sciences, mathématiques ou physiques, au niveau master. La formalisation de l’infiniment petit de la mécanique quantique est un miracle d’abstraction, d’étonnement et d’émerveillement. Autant le développement de la physique classique (mécaniques newtonienne, lagrangienne, hamiltonienne et relativités) est lié à celui de la géométrie et du calcul tensoriel, autant l’émergence et le développement de la mécanique quantique sont liés à la théorie des espaces de Hilbert et à la théorie de la mesure. Dès lors qu’une observable (ce qui est accessible à une mesure expérimentale) est représentée par un opérateur sur un espace de Hilbert, les mathématiques se chargent de construire des mesures de probabilité sur le spectre de cet opérateur et ces mesures de probabilités deviennent une réalité physique dans les lois de transition de Born. Cet ouvrage décrit de façon précise le passage des mathématiques que l’on vient d’évoquer, �...

  2. Aux origines de la masse particules élémentaires et symétries fondamentales

    CERN Document Server

    Iliopoulos, Jean

    2014-01-01

    Pourquoi les « particules élémentaires » qui forment toute la matière ont-elles une masse ? Étrange question qui semble être en contradiction avec toute notre intuition physique. Dans ce livre, nous montrons d'abord que la réponse à cette question est tout sauf évidente et ensuite que la clé peut se trouver dans la découverte récente d'une nouvelle particule à l'accélérateur géant LHC (Large Hadron Collider) situé au CERN, près de Genève. Nous proposons au lecteur une promenade guidée qui l'emmènera des confins de l'Univers pendant les premières fractions de seconde après le Big Bang, aux plus petits constituants de la matière tels que nous les apercevons dans nos laboratoires. Notre guide sera un principe profond de symétrie qui, de façon surprenante, semble déterminer la structure du monde.

  3. Annual progress report of the Fontenay-aux-Roses Research Group, January 1 to December 31 1974

    International Nuclear Information System (INIS)

    The salient events of 1974 were the full-time working of TFR at Fontenay-aux-Roses and the building of Petula and Wega at Grenoble. The remounting of TFR after reinforcement of the vacuum chamber was followed by an increase in the small plasma radius by elimination of the copper shell to prolong the present program. In agreement with the Culham laboratory a common program to develop the injection of neutral particles up to the performance needed for the JET has begun. At Grenoble the mounting of Petula was finished and the technological problems of the vacuum chamber (metallic joints for the alumina-metal joints) have been solved. The mounting of Wega was pursued simultaneously with that of Petula within the European context of a collaboration with Garching and the Royal Military School. In the ''Ionized Gas Theory Section'' work was centered on: M.H.D. equilibrium and stability, plasma development in Tokamaks, waves, transport and convection, spectroscopy, micro-instabilities and turbulence. Fundamental physics covers the subjects: EQUATOR, EOS-POP and ODE experiments, HCN laser and atomic collisions. The activity in open configuration concerned the experiment Bille-en-Tete MB [fr

  4. Smart Sensing of the Aux. Feed-water Pump Performance in NPP Severe Accidents Using Advanced GMDH Method

    Energy Technology Data Exchange (ETDEWEB)

    No, Young Gyu; Seong, Poong Hyun [KAIST, Daejeon (Korea, Republic of)

    2016-05-15

    In order to develop and verify the models, a number of data obtained by simulating station black out (SBO) scenario for the optimized power reactor 1000 (OPR1000) using MARS code were used. Most of monitoring systems for component have been suggested by using the directly measured data. However, it is very difficult to acquire data related to safety-critical component' status. Therefore, it is necessary to develop the new method that combines the data-based equipped with learning system and data miming technique. Many data-based modeling methods have been applied successfully to nuclear engineering area, such as signal validation, plant diagnostics and event identification. Also, the data miming is the process of analyzing data from different perspectives and summarizing it into useful information. In this study, the smart sensing technique was developed using advanced group method of data handing (GMDH) model. The original GMDH is an inductive self organizing algebraic model. The advanced GMDH model is equipped with a fuzzy concept. The proposed advanced GMDH model enhances the original GMDH model by reducing the effect of outliers and noise. The advanced GMDH uses different weightings according to their importance which is specified by the fuzzy membership grade. The developed model was verified using SBO accident simulation data for the OPR1000 nuclear power plant acquired with MARS code. Also, the advanced GMDH model was trained using the simulated development data and verified with simulated test data. The development and test data sets were independent. The simulation results show that the performance of the developed advanced GMDH model was very satisfactory, as shown in Table 1. Therefore, if the developed model can be optimized using diverse and specific data, it will be possible to predict the performance of Aux. feed water pump accurately.

  5. Les stratégies des investisseurs : des bords de ville aux bords de mer

    Directory of Open Access Journals (Sweden)

    Sophie Cueille

    2004-03-01

    Full Text Available L’architecture de la villégiature a un prix. Construire des villes nouvelles, qu’elles soient balnéaires, thermales ou périurbaines, induit la mise en place de réseaux ferroviaires et viaires, d’édifices dévolus à la détente, les soins ou les jeux, d’hôtels et de maisons. Quels sont les investisseurs qui engagent d’importants financements en ces lieux ? Personnages de la vie politique, industrielle et bancaire, le plus souvent parisiens, tous se saisissent des besoins de la nouvelle société bourgeoise montante, consommatrice de loisirs dès le milieu du XIXe siècle. Si certains projets peuvent être initialement teintés d’une certaine forme de philanthropie, toutes les opérations deviennent très vite de véritables entreprises lucratives. Sociétés civiles en tous genres, concessions et affermages, les formules d’investissement s’adaptent au produit où souvent se mêlent intérêts publics et privés. La réussite de tels projets suscite également le financement de campagnes publicitaires importantes : journaux, affiches et guides sont publiés pour faire accourir la clientèle visée et ainsi rapporter aux investisseurs les profits escomptés.

  6. ETUDES ANALYTIQUES : Détection des OGM : du libre choix des consommateurs aux études de biovigilance

    Directory of Open Access Journals (Sweden)

    Bertheau Yves

    2000-07-01

    Full Text Available Les récentes affaires de semences conventionnelles de colza et de maïs contaminées par des traces d’OGM ont à nouveau, s’il en était besoin, rappelé à notre bon souvenir les besoins en méthodes de détection et d’identification des OGM fiables et sensibles. Les développements se poursuivent, certes bien plus lentement qu’initialement espéré du fait du nombre important de facteurs à maîtriser et du caractère relativement inédit de ce travail. Concernant des matrices alimentaires variées, cette détection se heurte au manque de recul dans plusieurs domaines tels que celui de l’extraction et la purification d’acides nucléiques en quantité et en qualité. Bien que développées pour satisfaire aux besoins réglementaires européens concernant l’alimentation humaine, ces méthodes devraient être aisément applicables dans d’autres domaines concernés par les OGM (étude des transferts de gènes par flux pollinique, éventuels transferts horizontaux, suivi des acides nucléiques lors de l’ingestion.... Au-delà des OGM, les méthodes mises en œuvre devraient présenter un intérêt dans d’autres domaines comme la microbiologie, l’épidémiologie ou l’authentification des composants biologiques d’un produit.

  7. Aux Débuts de la syntaxe structural: Tesnière et la construction d’une syntaxe

    Directory of Open Access Journals (Sweden)

    Pierre Swiggers

    1994-12-01

    Full Text Available “…il est parfaitement possible de constituer une syntaxe sur des données purement syntaxiques et en dehors de toute morphologie. Certes, le système proposé (... est loin d'être parfait. Mais on ne saurait le taxer d'arbitraire, prétendre qu'il dépasse la réalité des données, et n'y voir qu'une vue personnelle et subjective de son auteur (... Pour être plus abstraits et plus difficiles à saisir que Jes faits morphologiques, Jes faits syntaxiques n'en ont pas moins une réalité objective. Et ceux qui voudront Jes étudier pour édifier la syntaxe qui nous manque encore peuvent être en tout cas assurés de construire sur un terrain solide" (Lucien Tesniere, "Comment construire une syntaxe''., p. 229. Le projet tesniérien d'une syntaxe structurale - aboutissant aux Élements de syntaxe structurale (1959, deuxieme ed. 1966, ouvrage posthume - a sa propre histoire. Une histoire qui la rattache d'ailleurs à un courant de pensee international, qui se manifeste dans l'reuvre de Bally,2 Jespersen,3 Sapir,4 Brunot,5 Brøndal 6 et Hjelmslev,7 et qui s'articule autour de la problématique des classes de mots. En fait, ce courant de pensée se présente en premier lieu comme une critique du système des parties du discours: celles-ci ne sont guère des composantes du discours, au sens où elles constitueraient les bases constructives du discours, mais elles sont en fait des parties du système de la langue. Il importe done de franchir le pas, à partir d'elles, vers l'organisation de la phrase.

  8. Le projet Petits Films : du retour aux participants à la valorisation des données

    Directory of Open Access Journals (Sweden)

    Piccoli Vanessa

    2015-01-01

    Full Text Available En 2014, au sein du laboratoire ICAR (équipe InSitu / Cellule Corpus Complexe un projet appelé “Petits Films” a été conduit avec une double finalité : confectionner des petits films à partir de trois différents corpus et parallèlement mener une réflexion sur les modalités de réalisation, les finalités et les contraintes de ce type de réalisation. On considère que dans le domaine de l’analyse conversationnelle, dans lequel les chercheurs recourent de plus en plus à des corpus de données vidéo, la réalisation d’un petit film peut représenter non seulement un retour pour les participants, mais aussi un moyen de valorisation du corpus, d’un type d’approche en linguistique et plus largement de l’activité du laboratoire de recherche. Grâce à leur forme agréable et à leur courte durée, les petits films sont conçus pour la diffusion et la valorisation des méthodologies et des recherches, ils sont accessibles pour un large public, même de non-experts. Cependant, il est nécessaire de réfléchir aux questions juridiques et déontologiques que soulève cette opération.

  9. Systems Engineering

    Science.gov (United States)

    1989-05-01

    avec la ddfinitias, pour chaquo variable, d’un typo analogue aux d~clsrations de variables FORTRAN, A savoir - Booldes, tableau do hooldons, logique...scnce d’unc ergonomic suffisante) come une "documentation vivante " et reprisentative do syatiime, portable et as ndcesattaot pas de nathricl sp&ctfigue

  10. Le dévéloppement à l'ombre de la violence: un programme de ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    ebishop

    Une logique similaire s'applique aux facteurs politiques ou de justice. .... Si la discrimination politique ou ethnique a motivé les violences, .... 28 Simonsen 2005 ; Samuels et von Einsiedel 2004 ; Horowitz 1985 ; d'un avis contraire, Lopez-Pintor 2006. ...... confiance dans les institutions, les perceptions de la légitimité, etc.

  11. La désinfection du logement vinaire par le formol gazeux

    Directory of Open Access Journals (Sweden)

    Emile PEYNAUD

    1972-06-01

    Le pouvoir bactéricide du formol gazeux a été largement démontré sur les microorganismes pathogènes. Bien qu'il semble logique d'extra¬ poler ce pouvoir aux diverses espèces de bactéries responsables des maladies du vin, cette confirmation restait à faire.

  12. Comprehensive genome-wide analysis of the Aux/IAA gene family in Eucalyptus: evidence for the role of EgrIAA4 in wood formation.

    Science.gov (United States)

    Yu, Hong; Soler, Marçal; San Clemente, Hélène; Mila, Isabelle; Paiva, Jorge A P; Myburg, Alexander A; Bouzayen, Mondher; Grima-Pettenati, Jacqueline; Cassan-Wang, Hua

    2015-04-01

    Auxin plays a pivotal role in various plant growth and development processes, including vascular differentiation. The modulation of auxin responsiveness through the auxin perception and signaling machinery is believed to be a major regulatory mechanism controlling cambium activity and wood formation. To gain more insights into the roles of key Aux/IAA gene regulators of the auxin response in these processes, we identified and characterized members of the Aux/IAA family in the genome of Eucalyptus grandis, a tree of worldwide economic importance. We found that the gene family in Eucalyptus is slightly smaller than that in Populus and Arabidopsis, but all phylogenetic groups are represented. High-throughput expression profiling of different organs and tissues highlighted several Aux/IAA genes expressed in vascular cambium and/or developing xylem, some showing differential expression in response to developmental (juvenile vs. mature) and/or to environmental (tension stress) cues. Based on the expression profiles, we selected a promising candidate gene, EgrIAA4, for functional characterization. We showed that EgrIAA4 protein is localized in the nucleus and functions as an auxin-responsive repressor. Overexpressing a stabilized version of EgrIAA4 in Arabidopsis dramatically impeded plant growth and fertility and induced auxin-insensitive phenotypes such as inhibition of primary root elongation, lateral root emergence and agravitropism. Interestingly, the lignified secondary walls of the interfascicular fibers appeared very late, whereas those of the xylary fibers were virtually undetectable, suggesting that EgrIAA4 may play crucial roles in fiber development and secondary cell wall deposition. © The Author 2015. Published by Oxford University Press on behalf of Japanese Society of Plant Physiologists. All rights reserved. For permissions, please email: journals.permissions@oup.com.

  13. Un projet de développement forestier au Niger : problèmes d'adaptation des objectifs initiaux aux contraintes de réalisation

    OpenAIRE

    Clément, Jean

    1986-01-01

    Comme tous les pays du Sahel, le Niger est affronté à de graves problèmes de désertification et de déboisement dont les causes sont diverses : sécheresses successives,intensification du paturage provoquée par l'accroissement des troupeaux, consommation accrue de bois de feu... Sur la base d'une population totale de 6 OOO OOO habitants, la consommation de bois de feu peut être estimée à environ 4 OOO OOO m3 qu'il faut comparer aux 3 OOO OOO m3 d'accroissement en volume annuel des peuplements n...

  14. De la production fruitière intégrée à la gestion écologique des vergers aux Antilles

    OpenAIRE

    Lavigne, Claire; Lesueur-Jannoyer, M.; de Lacroix, S.; Chauvet, G.; Lavigne, A.; Dufeal, D.

    2011-01-01

    La forte anthropisation aux Antilles françaises, la pression des monocultures de banane et de canne à sucre, et l'usage immodéré de pesticides, ont abouti à la pollution persistante d'une partie importante des sols de la SAU ainsi que des eaux de rivière et des nappes phréatiques. Si, dans les dix dernières années, la recherche de moyens de lutte biologique contre les insectes a été prioritaire, la lutte contre les adventices continue d'être un problème central pour les arboriculteurs qui ne ...

  15. Cartographie de la vulnérabilité globale d'une population citadine face aux risques naturels: le cas de Manizales

    Directory of Open Access Journals (Sweden)

    Anne-Catherine CHARDON

    1994-12-01

    Full Text Available Cette méthode cartographique sert à évaluer la vulnérabilité de la population d’une grande ville andine (Manizales, Colombie, exposée aux séismes et à de fréquents glissements de terrain. Sept facteurs naturels et huit facteurs socio-économiques, mesurés à l’échelle du quartier, sont intégrés, avec d’autre facteurs géographiques, dans une carte de vulnérabilité globale.

  16. La participation des personnes utilisatrices aux exercices de planification et d'organisation des services de santé mentale au Québec

    Directory of Open Access Journals (Sweden)

    Michèle Clément

    2013-10-01

    Full Text Available Cet article documente la manière dont s'est renouvelé et s'est transformé au fil du temps le projet de faire participer les usagers aux exercices de planification et d'organisation des services de santé mentale au Québec (Canada. Pour ce faire, les auteurs reviennent sur l'ensemble des documents ministériels qui ont traité de cette question et dégage, pour les principaux moment-clés, les principales modalités de participation des usagers.

  17. Le recours aux modeles dans l'enseignement de la biologie au secondaire : Conceptions d'enseignantes et d'enseignants et modes d'utilisation

    Science.gov (United States)

    Varlet, Madeleine

    Le recours aux modeles et a la modelisation est mentionne dans la documentation scientifique comme un moyen de favoriser la mise en oeuvre de pratiques d'enseignement-apprentissage constructivistes pour pallier les difficultes d'apprentissage en sciences. L'etude prealable du rapport des enseignantes et des enseignants aux modeles et a la modelisation est alors pertinente pour comprendre leurs pratiques d'enseignement et identifier des elements dont la prise en compte dans les formations initiale et disciplinaire peut contribuer au developpement d'un enseignement constructiviste des sciences. Plusieurs recherches ont porte sur ces conceptions sans faire de distinction selon les matieres enseignees, telles la physique, la chimie ou la biologie, alors que les modeles ne sont pas forcement utilises ou compris de la meme maniere dans ces differentes disciplines. Notre recherche s'est interessee aux conceptions d'enseignantes et d'enseignants de biologie au secondaire au sujet des modeles scientifiques, de quelques formes de representations de ces modeles ainsi que de leurs modes d'utilisation en classe. Les resultats, que nous avons obtenus au moyen d'une serie d'entrevues semi-dirigees, indiquent que globalement leurs conceptions au sujet des modeles sont compatibles avec celle scientifiquement admise, mais varient quant aux formes de representations des modeles. L'examen de ces conceptions temoigne d'une connaissance limitee des modeles et variable selon la matiere enseignee. Le niveau d'etudes, la formation prealable, l'experience en enseignement et un possible cloisonnement des matieres pourraient expliquer les differentes conceptions identifiees. En outre, des difficultes temporelles, conceptuelles et techniques peuvent freiner leurs tentatives de modelisation avec les eleves. Toutefois, nos resultats accreditent l'hypothese que les conceptions des enseignantes et des enseignants eux-memes au sujet des modeles, de leurs formes de representation et de leur approche

  18. La chasse aux axions

    CERN Multimedia

    Robilliard, Cécile

    2009-01-01

    Since three years, physicists double efforts to catch an hypothetical particle that would not interact - or little - with the matter. Its detection would resolve a lot of problems in the filed of particle physics and cosmology. (4 pages)

  19. Des Connaissances Aux Politiques

    International Development Research Centre (IDRC) Digital Library (Canada)

    Les synergies ont été mises en commun au fur et à mesure des progrès de la recherche. .... Recherche normative (sur le rôle et la performance des institutions .... Système national d'information sur la gestion environnementale connecté à 19 ...... Un fort contrôle centralisé sur l'élaboration des politiques nationales peut ...

  20. Détermination de quelques paramètres hématologiques chez les agriculteurs exposés aux pesticides dans la région de Tlemcen

    OpenAIRE

    SAIDI, Fatima Zohra

    2015-01-01

    Résumé Les pesticides représentent une large gamme de produits utilisés de façon très variable. Les agriculteurs sont aujourd'hui le groupe le plus exposé aux risques de contact avec les pesticides. L'objectif de notre travail consiste à mettre en évidence les altérations hématologiques chez les hommes agriculteurs disposés aux pesticides comparés aux hommes témoins. Un prélèvement sanguin est réalisé afin de déterminer quelques paramètres hématologiques (FNS, numérations cellu...

  1. Du karma aux planètes From the Karma to the Planets: Arakanese Healers and their Heterogeneous Practices

    Directory of Open Access Journals (Sweden)

    Céline Coderey

    2012-10-01

    Full Text Available En Arakan, les conceptions de la maladie et les pratiques thérapeutiques relevant du bouddhisme theravāda, de l’astrologie, du culte des esprits, de la médecine et de bien d’autres domaines forment un ensemble signifiant et hiérarchisé. Ensemble signifiant parce que malades et thérapeutes considèrent ces conceptions et pratiques comme indissociables les unes des autres et devant donc être combinées afin de mener à bien le processus de guérison. Ensemble hiérarchisé car, à l’intérieur de celui-ci, le bouddhisme occupe une place hégémonique au niveau des valeurs. Néanmoins, dans le domaine thérapeutique, son apport est limité. Ce n’est que combinées aux pratiques astrologiques, médicales, etc. que les pratiques bouddhiques peuvent contribuer à la prévention et au soin des maladies. L’attention est ici portée sur la manière dont laquelle cette totalité signifiante et hiérarchisée s’exprime dans les pratiques des thérapeutes. Sur la base d’une étude de cas, l’article montre que souvent les thérapeutes cumulent plusieurs formations et pratiques plus ou moins hétérogènes afin de pouvoir intervenir sur le plus grand nombre possible de facteurs de la maladie : déséquilibre des éléments corporels, mauvais karma, influences planétaires néfastes, agressions par des puissances maléfiques.In Arakan, sickness-related conceptions and therapeutic practices issuing from Theravada Buddhism, astrology, spirits cult and medicine form a meaningful and hierarchical whole. This whole is meaningful because patients and healers consider that it is the combination of various conceptions and various practices which makes sense and which guarantees the succes of the healing treatement. The whole is hierarchical because conceptions and practices are organised into a hierarchy where Buddhism occupies an hegemonic position. Nevertheless, in the healing field its contribution is limited. Only if combined with

  2. Combining histology, stable isotope analysis and ZooMS collagen fingerprinting to investigate the taphonomic history and dietary behaviour of extinct giant tortoises from the Mare aux Songes deposit on Mauritius

    NARCIS (Netherlands)

    van der Sluis, L.G.; Hollund, H.I.; Buckley, M.; de Louw, P.G.B.; Rijsdijk, K.F.; Kars, H.

    2014-01-01

    Taphonomic research of bones can provide additional insight into a site's formation and development, the burial environment and ongoing post-mortem processes. A total of 30 tortoise (Cylindraspis) femur bone samples from the Mare aux Songes site (Mauritius) were studied histologically, assessing

  3. Modelo de auxílio à identificação de trabalho escravo ou degradante utilizando lógica fuzzy

    OpenAIRE

    Silva Filho, Benedito de Lima

    2006-01-01

    Dissertação (mestrado) - Universidade Federal de Santa Catarina, Centro Tecnológico. Programa de Pós-Graduação em Engenharia de Produção Esta dissertação apresenta um modelo de auxílio de decisão na identificação de trabalho escravo ou degradante utilizando lógica fuzzy. O mesmo aumenta a transparência nas identificações das condições de trabalho escravo ou degradante, capacitando os agentes do Ministério do Trabalho e Emprego e os profissionais que atuam na área para uma melhor compreensã...

  4. Le Machine Learning confronté aux contraintes opérationnelles des systèmes de détection

    OpenAIRE

    Beaugnon , Anaël; Husson , Antoine

    2017-01-01

    International audience; Les systèmes de détection d’intrusion, reposant traditionnellementsur des signatures, n’ont pas échappé à l’attrait récent des techniquesde Machine Learning. Si les résultats présentés dans les articles de rechercheacadémique sont souvent excellents, les experts en sécurité ontcependant encore de nombreuses réticences concernant l’utilisation duMachine Learning dans les systèmes de détection d’intrusion. Ils redoutentgénéralement une inadéquation de ces techniques aux ...

  5. « Women’s Studies » aux Etats-Unis : trente ans de succès et de contestation

    OpenAIRE

    BOXER, Marilyn

    2006-01-01

    Ces trente dernières années, les women’s studies se sont développées aux États-Unis et sont devenues un nouveau domaine du savoir dans l’enseignement supérieur. Entre 1978 et 1995, plus de 10 000 étudiants ont obtenu un diplôme doctoral fondé sur un travail de recherche dans ce domaine. Les women’s studies ont amené de nouvelles questions, de nouveaux concepts, de nouvelles catégories d’analyse et des interprétations révisées de la sagesse conventionnelle à beaucoup – si ce n’est à la plupart...

  6. Des monastères aux funérailles. La construction d’une relation ethnographique avec des chrétiennes de Damas (Syrie

    Directory of Open Access Journals (Sweden)

    Anna Poujeau

    2009-03-01

    Full Text Available Des monastères aux funérailles. La construction d’une relation ethnographique avec des chrétiennes de Damas (Syrie. En juillet 2004, j’ai assisté aux funérailles d’un jeune homme de la famille au sein de laquelle je vivais à Damas. À l’époque, l’intense émotion suscitée par cet événement empêcha que je m’y intéresse de plus près. Ce n’est que deux ans plus tard, en juillet 2006, que j’ai décidé d’enquêter sur l’un des aspects majeurs de la cérémonie : les lamentations funèbres féminines. Lors de ce dernier terrain, les femmes de la famille que j’interrogeais, que j’accompagnais aux funérailles et dont j’enregistrais les chants m’assignèrent alors une place tout à fait particulière. Puisque, moi aussi, « je m’habillais en noir et je venais aux funérailles », je ne pouvais plus être considérée comme une étrangère. Dès lors, elles firent de moi la fille d’une de leur sœur émigrée à Paris et mariée avec un Français. Ce statut me fut par ailleurs confirmé lorsqu’elles m’attribuèrent une place dans leurs plaisanteries entre sœurs, tantes et neveux matrilatéraux.Dans cet article, je souhaite engager une double réflexion : sur la position et l’implication de l’ethnologue sur un terrain où l’émotion est au premier plan, ainsi que sur la façon dont être assignée à une place dans la parenté de ses informateurs donne enfin toute liberté d’action à l’ethnologue sur son terrain.From monasteries to funerals. The construction of ethnographical relations with the Christians of Damascus (Syria. In July 2004, I attended the funeral of a young man from the family with whom I was staying in Damascus. At the time, the intense emotion provoked by that event prevented me from immediately examining it more closely. It was only two years later, in July 2006, that I decided to study one of the main features of the ceremony: the women’s lamentations. During this

  7. Paternité des articles et intérêts concurrents : une analyse des recommandations aux auteurs des journaux traitant de pratique pharmaceutique

    Science.gov (United States)

    Courbon, Ève; Tanguay, Cynthia; Lebel, Denis; Bussières, Jean-François

    2014-01-01

    RÉSUMÉ Contexte : La présence d’auteurs honorifiques et fantômes ainsi que les intérêts concurrents représentent des difficultés bien documentées, liées à la publication d’articles scientifiques. Il existe des lignes directrices encadrant la rédaction et la publication de manuscrits scientifiques, notamment celles de l’International Committee of Medical Journal Editors (ICMJE). Objectifs : L’objectif principal de cette étude descriptive et transversale visait à recenser les instructions portant sur la paternité des articles et les intérêts concurrents provenant des recommandations aux auteurs des journaux traitant de pratique pharmaceutique. L’objectif secondaire visait à déterminer des mesures correctrices pour une paternité des articles plus transparente. Méthode : La recherche a débuté par l’identification des journaux traitant de pratique pharmaceutique. La consultation des instructions aux auteurs des journaux a permis ensuite de recenser les recommandations destinées à éviter les problèmes de paternité des articles et d’intérêts concurrents. Finalement, les membres de l’équipe de recherche se sont consultés afin de définir des mesures correctrices possibles à l’intention des chercheurs. Résultats : Des 232 journaux traitant de pharmacie, 33 ont été définis comme traitant de pratique pharmaceutique. Un total de 24 (73 %) journaux mentionnaient suivre la politique de l’ICMJE, 14 (42 %) demandaient aux auteurs de remplir un formulaire de déclaration d’intérêts concurrents au moment de la soumission de l’article, 17 (52 %) présentaient une définition de la qualité d’auteur et 5 (15 %) demandaient de détailler les contributions de chaque auteur. Une grille de 40 critères a été élaborée pour définir l’attribution du statut d’auteur. Conclusion : Moins de la moitié des journaux demandait aux auteurs de transmettre un formulaire de déclaration des intérêts concurrents au moment de la

  8. Rôles et actions des groupes dominants dans la ville : des outils aux processus historicisés. Introduction

    Directory of Open Access Journals (Sweden)

    Céline Tellier

    2009-05-01

    Full Text Available Fruit d’une journée d’étude organisée en mars 2008 par le programme de recherche ARC « Les élites dans la ville » de l’Université Libre de Bruxelles, ce numéro spécial regroupe une série d’articles qui s’intéressent aux modes opératoires de la « construction » de l’espace urbain par certains groupes sociaux, appelés ici « dominants ». Par « construction », nous n’entendons pas seulement les aspects matériels mais aussi, si pas davantage, les aspects sociaux et symboliques qui sont mis en œuvr...

  9. Accès aux soins des personnes originaires d&8217;Afrique subsaharienne vivant avec une hépatite B chronique

    OpenAIRE

    Vignier, N.; Spira, R. D.; Lert, F.; Pannetier, J.; Ravalihasy, Andrainolo; Gosselin, A.; Lydie, N.; Bouchaud, O.; Desgrées du Loû, Annabel; Grp, Anrs-Parcours

    2017-01-01

    Objectif : L'objectif de cette étude est d'analyser l'accès aux soins des personnes originaires d'Afrique subsaharienne (ASS) vivant avec une hépatite B chronique (HBC) en France. Méthodes : L'enquête ANRS-Parcours est une étude biographique réalisée en 2012-2013 auprès de personnes originaires d'ASS recrutées dans des services de prise en charge de l'HBC en Ile-de-France. Les données ont été recueillies en face-à-face à l'aide d'une grille biographique et d'un questionnaire standardisé. ...

  10. Fédéralisme et droits des LGBT aux États-Unis et au Canada : analyse comparatives des politiques

    Directory of Open Access Journals (Sweden)

    Miriam Smith

    2014-12-01

    Full Text Available L’article examine le militantisme LGBT et les résultats des politiques en matière de droit pénal et du mariage entre personnes de même sexe de 1969 à aujourd’hui, dans le cadre d’une analyse comparée du fédéralisme aux États-Unis et au Canada. Nous soutiendrons que le fédéralisme a grandement façonné les politiques publiques relatives aux droits des LGBT. Dans le régime américain, le potentiel d’expansion du fédéralisme a favorisé les changements graduels de politiques dans les États et, parallèlement, les multiples points de véto créés par le système de séparation des pouvoirs conjugués aux compétences conférés aux États dans d’importants domaines de politiques ont entravé ces changements de politiques. Dans le régime canadien, la centralisation des mécanismes de protection des droits de la personne dans la Charte de même que la dynamique descendante de l’exercice du pouvoir dans le régime parlementaire de type Westminster ont facilité les changements de politiques. Le fédéralisme est souvent perçu comme un obstacle à l’adoption de politiques progressistes. La répartition des pouvoirs entrave l’élaboration de politiques cohérentes et prête le flanc à la prolifération de vétos dont peuvent se prévaloir des groupes influents pour freiner le changement. Les critiques de cette perspective arguent depuis longtemps que, même si le fédéralisme multiplie les points de véto, il présente aussi de nombreuses possibilités d’innovation. Ils font valoir que les groupes ont plus de poids dans les régimes fédéraux puisqu’ils peuvent exercer leur influence à deux paliers de gouvernement plutôt qu’à un. Ainsi, un groupe qui ne réussit pas à se faire entendre à l’un des paliers pourra tenter sa chance au second et pourra même dresser un palier contre l’autre pour atteindre ses objectifs stratégiques.

  11. Decommissioning of the nuclear licensed facilities at the Fontenay aux Roses CEA Center; cleanup of nuclear licensed facility 57 and monitoring of operations and operating feedback

    International Nuclear Information System (INIS)

    Estivie, D.; Bohar, M.P.; Jeanjacques, M.; Binet, C.; Bremond, M.P.; Poyau, C.; Mandard, L.; Boissonneau, J.F.; Fouquereau, A.; Pichereau, E.

    2008-01-01

    This is a summary of the program for the decommissioning of all the CEA Licensed Nuclear Facilities in Fontenay aux Roses. The particularity of this center is now it is located in a built-up area. It is presented like example the operations to clean up the equipment of the Nuclear Licensed Facility 57 (NLF 57). Due to the diversity of the research and development work carried out on the reprocessing of spent fuel in it, this installation is emblematic of many of the technical and organizational issues liable to be encountered in the final closure of nuclear facilities. It was developed a method applied to establish the multi-annual budget, monitor the progress of operations and integrate, as work continues, the operating feedback. (author)

  12. [ALEA study. Treatment of chronic wounds infected by the application of silver dressings nanocrystalline combined with dressings hydrocellular].

    Science.gov (United States)

    Verdú Soriano, José; Nolasco Bonmati, Andreu

    2010-10-01

    This study was conducted with the objective to assess, in real clinical conditions in primary care and geriatric centers, application and utility of nanocrystalline silver dressings dressings combined with hydrocellular in relation to the development during 20 shifts dressing or complete healing of the characteristics of the lesions included in the study Prospective observational multicenter open, repeated measures. It could include injuries of different etiologies (pressure ulcers stage 11-111, lower limb and traumatic wounds or surgical origin), with clinical signs of local infection (at least three of the following: redness, purulent discharge, heat, edema and pain). Only one wound was included per patient. An analysis of effectiveness by intention to treat all lesions included. We recruited 103 patients who met the inclusion criteria but were collected in which 77 patients were used for nanocrystalline silver dressings in some phase of the study, They had a median of 80 years of age and 58.4% were women. By type of injury: 53.2% pressure ulcers, 31.2% lower extremity ulcers and 14.3% traumatic or surgical wounds. Over 50% of the lesions was older than eight months and a larger area of 22.75 cm2. At first, 70.1% had redness, purulent discharge 64.9%, 37.7% heat edema 42.9% and 65.8% pain. Remained in the study a median of 42.5 days at a rate of change of dressing every 2.5. During this time in 96.1% of the lesions were removed for clinical signs of local infection in a statistically significant (p < or = 0.001). 27.3% healed from injuries and those not healed, 92.9% experienced improvement, and its healing curves were statistically significant (p < 0.05). 92.2% of clinicians assessed treatment with these products as good or excellent. The use of the products used in this study consistent with the concept and PLH TIME, has proved useful in this type of injury reducing the clinical signs of infection, promoting granulation tissue and necrotic removing the burden being able to manage the exudate of an optimal healing and getting one out of three masses.

  13. Transcriptome profiling of petal abscission zone and functional analysis of an Aux/IAA family gene RhIAA16 involved in petal shedding in rose

    Directory of Open Access Journals (Sweden)

    Yuerong Gao

    2016-09-01

    Full Text Available Roses are one of the most important cut flowers among ornamental plants. Rose flower longevity is largely dependent on the timing of petal shedding occurrence. To understand the molecular mechanism underlying petal abscission in rose, we performed transcriptome profiling of the petal abscission zone during petal shedding using Illumina technology. We identified a total of 2592 differentially transcribed genes (DTGs during rose petal shedding. Gene ontology term enrichment and pathway analysis revealed that major biochemical pathways the DTGs were involved in included ethylene biosynthesis, starch degradation, superpathway of cytosolic glycolysis, pyruvate dehydrogenase and TCA cycle, photorespiration and the lactose degradation III pathway. This suggests that alterations in carbon metabolism are an important part of rose petal abscission. Among these DTGs, approximately 150 genes putatively encoding transcription factors were identified in rose abscission zone. These included zinc finger, WRKY, ERF, and Aux/IAA gene families, suggesting that petal abscission involves complex transcriptional reprogramming. Approximately 108 DTGs were related to hormone pathways, of which auxin and ethylene related DTGs were the largest groups including 52 and 41 genes, respectively. These also included 12 DTGs related to gibberellin and 6 DTGs in jasmonic acid pathway. Surprisingly, no DTGs involved in the biosynthesis/signaling of abscisic acid, cytokinin, brassinosteroid, and salicylic acid pathways were detected. Moreover, among DTGs related to auxin, we identified an Aux/IAA gene RhIAA16 that was up-regulated in response to petal shedding. Down-regulation of RhIAA16 by virus-induced gene silencing in rose promoted petal abscission, suggesting that RhIAA16 plays an important role in rose petal abscission.

  14. Brittleness and elastic limit of iron-aluminium 40 at high strain rates; Fragilite et limite elastique du fer-aluminium 40 aux grandes vitesses de deformation

    Energy Technology Data Exchange (ETDEWEB)

    Cottu, J P [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

    1967-07-01

    Iron-aluminium 40 - a B2 ordered solid solution - was tensile tested to provide information on the brittleness of this alloy and its dependence on strain rate and temperature. For slow strain rates (0.34 per cent s{sup -1}) cleaved fracture prevails when temperature is kept below 400 deg. C, while a ductile rupture is observed, with an almost 100 per cent necking at higher temperatures. In this case, recrystallization occurs during the deformation. For higher strain rates - 335 per cent s{sup -1}), a ductility reduction - owed to intergranular fracture - precedes the brittle-ductile transition. This property may be bound to the peak on the yield stress temperature curve, which is itself connected to the ordered structure of this alloy. (author) [French] Les essais de traction que nous avons effectues sur le fer-aluminium 40, solution solide ordonnee de type B2, ont pour but de preciser l'influence de la vitesse de deformation et de la temperature sur la fragilite de l'alliage. Pour les faibles vitesses (0,34 pour cent s{sup -1}), la rupture est surtout clivee si la temperature est inferieure a 400 deg. C, puis ductile avec une striction voisine de 100 pour cent aux temperatures superieures; la recristallisation intervient alors ou cours meme de la deformation. Aux vitesses elevees (335 pour cent s{sup -1}) la transition fragile-ductile est precedee d'une chute de ductilite liee a une decohesion intergranulaire. Nous avons associe cette derniere propriete a la presence d'un pic de limite elastique apparaissant a chaud, a vitesse elevee et pouvant etre relie au caractere ordonne de l'alliage. (auteur)

  15. Occurrence des traumatismes alvéolo-dentaires aux cliniques universitaires de Kinshasa: deuxième partie, étude préliminaire de 93 cas

    Science.gov (United States)

    Foche, Adelin Nzudjom; Bushabu, Fidele Nyimi; Mana, Charles Mfutu; Haruna, Ramazani; Masin, Steve Sekele; Nsudila, Monique; Alifi, Paul Bobe; Muinamiyi, Pierre Muyembi; Burley, Jean Paul Sekele Isourady

    2018-01-01

    Introduction L'objectif de cette étude était d'analyser les caractéristiques épidémiologiques cliniques des fractures alvéolo-dentaires aux cliniques universitaires de Kinshasa/RDC. Méthodes Étude transversale de 7 ans, réalisée dans le département d'odontostomatologie, service de stomatologie et de chirurgie maxillo-faciale/cliniques universitaires de Kinshasa de Janvier 2007 à Décembre 2014. Résultats Sur les 93 dossiers colligés, le sexe masculin était prédominant (66,7%) et l'âge le plus prévalent se situait entre 20 ans et 29 ans. Les causes les plus fréquentes ont été les agressions/rixes (52,7%) et la luxation dentaire a été le type des lésions la plus fréquente avec 52,7%. La RX retro-alvéolaire été réalisée dans 75,7%, et le blocage mono-maxillaire fut le type de traitement le plus réalisé (60,2%). Conclusion L'analyse de profil clinique des traumatismes alvéolo-dentaires aux cliniques universitaires de Kinshasa est celui d'un adulte jeune de sexe masculin, présentant des luxations dentaires des maxillaires dont les causes sont les agressions/rixes. PMID:29875931

  16. Extensions de la logique d'équilibre par des concepts modaux

    OpenAIRE

    Su , Ezgi ,

    2015-01-01

    Here-and-there (HT) logic is a three-valued monotonic logic which is intermediate between classical logic and intuitionistic logic. Equilibrium logic is a nonmonotonic formalism whose semantics is given through a minimisation criterion over HT models. It is closely aligned with answer set programming (ASP), which is a relatively new paradigm for declarative programming. To spell it out, equilibrium logic provides a logical foundation for ASP: it captures the answer set semantics of logic prog...

  17. Chapitre 14. Jean-Louis Derouet : Logique industrielle et compromis d’établissements

    OpenAIRE

    Boucher-Petrovic, Nathalie; Combès, Yolande

    2016-01-01

    International audience; En 1989, lorsqu’il publie l’article dont sont tirés les extraits ci-dessous, J.-L. Derouet est professeur de sociologie à l’Institut National de la Recherche Pédagogique (INRP), où il dirige le Groupe d’études sociologiques. Ses recherches portent sur les transformations du système éducatif et il s’intéresse plus particulièrement à l’organisation des établissements d’enseignement, à leur mode de fonctionnement et à qu’il nomme leur statut « d’entreprise composite ». À ...

  18. Logique dynamique pour le raisonnement stratégique dans les jeux extensifs

    NARCIS (Netherlands)

    C. Dégremont (Cédric); J.A. Zvesper (Jonathan)

    2007-01-01

    htmlabstractThis paper continues the dynamic modal logic analysis provided by van Benthem [5] of procedural rationality in games. Specifically we look at extensive games, and use preference logic to provide a closer analysis of backward induction type algorithms. This results in distinguishing two

  19. Segmentation par logique floue pour l'estimation du nombre de ...

    African Journals Online (AJOL)

    Our approach is based on the use of principal component analysis (PCA), followed by the application of fuzzy logic to the first principal component images as segmentation method of red blood cells. It allowed us to define a gradual membership of red blood cells to a class, thus facilitating their counting. The results give rise ...

  20. 27 Segmentation par logique floue pour l'estimation du nombre de ...

    African Journals Online (AJOL)

    bagui kossan olivier

    Le diagnostic rapide est par conséquent, une urgence médicale car, le ... Vision Allied Technology, avec un capteur de MT9P031 de Micron / Aptina), avec ..... [4] - O. K. BAGUI, J. T. ZOUEU, C. WÄHLBY, Automatic malaria diagnosis by the ...

  1. Approche psychanalytique de la psychose : structure, logique, clinique, éthique

    OpenAIRE

    Sakellariou, Dimitris Petros

    2011-01-01

    For Freud and Lacan psychosis is not a deficiency. Nowadays, Schreber’s text still remains an unequalled paradigmatic treatise. For Freud, paranoid delirium is an attempt at recovery, and for Lacan it is an attempt to analyze severe logic. The thorny question of psychotic transference still remains. Freud does not believe that a psychotic patient is capable of analytical transference. Lacan thinks that at the beginning, the transference is likely to provoke a trigged of, furthermore the psych...

  2. Les bienfaits pour la santé et la prédominance du sucre dans les céréales pour déjeuner destinées aux enfants au Canada

    Directory of Open Access Journals (Sweden)

    Monique Potvin Kent

    2017-01-01

    Full Text Available Introduction : Cette étude vise à comparer le contenu nutritionnel et les bienfaits pour la santé des céréales pour déjeuner destinées aux enfants et celles non destinées aux enfants et à évaluer la prédominance du sucre ajouté dans ces produits. Méthodologie : Nous avons recueilli des données sur le contenu nutritionnel de 262 céréales pour déjeuner vendues dans les cinq principales chaînes d’alimentation à Ottawa (Ontario et à Gatineau (Québec. Pour chaque céréale, nous avons pris en note les cinq premiers ingrédients et la quantité de sucres ajoutés indiqués sur la liste des ingrédients. Les diverses marques de céréales ont été ensuite classées en deux catégories, soit « plus saines » ou « moins saines », à l’aide du modèle de profil nutritionnel du Royaume-Uni. Nous avons évalué chaque céréale en fonction de divers critères afin de déterminer si elle était destinée ou non aux enfants. Des comparaisons statistiques ont été établies entre les céréales destinées aux enfants et les autres. Résultats : Sur l'ensemble des céréales pour déjeuner, 19,8 % étaient destinées aux enfants et contenaient beaucoup moins de gras et de gras saturés. Ces céréales avaient une teneur en sodium et en sucre significativement plus élevée et une teneur en fibres et en protéines plus faible, et elles étaient trois fois plus susceptibles d’être classées comme « moins saines » par rapport aux céréales non destinées aux enfants. Aucune des céréales destinées aux enfants n’était sans sucre et, pour 75 % d’entre elles, le sucre occupait le deuxième rang dans la liste des ingrédients. Six entreprises de céréales pour déjeuner possédaient une gamme de produits destinés aux enfants composée entièrement de céréales « moins saines ». Conclusion : Il est nécessaire d’adopter un règlement qui limite le marketing alimentaire ciblant les enfants et les jeunes de moins de 17

  3. Didier Combeau, Des Américains et des armes à feux. Violence et démocratie aux Etats-Unis. Saul Cornell, A Well-Regulated Militia : The Founding Fathers and the Origins of Gun Control in America.

    Directory of Open Access Journals (Sweden)

    Renaud Pacoud

    2008-07-01

    Full Text Available Deux ouvrages différents dans leur approche mais également passionnants permettent de saisir l’évolution du débat sur les armes à feu aux États-Unis. Des Américains et des armes à feux. Violence et démocratie aux Etats Unis de Didier Combeau rend compte de la relation complexe que les Américains entretiennent avec les armes à feu depuis la fondation de la nation et de la polémique contemporaine sur la question du droit aux armes. A Well-Regulated Militia : The Founding Fathers and the Origins...

  4. Evolução das relações entre cidades e portos: entre lógicas homogeneizantes e dinâmicas de diferenciação Évolution des relations entre villes et ports: entre logiques homogénéisatrices et dynamiques de différenciation Evolution of relationships between cities and ports: homogenizing trends and differentiation dynamics

    Directory of Open Access Journals (Sweden)

    Flavia Nico Vasconcelos

    2012-06-01

    maille globale des interactions spatiales de longue distance redéfinit le paysage institutionnel, les modalités technico opérationnelles et l´organisation spatiale du système portuaire mondial. La situation des ports, par lesquels transite l´essentiel du commerce international de marchandises, n´en est pas moins paradoxale et complexe. Les stratégies développées par les acteurs dominant l´horizon maritime du port et celles imposées par les acteurs économiques dominant son horizon terrestre, placent les villes portuaires dans le double champs des réseaux du transport et de la production. L´enjeu pour les politiques portuaires, oscillant entre concurrence et complémentarité, consiste donc à positionner le port au cœur de ces réseaux en incorporant un nombre croissant de variables économiques, commerciales, urbanistiques, environnementales et sociales face aux rationnalités fonctionnelles et territoriales d´acteurs pouvant transformer le port en simple nœud de transbordement ou, à l´opposé, en grand centre logistique. S’appuyant sur la définition des ports de commerce comme territoires multi-situés dont les marges de manœuvre sur «l’échiquier» mondial et régional sont à l´origine d´une articulation différenciée des compétences liées au port de commerce, au système productif et aux ressources du territoire urbain, une analyse de leur trajectoire à trois échelles, au niveau global, dans le cadre de la mondialisation ; au niveau méso-économique, au sein de systèmes régionaux qui capturent des volumes croissants de flux et d´activités de transformation; et au niveau local, sur le territoire de la ville portuaire permet d´élaborer une typologie des villes portuaires comme territoires circulatoires et/ou productifs.The current stage of globalisation presents mutations that act on the global network of long distance spatial interactions and redefine the institutional scenery, the technic-operational modalities and the

  5. Aspects épidémiologiques des accidents vasculaires cérébraux (AVC) aux urgences de l'institut de cardiologie d'Abidjan (ICA)

    Science.gov (United States)

    N'goran, Yves N'da Kouakou; Traore, Fatou; Tano, Micesse; Kramoh, Kouadio Euloge; Kakou, Jean-Baptiste Anzouan; Konin, Christophe; Kakou, Maurice Guikahue

    2015-01-01

    Introduction L'objectif de notre étude était de décrire les caractéristiques sociodémographiques et les Facteurs de Risque cardio-Vasculaires (FRV) des patients admis pour accidents vasculaires cérébraux (AVC) dans un service autre que celui de la neurologie. Méthodes Étude transversale rétrospective sur une période de 2 ans (janv. 2010 et déc. 2011), réalisée aux urgences de l'institut de cardiologie d'Abidjan. Résultats Il s'agissait de 176 adultes avec un âge moyen de 60 ans, une prédominance féminine. Les facteurs de risque majeurs retrouvés étaient l'hypertension artérielle dans 86,4% des cas, le diabète dans 11,4% des cas, le tabagisme dans 2,2% des cas. Les motifs de consultation étaient la perte de connaissance dans 36,4% des cas, l'hémiplégie dans 31,8% des cas, les céphalées dans 17,4% des cas, les vertiges dans 10,9% et les palpitations dans 2,2% des cas. La tension artérielle systolique moyenne était à 174 mmHg, la tension artérielle diastolique moyenne était à 105 mmHg et la pression pulsée moyenne était à 70 mmHg. Les AVC étaient associés à une arythmie complète par fibrillation auriculaire dans 11,4% des cas. Les AVC ischémiques représentaient 84,1%. L’évolution aux urgences a été marquée par un décès dans 17% (30) des cas. Conclusion Les AVC constituent un problème majeur de santé publique. Malgré sa prédominance féminine, ils (AVC) touchaient 44% des hommes dans notre étude lorsqu'on sait qu'en Afrique l'activité sociale repose sur les hommes. Ils restent une pathologie grave par la forte létalité. PMID:26327997

  6. CO{sub 2} direct cycles suitable for AGR type reactors; Cycles directs de gaz carbonique applicables aux reacteurs du genre AGR

    Energy Technology Data Exchange (ETDEWEB)

    Maillet, E [Commissariat a l' Energie Atomique. Centre d' Etudes Nucleaires de Saclay, 91 - Gif-sur-Yvette (France)

    1967-10-01

    The perspectives given by the gas turbines under pressure, to build simple nuclear power plants and acieving significantly high yield, are specified. The CO{sub 2} is characterised by by good efficiency under moderate temperature (500 to 750 Celsius degrees), compactness and the simpleness of machines and the safe exploitation (supply, storage, relief cooling, thermosyphon). The revision of thermal properties of the CO{sub 2} and loss elements show that several direct cycles would fit in particular to the AGR type reactors. Cycles that would diverge a little from classical models and able to lead to power and heat generation can lead by simple means to the best results. Several satisfying solutions present for the starting up, the power regulation and the stopping. The nuclear power plant components and the functioning safety are equally considered in the present report. The conclusions stimulate the studies and realizations of carbon dioxide gas turbines in when approprite. [French] Les perspectives offertes par la turbine a gaz sous pression, pour construire des centrales nucleaires simples et de rendement progressivement eleve, se precisent actuellement. le CO{sub 2} se distingue par sa bonne efficacite a temperature moderee (500 a 750 degres celsius), la compacite et la simplicite des machines, et la surete qu'il apporte a l'exploitation ( approvisionnement, stockage, refroidissement de secours, thermosiphon). La revision des proprietes thermophysiques du CO{sub 2} et des elements de pertes montre que divers cycles directs conviendraient en particulier aux reacteurs agr ou derives. Des cycles s'ecartant peu des modeles classiques, et se pretant ulterieurement a la production simultanee d'electricite et de chaleur, peuvent conduire par des moyens simples aux meilleurs resultats d'ensemble. Plusieurs solutions satisfaisantes se presentent pour le demarrage, le reglage de la puissance et l'arret. Les composants de la centrale et la surete de fonctionnement sont

  7. DET/MPS - THE GSFC ENERGY BALANCE PROGRAM, DIRECT ENERGY TRANSFER/MULTIMISSION SPACECRAFT MODULAR POWER SYSTEM (MACINTOSH A/UX VERSION)

    Science.gov (United States)

    Jagielski, J. M.

    1994-01-01

    The DET/MPS programs model and simulate the Direct Energy Transfer and Multimission Spacecraft Modular Power System in order to aid both in design and in analysis of orbital energy balance. Typically, the DET power system has the solar array directly to the spacecraft bus, and the central building block of MPS is the Standard Power Regulator Unit. DET/MPS allows a minute-by-minute simulation of the power system's performance as it responds to various orbital parameters, focusing its output on solar array output and battery characteristics. While this package is limited in terms of orbital mechanics, it is sufficient to calculate eclipse and solar array data for circular or non-circular orbits. DET/MPS can be adjusted to run one or sequential orbits up to about one week, simulated time. These programs have been used on a variety of Goddard Space Flight Center spacecraft projects. DET/MPS is written in FORTRAN 77 with some VAX-type extensions. Any FORTRAN 77 compiler that includes VAX extensions should be able to compile and run the program with little or no modifications. The compiler must at least support free-form (or tab-delineated) source format and 'do do-while end-do' control structures. DET/MPS is available for three platforms: GSC-13374, for DEC VAX series computers running VMS, is available in DEC VAX Backup format on a 9-track 1600 BPI tape (standard distribution) or TK50 tape cartridge; GSC-13443, for UNIX-based computers, is available on a .25 inch streaming magnetic tape cartridge in UNIX tar format; and GSC-13444, for Macintosh computers running AU/X with either the NKR FORTRAN or AbSoft MacFORTRAN II compilers, is available on a 3.5 inch 800K Macintosh format diskette. Source code and test data are supplied. The UNIX version of DET requires 90K of main memory for execution. DET/MPS was developed in 1990. A/UX and Macintosh are registered trademarks of Apple Computer, Inc. VMS, DEC VAX and TK50 are trademarks of Digital Equipment Corporation. UNIX is a

  8. Cohabitation sociale et ordre public aux Champs-Élysées :Gestion et appropriation du carré des jeux (1700-1830

    Directory of Open Access Journals (Sweden)

    Véronique Laporte

    2011-08-01

    Full Text Available Au 18e siècle et au début du 19e siècle, les Champs-Élysées sont ouverts à tous et attirent une clientèle diversifiée. Des joueurs issus d’horizons très différents s’y retrouvent pour pratiquer différentes activités, telles que la longue paume, les boules ou les barres. Afin que les promeneurs ne soient pas importunés par les jeux, ces derniers sont confinés dans une vaste clairière servant également lors des revues militaires et des fêtes publiques. Les autorités ont une volonté réelle d’offrir aux visiteurs des espaces de jeux, mais elles craignent aussi les débordements susceptibles d’être créés par les amusements. En effet, qu’importe si les joueurs sont nobles ou écoliers, la même crainte transparaît. Il s’agit de la peur des attroupements. C’est pourquoi les autorités tentent de diminuer l’affluence aux Champs-Élysées en contrôlant le nombre et la nature des jeux pratiqués dans cet espace public.At the end of the 18th century and the beginning of the 19th century, the Champs-Élysées were open to people of all extractions and attracted indeed a diversified public. Players of different social origins gathered for various collective games such as the longue paume, bowls, or "les barres". In order not to disturb the strollers, the games were confined in a clearing also used for military reviews and public celebrations. Authorities had a will to offer playing spaces to visitors, but were at the same time concerned by the possibility of public overflowings. Whether they be aristocrats or schoolboys, the same apprehension comes out: the fear of gatherings. This is the why the authorities attempted to reduce the crowds on the Champs-Élysées by controlling the number and the nature of the games practiced in that public place.

  9. Lutte contre la piraterie : faut-il faire appel aux sociétés de sécurité privées ?

    Directory of Open Access Journals (Sweden)

    2009-10-01

    Full Text Available Le point de vue d’un armateur françaisEric Frécon : Quel est l’environnement juridique dans lequel opèrent les armateurs soucieux de protéger leur navire avec des hommes en armes ?Sur un navire, dans les eaux nationales d’un pays, la protection armée s’effectue dans le cadre du droit maritime dudit pays. Ces eaux nationales s’entendent sans contestation aux douze nautiques mais dans certains cas, comme aux Etats-Unis, elles sont prolongées jusqu’à la limite de la ZEE soit 200 milles. Ainsi, d...

  10. Handling Uncertainty in Accessing Petroleum Exploration Data Traitement de l'incertain dans l'accès aux données d'exploration pétrolière

    Directory of Open Access Journals (Sweden)

    Chung P. W. H.

    2006-11-01

    Full Text Available This paper discusses the role of uncertainty in accessing petroleum exploration databases. Two distinct forms of uncertainty are identified : the uncertainty in the user's requirements, and the uncertainty in the data held. A general mechanism is described which is applicable to both. Cet article traite du rôle de l'incertitude dans l'accès aux bases de données d'exploration pétrolière. Deux sortes distinctes d'incertitudes sont identifiées : l'incertitude au niveau des requêtes de l'utilisateur et l'incertitude attachée aux données stockées. Nous décrivons un mécanisme général qui s'applique à ces deux types d'incertitude.

  11. Ecrivains français de Page classique proposés pour l'enseignement du F.LE. en Espagne aux 18e et 19e siècles

    OpenAIRE

    Fischer Hubert, Denise

    2015-01-01

    L'étude de la littérature dans les manuels de FLE est assez tardive. L'accent est surtout mis, aux 17e et 18° siècles, sur les règles de grammaire, de prononciation et aussi sur le «français fonctionnel» (dialogues utiles aux marchands et voyageurs qui se déplacent en France et ont besoin d'une phraséologie courante). A la fin du 18e et au 19e siècle, on commence à penser que la lecture des grands classiques est un point important dans l'étude de la langue. Le grammairien se réfère sans cesse...

  12. L’alternance dans une formation professionnelle universitaire. De l’idéal épistémologique aux contradictions pédagogiques

    Directory of Open Access Journals (Sweden)

    Hugues Pentecouteau

    2012-04-01

    Full Text Available L’ouverture de l’université française sur le monde du travail constitue l’un des faits marquants de l’histoire du système universitaire au cours des deux dernières décennies. Le développement des formations professionnelles, du nombre de stages effectués par des étudiants et des conventions passées avec des partenaires professionnelles ont contribué à modifier le paysage de la formation diplômante. En développant des formations par alternance, l’université s’est engagée dans des formes pédagogiques qui nécessitent de penser autrement l’articulation entre la théorie et la pratique. L’objet de cette contribution est de questionner de manière critique différentes formes d’alternance et d’illustrer à partir d’une expérience d’alternance intégrative menée dans une formation aux métiers de la formation.

  13. Aux sources de la représentation des femmes autochtones dans trois récits de voyage français de la Renaissance

    Directory of Open Access Journals (Sweden)

    Megan Talbot

    2018-05-01

    Full Text Available En analysant trois récits de voyage de la Renaissance ; l’Histoire d’un voyage faict en la terre du Brésil de Jean de Léry, Le grand voyage du pays des Hurons de Gabriel Sagard et des lettres de Marie de L’Incarnation, cet article cherche à analyser le portrait des femmes autochtones de la Nouvelle-France par une perspective européenne. Les auteurs avant tout font une comparaison entre la société européenne et la société autochtone pendant les premières explorations. Nous examinerons les thèmes communs des voyageurs comme les descriptions des femmes, y compris l’apparence physique, le comportement et les devoirs de la femme et dans le cas de Marie de L’Incarnation, l’héroïsme de différentes tribus. Les œuvres en question comparent les sociétés de leur temps, donnant l’occasion aux lecteurs modernes de retourner au passé pour comprendre la façon dont les femmes autochtones ont été représentées par les voyageurs au début de la colonisation.

  14. Possible control of introduced giant African land snails (Achatina spp. by the reintroduced endemic skink Leiolopisma telfairii, Ile aux Aigrettes, Mauritius

    Directory of Open Access Journals (Sweden)

    Jamie A. COPSEY

    2011-01-01

    Full Text Available The giant African land snail (Achatina fulica is one of the world’s worst invasive species, out‐competing endemic snails, consuming native vegetation and potentially altering nutrient cycles. Attempts to eradicate the snail from islands have only been successful with incipient populations. We present correlative evidence that native island predators may act as an effective control agent for the snail. In 2000 a population of between 37,300 and 45,100 African land snails was estimated on the 26ha nature reserve island of Ile aux Aigrette, Mauritius. Between 2006 and 2007, 260 endemic Telfair’s skink Leiolopisma telfairii were reintroduced to the reserve. Snail population surveys in 2008 and 2009 showed that the introduced snail population had declined to 5,569 (± 3,630 and 6,871 (±5,379, respectively. Previous studies showed that the introduced snails were selective over other invertebrate prey items. We suggest that predation by the endemic skink has been an important causal factor behind the snail population decline.

  15. La modélisation graphique de phénomènes émergents pour répondre aux besoins de la prospective

    Directory of Open Access Journals (Sweden)

    Laure Casanova Enault

    2017-01-01

    Full Text Available La modélisation graphique de scénarios prospectifs développés dans le programme Territoire durable 2030 piloté par le Ministère de l’Écologie, du Développement Durable et de l’énergie (MEDDE a été l’occasion d’interroger l’ajustement de la méthode aux besoins de la prospective. L’enjeu réside dans l’exploration des modes de représentation de deux thématiques difficiles à appréhender par la méthode et qui sont pourtant devenues décisives dans la compréhension de l’évolution des territoires du fait de la généralisation du référentiel de développement durable : l’environnement et la gouvernance.

  16. La prodigieuse odyssée des particules élémentaires du bigbang jusqu'aux être pensants, et ensuite ? : essai

    CERN Document Server

    Bourdinaud, Michel

    2017-01-01

    Notre univers est un fragment échappé du chaos fondamental au travers du Big Bang et cristallisé sous une forme stable d’un point de vue cosmique. Bien des questions restent sans réponse. • Pourquoi y a-t-il quelque chose plutôt que rien ? • Ce quelque chose est-il le fruit d’un dessein ? • D’où proviennent les lois physiques qui gouvernent l’univers ? • Comment expliquer l’insolite et incessante organisation de la matière depuis le Big Bang ? • L’eau est une des clés de la vie, pourquoi une telle quantité sur la Terre ? • Par quel prodige les particules élémentaires sont-elles parvenues à constituer des êtres pensants ? Dans une expansion vertigineuse aux allures de fuite en avant, l’humanité aborde une crise majeure, car son économie est dévastatrice et ses comportements irrationnels la mènent au bord de l’autodestruction. Parvenir au contrôle des moyens d’anéantissement qu’elle a elle-même enfantés, ainsi que rapidement mettre un terme au pillag...

  17. Methods for determining thermal stresses values. Some examples relating to nuclear reactors; Methodes de determination des contraintes thermiques. Quelques exemples d'application aux reacteurs

    Energy Technology Data Exchange (ETDEWEB)

    Bernard, J; Gautier, A [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires; Peres, A [Israel Institute of Technology, Dept. of Nuclear Science Technion (Israel)

    1958-07-01

    As modern techniques develop more elaborate machines, and make their way towards higher and higher temperatures and pressures, the thermal stresses become a matter of major importance in the design of mechanical structures. In the first part of this paper, the authors examine the problem from a theoretical standpoint, and try to evaluate the aptitude and limitation of mathematical techniques to attain the quantitative values of thermal stresses. This paper deals mainly with the experimental methods to measure thermal stresses. The authors show some examples relating to nuclear reactors. (author)Fren. [French] Au fur et a mesure que la technique moderne developpe des machines plus poussees et s'oriente vers des temperatures et des pressions toujours plus elevees, les contraintes thermiques deviennent un facteur d'importance capitale dans le calcul des structures mecaniques. Les auteurs examinent d'abord l'aspect theorique du probleme, ainsi que l'aptitude et les limites du calcul pour exprimer quantitativement la valeur des contraintes thermiques. Les auteurs exposent principalement, ensuite, les methodes experimentales qui permettent de mesurer ces contraintes, et illustrent cet expose de quelques exemples relatifs aux installations nucleaires. (auteur)

  18. L’octroi de crédits aux femmes entrepreneuses libanaises par les banquiers : le cas du dispositif Kafalat

    Directory of Open Access Journals (Sweden)

    Inaya Wahidi

    2016-03-01

    Full Text Available L’accès au crédit bancaire sans garantie est quasi impossible au Liban, d’où le dispositif Kafalat qui représente une solution face à cette difficulté. Selon la littérature, l’entrepreneuriat des femmes souffre de discrimination par rapport aux hommes quant à l’octroi de crédits bancaires. Notre objectif est d’essayer de voir dans quelle mesure cette situation existe au Liban. L’étude exploratoire conduite par entretiens semi-directifs auprès des banquiers exclusivement fournit les premiers éléments sur le profil de ces femmes entrepreneuses libanaises et sur la discrimination éventuelle qui pourrait exister du fait de leur sexe pour l’obtention de crédits bancaires. Les résultats semblent montrer que les banquiers ne font pas de distinction entre les entrepreneurs hommes ou femmes, même si les entrepreneuses ont peut-être moins d’informations concernant les garanties offertes par le dispositif Kafalat et sont souvent soutenues par leur mari qui accepte une hypothèque comme garantie du crédit demandé par leur femme ou qui passe par leur femme pour obtenir le crédit nécessaire au développement de leur propre entreprise.

  19. Contribution des causes de décès aux gains en espérance de vie à 65 ans au Canada et l’influence de leur profil par âge, 1979-2007

    DEFF Research Database (Denmark)

    Bergeron Boucher, Marie-Pier

    variation par âge des causes de décès influencent les tendances des taux de mortalité par cause. Les résultats montrent que les progrès de l’espérance de vie à 65 ans sont encore majoritairement dus à la diminution de la mortalité liée aux maladies cardiovasculaires. Toutefois, ces dernières causes de décès...... dans l’évolution de l’espérance de vie proviennent de modifications dans les tendances de certaines causes de décès et de leurs interactions. Cette étude analyse la contribution respective de certaines causes de décès aux changements observés de l’espérance de vie, mais aussi comment les profils de...... ne sont pas les seules à contribuer aux progrès en espérance de vie, puisque les taux de mortalité des dix principales causes de décès au Canada ont connu une diminution depuis 1979, malgré des profils de variation par âge différents....

  20. Fracture numérique, fracture sociale : aux frontières de l'intégration et de l'exclusion

    Directory of Open Access Journals (Sweden)

    Luc Vodoz

    2010-12-01

    Full Text Available La fracture numérique est une ligne de rupture symbolique, le tracé d'un clivage entre d'une part les individus ou groupes sociaux qui sont – ou se sentent – bien intégrés à la « société de l'information », d'autre part ceux qui sont – ou se sentent – exclus de cette société. Comme bien d'autres frontières, cette ligne est difficilement visible voire totalement imperceptible dans le terrain. Ce texte relate un cheminement sur la frontière, sur les logiques prévalant à l'articulation entre deux espaces, entre deux réalités comme entre deux points de vue. Il s’efforce de comprendre ce que vivent celles et ceux qui se situent sur la limite, qui tentent de la franchir ou au contraire d'éviter leur expulsion. L’investigation s’est déroulée dans les milieux de la formation professionnelle et continue en matière de TIC. Plus largement, il s'agissait d'examiner les éventuelles correspondances entre intégration à (ou exclusion de la « société de l'information » d'une part, et d'autre part l'intégration (ou l'exclusion sociale plus générale des personnes considérées.Digital gap, social gap: sitting on the boundaries of integration and exclusionThe digital gap is a symbolic demarcation of rupture, a line that traces the separation between individuals or social groups who are – or feel they are –integrated into the “information society”, and those who are – or feel – excluded from this society. As with many other boundaries, this particular line is difficult to perceive or even is totally imperceptible in the field. Analysing a journey on the boundary itself, this text concentrates on the logics emerging from the connection between the two spaces, two realities, two points of view. It attempts to understand what those who find themselves on this limit actually live, as do also those who attempt de jump the gap or on the contrary try to avoid their expulsion. The enquiry took place in a

  1. Contribution to the methods for estimating uranium deposits (1963); Contribution aux methodes d'estimation des gisements d'uranium (1963)

    Energy Technology Data Exchange (ETDEWEB)

    Carlier, A. [Commissariat a l' Energie Atomique, Fontenay-aux-Roses (France). Centre d' Etudes Nucleaires

    1964-02-15

    be taken in some cases. A detailed alphabetical index is intended to help find in this publication the definitions, formulae or theories that most interest the reader. (author) [French] Apres avoir rappele ce qu'est un gisement, de valeur economique, sur la base du marginalisme, l'auteur distingue plusieurs categories de reserves suivant le degre de connaissance du gite et suivant le poste d'exploitation ou est considere le minerai. Il rejette les anciennes categories 'a vue', 'probable' et 'possible' pour les remplacer par des categories mieux adaptees. Les reserves sensu stricto sont celles pour lesquelles on est en mesure de calculer l'erreur aleatoire d'estimation. Une notion est introduite a ce sujet, c'est le contraste naturel des teneurs dans un gite (coefficient de dispersion absolu {alpha}). L'auteur distingue 3 formes de reconnaissance des gites, la mauvaise, la bonne et l'ideale. La premiere est la reconnaissance anarchique trop souvent recontree la seconde est la reconnaissance logique fondee sur une implantation systematique des galeries, sondages, etc. La troisieme, difficile a atteindre, est celle qui minimise la depense des recherches pour une precision fixee a l'avance. Une partie de l'ouvrage traite des erreurs d'echantillonnage telles que celles resultant du quartage d'un lot (theorie de Pierre GY), ou celles issues de l'emploi de la radioactivite pour estimer les teneurs. Une autre partie traite des erreurs d'extension (assimilation du gite a ses echantillons) et donne les formules essentielles pour calculer ces erreurs aleatoires (geostatistique de Matheron). A propos de l'estimateur lui-meme, on note la disharmonie entre l'echantillon et sa zone d'influence, et le moyen de remedier a cette discordance par le 'krigeage' est fourni dans l'ouvrage. La these donne de nombreux exemples des differents parametres numeriques

  2. Contribution to the methods for estimating uranium deposits (1963); Contribution aux methodes d'estimation des gisements d'uranium (1963)

    Energy Technology Data Exchange (ETDEWEB)

    Carlier, A [Commissariat a l' Energie Atomique, Fontenay-aux-Roses (France). Centre d' Etudes Nucleaires

    1964-02-15

    index is intended to help find in this publication the definitions, formulae or theories that most interest the reader. (author) [French] Apres avoir rappele ce qu'est un gisement, de valeur economique, sur la base du marginalisme, l'auteur distingue plusieurs categories de reserves suivant le degre de connaissance du gite et suivant le poste d'exploitation ou est considere le minerai. Il rejette les anciennes categories 'a vue', 'probable' et 'possible' pour les remplacer par des categories mieux adaptees. Les reserves sensu stricto sont celles pour lesquelles on est en mesure de calculer l'erreur aleatoire d'estimation. Une notion est introduite a ce sujet, c'est le contraste naturel des teneurs dans un gite (coefficient de dispersion absolu {alpha}). L'auteur distingue 3 formes de reconnaissance des gites, la mauvaise, la bonne et l'ideale. La premiere est la reconnaissance anarchique trop souvent recontree la seconde est la reconnaissance logique fondee sur une implantation systematique des galeries, sondages, etc. La troisieme, difficile a atteindre, est celle qui minimise la depense des recherches pour une precision fixee a l'avance. Une partie de l'ouvrage traite des erreurs d'echantillonnage telles que celles resultant du quartage d'un lot (theorie de Pierre GY), ou celles issues de l'emploi de la radioactivite pour estimer les teneurs. Une autre partie traite des erreurs d'extension (assimilation du gite a ses echantillons) et donne les formules essentielles pour calculer ces erreurs aleatoires (geostatistique de Matheron). A propos de l'estimateur lui-meme, on note la disharmonie entre l'echantillon et sa zone d'influence, et le moyen de remedier a cette discordance par le 'krigeage' est fourni dans l'ouvrage. La these donne de nombreux exemples des differents parametres numeriques qui caracterisent un gite d'uranium (coefficient de dispersion absolu) ou un minerai d'uranium (parametre de liberation), ainsi que plusieurs exemples de droite de correspondance de

  3. La diffusion du semis direct au Brésil, diversité des pratiques et logiques territoriales : l’exemple de la région d’Itaipu au Paraná A difusão do plantio direto no Brasil, diversidade das práticas e lógicas territoriais : o exemplo da região de Itaipú, Paraná

    Directory of Open Access Journals (Sweden)

    Ivo Mello

    2011-10-01

    Full Text Available Le semis direct est un système de production fondé sur le non-travail du sol. Il intègre une série de pratiques agricoles qui permettent de protéger les sols cultivés de l’érosion, de réduire les consommations de carburants, voire d’augmenter les rendements. Le large succès du semis direct au Brésil, contribue à la compétitivité et à la forte croissance de ses productions tout en préservant les sols. Le système complet du semis direct sous couvert est fondé sur trois principes : le non-labour, la couverture permanente du sol et des rotations culturales. Sur le terrain, les pratiques sont variées et nombre d’agriculteurs n’appliquent pas les deux derniers principes. La technique est le plus souvent associée à l’emploi d’herbicides qui présentent des risques de pollution, encore peu appréhendés au Brésil. Le semis direct s’est implanté dans le Sud du pays dans les années 1970-1990. De là, le système, mis en œuvre par les gaúchos, s’est rapidement étendu dans d’autres régions, particulièrement dans le centre et le nord du pays. Dans ce travail, les pratiques du semis direct sont étudiées à deux échelles. La région du Paraná 3, située en bordure orientale du lac de barrage d’Itaipu, montre que la pratique du semis direct, adoptée par de nombreux agriculteurs intègre également la protection du barrage afin de limiter l’érosion et la pollution de l’eau. A l’échelle des exploitations, des entretiens avec trois producteurs du Paraná et du Rio Grande do Sul, réalisant du semis direct sous couvert, présentent les pratiques et les raisonnements qui leurs sont associés. Ces entretiens nous montrent que l’adoption d’un système d’agriculture de conservation repose sur une révision profonde du mode de production et sur l’appropriation des connaissances relatives aux processus naturels. Si le succès du semis direct s’appuie sur l’augmentation des gains économiques, ce

  4. Diffusion in moving grain-boundaries; Diffusion aux joints de grains en mouvement; Diffuziya na peremeshchayushchikhsya granichnykh poverkhnostyakh zeren; Difusion de los limites intergranulares en movimiento

    Energy Technology Data Exchange (ETDEWEB)

    Blackburn, D A; Brown, A F [Solid State Laboratory, University of Edinburgh, Edinburgh (United Kingdom)

    1962-01-15

    Bicrystals of copper have been sheared along the common boundary at rates of 0.06-0.3 {mu}m/h at temperatures around 725{sup o} C. Penetration of Ag{sup 110} into static boundaries and boundaries moving in this way was studied by autoradiography. For both moving and static boundaries good agreement is obtained with Fisher's formula. The ratio of the diffusivities in the grain boundary and the bulk crystal (D'/D) is about 10{sup 6}. For the boundaries studied D'/D appears to increase slightly with total shear and with shear rate, but only by a factor of not more than two over the ranges investigated. (author) [French] Des bicristaux de cuivre ont ete sectionnes le long du joint commun a raison de 00,6 a 0,3 {mu} par heure, a des temperatures d'environ 725{sup o} C. La penetration de l'argent-110 aux joints fixes et aux joints en mouvement a ete etudiee par autoradiographie. Pour les joints en mouvement et r o m les joints fixes, les auteurs ont obtenu des resultats qui concordent avec la formule de Fisher. Le coefficient d'autodiffusion intergranulaire et massique (D'/D) est d'environ 10{sup 6}. Pour les joints etudies, le rapport D'/D semble augmenter legerement avec le sectionnement total et la vitesse de sectionnement, mais sans doubler pour les valeurs considerees. (author) [Spanish] Los autores han cizallado bicristales de cobre a lo largo de su limite comun a velocidades de 0,06-0,3 {mu}/h y a temperaturas del orden de los 725{sup o} C, a fin de estudiar por autorradiografia la penetracion del {sup 110}Ag wen los limites estacionarios y en los limites en movimiento. Los resultados obtenidos para ambos tipos de limites concuerdan satisfactoriamente con la formula de Fisher. La razon D'/D entre los coeficientes de difusion en los limites intergranulares y en la masa del cristal es del orden de 10{sup 6}. En el caso de los limites estudiados, este cociente parece crecer ligeramente con el esfuerzo total y con la velocidad de cizallamiento, pero el aumento no

  5. La femme écrivain hébraïque narre aux enfants Israeli Women Writing for Children: Devora Omer an Author of Young Literature ספרות נוער כתובה על ידי נשים : דבורה עומר

    Directory of Open Access Journals (Sweden)

    Dorit Shilo

    2011-11-01

    Full Text Available Les auteurs de la littérature israélienne pour enfants. Dans la première partie de l'article, j'explore les premiers jours de la littérature hébraïque pour enfants (XIXe siècle. Je tiens à souligner que ce sont les auteurs masculins qui ont régné sur ce genre littéraire et qu’à travers le XXe siècle un phénomène intriguant apparaît: les femmes commencent à écrire des oeuvres littéraires pour les enfants, et deviennent professionnelles dans ce domaine.La deuxième partie de l'article est dédiée à Devora Omer (né en 1932 qui est l'une des romancières les plus populaires et appréciées chez les enfants dans la littérature israélienne contemporaine. En particulier, j'examine le protagoniste féminin, Zohara, dans son œuvre Le’eov ad mavet (Aimer jusqu'à la mort, 1980, par rapport à la représentation de son apparence physique et à son monologue intérieur. Je suggère que même si elle est intégrée dans l'armée et donc « égale » aux hommes, le personnage principal du roman entretient la conception de l'auteur de la féminité, c'est-à-dire être physiquement attractive, même dans la bataille, pendant qu’elle est obligée d'accomplir les tâches ménagères, traditionnellement considérées comme le travail des femmes. En conclusion, la représentation de Zohara renvoie aux conflits entre les sexes dans la société israélienne contemporaine.In the first part of the article, I explore the early days of Hebrew children’s literature (19th century. I emphasize that it was male authors who ruled this literary genre and throughout the 20th century an intriguing phenomenon appears: women start writing literary works for children, becoming professionals in the domain. The second part of the article is dedicated to Devora Omer (born 1932 who is one of the most popular and well-appreciated children’s novelists in contemporary Israeli literature. In particular, I examine the female protagonist, Zohara, in

  6. The Aux/IAA gene rum1 involved in seminal and lateral root formation controls vascular patterning in maize (Zea mays L.) primary roots.

    Science.gov (United States)

    Zhang, Yanxiang; Paschold, Anja; Marcon, Caroline; Liu, Sanzhen; Tai, Huanhuan; Nestler, Josefine; Yeh, Cheng-Ting; Opitz, Nina; Lanz, Christa; Schnable, Patrick S; Hochholdinger, Frank

    2014-09-01

    The maize (Zea mays L.) Aux/IAA protein RUM1 (ROOTLESS WITH UNDETECTABLE MERISTEMS 1) controls seminal and lateral root initiation. To identify RUM1-dependent gene expression patterns, RNA-Seq of the differentiation zone of primary roots of rum1 mutants and the wild type was performed in four biological replicates. In total, 2 801 high-confidence maize genes displayed differential gene expression with Fc ≥2 and FDR ≤1%. The auxin signalling-related genes rum1, like-auxin1 (lax1), lax2, (nam ataf cuc 1 nac1), the plethora genes plt1 (plethora 1), bbm1 (baby boom 1), and hscf1 (heat shock complementing factor 1) and the auxin response factors arf8 and arf37 were down-regulated in the mutant rum1. All of these genes except nac1 were auxin-inducible. The maize arf8 and arf37 genes are orthologues of Arabidopsis MP/ARF5 (MONOPTEROS/ARF5), which controls the differentiation of vascular cells. Histological analyses of mutant rum1 roots revealed defects in xylem organization and the differentiation of pith cells around the xylem. Moreover, histochemical staining of enlarged pith cells surrounding late metaxylem elements demonstrated that their thickened cell walls displayed excessive lignin deposition. In line with this phenotype, rum1-dependent mis-expression of several lignin biosynthesis genes was observed. In summary, RNA-Seq of RUM1-dependent gene expression in maize primary roots, in combination with histological and histochemical analyses, revealed the specific regulation of auxin signal transduction components by RUM1 and novel functions of RUM1 in vascular development. © The Author 2014. Published by Oxford University Press on behalf of the Society for Experimental Biology.

  7. Finance et risque aux Etats-Unis : vers une nouvelle frontière ? Finance and Risk in the USA: A New Frontier?

    Directory of Open Access Journals (Sweden)

    Christine Zumello

    2010-03-01

    Full Text Available Cet article aborde la question de l’évaluation et de l’anticipation du risque sur les marchés financiers aux États-Unis. Les différents types de risque sont analysés ainsi que les principales méthodes utilisées pour les évaluer. La crise des subprimes qui a marqué la fin du second mandat de G.W. Bush a semblé déboucher sur une crise systémique. Parmi les différentes strates de risque, le plus grave est celui qui porte le système financier et économique au naufrage. Les conditions de la remise en cause du système suite à des prises de risque ou une absence de contrôle rigoureux du risque posent la question de l’équilibre entre la sphère politique et la sphère financière.This article raises the question of the evaluation and anticipation of risk on financial markets in the United States. The various types of risk are analysed as well as the main methods used to measure risk. The subprime crisis which dominated the end of the second G.W. Bush presidential term seemed to bring the whole financial and economic system to the brink of collapse. The central notion of the measure and control of risk hinges on the role of the political sphere versus the financial sphere.

  8. Économiste et développement durable : de la professionnalité aux métiers

    Directory of Open Access Journals (Sweden)

    Catherine Figuière

    2010-12-01

    Full Text Available Les emplois intégrant certaines dimensions du développement durable (DD se développent, même si leur affichage n’est pas toujours limpide. Ce texte se propose de distinguer tout d’abord les nouveaux gisements d’emplois des nouvelles préoccupations intégrées à des pratiques existantes ; les postes proposés aux économistes se situant clairement dans cette seconde catégorie. Il vise ensuite, sur la base d’une expérimentation de formation universitaire menée à Grenoble, à mettre en évidence la nécessité d’une formation articulant  « une éducation à propos du développement durable » et la maîtrise d’outils transversaux de l’économie-gestion, tels que la conduite du changement. Cette maîtrise est en effet imposée par la grande variété de l’offre de situations professionnelles.Jobs requiring skills which integrate some dimensions of sustainable development are increasingly numerous, even if their description is not always clear. This paper proposes primarily to identify newly-created jobs from traditional jobs integrating new issues in their description. The jobs offered to economists clearly belong to the second category. Then, based on an experiment carried out at Grenoble University, this paper aims at stressing the need for training including on the one hand, courses “about sustainable development” and on the other, proficiency in using some transversal tools of economics and management, such as organisational change management. This proficiency is indeed imposed by the large variety of the professional positions on offer in this field.

  9. Influence du compartiment trophique dans les réponses des populations de poissons aux variations artificielles de débit

    Directory of Open Access Journals (Sweden)

    ORTH D. J.

    1995-04-01

    Full Text Available Les réponses des populations de poissons aux altérations de débit sont assez peu souvent correctement prédites à partir des simulations physiques d'habitat. Actuellement, les évaluations de débit réservé sont basées sur des analyses de l'habitat physique, qui sont supposées avoir une influence sur ces populations. Cela conduit au dilemme en matière de détermination de ces débits : combien d'espèces et de stades faut-il analyser et comment pondérer leur importance respective ? Dans certains cours d'eau, les simulations d'habitat physique issues de PHABSIM (Physical Habitat Simulation pour les poissons les plus courants montrent une surface pondérée utile insensible ou maximum à faible débit. Or, les débits moyens à forts débits sont indubitablement importants pour différentes raisons, telles que le recrutement des espèces inféodées à la plaine alluviale, le nettoyage du fond du lit, les entrées de matière organique et la production des invertébrés benthiques. La densité, la diversité et la production des insectes aquatiques dans différents types de cours d'eau montrent des variations spatiales et interannuelles considérables, souvent directement reliables aux débits. De même, la croissance et le succès de prise de nourriture des poissons varient en fonction de l'abondance des proies. Un modèle de chaîne trophique a été développé pour étudier l'influence de la nourriture de base (insectes aquatiques, proies constituées par les poissons de petite taille et écrevisses sur la production des poissons prédateurs clé (Black bass à petite bouche, Micropterus dolomieu, Rock bass, Ambloplites rupestris, et Poisson chat à tête plate, Pylodictis olivaris dans un grand cours d'eau à régime thermique chaud. L'analyse du modèle indique que la production des poissons est très dépendante de la disponibilité des proies, en particulier les insectes aquatiques et les écrevisses. A partir des analyses du mod

  10. Dépendance économique aux produits forestiers non ligneux : cas des ménages riverains des forêts de Boulon et de Koflandé au Sud-Ouest du Burkina Faso

    Directory of Open Access Journals (Sweden)

    Mathieu Ouédraogo

    2013-06-01

    Full Text Available Dépendance économique aux produits forestiers non ligneux : cas des ménages riverains des forêts de Boulon et de Koflandé au Sud-Ouest du Burkina Faso Résumé Cette étude a pour objectif d’évaluer la dépendance économique des ménages riverains des forêts de Boulon et de Koflandé aux produits forestiers non ligneux (PFNL et d’identifier les déterminants de cette dépendance. Des enquêtes ont été menées auprès de 583 ménages de 14 villages riverains de ces forêts. Les résultats montrent que le revenu moyen annuel par ménage est de 846 800 F CFA avec une contribution de 60% du revenu des cultures et 12% du revenu d’élevage. Les PFNL procurent en moyenne 72 479 F CFA par ménage et par an à près de 93% des ménages enquêtés. La dépendance économique des ménages aux PFNL est estimée à 12%. Elle diminue avec le revenu, traduisant une plus grande dépendance des ménages pauvres des PFNL. Par ailleurs, les hommes sont économiquement moins dépendants des PFNL que les femmes. Les principaux déterminants de la dépendance aux PFNL sont le statut d’autochtone, la taille du ménage, la superficie forestière et la densité de population du département qui affectent positivement la dépendance aux PFNL. Dans le cadre d’une politique de réduction de la pauvreté en milieu rural, il faut prendre des mesures qui favorisent l’accès durable des ménages les plus pauvres aux ressources forestières. Mots clés : Produits forestiers non ligneux, dépendance économique, modélisation économétrique, Burkina Faso.   Economic dependence on non-timber forest products: case of households living near the Forests of Boulon and Koflande, in the south-western of Burkina Faso Abstract This study aims at assessing the household economic dependence on non-timber forest products (NTFPs in Boulon and Koflande Forest area and the main determinants of that dependence. The data have been collected with a sample of 583

  11. Foire aux questions techniques concernant la Bourse du CRDI aux ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Un de mes professeurs n'a pas été en mesure de remplir à temps le formulaire lui permettant de donner des références à mon sujet. Par conséquent, je n'ai pas pu soumettre ma demande avant la date et l'heure butoirs. Est-ce que le formulaire de mon professeur peut être téléversé et soumis après la date et l'heure butoirs ...

  12. Gestion du parc agroforestier du terroir de Vipalogo (Burkina Faso ...

    African Journals Online (AJOL)

    Au Burkina Faso, l'arbre rural fait partie des systèmes de production. Le choix des espèces, leur densité, les modes de gestion ainsi que les besoins à satisfaire, obéissent à des critères propres aux producteurs. C'est pour comprendre ces logiques paysannes de la gestion du parc agroforestier que la présente étude a été ...

  13. The Design, Development and Testing of Complex Avionics Systems: Conference Proceedings Held at the Avionics Panel Symposium in Las Vegas, Nevada on 27 April-1 May 1987

    Science.gov (United States)

    1987-12-01

    la d6finition, pour chaque variable, d’un type analogue aux dclarations de variables FORTRAN, A savoir - Zool en, tableau de boolsens, logique, r~el...reference. 11 est alars possible ds Ilutiliser (sass reserve d’une ergonomic soffisante) cosine one "documentation vivante " et representative du...ou cognitives sur son tableau de bord, sur sa mission. Il dispose aussi de connaissances plus dynamiques, plus fonctionnelles groupees de faqon

  14. Analyste intermédiaire de systèmes de gestion de l'information (h/f ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    entreprendre des études, cerner et analyser les exigences en GI en consultation avec les clients et en réponse aux besoins de leurs utilisateurs;; élaborer et conserver des structures, définitions et normes d'information logique (par exemple, architecture de l'information et cadre des métadonnées);; définir des types de ...

  15. Contribution to the determination of Sb-Ag-Cu-Ga-Mo-Zn using 14 MeV neutron activation; Contribution au dosage de Sb-Ag-Cu-Ga-Mo-Zn par activation aux neutrons de 14 MeV

    Energy Technology Data Exchange (ETDEWEB)

    Crambes, M [Commissariat a l' Energie Atomique, Grenoble (France). Centre d' Etudes Nucleaires

    1966-04-01

    By using, 14 MeV, neutron irradiation it is possible to extend the field of application of neutron radio-activation analysis, in particular to the case of light elements. For, many other elements it can replace in-pile irradiation thereby making it possible, thanks to portable 14 MeV neutron generators, to carry out radio-activation analyses away from nuclear-research c e n t r e s. With a view to applying this analytical technique to routine work, we have developed some rapid chemical separation methods in order to make possible the determination of several elements which after exposure to fast neutrons, produce {beta} emitting nuclides which cannot be differentiated by a simple instrumental study, the emitted radiation being of the same type and of similar half-life the two cases. (author) [French] L'irradiation au moyen de neutrons de 14 MeV permet d'etendre le domaine d'application de l'analyse par radioactivation neutronique, en particulier aux elements legers. Cependant pour de nombreux autres elements elle peut remplacer l'irradiation en reacteur nucleaire permettant ainsi grace aux ensembles portables producteurs de neutrons de 14 MeV, l'extension de l'analyse par radioactivation a l'exterieur des centres d'etudes nucleaires. Dans le but d'appliquer cette methode d'analyse a des travaux de routine, nous avons mis au point des separations chimiques rapides, afin de permettre le dosage de quelques elements qui par irradiation aux neutrons rapides, engendrent des nucleides emetteurs {beta} qu'une simple etude instrumentale ne peut differencier en raison de l'identite de leur rayonnement et de leurs periodes radioactives trop proches. (auteur)

  16. Evaluation des indicateurs d’alerte précoce de la résistance du VIH aux ARV en Côte d’Ivoire en 2011

    Science.gov (United States)

    Yao, Kouadio Jean; Damey, Néto Florence; Konan, Diby Jean Paul; Aka, Joseph; Aka-Konan, Sandrine; Ani, Alex; Bonle, Marguerite Te; Kouassi, Dinard

    2016-01-01

    Introduction En 2001, l'Organisation des Nations Unies recommandait de rendre disponible les médicaments antirétroviraux dans les pays à ressources limitées. Cependant, l'utilisation de ces médicaments à grande échelle s'accompagne du développement de résistance du virus. En Côte d'Ivoire, plusieurs sites prescrivent les antirétroviraux. Cette étude avait pour objectif d'évaluer les facteurs programmatiques associés à un risque élevé d'émergence de résistance du VIH aux antirétroviraux. Méthodes Il s'agit d'une cohorte rétrospective sur 20 sites de prise en charge des personnes vivant avec le VIH. La population d'étude était constituée des personnes ayant initié leur traitement antirétroviral sur les sites en 2008-2009. L'estimation de la taille de l'échantillon a été faite à partir de la stratégie d'échantillonnage de l'OMS. Résultats Sur 20 sites, 98% des prescriptions initiales étaient conformes aux directives nationales et 20% des sites avaient 100% de prescriptions conformes. Au total, 33% des patients étaient perdus de vue au cours des 12 premiers mois de traitement antirétroviral et 20% des sites avaient moins de 20% de perdus de vue. A 12 mois, 51% des patients demeuraient sous traitement de première intention approprié et 11% des sites ont atteint le seuil d'au moins 70% de patients sous traitement de première intention approprié. Un seul site n'a pas connu de rupture d'antirétroviraux sur les 12 mois. Conclusion Des insuffisances relevées dans la prise en charge des personnes vivant avec le VIH traduisent l'existence d'un risque important de résistance du virus aux antirétroviraux en 2008-2009. Pour minimiser ce risque les pratiques de prescription devraient être améliorées, un système de recherche des absents aux rendez-vous devrait être mis en place et la disponibilité constante des antirétroviraux devraient être assurée. PMID:28250876

  17. Le droit des missions aux colonies : une affaire « patrimoniale » ? Missionary law in the colonies : a « patrimonial » affair ?

    Directory of Open Access Journals (Sweden)

    Bernard Durand

    2008-01-01

    Full Text Available Rarement de la compétence du législateur métropolitain, sinon à appliquer les solutions arrêtées sous le régime du concordat, souvent abandonné au législateur local et encore plus souvent laissé à l’état de « fait » ?, le droit des missions dans les colonies, lorsque s’engage la question des liens entre Église et État sous la IIIe République, accuse des traits originaux. Au-delà des interrogations relatives aux autorisations, à la police des cultes, aux immeubles affectés aux cultes, revient de façon répétée la question du droit de propriété reconnu aux missions. Procès, transactions, arrangements, conflits font se rencontrer le Domaine et les « missions » devant un juge le plus souvent embarrassé pour dire le droit. Faut-il en conclure que les difficultés d’introduire les lois de 1901, 1904, 1905 se marient avec celles lancinantes de l’introduction d’un régime du droit des biens, tout aussi difficile à dessiner ? C’est l’hypothèse à présenter.Missionary law in the colonies, when seen in the context of the relationships between Church and State under the Third Republic, has many original features : it rarely entered the sphere of action of metropolitan lawyers (who simply applied the solutions adopted under the Concordat regime. Local lawyers were often left to deal with it, when anything happened at all. Beyond issues such as the control of worship (for example, the authorisations that were granted, or the buildings that were especially designated, to conduct worship, the question of the property rights of the mission returned time and again. Through lawsuits, transactions, settlements and conflicts, we witness how the colonial Domain and the ‘missions’ met before a judge who, most of the time, was embarrassed to adjudicate. Can we then conclude that the difficulties encountered in introducing the laws of 1901, 1904 and 1905 are tied to the repeated difficulties to introduce property

  18. Formes du regroupement pluriprofessionnel en soins de premiers recours. Une typologie des maisons, pôles et centres de santé participant aux Expérimentations des nouveaux modes de rémunération (ENMR)

    OpenAIRE

    Anissa Afrite; Julien Mousques

    2014-01-01

    Dans le cadre d’un programme de recherche global sur le lien entre le regroupement pluriprofessionnel en soins de premiers recours dans les sites participant aux Expérimentations des nouveaux modes de rémunération (ENMR) et la performance des médecins généralistes en matière d’activité, de productivité, d’efficacité et d’efficience de leurs pratiques, cette recherche a pour objectif d’analyser la structure, l’organisation et le fonctionnement des maisons, pôles et centres de santé participant...

  19. Dépendance économique aux produits forestiers non ligneux : cas des ménages riverains des forêts de Boulon et de Koflandé, au Sud-Ouest du Burkina Faso

    DEFF Research Database (Denmark)

    Ouédraogo, M; Ouédraogo, D; Thiombiano, T

    2013-01-01

    Cette étude a pour objectif d’évaluer la dépendance économique des ménages riverains des forêts de Boulon et de Koflandé aux produits forestiers non ligneux (PFNL) et d’identifier les déterminants de cette dépendance. Des enquêtes ont été menées auprès de 583 ménages de 14 villages riverains de c...

  20. Les compétences infirmières mobilisées dans un service d'oncologie pédiatrique pour répondre aux besoins de l'enfant et sa famille: travail de Bachelor

    OpenAIRE

    Alemanno, Gaëtan; Lorency, Vincent; Morf, Benjamin; Delajoux, Annie

    2013-01-01

    Dans ce travail de bachelor, nous nous intéressons aux compétences infirmières en onco-hématologie pédiatrique. En faisant cette recherche, nous mettons en évidences le vécu des parents dont l’enfant est malade, ainsi que leurs différents besoins ressentis, que ce soit de l’enfant ou des proches aidants. Nous identifions ces compétences en comparant, les actions et pratiques infirmières, avec le modèle de Calgary.

  1. X-ray diffraction studies of neutron irradiated beryllium oxide; Etude par diffraction des rayons X de glucine irradiee aux neutrons

    Energy Technology Data Exchange (ETDEWEB)

    Belbeoch, B; Rodot, J; Roulliay, M [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

    1966-07-01

    X-ray diagrams of neutron irradiated sintered BeO (E > 1 MeV) can be classified into 3 types depending on the value of the c/a ratio, independently of the characteristics of the sinters, (hot pressed or cold pressed, material, variable density and grain size, pure BeO or BeO with additions). The anisotropic expansion of the BeO lattice caused by irradiation depends not only on the dose of irradiation, but also on the intergranular stresses of the samples. The sintered samples which resist most satisfactorily to irradiation consist of cold pressed high density and small grain size material for which the c/a ratio varies little with increasing dosage. The single crystal diagrams show the same classification as the polycrystalline material in respect with the c/a ratio. Furthermore, in addition to the Bragg reflections, X-ray diffusions are observed; the distribution of the defects is no longer isotropic; a description is given in particular of the scattering which occurs when 1.625 < c/a < 1.645. It appears that the defects start to congregate and cause pronounced distortion of the lattice. The defects are stabilized in the form of large aggregates only when a later irradiation stage is reached. (author) [French] Les diagrammes de rayons X obtenus a l'aide d'echantillons frittes de BeO irradies aux neutrons (E > 1 MeV) peuvent etre classes en trois types qui dependent de la valeur du rapport c/a, quelles que soient les caracteristiques du fritte (fritte sous charge ou fritte naturel, densite et taille de grains variables, BeO pur ou avec additions). La dilatation anisotrope de la maille de BeO observee par irradiation ne depend pas seulement de la dose recue, mais aussi des etats de contraintes intergranulaires des echantillons; ainsi les frittes qui resistent le mieux sous irradiation sont les frittes naturels a forte densite et a petits grains pour lesquels le rapport c/a varie peu en fonction de la dose d'irradiation. Les diagrammes de monocristaux presentent la

  2. Constitution d’un Corpus de Français Langue Etrangère destiné aux Apprenants Allemands

    Directory of Open Access Journals (Sweden)

    Fauth Camille

    2014-07-01

    Nationale de la Recherche et Deutsche Forschungsgemeinschaft attribué à l’équipe Parole du LORIA UMR 7503, Nancy – France et à l’Equipe de Linguistique Computationnelle et de Phonétique FR 4.7 de l’Université de la Sarre Sarrebruck – Allemagne dans lequel le français et l’allemand sont des langues cibles. Pour la paire allemand-français, peu de corpus parallèles sont disponibles. Nous présentons ici l’élaboration d’un corpus de productions orales de locuteurs natifs et non natifs pour la paire allemand-français. Notre corpus entend mettre au jour les déviations phonétiques et phonologiques que les locuteurs allemands produisent lorsqu’ils apprennent le français. Ce travail s’insère dans un projet plus global, Ce projet entend étudier les difficultés que les locuteurs français rencontrent lorsqu’ils apprennent l’allemand, et réciproquement. Aussi, cinquante locuteurs allemands seront recrutés dans des milieux universitaires et scolaires (niveau lycée en Allemagne et cinquante locuteurs français dans les mêmes milieux en France. Il s’agit pour les deux populations de produire d’une part le corpus en langue étrangère (en langue française pour les locuteurs allemands et en langue allemande pour les locuteurs français mais également le corpus en langue maternelle (en allemand pour les allemands et en français pour les français. Les corpus ainsi obtenus devraient nous permettre d’identifier les difficultés que les locuteurs allemands ou français rencontrent lorsqu’ils apprennent le français ou l’allemand. Les données de contrôle sont doubles puisque l’on pourra à la fois se référer aux productions des apprenants dans leur langue maternelle (ici l’allemand, mais également à celles de locuteurs natifs (ici germanophones. Nous ne présenterons ici que la constitution du corpus en français.

  3. Le travail, marchandise fictive ? 100 ans de marchandisation de la main d’œuvre mexicaine aux États-Unis

    Directory of Open Access Journals (Sweden)

    Yves-Marie Abraham

    2008-12-01

    Full Text Available Pour Karl Polanyi, la société de marché est impossible, car elle suppose de traiter le travail, la terre et la monnaie comme des marchandises, ce qui ne peut qu’être destructeur de la société. A partir d’une analyse de l’utilisation de la main d’œuvre mexicaine par les employeurs américains depuis 100 ans, nous tentons de montrer que cette marchandisation est tout à fait possible en ce qui concerne le travail. Elle consiste, dans son principe, à réduire l’être humain à sa seule force de travail, tout en restant dans le cadre formel du salariat. Dans le cas des travailleurs mexicains, qu’il s’agisse d’ouvriers agricoles bénéficiant d’un contrat de travail temporaire sur le sol américain, d’employés de maquiladoras sur le sol mexicain ou de travailleurs sans-papiers vivant aux États-Unis, la frontière territoriale entre les deux pays apparaît comme un moyen particulièrement efficace pour accomplir cette réduction. C’est dire aussi que cette marchandisation du travail n’est pas forcément la conséquence de la mise en place de marchés autorégulateurs, contrairement à ce que soutient Polanyi.For Karl Polanyi, market society is impossible, since it supposes that work, land and money be treated as merchandise, which can only destroy society. On the basis of the analysis of the utilisation of Mexican labor by US firms over 100 years, this paper tries to show that merchandisation is quite possible as concerns work. It reduces the human being to his sole work force, while staying in the formal context of salaried work. In the case of Mexican workers, whether it be farm workers with temporary contracts in the US, or employees of maquiladoras on the Mexican soil, or illegal workers in the US, the territorial frontier between the two countries apears a particularly efficient way to accomplish this redcuction. The merchandisation of work is not necessarily the consequence of the establishment of autoregulating

  4. Des controverses aux compromis. Les lignes de front du métro bruxellois From controversies to compromises. The frontlines of Brussels metro

    Directory of Open Access Journals (Sweden)

    Céline Tellier

    2012-12-01

    Full Text Available En 1963, le Ministère belge des Communications publie un document intitulé “Promotion des Transports en commun dans les grandes agglomérations”, véritable plaidoyer en faveur du transport public à l’échelle de cinq grandes villes belges. Dans cet article, nous proposons d’analyser de manière approfondie ce document pour comprendre la controverse fondatrice qui a justifié les travaux du futur métro à Bruxelles. En faisant parler les archives institutionnelles, nous soutenons que le métro bruxellois peut être considéré comme le résultat d’un compromis entre les deux institutions à l’époque en charge de la mobilité à Bruxelles : le Ministère des Travaux Publics et le Ministère des Communications. Préférant répondre aux normes de capacité et de rapidité déjà présentes dans le monde routier, le transport public a ainsi fait le deuil de la surface et, par là, a purifié le débat des mobilités urbaines en une solution apparemment strictement technique, espace pacifié où protagonistes d’un champ désormais commun peuvent s’entendre et s’allier.In 1963 the Belgian Ministry of Communications published a document entitled “Promotion des Transports en commun dans les grandes agglomérations”, real plea for the defence of public transport on the scale of five Belgian cities. In this article, we propose to analyze this document deeply, to help the understanding of the founding controversy which justified the works of future metro in Brussels. By studying institutional archives, we maintain that the Brussels metro may be considered as the result of a compromise between the two institutions dealing with mobility at that time in Brussels: the Ministry of Civil Engineering and the Ministry of Communications. Through responding to capacity and speed standards already present in the field of road transport, public transport gave up the surface and turned the debate on urban mobility into an apparently

  5. L’enfant pauvre et la naissance de la photographie sociale aux États-Unis au XIXe siècle

    Directory of Open Access Journals (Sweden)

    Anne LESME

    2010-03-01

    Full Text Available À la fin du XIXe siècle, le journaliste et photographe Jacob Riis révèle les conditions de vie déplorables des familles d’immigrants à New York. C’est le début de la photographie sociale aux États-Unis où la représentation de l’enfant pauvre tiendra une place majeure. Ses photographies, projetées au cours de conférences faites par l’auteur et reproduites dans des publications, contribueront à un changement de mentalité. Si le regard de ce photographe reste celui d’un membre de la classe moyenne sur les enfants du Lower East Side, ses images apportent une nouvelle vision de la pauvreté, en phase avec un enfant désormais perçu comme innocent par la société. Par ailleurs, cet usage particulier du rôle probant de la photographie en soutien du texte inaugure un nouveau mode de communication dont les réformateurs useront afin d’émouvoir et de faire réagir le public des classes moyennes et aisées.At the end of the 19th century, Jacob Riis, journalist and photographer, brought to light the appalling conditions of the slums in New York; it was the beginning of the social documentary photography in the United States. The representation of destitute children was to become central in this genre. His photographs, used during stereopticon slides projections and published in books and articles, contributed to a change of mentality. However influenced by a middle-class vision of the Lower East Side’s children, Jacob Riis’s photographs contributed to bring a new perception of poverty in line with a child who was from that time perceived as innocent by a large part of society. This particular use of photography as a convincing and reliable medium added to the text initiated a new means of communication used by the reformers to move and provoke reactions from a middle and upper-class public.

  6. Acidentes de trabalho no Brasil: prevalência, duração e despesa previdenciária dos auxílios-doença

    Directory of Open Access Journals (Sweden)

    Paulo César Andrade Almeida

    Full Text Available RESUMO OBJETIVO: estimar a prevalência, a duração e a despesa previdenciária dos benefícios de Auxílio-Doença por Acidente do Trabalho (ADAT pagos pelo Instituto Nacional do Seguro Social (INSS aos segurados empregados no Brasil em 2008. MÉTODO: As variáveis ADAT foram estratificadas segundo sexo, idade e agravos categorizados em capítulos da CID-10. RESULTADO: foram concedidos 306.908 ADAT com prevalência de 94,2 por 10.000 vínculos. Os agravos mais prevalentes foram os do capítulo XIX - Lesões, envenenamento e algumas outras consequências de causas externas, do XIII - Doenças do sistema osteomuscular e do tecido conjuntivo, e do V - Transtornos mentais e comportamentais. A prevalência dos benefícios foi maior no sexo masculino (111,2 e na faixa etária ≥ 40 anos (116,9. A duração média foi de 75 ± 64 dias e a despesa média de R$ 2.181,00 ± 2.769,00, sendo maior para o Capítulo II - Neoplasias (R$ 5.083,00 ± 5.702,00. A despesa-dia média foi R$ 29,00 ± 18,00, sendo superior para o Capítulo V (R$ 39,00 ± 23,00. A idade ≥ 40 anos apresentou maior prevalência, duração e despesa entre todos os capítulos, à exceção do XIX, que foi o mais prevalente entre os mais jovens. CONCLUSÃO: os dados de ADAT são sugestivos de subcaracterização da relação com o trabalho. A alta prevalência de agravos do Capítulo XIX sugere precariedade das medidas de segurança no trabalho. Homens e mulheres apresentam diferentes perfis de acidentabilidade sem interferência na duração do benefício.

  7. Critical study of some soft-tissue equivalent material. Sensitivity to neutrons of 1 keV to 14 MeV; Etude critique de quelques materiaux equivalents aux tissus mous. Sensibilite aux neutrons de 1 keV a 14 MeV

    Energy Technology Data Exchange (ETDEWEB)

    Kerviler, H de; Pages, L; Tardy-Joubert, Ph [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

    1965-07-01

    Authors have studied the elastic and inelastic reactions on various elements contribution to kerma in standard soft tissue and as a function of neutron energy from 1 keV to 14 MeV the ratio of kerma in tissue equivalent material to kerma in soft tissue. The results of calculations are made for materials without hydrogen in view to state exactly their neutron sensitivity and for the following hydrogenous materials: Rossi and Failla plastic, MixD, pure polyethylene and a new CEA tissue equivalent (a magnesium fluoride and polyethylene compound). Results for {gamma}-rays are given. (authors) [French] Les auteurs ont etudie la contribution au kerma total des reactions elastiques et inelastiques sur les divers composants du tissu mou standard et la variation, en fonction de l'energie des neutrons de 1 keV a 14 MeV, du rapport des kermas dans differents materiaux equivalents au tissu au kerma dans les tissus mous. Les materiaux etudies sont des materiaux sans hydrogene afin de preciser leur sensibilite aux neutrons et les materiaux hydrogenes suivants: plastique de Rossi et Failla, polyethylene pur, MixD, nouveau plastique CEA a base de polyethylene et de fluorure de magnesium. Les resultats pour les photons sont egalement rappeles. (auteurs)

  8. Aux origines des Jeux olympiques.

    Directory of Open Access Journals (Sweden)

    Isabelle Debilly

    2005-11-01

    Full Text Available Si les Jo modernes sont régulièrement sous les feux de l’actualité, soit par la répétition temporelle des Olympiades elle-même, soit par les enjeux économiques féroces qui découlent du choix des lieux, ceux de l’Antiquité sont en général cantonnés au domaine scolaire ou universitaire. Néanmoins, ils bénéficient tous les quatre ans d`un éclairage médiatique. L’ouvrage Olympie. La victoire pour les dieux est au croisement des deux domaines. En effet, écrit par un ...

  9. Attitudes des éleveurs et sensibilité des systèmes d'élevage face aux sécheresses dans les Alpes françaises

    Directory of Open Access Journals (Sweden)

    Laurent Dobremez

    2011-01-01

    Full Text Available Les systèmes d'élevage des Alpes françaises sont fortement exposés au changement climatique annoncé et la plupart subissent déjà des épisodes de sécheresse depuis le début des années 2000. Face à ces aléas, les éleveurs ont mis en œuvre un certain nombre de leviers et envisagent d'en activer d'autres à l'avenir. Des enquêtes en exploitation ont permis d’identifier ces leviers. Leur analyse permet de caractériser les attitudes des éleveurs face aux sécheresses et d’évaluer l’évolution de la sensibilité de leurs systèmes d’élevage. A l'exception des exploitations disposant de surfaces irriguées importantes, toutes les exploitations cherchent d'abord à contourner l’aléa. Elles ont recours aux achats de fourrage pour compenser la baisse des récoltes destinées aux stocks hivernaux, mais à des degrés divers selon la durée de l’hivernage. Pour les périodes de pâturage, les éleveurs de haute montagne et les systèmes laitiers des Alpes du nord jouent avant tout sur un système résistant grâce à l’agrandissement et au surdimensionnement des pâtures par rapport aux besoins du troupeau. Les exploitations pastorales des Alpes du sud misent aussi sur une diversité de surfaces et une certaine latitude dans la conduite technique pour s'adapter aux conditions de l'année. Une succession répétée d’années sèches pourrait se traduire par des ruptures plus radicales dans les systèmes d’élevage. Il faut aussi garder à l’esprit que le changement climatique n'est qu'un des facteurs influençant les modes de transformation des exploitations.Livestock farming systems in the French Alps are particularly exposed to the predicted climate change and most of them have already experienced periods of drought since the beginning of the 2000s. Faced with this risk, livestock farmers have put in place a certain number of measures and envisage introducing others in the future. For the present study, surveys were

  10. Réordonner l’espace et le temps :

    OpenAIRE

    Senil, Nicolas

    2012-01-01

    La multiplication des objets, des acteurs et des logiques de la patrimonialisation génère un brouillage de plus en plus important sur la force et le sens de nos rapports au passé. Dans ce contexte, cet article se propose de réfléchir aux processus d’émergence de nouveaux objets patrimoniaux et aux conséquences de ces mobilisations. Il s’appuie sur l’analyse comparée de deux objets symétriques et tous deux patrimonialisés : la grotte Chauvet et le viaduc de Millau. En montrant que chaque objet...

  11. Aide sociale et coopération en Amazonie brésilienne

    OpenAIRE

    Buclet, Benjamin

    2017-01-01

    L’internationalisation de l’aide sociale n’échappe pas à la confrontation de valeurs supposées universelles aux cultures locales, ni à l’orientation des capitaux selon des règles définies par les dominants. Les parcours des individus impliqués dans les projets de développement, leur position dans les hiérarchies symboliques et les possibles qui leurs sont offerts reflètent des logiques de pouvoir bien éloignées des idéaux mis en avant dans la rhétorique de nombreuses organisations de solidari...

  12. Open-air ionisation chambers with walls of soft-tissue equivalent material for measuring photon doses; Chambres d'ionisation d'ambiance a parois en materiau equivalent aux tissus mous pour la mesure des doses absorbees dues aux photons

    Energy Technology Data Exchange (ETDEWEB)

    Vialettes, H.; Anceau, J.C.; Grand, M.; Petit, G. [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

    1968-07-01

    The ionisation chambers presented in this report constitute a contribution to research into methods of carrying out correct determinations in the field of health physics. The use of a mixture of teflon containing 42.5 per cent by weight of carbon for the chamber walls makes it possible to measure directly the dose absorbed in air through 300 mg/cm{sup 2} of soft tissue and, consequently, the dose absorbed in the soft tissues with a maximum error of 10 per cent for photon energies of between 10 keV and 10 MeV. Furthermore since this material does not contain hydrogen, the chamber has a sensitivity to neutrons which is much less than other chambers in current use. Finally the shape of these chambers has been studied with a view to obtaining a satisfactory measurement from the isotropy point of view; for example for gamma radiation of 27 keV, the 3 litre chamber is isotropic to within 10 per cent over 270 degrees, and the 12 litre chamber is isotropic to within 10 per cent over 300 degrees; for 1.25 MeV gamma radiation this range is extended over 330 degrees for the 3 litre chamber, and 360 degrees for the 12 litre chamber. This report presents the measurements carried out with these chambers as well as the results obtained. These results are then compared to those obtained with other chambers currently used in the field of health physics. (authors) [French] Les chambres d'ionisation presentees dans ce rapport apportent une contribution a la recherche de moyens dosimetriques adaptes aux mesures a effectuer pour assurer une dosimetrie correcte dans le domaine de la radioprotection. L'utilisation d'un melange de teflon charge a 42.5 pour cent en masse de carbone comme materiau constituant les parois de la chambre permet de realiser un dosimetre mesurant directement la dose absorbee dans l'air sous 3OO mg/cm{sup 2} de tissu mou et, par consequent, la dose absorbee dans les tissus mous avec une erreur maximale de 10 pour cent, pour des photons d

  13. The reactions of magnesium and its alloys with moist gases at high temperatures; Les reactions du magnesium et de ses alliages avec les gaz humides aux temperatures elevees

    Energy Technology Data Exchange (ETDEWEB)

    Darras, R [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

    1963-02-15

    , un changement important d'energie d'activation du processus d'oxydation se produit systematiquement, mais aussi a une temperature variable suivant l'atmosphere consideree. Cependant, dans le cas des alliages, la cinetique d'oxydation lineaire classique est generalement precedee de courtes periodes d'induction, a caractere parabolique. On a ensuite mis en evidence et interprete deux possibilites d'inhibition de ia corrosion du magnesium par la vapeur d'eau: soit a la suite d'une fluoration superficielle partielle, soit lorsque le gaz porteur est l'anhydride carbonique. D'autre part, les conditions extremes de l'oxydation, c'est-a-dire les phenomenes d'inflammation qui surviennent a une temperature bien determinee dans chaque atmosphere, ont fait l'objet d'une etude particuliere. Enfin, on s'est efforce de degager la portee de l'ensemble de ces resultats aux deux points de vue fondamental et pratique. (auteur)

  14. Differential effects of NAA and 2,4-D in reducing floret abscission in cestrum (Cestrum elegans) cut flowers are associated with their differential activation of Aux/IAA homologous genes.

    Science.gov (United States)

    Abebie, Bekele; Lers, Amnon; Philosoph-Hadas, Sonia; Goren, Raphael; Riov, Joseph; Meir, Shimon

    2008-01-01

    A previous study showed that the relative effectiveness of 2,4-dichlorophenoxyacetic acid (2,4-D) compared with that of 1-naphthaleneacetic acid (NAA) in reducing floret bud abscission in cestrum (Cestrum elegans) cut flowers was due to its acropetal transport. The aim of the present study was to examine if the differential effect of these auxins on floret abscission is reflected in the expression of Aux/IAA genes in the floret abscission zone (AZ). cDNAs were isolated by PCR-based cloning from the floret AZ of auxin-treated cut flowers. The expression patterns of the cDNAs in various tissues and the effect of indole-3-acetic acid (IAA), applied with or without cycloheximide, on their expression in the floret AZ were examined by northern blot analysis. The regulation of transcript accumulation in the floret AZ in response to NAA or 2,4-D was measured by real-time PCR during auxin pulsing of cut flowers and vase life, concomitantly with floret abscission. Six isolated cDNAs were identified to represent Aux/IAA homologous genes, designated as Cestrum elegans (Ce)-IAA1 to Ce-IAA6. Four Ce-IAA genes were characterized as early auxin-responsive genes (ARGs), and two (Ce-IAA1 and Ce-IAA5) as late ARGs. Only Ce-IAA5 was AZ-specific in floret buds. A temporal regulation of Ce-IAA transcript levels in the floret AZ was found, with 2,4-D inducing higher expression levels than NAA in floret buds. These Ce-IAA expression levels were negatively correlated with floret abscission. The differential transport characteristics of NAA and 2,4-D in cestrum cut flowers were reflected in differential activation of the Ce-IAA genes identified in the floret AZ. Therefore, Aux/IAA genes can be used as molecular markers to measure auxin activity, which reflects free auxin level in the AZ. Two of the identified genes, Ce-IAA1 and Ce-IAA5, may also have a regulatory role in abscission.

  15. L’art du vitrail en France au temps de la reconstruction et de la croissance. Note sur les fonds Hébert-Stevens - Bony conservés aux Archives nationales du monde du travail (Fonds n° 2002 001

    Directory of Open Access Journals (Sweden)

    Christian Hottin

    2009-11-01

    Full Text Available Cet article a pour objet de présenter brièvement le fonds de l’atelier Hébert-Stevens - Bony, entré aux Archives nationales (Archives nationales du monde du travail, Roubaix en 2002

  16. Questions de mathématiques élémentaires à l'usage des candidats aux écoles du Gouvernement, des aspirants au baccalauréat ès sciences et des élèves des établissements d'enseignement secondaire

    CERN Document Server

    Vuibert, Henry

    1879-01-01

    Questions de mathématiques élémentaires à l'usage des candidats aux écoles du Gouvernement, des aspirants au baccalauréat ès sciences et des élèves des établissements d'enseignement secondaire

  17. Electron spin resonance in neutron-irradiated graphite. Dependence on temperature and effect of annealing; Resonance paramagnetique du graphite irradie aux neutrons. Variation en fonction de la temperature et experiences de recuit

    Energy Technology Data Exchange (ETDEWEB)

    Kester, T [Commissariat a l' Energie Atomique, Grenoble (France). Centre d' Etudes Nucleaires, Laboratoire de resonance magnetique

    1967-09-01

    The temperature dependence of the electron spin resonance signal from neutron irradiated graphite has been studied. The results lead to an interpretation of the nature of the paramagnetic centers created by irradiation. In annealing experiments on graphite samples, which had been irradiated at low temperature, two annealing peaks and one anti-annealing peak were found. Interpretations are proposed for these peaks. (author) [French] Le graphite irradie aux neutrons a ete etudie par resonance paramagnetique electronique en fonction de la temperature. La nature des centres paramagnetiques crees par irradiation est interpretee a l'aide des resultats. Des experiences de recuit sur des echantillons de graphite irradie a 77 deg. K ont permis de mettre en evidence deux pics de recuit et un pic d'anti-recuit, pour lesquels des interpretations sont proposees. (auteur)

  18. L’enseignement clinique du droit de l’immigration aux Etats-Unis : la clinique de l’Université de Californie Davis et le programme DACA

    OpenAIRE

    Kahssay, Jihan A.

    2014-01-01

    Les cliniques de l'immigration jouent un rôle important et original dans l'enseignement du droit de l'immigration aux USA. Elle remplissent également un rôle social important dans l'accès au droit pour les publics défavorisés. Dans cette interview, J. Kahssay, avocate et chargée du programme DACA à la clinique du droit de l'immigration de l'Université de Californie Davis (King hall school of law), présente le fonctionnement général de la clinique du droit de l'immigration de UC Davis. Elle dé...

  19. Latte-Abdallah Stéphanie, Images aux frontières, Représentations et constructions sociales et politiques, Palestine, Jordanie 1948-2000, Publications de l’IFPO, 2005, 369 p.

    Directory of Open Access Journals (Sweden)

    Véronique Bontemps

    2008-01-01

    Full Text Available Le traitement médiatique du 11 septembre 2001, et les images, diffusées en boucle sur les chaînes de télévision, des avions s’écrasant sur les Twin Towers ont tragiquement confirmé l’immense pouvoir des images sur notre appréhension de la réalité sociale. L’ouvrage Images aux frontières s’inscrit dans cette interrogation. Il regroupe des articles de sociologues, anthropologues, historiens et politologues autour de la notion « d’image » dans la construction des identités collectives en Palesti...

  20. L’effet de la personnalité sur la performance des étudiants universitaires en sciences de l’administration à l’examen écrit, au test à choix multiple et aux travaux pratiques

    Directory of Open Access Journals (Sweden)

    Sawsen Lakhal

    2017-03-01

    Full Text Available Plusieurs programmes universitaires en sciences de l’administration au Canada ont implanté des réformes majeures, suite aux demandes des organismes d’agrément tels que l’Association to Advance Collegiate Schools of Business (AACSB. Conséquemment, de plus en plus de méthodes d’évaluation des apprentissages sont utilisées. Toutefois, l’introduction de ces méthodes dans les programmes d’études pourrait engendrer des biais aux résultats de l’évaluation des apprentissages. L’étude des facteurs pouvant avoir un effet sur la performance des étudiants aux différentes méthodes d’évaluation devient pertinente dans ce contexte. Ainsi, l’objectif de cette étude consiste à vérifier si la personnalité telle que définie par le modèle des cinq facteurs influence la performance à l’examen écrit, au test à choix multiples et aux travaux pratiques. Deux variables contrôle, le genre et l’âge, sont inclus dans les analyses. Un échantillon de 378 étudiants inscrits à un cours de premier cycle universitaire en sciences de l’administration a répondu à un questionnaire en ligne. Les résultats des analyses des régressions linéaires multiples indiquent que ce ne sont pas toujours les mêmes facteurs de la personnalité qui sont sollicités d’une méthode d’évaluation à l’autre, indiquant l’existence potentielle de biais à l’évaluation des apprentissages. Ces résultats sont discutés au regard de la littérature plus large dans le domaine et touchant à d’autres programmes d’études universitaires. In Canada, a number of university programs in business administration have imbedded major reforms, following requests from accreditation bodies such as the Association to Advance Collegiate Schools of Business (AACSB. Consequently, more and more learning assessment methods are used. However, the introduction of these methods in curricula could lead to bias to the results of learning assessment. In

  1. Potentialités et difficultés d’un projet en humanités numériques (DH) : confrontation aux outils et réorientations de recherche

    OpenAIRE

    Cocco, Christelle; Dessart, Grégory; Serbaeva, Olga; Brandt, Pierre-Yves; Vinck, Dominique; Darbellay, Frédéric

    2018-01-01

    Cet article reprend les potentialités et les difficultés rencontrées lors de l’élaboration d’outils numériques dans le cadre d’un projet interdisciplinaire investiguant des dessins de dieux chez l’enfant et l’adolescent. Il se concentre sur les réorientations du projet qui en ont découlé par rapport aux attentes de départ. En particulier, nous décrirons comment des solutions ont été trouvées pour profiter des potentialités des outils numériques et quels choix ont dû être effectués concernant ...

  2. Normand LANDRY et Anne-Sophie LETELLIER (dir.) (2016), L’éducation aux médias à l’ère numérique. Entre fondations et renouvellement

    OpenAIRE

    Kouawo, Candide Achille Ayayi

    2018-01-01

    L’ouvrage collectif dirigé par Normand Landry et Anne-Sophie Letellier porte sur la thématique de l’éducation aux médias, et ce, dans une société où les technologies numériques sont omniprésentes. Dès l’introduction, les auteurs nous immergent dans une société hautement médiatisée où, à travers les réseaux numériques, nous avons accès à de multiples services. Il est donc impératif de poser un regard critique sur ces nouveaux médias, sur l’information, sur les pratiques et sur les attitudes qu...

  3. Différences corporelles et identités collectives : la politique du genre et de la race dans la recherche biomédicale aux États-Unis

    OpenAIRE

    Epstein, Steven

    2015-01-01

    À la suite des changements récents, les politiques en matière de recherche dans le domaine de la santé aux Etats-Unis exigent l'inclusion des femmes et des membres de minorités raciales et ethniques comme sujets expérimentaux dans la recherche biomédicale. Cet article analyse les débats qui sous-tendent ces politiques et qui concernent la gestion médicale des corps, des groupes, des identités et des différences. Une grande part de l'incertitude qui entoure ces nouvelles politiques reflète le ...

  4. {pi}{sup -}-p proton scattering at 516, 616, 710, 887 and 1085 MeV (1961); Diffusion de protons {pi}{sup -}-p aux energies de 516, 616, 710, 887 et 1085 MeV (1961)

    Energy Technology Data Exchange (ETDEWEB)

    Barloutaud, R; Choquet, C; Gaillard, J M; Heughebaert, J; Leveque, A; Lehmann, P; Meyer, J; Revel, D [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires; Grard, F; Heughebaert, J [I.I.S.N., Lab. des Hautes Energies, Bruxelles (Belgium); Grard, F; Macleod, G; Montanet, L [Conseil Europeen pour la recherche nucleaire, Lab. europeen pour la physique des particules, Geneve (Switzerland)

    1961-07-01

    {pi}{sup -}-p collisions at energies of 516, 616, 710, 887 and 1085 MeV were observed by means of the 20 cm Saclay bubble chamber. Angular distributions for elastic scattering were obtained and analyzed. Total cross sections for elastic and inelastic scattering for {pi}{sup -}-p collisions and for the T = 1/2 state were determined. (authors) [French] Nous avons etudie des collisions entre pions negatifs et protons aux energies de 516, 616, 710, 887 et 1085 MeV, au moyen de la chambre A bulles de 20 cm de Saclay. Les distributions angulaires de diffusion elastique ont ete obtenues et analysees. Nous avons determine les sections efficaces totales pour les diffusions elastiques et inelastiques {pi}{sup -}-p et pour ces processus dans l'etat T = 1/2. (auteurs)

  5. Règlement de sécurité contre l'incendie relatif aux établissements recevant du public dispositions générales et commentaires de la commission centrale de sécurité

    CERN Document Server

    2015-01-01

    L’ouvrage comporte : les dispositions des Codes de la construction et de l'habitation, et l'urbanisme relatives à la protection contre l'incendie ; les articles : GN, GE, CO, AM, DF, CH, GZ, EL, EC, AS, GC et MS ; les instructions techniques ; les textes relatifs aux commissions de sécurité ; les textes concernant l’accessibilité des personnes handicapées ; les textes intéressant les qualifications des personnels des services de sécurité des ERP (SSIAP) ; la jurisprudence sur les ERP avec des arrêts du Conseil d'État et des arrêts des cours administratives d'appel.

  6. Grégory Quenet, 2005, Les Tremblements de terre aux dix-septième et dix-huitième siècles. La naissance d’un risque, Seyssel, Champ Vallon, 587 p.

    Directory of Open Access Journals (Sweden)

    Stéphane Callens

    2005-06-01

    Full Text Available A la question «  Qu’est-ce que les Lumières ? », des réponses inadéquates sont souvent apportées : le dix-huitième siècle aurait été ce moment charnière, privilégiant un idéal d’assujettissement du monde naturel, prélude aux catastrophes du monde industriel. Cette historiographie naïve est battue en brèche dans l’ouvrage de Grégory Quenet consacré à la naissance d’un risque, le risque sismique. Grégory Quenet est un historien qui a travaillé à la vérification des données sismiques pour la Fra...

  7. Publicité alimentaire destinée aux enfants : examen de la portée de l’exposition, du pouvoir et des répercussions selon le contexte

    Directory of Open Access Journals (Sweden)

    Rachel Prowse

    2017-01-01

    Full Text Available Introduction : La publicité alimentaire a des répercussions sur les connaissances et les comportements alimentaires des enfants ainsi que sur leur santé. La réglementation actuelle au Canada est axée sur la restriction des aspects promotionnels de la publicité alimentaire, mais elle accorde peu d’attention, voire aucune, à l’endroit où se fait l’expérience alimentaire des enfants. Il est essentiel de comprendre où s’inscrit la publicité alimentaire dans le quotidien des enfants pour pouvoir les protéger. Notre étude fait état de la littérature sur la publicité alimentaire destinée aux enfants au Canada en fonction du contexte. Méthodologie : L’auteure a consulté des bases de données pour trouver des travaux de recherche canadiens portant sur l’exposition des enfants et des jeunes (de 2 à 17 ans à la publicité alimentaire, sur le pouvoir et les répercussions que celle-ci peut avoir sur les enfants dans différents contextes et sur la façon dont la réglementation actuelle peut en atténuer l'effet sur les enfants. Ont été sélectionnées les études en anglais, examinées par des pairs et publiées entre 2000 et 2016. Résultats : Vingt-cinq études se sont intéressées à l’exposition des enfants à la publicité alimentaire et au pouvoir ou aux répercussions qu’elle peut avoir sur ceux-ci à la maison (par la télévision ou Internet (n = 12, dans les écoles publiques (n = 1, dans les épiceries (n = 8, dans les restaurants rapides (n = 2 et en général (n = 2. Les tendances de la recherche révèlent que les aliments malsains ciblent les enfants par différentes techniques promotionnelles, qui se chevauchent selon les contextes. Il existe plusieurs lacunes en matière de recherche dans ce domaine, ce qui donne un portrait incomplet et potentiellement sous-estimé de la publicité alimentaire destinée aux enfants au Canada. Les données probantes disponibles indiquent que les approches canadiennes

  8. Mesures de spectrométrie et de dosimétrie neutron aux postes de travail pour l'étalonnage de dosimètres individuels PGP-DIN

    OpenAIRE

    Itié, C.; Muller, H.; Asselineau, B.; Médioni, R.; Crovisier, P.; Valier-Bradier, P.; Groetz, J. E.; Piot, J.

    2002-01-01

    International audience; (ManuAcrit r e p le 3 juillet 2002, accepté le 29 septembre 2002) Dans le cadre de la mise en application des recommandations décrites dans la publication 60 de la CIPR, des mesures de spectrométrie neutron ont été réalisées à plusieurs postes de travail au CEA de Valduc. Le but de ces mesures était la détermination de nouveaux coefficients d'étalonnage h affecter aux dosimètres individuels neutron PGP-DIN afin de restituer correctement les doses reçues par les opérate...

  9. Compatibility problems of canning materials with carbon dioxide at high temperatures; Problemes de comptabilite des materiaux de gainage avec le gaz carbonique aux temperatures elevees

    Energy Technology Data Exchange (ETDEWEB)

    Darras, R; Loriers, H [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

    1964-07-01

    stabilisees au niobium, sans addition de molybdene, s'averent les plus recommandables. A partir de 700 C, la nuance 20 Cr - 25 Ni + Nb semble meme s'imposer par rapport a la nuance classique 18 Cr - 10 Ni + Nb, surtout en raison d'une tendance moins accentuee aux penetrations locales d'oxyde. Par ailleurs, l'alliage fer-aluminium a 25 pour cent d'aluminium en poids, presente une resistance a l'oxydation remarquable, tout en permettant une economie appreciable de neutrons, mais sa mise en oeuvre technologique reste delicate. Enfin, des etudes recentes ont permis d'etablir que certains alliages a base de zirconium, renfermant 1 a 4 pour cent de cuivre en poids, pourraient constituer une solution valable jusqu'a des temperatures de l'ordre de 600 C. Ces alliages s'oxydent en effet beaucoup moins rapidement que le zirconium non allie et d'autres alliages classiques, qui avaient ete elimines precedemment pour cette raison. Finalement, parmi les materiaux capables de supporter les conditions physicochimiques auxquelles seraient soumises les gaines d'elements combustibles dans les reacteurs a moyenne temperature, les plus susceptibles d'application immediate seraient les aciers inoxydables austenitiques et les alliages zirconium-cuivre, dont la metallurgie est relativement bien connue. Dans le futur, l'interet pratique des alliages de beryllium et des alliages fer-aluminium devrait croitre, compte tenu des etudes poursuivies en vue de l'amelioration de leurs proprietes mecaniques et de leur mise en oeuvre. (auteurs)

  10. Pollution Atmosphérique et Santé: Corrélation ou Causalité? Le Cas de la Relation entre l'Exposition aux Particules et la Mortalité Cardio-pulmonaire.

    Science.gov (United States)

    Dab, William; Ségala, Claire; Dor, Frédéric; Festy, Bernard; Lameloise, Philippe; Moullec, Yvon Le; Tertre, Alain Le; Médina, Sylvia; Quénel, Philippe; Wallaert, Benoît; Zmirou, Et Denis

    2001-02-01

    De nombreuses études épidémiologiques ont observé dans des contextes différents une faible relation à court terme entre les particules et la mortalité cardio-pulmonaire, même quand les normes de qualité de l'air n'étaient pas dépassées. La causalité de cette relation est un enjeu de santé publique en raison de l'importance de la population exposée. Notre objectif est de faire l'inventaire critique des arguments utilisés dans 15 revues de la littérature publiées. Nous expliquons l'importance de distinguer la validité de la causalité et analysons de façon systématique les différents critères de jugement dans le contexte des études écologiques temporelles. Notre conclusion est que la relation observée est valide et que la plupart des critères de causalité sont respectés. Diminuer le niveau d'exposition des populations aux particules est souhaitable. En Europe, en agissant à la source, notamment sur les émissions Diesel, on diminuera aussi d'autres polluants qui peuvent jouer un rôle sanitaire. Aux États-Unis, la situation est plus complexe car les particules sont surtout secondaires. Il est également indispensable de poursuivre les recherches pour mieux connaître les déterminants des expositions globales des individus et mieux comprendre le rôle toxique des différents facteurs physico-chimiques des particules.

  11. Vers une méthode de réglage expérimentale des commandes PID floues : application aux systèmes électromécaniques

    Science.gov (United States)

    Maussion, P.; Hissel, D.

    1998-08-01

    Electrical and electromechanical systems have to satisfy to more and more constrained specifications. Therefore, non-linear control structures must be spread out. Among them, fuzzy logic control can be one interessant and performant alternative. The main handicap of this kind of stucture resides in the fact that the tuning parameters are very numerous. In this paper, we first propose an on-site tuning strategy of this set of parameters in the case of a fuzzy proportionnal-integrative controller based on the experimental designs methodology and on a limited number of pre-defined closed-loop experiments. Then, a complete set of predetermined parameters for a fuzzy proportionnal-integrative-derivative controller will be given. These parameters have been optimized on a specified benchmark according to an IAE criterion. They are calculated like the Ziegler-Nichols or Broïda methodology on conventional controllers; that is, using a single open-loop step response to obtain a model of a first-order plus delay transfert function. Validity limits for this method are provided. Les systèmes électriques ou électromécaniques doivent satisfaire à des spécifications de plus en plus contraignantes qui nécessitent la mise au point de structures de commande non linéaires. Parmi celles-ci, la commande par logique floue constitue une alternative intéressante et performante. Son principal handicap réside dans le nombre très important de paramètres à régler. Dans cet article, nous nous proposons de systématiser ces réglages dans deux cas de figure. Tout d'abord nous utiliserons la méthodologie des plans d'expérimentations pour effectuer un réglage sur site d'un contrôleur flou de type proportionnel-intégral. Ce réglage sera obtenu en ne réalisant qu'un nombre limité d'essais expérimentaux en boucle fermée avec des combinaisons prédéfinies des paramètres à régler. La combinaison optimale de ces paramètres au sens d'un critère de type IAE (Intégrale de la

  12. Logiques touristiques en station de haute-montagne : quelles évolutions possibles vers la durabilité ?

    Directory of Open Access Journals (Sweden)

    Laurent Arcuset

    2009-12-01

    Full Text Available Ce texte part des enseignements issus d’une évaluation des pratiques touristiques à l’aune des principes du tourisme durable, réalisée en 2004 dans le cadre d’un réseau national piloté par l’Agence Française d’Ingénierie Touristique (aujourd’hui ODIT France, pour la station de Valloire, station de première génération de Maurienne dont le développement et la modernisation dans les années 2000 sont allés de pair avec un vaste programme immobilier. L’article explore les enjeux et les difficultés de la mise en œuvre du développement durable à Valloire, pose la question de la « révolution culturelle » que les acteurs devraient accomplir pour changer de modèle de développement économique, et suggère quelques pistes pour y parvenir. L’approche locale du « tourisme durable », en effet, semble pour l’heure plutôt tendre – comme dans bien d’autres stations de haute montagne – vers une gestion plus environnementale des fonctions urbaines de base que vers une véritable remise en cause d’un modèle touristique reposant sur le triptyque développement du domaine skiable, sécurisation de la ressource neige et programmes immobiliers de tourisme.This text starts from the teachings stemming from an evaluation of the tourist practices in the light of sustainable tourism principles, realized in 2004 within the framework of a national network piloted by the French Agency of Touristic Engineering (today ODIT France, for the ski resort of Valloire, first-generation resort in the Maurienne, which development and modernization in the 2000s kept pace with a vast real estate program. The article investigates the stakes and difficulties of the implementation of sustainable development in Valloire, asks the question of the "cultural revolution" which the actors should achieve to change the model of economic development, and suggest some tracks to reach there. The local approach of "sustainable tourism", indeed, seems for the moment rather to aim - as in many other high mountain ski resorts - towards a more environmental management of the basic urban functions than a real questioning of a tourist model based upon the triptych development of the ski slopes, securizing of the snow resource and touristic real estate programs.

  13. Les tubes de la pornosphère : des logiques documentaires entre information et déformation

    OpenAIRE

    Le Deuff, Olivier

    2014-01-01

    Les tags sur les plateformes de vidéos pornographiques en libre accès, la pornosphère, constituent l’expression d’un nouveau discours qui tend à se populariser dans le langage courant. D’autres éléments organisationnels viennent accompagner les systèmes folksonomiques afin d’améliorer l’accès au contenu pour les usagers et leurs possibilités d’action. Seulement, cette liberté d’accès dissimule une complexité plus grande, celle qui finit par former les usagers à une nouvelle grammaire, qui inf...

  14. Sécurité d'État et insécurité nationale au Mali : les logiques ...

    African Journals Online (AJOL)

    PhD, Socio économiste, Directeur, CERNES, Bamako, Mali. .... Au regard de la référence que constitue la définition sécuritaire régalienne de l'État et de son monopole .... Sur le plan économique, le cycle accumulation, rupture et reconstitution.

  15. Pourquoi le Grundgedanke (T. 4.0312 de Wittgenstein est si “Fondamental”?

    Directory of Open Access Journals (Sweden)

    André Leclerc

    1998-12-01

    Full Text Available La pensée fondamentale de Wittgenstein affirme que les constantes logiques ne représentent pas, ne fonctionnent pas sémantiquement comme des noms. En apparence triviale, cette pensée, nous le montrerons, à des ramifications étonnantes dans la philosophie du premier Wittgenstein, en particulier en ce qui concerne sa conception de la logique. Notre but est d'interpréter l'aphorisme en question (T. 4.0312 en montrant comment il se rapporte aux thèses et théories les plus importantes du Tractatus, et comment il permet de les faire tenir ensemble d'une façon cohérente, justifiant par là son caractère "fondamental". Nous tentons également d'apporter une réponse aux questions suivantes : les propositions complexes sont-elles encore - comme les propositions atomiques - des "images" de la réalité ? et quelle est cette "logique des faits" dont parle Wittgenstein dans l'aphorisme sous examen ?

  16. Use of optical aids by visually impaired students: social and cultural factors Uso de auxílios ópticos por escolares com deficiência visual: fatores socioculturais

    Directory of Open Access Journals (Sweden)

    Gelse Beatriz Martins Monteiro

    2006-08-01

    Full Text Available PURPOSE: To identify conceptions, social and cultural factors regarding the use of optical aids by visually impaired students and to present information to health and educational professionals. METHODS: Qualitative research using spontaneous theater (interactive theater modality based on improvisation as research instrument. To analyze data, an adapted form of the collective subject discourse technique - procedures for organization of verbal data - was applied. Scenes, gestures, expressions, silences and behaviors were added to the original proposal. The study population included all visually impaired students from elementary public schools, aged 10 to 14 years who attended a resource room in a São Paulo state city. The students were examined at a university low vision service. RESULTS: Little knowledge about the impairment and difficult adaptation to use of optical aids were identified. The students' behavior showed denial of own problems, discomfort on public use of aids and lack of participation in own health decisions. CONCLUSION: Analysis through spontaneous theater session allows the professional to gather information which is not possible to acquire in the health assistance atmosphere. Needs, difficulties and barriers the users found before the prescribed treatment were identified.OBJETIVO: Identificar concepções e verificar aspectos socioculturais a respeito do uso de auxílios ópticos por escolares deficientes visuais e oferecer informações a profissionais das áreas de saúde e educacional. MÉTODOS: Utilizou-se pesquisa qualitativa mediante aplicação da técnica do teatro espontâneo - modalidade de teatro interativo, de improviso, construído a partir de histórias contadas pelos participantes. Para análise das informações colhidas, foi adaptada a técnica de análise do discurso do sujeito coletivo, conjunto de procedimentos de organização de dados discursivos de natureza verbal. Por se tratar de técnica psicodram

  17. Pilot Plant for Food Irradiation in The Netherlands; Usine Pilote pour l'Irradiation de Denrees Alimentaires aux Pays-Bas; Opytnaya ustanovka po oblucheniyu pishchevykh produktov v Gollandii; Planta Piloto de Irradiacion de Alimentos en los Paises Bajos

    Energy Technology Data Exchange (ETDEWEB)

    De Zeeuw, D.; Van Kooy, J. G. [Association EURATOM-ITAL, Wageningen (Netherlands)

    1966-11-15

    The main problem raised by pilot- plant investigations is to devise a method for bridging the gap between developmental work in the laboratory and the practical applications of this work. How can the knowledge acquired in the laboratory be passed on to manufacturers or processors? The following questions are pertinent: (a) Is the pilot plant regarded as an immediate precursor of commercial plants? (b) How is a 100-fold increase in product handling realized? (c) How is commercial interest increased? (d) Who carries the final responsibilities for the programme of the pilot plant? (e) What technical facilities are needed, and (f) How the pilot plant should be organized to keep a constant flow of information between interested parties. All these aspects are discussed on the basis of a planned pilot plant for food irradiation in the Netherlands. (author) [French] Le principal probleme que pose l'etude d'une installation pilote consiste a franchir le pas entre les travaux en laboratoire et leur application pratique. En d'autres termes, comment les connaissances acquises en laboratoire peuvent-elles etre transmises aux constructeurs ou aux utilisateurs? Les questions suivantes se posent: a) L'installation pilote est-elle consideree comme le precurseur immediat d'une version commerciale? b) comment peut-on multiplier sa capacite par 100? c) Comment peut-on la rendre commercialement plus interessante? d) Qui est responsable en dernier ressort du programme de l'installation pilote? e) Quels sont les moyens techniques necessaires? f) Comment organiser l'installation pilote pour assurer un echange constant de renseignements entre les parties interessees? Tous les points mentionnes ci-dessus sont etudies en partant des donnees relatives a une installation pilote d'irradiation dont la construction est envisagee aux Pays-Bas. (author) [Spanish] El problema principal que plantea el estudio de las plantas piloto es idear un metodo que sirva de nexo entre los trabajos de

  18. Analyse d’un genre de discours spécialisé : les lettres annuelles de Warren Buffett aux actionnaires de Berkshire Hathaway et leur spécificité

    Directory of Open Access Journals (Sweden)

    Catherine RESCHE

    2010-09-01

    Full Text Available Cette étude a pour objet d’analyser un genre de discours spécialisé particulier au monde des entreprises. Les lettres aux actionnaires rédigées par Warren Buffett, dont la portée dépasse le cercle des actionnaires concernés, suscitent un intérêt hors du commun. Une analyse qualitative et quantitative portant sur le fond et la forme nous a permis de les comparer à un corpus témoin d’autres lettres aux actionnaires pour faire ressortir leur spécificité. La perspective diachronique qui a été adoptée nous a également donné l’occasion de mesurer l’évolution interne de ces documents sur une période de 32 ans. Les résultats de l’étude font ressortir une très grande présence de l’auteur dans son discours et la nature dialogique de ce discours. La « marqueterie discursive » atypique qui caractérise le style Buffett conduit également à envisager ses lettres comme des macro-actes de langage. Néanmoins, elles se rattachent sans ambiguïté au genre « lettre aux actionnaires » par la situation dans laquelle elles sont produites, le but qu’elles poursuivent et la fonction sociale qu’elles remplissent. Ce sont ces mêmes éléments qui permettent de les considérer comme un échantillon de discours spécialisé, même si leur syntaxe n’est pas spécifique et si le discours n’est pas particulièrement technique.The paper focuses on a particular genre which is characteristic of the corporate world. Warren Buffett’s letters to the shareholders seem to arouse unprecedented interest among readers who greatly outnumber his shareholders. The letters’ form and content were analyzed quantitatively and qualitatively and compared to a sample corpus of other letters to the shareholders in order to determine their specificity. The diachronic approach that was chosen was an opportunity to observe how Buffett’s letters have evolved over a period of 32 years. The findings of this analysis seem to indicate that the

  19. Séroprévalence et facteurs associés au VIH et aux hépatites virales B et C dans la ville de Bafoussam au Cameroun

    Science.gov (United States)

    Mbopi-Keou, Francois-Xavier; Nkala, Isabelle Vanessa Monthe; Kalla, Ginette Claude Mireille; Nguefack-Tsague, Georges; Kamga, Hortense Gonsu; Noubom, Michel; Mvogo, Côme Ebana; Sosso, Maurice Aurelien

    2015-01-01

    Introduction L'objectif de ce travail était de déterminer la séroprévalence et les facteurs associés au VIH et aux hépatites virales B et C dans la ville de Bafoussam au Cameroun. Méthodes Il s'agissait d'une étude descriptive et analytique réalisée de février 2012 à Juin 2012 dans la ville de Bafoussam au Cameroun. Pour cette étude, nous avons obtenu une clairance éthique. Résultats Au total, 982 personnes ont été dépistées pour le VIH et les hépatites virales B et C. Les femmes représentaient 56,3% des personnes dépistées. La tranche d’âge la plus représentée était celle des 20 à 24 ans. L’âge médian était de 34,5 ans. Les prévalences du VIH, de l'AgHBs, et de l'Ac anti HCV étaient respectivement de 6,0%, 4,1%, et 0,4%. La prévalence du VIH était 2 fois plus élevée parmi les femmes que les hommes avec 8,1% contre 3,5% (p=0,01). Les prévalences les plus élevées ont été observées chez les personnes de 30 à 34 ans, 40 à 44 ans avec 15,0% et 11,5% (p=0,01), les personnes sans emploi avec 11,1% (pVIH n’était pas directement liée aux comportements et pratiques sexuels de la population de l’étude. On enregistrait une prévalence élevée de 29,3% chez les individus ayant déclaré avoir au moins une infection sexuellement transmissible (p=0,000). Conclusion Il apparait urgent de mettre en place des stratégies de prévention contre le VIH, les hépatites virales et les facteurs associés au Cameroun. PMID:26113899

  20. Les mécanismes d'action des détergents et les doubles couche électriques aux interfaces Action Mechanisms of Detergents and Double Electric Layer At Interfaces

    Directory of Open Access Journals (Sweden)

    Briant J.

    2006-11-01

    Full Text Available Les doubles couches électriques aux interfaces jouent un rôle important dans l'action des additifs détergents ioniques, surtout dans la stabilisation des suspensions. Les phénomènes électrocinétiques aux interfaces : électroosmose, potentiel d'écoulement, électrophorèse, potentiel de sédimentation permettent de mettre en évidence la double couche électrique et d'en déterminer certaines caractéristiques signe de la charge de la couche mobile, potentiel électrocinétique, etc. Les relations entre la stabilité des suspensions et l'interaction des doubles couches électriques ont fait l'objet d'études approfondies de Deriaguin, Verwey et Overbeek. Ces auteurs ont analysé le mécanisme d'action des doubles couches électriques et la façon dont elles pouvaient créer des forces de répulsion capables de surmonter les forces d'attraction de Van der Waals entre particules. Leur analyse permet d'expliquer les observations faites sur les effets de la charge des particules, la nature des ions fixés, la concentration de la phase dispersante en produits actifs. Le mécanisme d'action des doubles couches électriques permet peut-être d'appréhender mieux le mécanisme d'action des additifs non ioniques. Double electric loyers at interfaces play an important part in the action of ionic detergent additives, especially in the stability of suspensions. Electrokinetic phenomena at interfaces (electroosmosis,flow potential, electrophoresis, sedimentation potential can be used to reveal the double electric layer and to determine various properties such as the sign of the charge of the mobile loyer, the electrokinetic potential, etc. The relations between the stabillity of suspensions and the interaction of double electric loyers have been the subject of in-depth research by Deriaguin, Verwey and Overbeek. The authors have analyzed the action mechanism of double electric loyers and the way they can create repulsion forces capable of overcoming

  1. Entre Africanité et Afro-Américanité. Divinités « akan » et culte des ancêtres aux États-Unis

    Directory of Open Access Journals (Sweden)

    Pauline Guedj

    2007-07-01

    Full Text Available En 1967, naquit aux États-Unis la première maison de culte « akan » qui, s’inspirant des pratiques d’un sanctuaire de religion dite « traditionnelle » à Larteh Kubease au Ghana, rassemblait en son sein des adeptes afro-américains de ce culte fraîchement importé. En revenant sur l’histoire du mouvement « akan » aux États-Unis, sur ses réalités actuelles et sur les rituels sur lesquels il repose, l’auteur se propose d’analyser la manière dont le culte des ancêtres constitue aujourd’hui pour les fidèles une nouvelle stratégie, leur permettant de mêler leurs propres expériences afro-américaines à une tentative jusqu’auboutiste de retour à l’identité africaine ancestrale et immuable qu’ils espèrent recouvrer.The first « Akan » shrine house based on the practices of the Akonedi Shrine in Larteh Kubease, Ghana, was born in New York in 1967. It assembled many African American practitioners who used « Akan » religion to search for their roots. Analyzing the history of the « Akan » movement in America, dealing with its current reality as well as describing some of its rituals, this paper will study the way in which ancestors worship constitute today a new step in the reafricanization process in North America. Worshipping their African American ancestors along with their African gods, the practitioners of the « Akan » religion have managed to include their own experience in their effort to go back to their ancestral roots.La primera casa-templo « akan » surgió en los Estados Unidos en el año 1967, agrupando adeptos afro-americanos que se inspiraban de las prácticas de un santuario de religión « tradicional » en Larteh Kubease (Ghana. Retomando la historia del movimiento « akan » en Estados Unidos, así como la descripción de sus realidades actuales y de los rituales que lo conforman, la autora propone analizar en que medida el culto a los ancestros constituye hoy en día una nueva

  2. DE L’IRRATIONNEL AU RATIONNEL : QUAND LES ANIMAUX TIENNENT LE DISCOURS DE LA VÉRITÉ AUX HOMMES / FROM NON-RATIONALE TO RATIONALE: WHEN ANIMALS POSSESS TRUTH SPEECH TO HUMAN BEINGS / DE LA IRAŢIONAL LA RAŢIONAL: CÂND ANIMALELE DEŢIN DISCURSUL ADEVĂRULUI ÎN FAŢA FIINŢELOR UMANE

    Directory of Open Access Journals (Sweden)

    Yao Lambert Konan

    2013-11-01

    Full Text Available Cette étude, qui s’est intéressée à la figuration faunesque dans les contes de l’Afrique noire, a saisi l’animal en tant que symbole thématique et force agissante. Le bestiaire dans l’univers narratif des textes oraux assume une triple fonctionnalité : véhiculer les idéaux de la société, indiquer les repères de conduite à tenir dans telle ou telle circonstance et se conformer aux normes communautaires. La symbolisation animale permet de déboucher sur la sagesse humaine, élément fondamental de la paix sociale.

  3. Lutte contre les cerscosporioses du bananier aux Antilles françaises : Banatrace, un système d'information géographique multi-acteurs pour la gestion et la traçabilité des épandages aériens

    OpenAIRE

    DUMAS, Marine; DUMAS, Marine

    2011-01-01

    Comment un système d’information géographique peut-il aider à améliorer la fiabilité des traitements aériens contre les maladies fongiques du bananier tout en réduisant leur impact environnemental ? Des réponses aux Antilles françaises avec l’outil informatique multi-acteurs Banatrace, conçu pour aider les gestionnaires à répondre aux différents besoins de traçabilité imposée par la réglementation récente sur les épandages aériens.

  4. "Quelque part {u00E1 un tournant du destin..." ; "Ciel vide, bőte aux lettres vide, chemin vide..." ; "Singe indécis..." ; Ithaque / Tõnu Õnnepalu ; trad. par Antoine Chalvin avec le concours de l'auteur

    Index Scriptorium Estoniae

    Õnnepalu, Tõnu

    1992-01-01

    Orig.: "Kusagil saatuse käänakul..." ; "Tühi taevas, tühi postkast, tühi kruusatee..." ; "Otsustusvõimetu ahv..." ; Ithaka. Sisu: "Quelque part {u00E1 un tournant du destin..." ; "Ciel vide, bőte aux lettres vide, chemin vide..." ; "Singe indécis..." ; Ithaque. T. Õnnepalust lk. 93. Kadriann Soosaare illustratsioon lk. 97

  5. Genre et stéréotypage médiatique: du procès des médias aux processus psycho-sociaux de facilitation ou de réactance

    Directory of Open Access Journals (Sweden)

    Claude Chabrol

    2016-12-01

    Full Text Available Les discours sociaux publiquement produits dans les sociétés occidentales contemporaines mettent en oeuvre des opérations de stéréotypages qui évoquent des représentations bien connues et parfois opposées, conformes ou non aux catégorisations psycho-sociales profondes. Leurs fonctions premières ne semblent pas être de renforcer les catégorisations de genre les plus traditionnelles ou de promouvoir leurs avatars modernes opposés, mais bien plutôt de les rendre compatibles entre elles, au risque de les vider de leurs significations premières au profit d’un Imaginaire social qui les concilierait toutes à la façon dont les mythes tentaient eux aussi pour Levi Strauss d’opérer une conciliation et un dépassement de représentations sociales contraires dans les sociétés antérieures. Ces discours suscitent aussi des phénomènes importants de résistance dits de “reactance”. Des psychologues proposent aussi de renforcer la résistance à cette persuasion qu’ils ont d’ailleurs souvent étudiée de près.

  6. Absolute NMR shielding scales and nuclear spin–rotation constants in {sup 175}LuX and {sup 197}AuX (X = {sup 19}F, {sup 35}Cl, {sup 79}Br and {sup 127}I)

    Energy Technology Data Exchange (ETDEWEB)

    Demissie, Taye B., E-mail: taye.b.demissie@uit.no; Komorovsky, Stanislav; Repisky, Michal; Ruud, Kenneth [Centre for Theoretical and Computational Chemistry, Department of Chemistry, UiT The Arctic University of Norway, N-9037 Tromsø (Norway); Jaszuński, Michał [Institute of Organic Chemistry, Polish Academy of Sciences, Kasprzaka 44, 01 224 Warszawa (Poland)

    2015-10-28

    We present nuclear spin–rotation constants, absolute nuclear magnetic resonance (NMR) shielding constants, and shielding spans of all the nuclei in {sup 175}LuX and {sup 197}AuX (X = {sup 19}F, {sup 35}Cl, {sup 79}Br, {sup 127}I), calculated using coupled-cluster singles-and-doubles with a perturbative triples (CCSD(T)) correction theory, four-component relativistic density functional theory (relativistic DFT), and non-relativistic DFT. The total nuclear spin–rotation constants determined by adding the relativistic corrections obtained from DFT calculations to the CCSD(T) values are in general in agreement with available experimental data, indicating that the computational approach followed in this study allows us to predict reliable results for the unknown spin–rotation constants in these molecules. The total NMR absolute shielding constants are determined for all the nuclei following the same approach as that applied for the nuclear spin–rotation constants. In most of the molecules, relativistic effects significantly change the computed shielding constants, demonstrating that straightforward application of the non-relativistic formula relating the electronic contribution to the nuclear spin–rotation constants and the paramagnetic contribution to the shielding constants does not yield correct results. We also analyze the origin of the unusually large absolute shielding constant and its relativistic correction of gold in AuF compared to the other gold monohalides.

  7. O Passeio Público do Rio de Janeiro: Análise Histórica com Auxílio da Representação Gráfica Digital

    Directory of Open Access Journals (Sweden)

    Naylor Barbosa Vilas Boas

    2000-12-01

    Full Text Available O presente artigo tem por objetivo expor uma breve análise histórica do Passeio Público do Rio de Janeiro, um dos mais importantes jardins públicos da cidade ao longo do século 19, concebido originalmente no século 18, por mestre Valentim da Fonseca e Silva, ilustre artista do Rio colonial. Por meio de modernos recursos de reconstrução virtual e modelagem eletrônica, baseados em intensas pesquisas iconográficas e na análise de antigos relatos de viajantes, foram recriados os dois principais momentos desse jardim ao longo desses dois séculos de existência: o Passeio Público original de mestre Valentim e o passeio remodelado na reforma romântica de 1860, por Auguste Glaziou. Originalmente fazendo parte de um trabalho que trata de questões de análise da percepção do espaço, a utilização de recursos de reconstrução virtual e modelagem eletrônica apresenta-se como uma importante ferramenta de auxílio na reconstituição de espaços que não mais existem fisicamente, permitindo assim a simulação das percepções vivenciadas por um observador hipotético caminhando por eles

  8. L’utilisation d’adhésifs optiques réticulables aux UV pour le collage d’objets d’art en verre transparent coloré, à surface d’encollage réduite

    Directory of Open Access Journals (Sweden)

    Viviane Bechoux

    2011-11-01

    Full Text Available La recherche porte sur une double problématique :1° La possibilité d’utiliser les adhésifs réticulables aux UV  pour coller le verre transparent coloré. 2° Le collage du verre  s’avère très complexe quand les éléments à assembler sont fins, fragiles et quand la surface d’encollage est réduite à quelques millimètres.Dans ce cas précis, la solidité mécanique du collage et la rapidité de polymérisation de l’adhésif sont les premiers critères à prendre en compte pour assurer un assemblage final fiable.This research focuses on two issues : 1° The possibility to use UV-crosslinkable adhesives to bond transparent coloured glass.2° The glass bonding is very complex when the parts to be joined are thin, fragile, and when the bonding surface is reduced to a few millimetres in size. In this case, the mechanical strength of the bonding and the speed of the curing process of the adhesive are the first criteria to be taken into account to ensure a reliable final bonding.

  9. Dissecção endoscópica da artéria torácica interna com auxílio robótico Endoscopic harvest of internal thoracic artery with robotic assistance

    Directory of Open Access Journals (Sweden)

    Paulo R .L. Prates

    2004-06-01

    Full Text Available A cirurgia robótica é hoje um método viável para reduzir o trauma e as morbidades relacionadas em cirurgia cardíaca. Em nossa instituição, o auxílio robótico já foi utilizado de forma bem-sucedida em implantes toracoscópicos de eletrodos epimiocárdicos para marcapassos biventriculares. O objetivo deste artigo é descrever a técnica por nós utilizada para dissecção da artéria torácica interna (ATI, mediante toracoscopia com apoio do robô AESOP e relatar seus resultados iniciais obtidos em nove pacientes.Robotic surgery is today a reliable method to reduce trauma and related comorbidities in cardiac surgery. In our institucion, robotic assistance has been effectively used for thoracoscopic implantation of epimyocardial leads for biventricular pacing. The objective of this article is to describe the technique that we developed to dissect the internal thoracic artery using thoracoscopy assistance with AESOP robotic system and to report the initial results obtained with its use in nine patients.

  10. Saqayti: For greater rationalization of tapstand water supplies Une meilleure rationalisation de la distribution d’eau grâce aux Saqaytis Saqayti para racionalizar la utilización de los puntos de abastecimiento de agua

    Directory of Open Access Journals (Sweden)

    T. Hascoet

    2011-04-01

    foyers, en particulier dans les zones urbaines et péri-urbaines, ne peuvent actuellement toujours pas bénéficier d’un raccordement individuel au réseau d’eau potable pour des raisons structurelles et/ou financières. Afin de leur garantir toutefois un accès à ce service essentiel, les autorités locales ont mis en place des points d’eau communaux collectifs -les bornes fontaines- où L’eau, financée par les communes, est desservie gratuitement et sans restriction d’accès. Mais si ces bornes fontaines constituent une solution à court terme, elles ne permettent ni d’assurer une gestion rationnelle de la ressource, ni de la partager équitablement. En effet, cet accès libre et gratuit entraîne surconsommations, gaspillages et utilisation de l’eau par des consommateurs qui n’étaient pas initialement ciblés par cette aide. Ceci a engendre de fait des charges élevées pour les municipalités concernées, qui menacent la durabilité du service dans son ensemble. Partant de ce constat, et conformément aux recommandations de la communauté internationale et de la société civile, un nouveau type de point d’eau, la borne fontaine « Saqayti », a été développé pour distribuer de l’eau prépayée à des usagers dans les villes de Rabat, Tanger et Tétouan. L’accès y est contingenté aux seuls porteurs d’une clé à puce électronique, préalablement choisis au cas par cas par l'autorité municipale. Ce système permet ainsi de limiter la distribution de l’eau aux seules populations visées qui peuvent accéder librement au point d’eau jusqu’à un seuil mensuel, prépayé par les communes, équivalent à leurs besoins essentiels. Cet article se propose de montrer que Saqayti se conçoit comme une solution de complément innovante au raccordement individuel au réseau, assurant aux populations les plus pauvres un accès au service d’eau et d’assainissement, répondant  aux standards de qualité internationaux, tout en

  11. Précaution et développement régional durable dans le domaine des risques naturels. Quels enseignements tirer des exemples présentes ?

    OpenAIRE

    Brugnot, Gérard

    2013-01-01

    Note portant sur l’auteur 1. RISQUES NATURELS : ALEA ET VULNERABILITE Le risque naturel est constitué de l'aléa et de la vulnérabilité. On peut compliquer cette définition en ajoutant, comme Finlay (1997), des niveaux de profondeur d'analyse (phénomènes/aléas vs enjeux/vulnérabilité), ou bien encore en prenant en compte l'aléa et la vulnérabilité perçus, faisant respectivement appel aux probabilités subjectives et aux théories de l'utilité et du risque en économie. R=G(A) ⊗ *U(D)* Dans cette...

  12. Rôle de la dispersion dans la réponse des populations de truites aux habitats formés par les grands débris ligneux dans les ruisseaux de montagne du Colorado

    Directory of Open Access Journals (Sweden)

    FAUSCH K. D.

    1995-04-01

    Full Text Available Un peu partout dans le monde, les aménagistes des pêches utilisent souvent des rondins pour réaliser des mouilles pour les salmonidés, souvent pour compenser l'absence de grands débris ligneux (LWD due à la déforestation ou à d'autres perturbations des forêts alluviales. Des mesures des LWD réalisées sur 11 ruisseaux de montagne du Colorado drainant de vieilles forêts de résineux (Picea - Abies montrent qu'ils sont à l'origine de la plupart des mouilles. Les morceaux qui contribuent à la formation des mouilles sont, en moyenne, plus grands que ceux qui n'en forment pas. La plupart enjambe le chenal perpendiculairement à l'écoulement et forme des mouilles de chute («plunge pool» et des mouilles de retenue («dammed pool». Les aménagistes des pêches qui utilisent des troncs perpendiculaires à l'écoulement pour réaliser des mouilles considèrent généralement que cette addition d'habitat améliore la survie des salmonidés résidents pendant les périodes critiques comme l'hiver. Une expérience de longue durée, réalisée pour tester cette hypothèse dans six ruisseaux de montagne du Colorado, a montré que les populations de truites résidentes augmentaient rapidement et significativement dans des portions expérimentales de 250m, par rapport à des témoins adjacents. Cependant, des mesures de la dispersion réalisées par des piégeages et des recaptures de truites marquées ont montré que les mouilles formées par des troncs augmentent les populations de truites adultes en permettant aux truites qui étaient en phase de déplacement de rester dans les portions expérimentales plutôt qu'en améliorant la survie hivernale sur place, comme le décrivent d'autres auteurs. La recherche sur les salmonidés d'eau courante non migrateurs et leur gestion a jusqu'à présent été marquée par un modèle impliquant des déplacements limités, ce qui implique que les adultes soient relativement sédentaires. Cependant, l

  13. Surveillance urinaire des professionnels de la santé exposés aux antinéoplasiques dans le cadre de leur travail: revue de la littérature de 2010 à 2015

    Science.gov (United States)

    Poupeau, Céline; Roland, Christel; Bussières, Jean-François

    2016-01-01

    RÉSUMÉ Contexte Il existe de plus en plus de données sur la présence de traces de médicaments dangereux dans l’urine des professionnels de la santé exposés à ces médicaments. Objectif Présenter une revue de la littérature scientifique concernant la surveillance urinaire de professionnels de la santé exposés aux anti-néoplasiques dans le cadre de leur travail. Sources de données Recherche sur PubMed avec les Medical Subject Headings (MeSH) « occupational exposure » et « antineoplastic agents » ainsi que sur Google Scholar avec les termes « antineoplastic », « urine » et « occupational exposure ». Sélection des études et extraction des données L’examen a porté sur tous les articles en anglais et en français ayant trait aux professionnels de la santé exposés à des médicaments dangereux dans le cadre de leur travail, publiés entre le 1er janvier 2010 et le 31 décembre 2015. Les articles ne comportant pas de résultats urinaires et ceux concernant les vétérinaires ainsi que les revues de littérature, les éditoriaux, les lettres à la rédaction et les résumés de congrès ont été exclus. Synthèse des données Vingt-quatre articles ont été retenus. Les études ont été menées dans 52 établissements de santé provenant de sept pays. Elles regroupaient 826 travailleurs exposés à des médicaments dangereux et 175 témoins, notamment des infirmiers (n = 16 études), des pharmaciens (n = 10), des assistants techniques en pharmacie (n = 8), des médecins (n = 7), des aides-soignants (n = 2) et autres (n = 8). Différentes méthodes analytiques ont été utilisées pour quantifier la présence de 13 médicaments dangereux, principalement le cyclophosphamide (n = 16 études), les platines (n = 7) et l’alpha-fluoro-béta-alanine, un métabolite urinaire du 5-fluorouracile (n = 3). La proportion de travailleurs qui ont étés déclarés positifs s’étendait de 0 % (n = 10 études) à 100 % (n = 4). Si l’on ne retient que

  14. Mechanical behaviour of substitutional body centered cubic Fe-Ti solid solutions at temperatures between 77 and 900 K; Plasticite des solutions solides cubiques centrees substitutionnelles fer-titane aux temperatures comprises entre 77 et 900 K

    Energy Technology Data Exchange (ETDEWEB)

    Dubots, Patrick

    1976-05-11

    Plastic behavior of body-centered cubic, interstitial free, Fe-Ti substitutional solid solutions has been characterised. We obtained the following results: at temperatures below 500 K, the thermal component τ* of the critical resolved shear stress τ greatly increases. Solute additions (c >0.12 wt pc) results in: softening at temperatures below 200 K, hardening at temperatures between 200 and 500 K. Results are discussed on Peierls mechanism. At temperatures below 200 K, screw dislocation motion is controlled.by the nucleation of dislocation pairs over the Peierls'hill. Substitutional solute favoring this process gives account of the softening. At temperatures above 200 K, edge dislocation motion controls the strain. The observed hardening is explained by the interaction occurring between edge-dislocations and foreign atoms. At temperatures between 500 and 800 K, a Portevin-Le Chatelier effect is observed. This effect is characterised by two types of serrations. The activation energy of the PLC effect has been determined (E = 1,4 eV). The origin of this phenomenon is the diffusion of solute towards dislocation by a vacancy-mechanism. Two maxima have been observed on the (σ{sub ε} - T) curves. These are due to superposition of overstraining (hardening) and creation of dislocations (softening). The athermal component τ{sub μ} is increased by titanium additions. This hardening has been explained by modulus and size effects. (author) [French] La caracterisation des mecanismes controlant la deformation plastique des solutions solides cubiques centrees substitutionnelles fer-titane, libres d'interstitiels pour les teneurs en solute superieures a 0,12pc pds, a donne les resultats suivants: aux temperatures inferieures a 500 K, la composante thermique τ* de la contrainte critique de cisaillement resolue τ augmente fortement. L'introduction du solute se traduit (pour c>0,12 pc pds): par un adoucissement pour θ < 200 K; par un durcissement pour 200 K< θ < 500 K. Le

  15. Emergency measures and treatment in the event of accidental aver exposure to radiation or of radioactive contamination; Mesures d'urgence et traitement en cas de surexposition accidentelle aux rayonnements ou en cas de contamination radioactive

    Energy Technology Data Exchange (ETDEWEB)

    Jammet, H [Commissariat a l' Energie Atomique, Saclay (France).Centre d' Etudes Nucleaires

    1960-07-01

    In the first part the author presents an overall view of emergency measures to be applied in the case of internal or external radioactive contamination. He states in particular, in these two cases, the methods by which it is possible to eliminate the contaminating radioactive substances from the organism. The author then considers the therapeutic methods to be adopted in the case of an accident of overexposure to radiation, distinguishing between the case of a partial irradiation and that of an acute total irradiation. There will be essentially three methods used depending on the physical measures carried out (irradiation, conditions, estimation of the dose received) and of the clinical data collected: particular treatments, treatment for helping the organism during its return to normal activity, temporary or permanent replacement of the organs affected. (author) [French] L'auteur presente, en une premiere partie, une vue d'ensemble des mesures d'urgence a appliquer en cas de contamination radioactive externe ou interne. Il fait etat en particulier, dans ces deux cas, des methodes permettant de debarrasser l'organisme des substances radioactives contaminantes. L'auteur envisage, ensuite, la therapeutique a adopter lors d'un accident de surexposition aux rayonnements, distinguant le cas d'une irradiation partielle et celui d'une irradiation totale aigue. Trois traitements seront essentiellement mis en oeuvre en fonction des mesures physiques effectuees (conditions d'irradiation, evaluation de la dose recue) et des donnees cliniques recueillies: traitements specifiques, traitement de soutien de l'organisme preparant la restauration, suppleance temporaire ou definitive d'organes defaillants. (auteur)

  16. Apoios de decisão: instrumento de auxílio à medicina baseada em preferências. Uma revisão conceitual Decision aids: an instrument to eliciting patient preference. Current concepts

    Directory of Open Access Journals (Sweden)

    Mirhelen Mendes de Abreu

    2006-08-01

    Full Text Available A necessidade da incorporação das preferências dos pacientes nas tomadas de decisão é uma realidade da assistência médica contemporânea, que caracteriza a medicina baseada em preferências. Os apoios de decisão são instrumentos que surgem como mecanismos de auxílio ao médico a expor riscos e benefícios de uma determinada tomada de decisão, sendo um mecanismo facilitador para a decisão compartilhada. Na literatura médica, particularmente em reumatologia, nota-se um emergente interesse pelo estudo das preferências dos pacientes nos ensaios clínicos. Este artigo de revisão tem por objetivo conceituar e caracterizar os apoios de decisão e suas implicações na pesquisa e prática clínicas, bem como ressaltar os princípios metodológicos necessários para a sua utilização e desenvolvimento.Patient preferences in decision making is one reality of the medical assistance, which characterizes the value based medicine. The decision aids are instruments that appear as support mechanisms for the doctor to exercise this model of decision making. In medical literature, particularly in rheumatology, an emergent interest on patient's preference study is noticed in clinical trials. The aim of this article is to appraise and to characterize the decision aids and its implications in the practical research and clinics, as well as standing out the necessary methodology principles for its use and development.

  17. Le couteau de Bohémond et la thériaque à vilain. La vénénologie savante face aux remèdes “merveilleux” ou “populaires”

    Directory of Open Access Journals (Sweden)

    Collard, Franck

    2013-06-01

    Full Text Available Originating in the western world at the end of the 13th century, treatises about poisoning aim to protect patients against poisons or to heal the poisoned. They must be considered as medical writings belonging to scholasticism. But the subject of toxicatio leads the authors to speak about antidotes that seem, at fi rst sight, far from the world of learned medicine because they are linked with “marvels of nature” or with popular culture. After listing those things mentioned by doctors, the paper will try to show why and how they were intellectually integrated in the scientia venenorum.[fr] Éclos en Occident à la fin du XIIIe siècle, les traités des poisons visent à protéger ou soigner les patients des périls ou des effets du poison. Ils se rangent parmi les écritures médicales scolastiques. Mais le domaine de la toxicatio conduit les auteurs à traiter d’antidotes à première vue éloignés des sphères de la médecine savante, soit qu’ils se rattachent aux “merveilles de la nature”, soit qu’ils proviennent de la culture vulgaire. Après avoir inventorié ces anti-poisons mentionnés par les docteurs, l’article s’attachera à montrer pourquoi et comment ils sont intellectuellement intégrés à la scientia venenorum.

  18. Une vie, une œuvre, des archives : note sur le fonds Dom Paul Bellot aux Archives nationales du monde du travail (Fonds n° 2003 006

    Directory of Open Access Journals (Sweden)

    Christian Hottin

    2009-11-01

    Full Text Available Cet article a pour objet de présenter brièvement les archives de Dom Paul Bellot, moine bénédictin et architecte, figure de l’architecture religieuse du premier vingtième siècle, conservées depuis 2003 aux Archives nationales du monde du travail à Roubaix. Au-delà de l’importance de ces documents pour l’histoire de l’art sacré contemporain et de l’éclairage qu’ils apportent à la connaissance d’une personnalité originale et complexe, l’histoire de ce fonds d’archives témoigne de quelques aspects des difficultés inhérentes à la conservation du patrimoine religieux : vieillissement des communautés monastiques, importance du bénévolat, nécessité d’un soutien des pouvoirs publics pour leur sauvegarde et leur valorisationThe aim of this article is to give a brief presentation of the archives of Dom Paul Bellot, Benedictine monk and architect and one of the leading figures of religious architecture during the first half of the 20th century. These archives are held today at Roubaix at the Archives nationales du Monde du Travail. Beyond the intrinsic interest of these papers for the history of contemporary sacred art and for the light they bring to understanding the original and complex personality of the man, the history of the papers also illustrates some of the difficulties inherent to the conservation of the religious heritage : the ageing of monastic communities ; the importance of non-paid work ; and the need for public support in the safekeeping and interpretation of the papers.

  19. Emergency measures and treatment in the event of accidental aver exposure to radiation or of radioactive contamination; Mesures d'urgence et traitement en cas de surexposition accidentelle aux rayonnements ou en cas de contamination radioactive

    Energy Technology Data Exchange (ETDEWEB)

    Jammet, H. [Commissariat a l' Energie Atomique, Saclay (France).Centre d' Etudes Nucleaires

    1960-07-01

    In the first part the author presents an overall view of emergency measures to be applied in the case of internal or external radioactive contamination. He states in particular, in these two cases, the methods by which it is possible to eliminate the contaminating radioactive substances from the organism. The author then considers the therapeutic methods to be adopted in the case of an accident of overexposure to radiation, distinguishing between the case of a partial irradiation and that of an acute total irradiation. There will be essentially three methods used depending on the physical measures carried out (irradiation, conditions, estimation of the dose received) and of the clinical data collected: particular treatments, treatment for helping the organism during its return to normal activity, temporary or permanent replacement of the organs affected. (author) [French] L'auteur presente, en une premiere partie, une vue d'ensemble des mesures d'urgence a appliquer en cas de contamination radioactive externe ou interne. Il fait etat en particulier, dans ces deux cas, des methodes permettant de debarrasser l'organisme des substances radioactives contaminantes. L'auteur envisage, ensuite, la therapeutique a adopter lors d'un accident de surexposition aux rayonnements, distinguant le cas d'une irradiation partielle et celui d'une irradiation totale aigue. Trois traitements seront essentiellement mis en oeuvre en fonction des mesures physiques effectuees (conditions d'irradiation, evaluation de la dose recue) et des donnees cliniques recueillies: traitements specifiques, traitement de soutien de l'organisme preparant la restauration, suppleance temporaire ou definitive d'organes defaillants. (auteur)

  20. Technique du Micro-Enseignement: Une Approche Pour Enseigner La Pratique de La Lecture aux Apprenants de Niveau A2 et La Perception de Cette Technique Par Les Futurs Enseignants

    Directory of Open Access Journals (Sweden)

    Nurten ÖZÇELİK

    2017-09-01

    Full Text Available Cette étude a été préparée en vue de déterminer les difficultés rencontrées par les futurs enseignants lors de l’enseignement de la lecture aux apprenants de niveau A2 par la technique du micro-enseignement, et de mettre à jour leurs opinions concernant les avantages ainsi que les inconvénients de cette technique. Le groupe de travail est composé de 20 futurs enseignants (14 femmes, 6 hommes du Département de la Didactique du FLE de la Faculté Pédagogique de l’Université Gazi, pour le deuxième semestre de la période 2014-2015. Les données recueillies par les questions à réponses ouvertes ont été évaluées par la méthode de l’analyse descriptive, à la suite des calculs de fréquence. Selon les résultats obtenus, les futurs enseignants ont surtout du mal à prononcer le français, à gérer leurs émotions, à préparer une présentation, des activités de pré-lecture et du dossier de présentation. Augmenter la confiance en soi, apprendre à préparer un plan de cours, donner la possibilité de voir les aspects insuffisants sont les points positifs de la technique. L’insuffisance des participations au cours, l’artificialité du milieu de la classe, la subjectivité des critiques des pairs sont indiqués par les participants comme les inconvénients de cette technique.

  1. Femicidio: la forma più estrema di violenza contro le donne / Fémicide : la forme la plus extrême de violence faite aux femmes / Femicide: the most extreme form of violence against women

    Directory of Open Access Journals (Sweden)

    Karadole Cristina

    2012-04-01

    the victims and, especially, the clear links between this crime and violence against women. Le fémicide, comme forme extrême de violence faite aux femmes, est un phénomène encore méconnu car il existe encore peu d’études sur le sujet en Italie. À l’issue d’une revue de la littérature criminologique et féministe internationale, cet article vise à définir le concept de « fémicide » et ses différentes déclinaisons dans la recherche scientifique et dans la lutte politique féministe. Le texte met en évidence la particularité de ce délit, qui doit être considéré différemment par rapport aux autres formes d’homicides. En effet, il s’agit d’un crime qui découle de la relation de pouvoir entre les hommes et les femmes ; le fémicide est l'acte final du cycle de la violence masculine contre les femmes, dont il représente le point culminant. Contrairement au sens commun et à la représentation médiatique et comme cet essai tente de le démontrer, le fémicide n’existe pas dans les cultures autres qu’occidentales, pas plus qu’il n’est particulièrement rattaché aux situations de difficulté sociale ou de marginalité culturelle, mais il s'inscrit, en tant que violence à l’égard des femmes, dans des rapports « normaux » et dans le conflit homme/femme. Cela signifie que des situations considérées comme « sûres » peuvent pourtant comporter des facteurs de risque d’être victimes de fémicide pour les femmes concernées. En effet, les fémicides peuvent intervenir chez soi ou au domicile de la famille, dans une relation conjugale comme pour des couples non mariés.Ensuite, l’auteur analyse aussi bien les premières études sociologiques et criminologiques italiennes que des données sur le phénomène. La seconde partie de ce texte est dédiée à la lecture des informations tirées d’une étude sur les articles de presse menée par le Groupe d'études sur le fémicide de l'association bolognaise contre la violence

  2. Non disponible / Not available

    OpenAIRE

    Bernard , Nguyen

    2001-01-01

    Non disponible / Not available; La chronobiologie est une science récente qui apporte une nouvelle manière de voir la médecine. La chronobiologie, grâce aux développements des moyens techniques de mesure physiologique, a contribué à faire d'importants progrès dans les connaissances tant dans le domaine de la physiologie que de la pathologie ou de la thérapeutique. Et son étude dans l'hypertension artérielle semble logique, puisqu'en France cette pathologie touche jusqu'à 20 à 30% de la popula...

  3. Des relations plus humaines ?

    OpenAIRE

    Ricciardi, Ferruccio

    2013-01-01

    À partir d’une approche sociohistorique, cet article s’intéresse aux effets de la croissance économique sur l’identité des cadres, en l’occurrence les groupements de cadres et patrons italiens qui, au lendemain de la Seconde Guerre mondiale, essaient de conjuguer les principes du catholicisme social dont ils se réclament dans l’arène publique avec les logiques issues du productivisme managérial américain qui s’impose en Europe occidentale. Le prisme des méthodes de « relations humaines » pour...

  4. Timing collector

    CERN Document Server

    Schnell, J D

    2006-01-01

    L'unité a pour but de normaliser en signe, en largeur et en amplitude les signaux de timing destinés à être acquis par les DPRAM. Les signaux d'origine, reçus en format blocking (30V), ou TTL (logique positive ou négative) sont transmis en mode différentiel au DPRAM. En option, ils peuvent être transmis parallèlement sur un tiroir auxiliaire lequel redistribue ces signaux aux fins de tests sur son panneau avant.

  5. Recherche de contaminations d'origine fongique dues à Candida non albicans sur les cathéters veineux périphériques aux services d'hématologie clinique et de maternité (Etablissement Hospitalier Spécialisé mère et enfant) du C.H.0 de Tlemcen

    OpenAIRE

    Zouaber, Rabab

    2015-01-01

    Les infections fongiques prennent place parmi les complications des sujets à haut risque hospitalisé. En effet, l'augmentation de ces infections et particulièrement aux levures pathogènes tels Candida au cours des dernières décennies est presque parallèle à l'augmentation de l'utilisation généralisée d'une large gamme de dispositifs médicaux implantés tels les cathéters. C'est pourquoi, nous avons envisagé de rechercher des contaminations nosocomiales d'origine fongique liée...

  6. Potentiel et limites d'utilisation, aux températures élevées, des lubrifiants liquides dans les moteurs Potential and Limitations of Use of Liquid Lubricants in Engines At High Temperatures

    Directory of Open Access Journals (Sweden)

    Toulhoat H.

    2006-11-01

    Full Text Available Cet article examine les possibilités de réponse de la formulation des lubrifiants à une élévation des températures dans les moteurs automobiles de la prochaine décennie; l'accroissement des puissances spécifiques des moteurs, et la réduction de leurs dimensions et de leur poids, la pénétration des turbo-compresseurs et des pots catalytiques, et dans une certaine mesure la tendance à réduire les rejets thermiques à l'échappement, sont des forces motrices pour cette évolution. Une augmentation de la température moyenne à la rampe d'environ 15 à 20°C est attendue pour la plupart des moteurs courants, à essence ou Diesel. Les températures en fond de gorge de segment de feu resteront très probablement dans l'intervalle actuel 250-260°C grâce aux systèmes de refroidissement des pistons. L'évolution des moteurs Diesel de camions dans les cinq dernières années est significative de cette tendance. Une telle évolution n'induira pas de bouleversements majeurs dans la formulation des lubrifiants pour automobiles. Cependant, elle déterminera une demande en VI significativement accrue de façon à maintenir les conditions de la lubrification hydrodynamique aux paliers, aussi bien que le comportement au démarrage à froid. Ceci sera obtenu par une meilleure combinaison des bases, avec une mise en oeuvre accrue des bases hydrotraitées et synthétiques, et un renforcement de l'additivation en épaississants ( règle du pouce: 0. 25 % par incrément de 1°C de température moyenne. Une alternative pourrait provenir de progrès réalisés sur le comportement visco-élastique et la stabilité sous cisaillement de ces polymères additifs de viscosité. Une autre exigence sur les propriétés des lubrifiants afin de faire face à cet accroissement apparemment marginal de température de fonctionnement, sera une meilleure résistance à l'oxydation, et dans cette optique, le recours aux bases non conventionnelles sera à nouveau

  7. Histoire de l’hôpital. L’éclairage des salles d’opération aux XIXe et XXe siècles : l’apparition du scialytique

    Directory of Open Access Journals (Sweden)

    Francis Dreyer

    2009-05-01

    Full Text Available L’éclairage des salles d’opération dans les hôpitaux et plus particulièrement celui des zones opératoires était l’un des problèmes récurrents qui entravaient le déroulement de certaines interventions. Les ombres, la focalisation et la chaleur de la source gênaient les chirurgiens. Plus que cela, la promiscuité entre les praticiens et leurs patients, la tradition des cours magistraux et les usages multiples de la salle de travail entraînaient la prolifération de maladies nosocomiales mortelles. Au début du XXe siècle, la venue d’une nouvelle source lumineuse, le scialytique BBT, qui projette un faisceau lumineux sans ombre portée, permit enfin de répondre aux besoins des médecins. Plus que la simple amélioration d’un confort visuel, le scialytique participa à la transformation de l’ancienne salle d’opération en un élément unique : le bloc opératoire. Cet espace hautement spécialisé et confiné put dès lors être placé stratégiquement, suivant les besoins, à l’intérieur de « l’hôpital bloc » moderne.The lighting of operating rooms in hospitals, and, more especially the lighting of operating zones, was a persistent problem which could interfere with certain surgical operations. Shadows, focussing and the heat from the light source were nuisance for the surgeons. The promiscuity between surgeons and patients, the tradition of holding courses during operations and the fact that operating rooms could be used for other purposes led to an increase in often fatal nosocomial infections. At the beginning of the twentieth century, the appearance of a new type of operating lamp, the scialytique BBT, which could light without casting shadows, at last brought a solution to the problem. But this new type of lighting not only increased the visual comfort of surgeons at work, it also had an impact in transforming the operating room into a dedicated space, the modern operating theatre. This highly specialised

  8. Ampleur et impact des évènements indésirables graves liés aux soins: étude d'incidence dans un hôpital du Centre-Est tunisien

    Science.gov (United States)

    Bouafia, Nabiha; Bougmiza, Iheb; Bahri, Fathi; Letaief, Mondher; Astagneau, Pascal; Njah, Mansour

    2013-01-01

    Introduction La prévention des événements indésirables représente une priorité de santé du fait de leur fréquence et de leur gravité potentielle. Ce travail a été mené afin d'avoir un diagnostic de la situation épidémiologique relative aux événements indésirables survenant dans notre hôpital. Méthodes Une étude prospective a été menée auprès de tous les patients qui ont été hospitalisés au CHU Farhat Hached - Sousse (Tunisie) sur une période d'un mois dans quatorze services de l'hôpital. La détection d'évènement indésirable grave (EIG) était basée sur les critères adoptés dans différentes études. Les tests T et Chi 2 ont été utilisés pour identifier les facteurs contribuant à l'apparition d'évènements indésirables. Résultats Au total, 162 EIG ont été identifiés pendant la période. 45% de ces évènements étaient des infections nosocomiales. Ces EIG ont eu comme conséquences un décès chez 9,2% des patients, la mise en jeu du pronostic vital de 26% des patients et la prolongation de la durée de séjour chez 61,7% d'entre eux. L'admission dans des circonstances particulières et l'exposition à des soins invasifs étaient identifiés comme des facteurs de risque potentiels EIG. Conclusion Le renforcement de la stratégie de gestion des risques sanitaires en ciblant préférentiellement le risque infectieux constitue une étape fondamentale dans l'amélioration de la sécurité des patients au sein de notre établissement de santé. PMID:24711868

  9. Contribution to the study of the behaviour of silicon planar transistors exposed to the {sup 60}Co {gamma} rays; Contribution a l'etude du comportement des transistors silicium a structure plane soumis aux rayons {gamma} du {sup 60}Co

    Energy Technology Data Exchange (ETDEWEB)

    Le Ber, J [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

    1967-05-15

    montre que des dispersions existent et sont fonction: - du point de mesure (niveau d'injection) - de la polarisation sous flux - de la dose instantanee - du fabricant pour un meme type de composant - de la geometrie utilisee Le probleme est ensuite traite au sens de la fiabilite et on donne des methodes permettant de garantir aux circuits une probabilite de bon fonctionnement pour une dose donnee. - methode du 'cas pire' - methode des moments - methode de Monte Carlo. (auteur)

  10. A Feminist Intervention That Hurt Women: Biological Differences, Ergonomics, and Occupational Health: Une intervention féministe qui a nui aux femmes: différences biologiques, égalité, ergonomie et santé au travail.

    Science.gov (United States)

    Messing, Karen

    2017-11-01

    éministes aux solutions pour le milieu de travail, ainsi que des pistes de recherche.

  11. Software Educativo como auxílio na aprendizagem da matemática: uma experiência utilizando as quatro operações com alunos do 4º Ano do Ensino Fundamental I

    Directory of Open Access Journals (Sweden)

    Marcílio Farias da Silva

    2013-01-01

    Full Text Available As dificuldades de aprendizagem decorrentes do modelo de ensino encontrado nas escolas e os avanços dos recursos tecnológicos são fatores que influenciam a educação matemática. Os alunos apresentam um grau de dificuldade relevante com relação ao ensino-aprendizagem, causado pela falta de motivação, de aulas monótonas e sem relação com o cotidiano. Ao mesmo tempo, os recursos tecnológicos vêm sendo inseridos na educação de forma crescente, trazendo resultados positivos para o ensino. Considerando tais fatores, este trabalho analisou o uso de software educativo como auxílio na aprendizagem de matemática, apresentando-o como uma possibilidade de tornar as aulas mais motivadoras aos alunos. Para verificar se essa utilização traz resultados positivos para o ensino-aprendizagem, buscou-se tal comprovação por meio de estudo de caso de natureza exploratória realizado com alunos do 4º ano do ensino fundamental I, utilizando como ferramenta o software educativo Tux of Math Command. Realizou-se uma análise comportamental dos alunos na realização de operações matemáticas em diferentes situações: resolvendo as operações em sala de aula, e utilizando o jogo no laboratório de informática. Na utilização do software, verificou-se uma atitude mais instigante dos alunos do que na resolução das operações em sala de aula. Esse interesse foi decorrente da associação do jogo feita pelos alunos, não como problema a ser resolvido e sim como algo prazeroso e significativo, em oposição ao ocorrido em sala de aula, momento em que prevaleceu a insegurança e a necessidade de apresentar soluções. A pesquisa possibilitou afirmação do questionamento apresentado neste trabalho, confirmando que a utilização do software educativo auxilia o processo de ensino-aprendizagem de matemática.

  12. Silicon P.I.N. Junctions used for studies of radiation damage; Etude de l'irradiation aux neutrons rapides du silicium au moyen de jonctions P.I.N

    Energy Technology Data Exchange (ETDEWEB)

    Lanore, J [Commissariat a l' Energie Atomique, Fontenay-aux-Roses (France). Centre d' Etudes Nucleaires

    1964-06-01

    Irradiation of silicon P.I.N. junction has been studied primarily for the purpose of developing a radiation damage dosimeter, but also for the purpose of investigating silicon itself. It is known that the rate of recombination of electrons and holes is a linear function of defects introduced by neutron irradiation. Two methods have been used to measure that rate of recombination: forward characteristic measurements, recovery time measurements. In order to explain how these two parameters depend on recombination rate we have given a theory of the P.I.N. junction. We have also given an idea of the carrier lifetime dependence versus temperature. Annealing effects in the range of 70 to 700 K have also been studied, we found five annealing stages with corresponding activation energies. As an application for these studies, we developed a radiation damage dosimeter with which we made several experiments in facilities such as Naiade or Marias. (author) [French] L'irradiation de structures P.I.N. etait faite dans le but d'etudier principalement la mise au point d'un dosimetre a ''radiation damage'' et aussi pour etudier plus profondement le silicium lui-meme. On sait que le taux de recombinaison electrons-trous est une fonction lineaire du taux de defauts introduits par irradiation aux neutrons. Deux methodes ont ete utilisees pour atteindre ce taux de recombinaison: mesures de la caracteristique directe, mesures du temps de retournement. Pour expliquer de quelle facon ces parametres dependent du taux de recombinaison. Nous avons donne une theorie de la jonction P.I.N. Nous avons aussi donne l'allure des variations du temps de vie des porteurs en fonction de la temperature. Nous avons d'autre part effectue des recuits entre 70 et 700 K, domaine dans lequel nous avons trouve cinq etapes de ''guerison'' avec les energies d'activation correspondantes. En application de ces etudes nous avons mis ou point un dosimetre a ''radiation damage'' avec lequel nous avons effectue des

  13. Silicon P.I.N. Junctions used for studies of radiation damage; Etude de l'irradiation aux neutrons rapides du silicium au moyen de jonctions P.I.N

    Energy Technology Data Exchange (ETDEWEB)

    Lanore, J. [Commissariat a l' Energie Atomique, Fontenay-aux-Roses (France). Centre d' Etudes Nucleaires

    1964-06-01

    Irradiation of silicon P.I.N. junction has been studied primarily for the purpose of developing a radiation damage dosimeter, but also for the purpose of investigating silicon itself. It is known that the rate of recombination of electrons and holes is a linear function of defects introduced by neutron irradiation. Two methods have been used to measure that rate of recombination: forward characteristic measurements, recovery time measurements. In order to explain how these two parameters depend on recombination rate we have given a theory of the P.I.N. junction. We have also given an idea of the carrier lifetime dependence versus temperature. Annealing effects in the range of 70 to 700 K have also been studied, we found five annealing stages with corresponding activation energies. As an application for these studies, we developed a radiation damage dosimeter with which we made several experiments in facilities such as Naiade or Marias. (author) [French] L'irradiation de structures P.I.N. etait faite dans le but d'etudier principalement la mise au point d'un dosimetre a ''radiation damage'' et aussi pour etudier plus profondement le silicium lui-meme. On sait que le taux de recombinaison electrons-trous est une fonction lineaire du taux de defauts introduits par irradiation aux neutrons. Deux methodes ont ete utilisees pour atteindre ce taux de recombinaison: mesures de la caracteristique directe, mesures du temps de retournement. Pour expliquer de quelle facon ces parametres dependent du taux de recombinaison. Nous avons donne une theorie de la jonction P.I.N. Nous avons aussi donne l'allure des variations du temps de vie des porteurs en fonction de la temperature. Nous avons d'autre part effectue des recuits entre 70 et 700 K, domaine dans lequel nous avons trouve cinq etapes de ''guerison'' avec les energies d'activation correspondantes. En application de ces etudes nous avons mis ou point un

  14. La foule révolutionnaire, l’imaginaire du complot et la violence fondatrice : aux origines de la nation française (1789 At the Origins of the French Nation (1789: The Revolutionary Crowd, Conspiracy Imaginations and Founding Violence

    Directory of Open Access Journals (Sweden)

    Philippe Münch

    2010-09-01

    Full Text Available Dans Les origines de la France contemporaine, Taine assimile la prise de la Bastille à l'anarchie. La foule est représentée comme un « animal primitif », affranchi de la raison et livré à ses instincts. L'historiographie jacobine de la Révolution française a depuis longtemps remis en question cette représentation animalière de la foule, en montrant que derrière les violences populaires, il existe des logiques politiques, sociales et économiques qui supposent une part de rationalité des acteurs. La violence est donc complexe, étant à la fois destructrice et fondatrice, comme le montrent les journées de juillet 1789.Cet article entend expliquer le processus par lequel la violence populaire a contribué in fine à la naissance de la nation française. L'imaginaire du complot a joué ici un rôle fondamental, qu'il s'agira de mettre en lumière en faisant une lecture croisée des historiographies jacobine et critique. L'imaginaire du complot entretient en fait un double rapport à la violence en constituant, d'une part, un moteur d'action et, de l'autre, une source de justification et de mythification nécessaire pour masquer le déferlement des furies. Ce processus de légitimation fournira les éléments constitutifs du premier récit national.In his Origins of Contemporary France, Hyppolyte Taine assimilates the storming of the Bastille to a descent into anarchy. The crowd is portrayed as a ‘primitive animal’, irrational and left to its instincts. The Jacobin historiography of the French Revolution has since criticized this depiction of the crowd as animals by highlighting political, social and economic rationales behind the people’s acts of violence. The events of July 1789 actually show how violence can be complex phenomenon that is destructive and founding at the same time. This article will explain the processes by which popular violence contributed in fine to the birth of the France nation. The conspiracy imaginations

  15. Building integrated photovoltaic; Photovaltaique integre aux batiments

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2004-01-01

    Durable, modular and flexible in use, as demonstrated by the different case studies in this publication, photovoltaic can replace diverse building elements, from glass facades to weather proof roofs. This leaflet towards architects describes aesthetic, technical, economic and environmental interest of building integrated photovoltaic. (author)

  16. AVIS AUX PASSIONNES... - French version only

    CERN Multimedia

    2002-01-01

    Les anémones du CERN seront bientôt orphelines. Nous recherchons une personne volontaire pour s'occuper de l'aquarium situé au bâtiment principal, pour une durée d'une année. Si vous êtes intéressé, ou si vous voulez plus d'information, téléphonez au 73830 (les anémones vivant dans l'aquarium vous remercient beaucoup d'avance).

  17. Administration des subventions du CRDI aux institutions :

    International Development Research Centre (IDRC) Digital Library (Canada)

    IDRC CRDI

    Comment puis-je réviser le budget de mon projet ? Le CRDI couvre-t-il les dépenses engagées en sus du montant de la subvention ? De quelle façon le CRDI transmet-il les fonds ? Mon institution doit-elle déposer les fonds reçus pour le projet dans un compte bancaire distinct ? Combien de temps faut-il au CRDI pour ...

  18. Comment parle-t-on aux animaux?

    DEFF Research Database (Denmark)

    Mondeme, Chloé

    2018-01-01

    three prominent modalities for addressing a pet animal, and examines their pragmatical effects. These empirical findings allow to rethink bigger issues usually raised when human/animal relationships are concerned: animal agency, attribution of intention, and the fundamentals of mutual adjustment....

  19. Accessibilite des batiments publics aux personnes handicapees

    CERN Document Server

    Colloca, C

    2003-01-01

    Selon les législations suisse et franèaise, les lieux de travail ainsi que les bâtiments recevant du public, doivent être aménagés en tenant compte de la présence de travailleurs et de public handicapés et de manière à favoriser leur autonomie. Les dispositions adoptées pour les accès, les portes, les dégagements et les ascenseurs desservant les postes de travail ou à vocation conviviale, et les locaux annexes tels que locaux sanitaires, locaux de restauration, parcs de stationnement, doivent permettre l'accès et l'évacuation des personnes handicapées, notamment celles circulant en fauteuil roulant.

  20. Le littoral face aux changements climatiques

    OpenAIRE

    Mulot, Vanessa; Vigneron, Anne-Laure; Lambert-Hadid, Marie-Laure

    2011-01-01

    Le changement climatique et l’anthropisation du littoral accentuent le risque de submersion marine sur l’ensemble des côtes. Malgré l’élévation en cours du niveau des mers, l’attractivité du littoral ne décroît pas malgré la connaissance du risque. Ce risque aggravera dans les années à venir les enjeux liés à la submersion marine, parmi lesquels le danger pour les vies humaines, comme l’a malheureusement illustré l’actualité (Xynhia), mais aussi la question de la propriété des biens et des te...

  1. Des biens communs aux biens publics mondiaux

    Directory of Open Access Journals (Sweden)

    Bernard Hours

    2008-03-01

    Full Text Available La notion de « biens communs » est investie d’une portée particulière à une époque ou on utilise aussi le concept de "biens publics mondiaux" sorti tout droit des divers processus plurivoques qui constituent la globalisation aujourd’hui. Ces expressions, proches mais différentes, amènent nécessairement à s’interroger, moins sur la propriété que sur l’appropriation et ses différentes formes. Elles appellent aussi une réflexion sur la production de la valeur et la rareté. Cet article rappelle d’abord les principales approches anthropologiques sur la circulation des biens, les échanges, l’appropriation. La notion de biens communs renvoie à un âge d’or antérieur à la propriété, une sorte de paradis perdu largement mythique. On s’interroge ensuite sur la notion actuelle de biens publics mondiaux, qui vient  sublimer l’enfer de l’exploitation et de la concurrence à l’échelle globale.The notion of common good has a specific role at the present time of globalisation. The concept of global public good is also used in this context. These terms, close together but also different, bring to the questions of appropriation, production and scarcity. This article first reminds the main anthropological approaches on circulation of goods, exchanges, and appropriation. The notion of common goods makes a reference to a golden age, a lost paradise before property. Then we propose a critical analysis of global public goods which are supposed to sublimate  global exploitation and competition.

  2. Quantification de la Charge Virale et tests de résistance du VIH-1 aux ARV à partir d’échantillons DBS (Dried Blood Spots chez des patients Guinéens sous traitement antirétroviral

    Directory of Open Access Journals (Sweden)

    Nestor Bangoura

    2015-06-01

    Full Text Available Problématique: Comme dans plusieurs pays du Sud, le suivi virologique des patients sous traitement antirétroviral (TARV en Guinée est timide voire inexistant dans certaines localités. Le but de cette étude était d’évaluer la faisabilité technique et logistique de l’utilisation des DBS dans les tests de charge virale (CV et de génotypage. Méthode: De septembre à octobre 2010, les DBS ont été préparés à partir de prélèvements sanguins de patients adultes sous TARV. Le délai d’envoi des échantillons au laboratoire de référence était de 30 jours maximum après le prélèvement et se faisait à température ambiante. La CV a été quantifiée et les échantillons de patients en échec virologique (CV ≥ 3 log10 copies/mL ont été génotypés selon le protocole de l’ANRS. L’algorithme de Stanford version 6.0.8 a été utilisé pour l’analyse et l’interprétation des mutations de résistance. Résultats: Parmi les 136 patients inclus, 129 et 7 étaient respectivement sous première et deuxième ligne de traitement avec une médiane de suivi de 35 mois [IQR: 6-108]. L’échec virologique a été noté chez 33 patients. Parmi eux, 84.8% (n = 28/33 ont bénéficié d’ungénotypage. Le taux de résistance global était de 14% (n = 19/136. Le CRF02_AG était le sous type viral le plus prévalent (82%; n = 23. Conclusion: En plus de montrer la faisabilité technique et logistique des tests de CV et de génotypage à partir des DBS, ces résultats montrent l’intérêt de leurs utilisations dans le suivi virologique des patients sous TARV. Cette étude a permis également de documenter l’échec virologique, la résistance aux ARV et la diversité génétique du VIH-1 en Guinée. Mots clés: VIH-1, Résistance aux ARV, DBS (Dried Blood Spots, Guinée Conakry, Génotypage,Charge Virale.   Quantification of Viral load and resistance tests of HIV-1 to ARVs from dried blood spotssamples in Guinean patients undergoing

  3. Analyse de la sensibilité aux paramètres gazoles d'un moteur diesel d'automobile à injection directe Small Direct Injection Diesel Engine Sensitivity to the Diesel Fuel Characteristics

    Directory of Open Access Journals (Sweden)

    Montagne X.

    2006-12-01

    Full Text Available L'étude présentée a été réalisée dans le cadre du GMCL (Groupement Moteur Carburant Lubrifiant, organisme qui réunit des constructeurs d'automobiles, des raffineurs et des additiveurs, avec l'objectif d'examiner la sensibilité d'un moteur Diesel à injection directe d'automobile aux paramètres du gazole. Les partenaires de cette étude sont Elf, IFP, Octel, PSA, Renault et Total. Parmi les solutions technologiques permettant de disposer de convertisseurs d'énergie assurant de faibles niveaux d'émissions de polluants et de consommation, le moteur Diesel se place naturellement en bonne position. Dans ce contexte, on enregistre aujourd'hui l'émergence du moteur Diesel à injection directe pour les véhicules légers en raison de ses performances, notamment en regard de la consommation. Toutefois, cette technologie nécessite une technique d'injection performante, associée à la gestion électronique, demande de l'EGR et un catalyseur d'oxydation afin de régler les problèmes d'émissions polluantes et sonores. Il est donc de première importance de cerner avec précision la sensibilité du moteur Diesel à injection directe aux paramètres carburants afin de tirer le meilleur profit de cette technologie. À partir d'un ensemble de gazoles formulés pour faire varier la composition chimique, l'indice de cétane et la densité, un moteur Audi à injection directe de type 1Z a été testé au banc, dans des conditions standard de réglage (avance à l'injection et taux de gaz recyclés. Cet ensemble de résultats a ainsi permis de démontrer que l'accroissement de l'indice de cétane, la réduction de la densité et de la teneur en polyaromatiques ont une influence positive sensible sur les émissions de CO, d'hydrocarbures imbrûlés, des VOF. En ce qui concerne les émissions de particules, l'indice de cétane semble avoir une influence négative sur la fraction sèche dans certaines conditions. De plus, il apparaît que les

  4. How Molecular Evolution Technologies can Provide Bespoke Industrial Enzymes: Application to Biofuels Comment les technologies d’évolution moléculaire peuvent fournir des enzymes industrielles sur mesure : application aux biocarburants

    Directory of Open Access Journals (Sweden)

    Fourage L.

    2013-08-01

    est l’un des principaux goulets d’étranglement dans le développement de la conversion biologique de la biomasse lignocellulosique en biocarburants. L’un des organismes les plus efficaces pour la production d’enzymes cellulolytiques est le champignon Trichoderma reesei, principalement grâce à sa capacité importante de sécrétion. La conversion de la cellulose en glucose implique trois types de cellulases travaillant en synergie : les endoglucanases (EC 3.2.1.4 clivant de façon aléatoire les liaisons glycosidiques en (3-1,4, les cellobiohydrolases (EC 3.2.1.91 attaquant la chaîne de cellulose aux deux extrémités afin de produire le cellobiose, dimère qui sera converti en glucose par l’action des (3-glucosidases (EC 3.2.1.21. De façon inattendue, la quantité de 3-glucosidase (BGL1 sécrétée par les souches de T. reesei représente un très faible pourcentage de la quantité totale des protéines sécrétées qui en fait donc une activité limitante du cocktail. Cette faible activité limite d’autant plus les performances du cocktail que le cellobiose représente le principal inhibiteur de la réaction cellulolyse par les cellobiohydrolases. Ce goulot d’étranglement peut être atténué soit par une surexpression de la (3-glucosidase chez T. reesei, soit par une amélioration de son activité spécifique. Après un bref aperçu des principales technologies existantes, cet exemple sera utilisé dans cette revue pour illustrer le potentiel des technologies d’évolution dirigée pour développer des enzymes répondant aux besoins de l’industrie des biotechnologies. Nous décrivons comment la mise en oeuvre d’une stratégie d’évolution dirigée par le L-ShufflingTM avec trois gènes parentaux provenant de la biodiversité microbienne permet d’obtenir des activités (3-glucosidases très améliorées par rapport à la Cel3a (3-glucosidase de T. reesei (activité spécifique 242 fois plus élevée pour le substrat pNPGIc. Cette am

  5. La symétrie « dissimulée » dans l’ordonnance des illustrations aux strophes de la deuxième moitié de L’Hymne Acathiste peintes sur la façade méridionale de l’église de la Décollation de Saint-Jean le Précurseur du village d’Arbore

    Directory of Open Access Journals (Sweden)

    Constantin I. Ciobanu

    2011-01-01

    Full Text Available Cette note a comme but l’explication de l’ordonnance insolite des illustrations aux strophes de la deuxième moitié de l’Hymne Acathiste peintes sur la façade méridionale de l’église de La décollation de Saint Jean le Précurseur du village d’Arbore. D’une manière à peu près mathématique, en partant de l’ordonnance consacrée des illustrations aux strophes de l’hymne, l’auteur essaye de démontrer comment, grâce à l’utilisation itérative du même cliché sur les parties recto et verso des décalques, peut-on obtenir le groupement des illustrations de l’église d’Arbore.

  6. Nova proposta de treinamento e avaliação do uso de auxílios ópticos em portadores de visão subnormal New proposal for training and evaluation of the use of optical aids in low vision patients

    Directory of Open Access Journals (Sweden)

    Silvana Terezinha Figueiredo Moya

    2002-01-01

    Full Text Available Objetivo: Elaboração de uma nova seqüência de treinamento e avaliação no uso do auxílio óptico para portadores de baixa visão. Métodos: Construção de tabelas obedecendo a uma seqüência de complexidade lingüística, iniciando com palavras, seguindo com expressões, períodos e culminando com textos. Utilização do novo material em 32 portadores de retinose pigmentária, com acuidade visual entre 0,5 e 1,3 LogMAR (20/63 e 20/400, registrando as velocidades de leitura com e sem auxílio óptico. Resultados: Tabelas de palavras, expressões, períodos e textos de tamanhos variados, com impressão de letras pretas em fundo branco e letras brancas em fundo preto. Apresentação dos dados referentes à idade, sexo, acuidade visual, auxílio óptico empregado, tamanho da impressão lida, velocidades de leitura sem e com auxílio e número de sessões de treinamento. Conclusões: A leitura de textos constitui o melhor instrumento de avaliação qualitativa e quantitativa no uso dos auxílios ópticos. As tabelas propostas baseiam-se em uma complexidade lingüística crescente, tentando minimizar ao máximo os fatores não relacionados à visão. Constitui valioso instrumento na prática da visão subnormal, entretanto, o desempenho de leitura depende de fatores relacionados a cada paciente.Purpose: The design and use of new near-vision charts for training and evaluation of the use of optical aids in low vision patients. Methods: Construction of new charts obeying a linguistic complexity, starting with words, followed by expressions and sentences and ending with texts. The new material was used in thirty-two patients with retinitis pigmentosa, with a corrected visual acuity from 0.5 to 1.3 LogMAR. Reading speeds were recorded with and without optical aids. Results: Word-reading, expression-reading, sentence-reading and text-reading charts in different sizes, with black print on a white background and white print on a black background. The

  7. Recapitulative list of the C.E.A. reports published by the French Atomic Energy Commission (n.757-1062, december 1957-december 1958) supplement to C.E.A. reports n. 593 and 756; Liste recapitulative des rapports C.E.A. publies par le Commissariat a l'Energie Atomique (du n.757 a 1062, decembre 1957-decembre 1958) complement aux rapports C.E.A. n. 593 et 756

    Energy Technology Data Exchange (ETDEWEB)

    Schmiterlow, C G; Cohen, Y [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

    1958-07-01

    Recapitulative list of the C.E.A. reports published by the French Atomic Energy Commission. (number 757-1062, december 1957 - december 1958). Supplement to C.E.A. reports number 593 and 756. (author) [French] Liste recapitulative des rapports C.E.A. publies par le Commissariat a l'Energie Atomique (du numero 757 au numero 1062, decembre 1957 - decembre 1958). Complement aux rapports C.E.A. numero 593 et 756. (auteur)

  8. Comparative study of the oxidation of various qualities of uranium in carbon dioxide at high temperatures; Etude comparative de l'oxydation de diverses qualites d'uranium dans l'anhydride carbonique aux temperatures elevees

    Energy Technology Data Exchange (ETDEWEB)

    Desrues, R; Paidassi, J [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

    1965-07-01

    et 700 C) par voie gravimetrique. a l'aide d'une thermobalance Ugine-Eyraud. De la comparaison des resultats, les 3 points suivants ont pu etre degages. Premieremt une loi lineaire (suivie a 700 C d'une loi acceleree) regit l'oxydation des six uraniums etudies. Les vitesses de reaction different au plus d'environ 100 pour cent, les qualites les plus pures s'oxydant le plus lentement, sauf a 700 C ou l'inverse a lieu. Deuxiemement, en meme temps qu'un film de bioxyde d'uranium sensiblement uniforme croit sur le metal, une attaque localisee sous forme de pustules se produit au voisinage immediat des inclusions de monocarbure dans l'uranium. L'importance relative de cette derniere est d'autant plus grande que la temperature d'oxydation est plus basse et que le nombre, la taille et l'inegalite de distribution des inclusions sont plus grands, c'est-a-dire que la teneur en carbone de l'uranium (comprise entre 7 et 1000 ppm dans nos essais) l'est egalement. Troisiement, aux temperatures d'oxydation superieures a 600 C, les pustules retrogradent fortement, mais il apparait des 700 C un debut de deformation generale de l'echantillon qui, a partir de 750 C, s'agrandit considerablement, ce qui entraine une acceleration de la cinetique de reaction par rapport a la loi lineaire. Compte tenu de la surchauffe, l'echantillon doit alors deja se trouver en phase gamma qui est particulierement deformable; d'autre part cet effet de grandissement est d'autant plus accentue que le metal est plus plastique, donc plus pur.

  9. Concession of sickness benefit to social security beneficiaries due to mental disorders Chance de deferimento de requerimentos de auxílio-doença a segurados do Instituto Nacional do Seguro Social com transtornos mentais

    Directory of Open Access Journals (Sweden)

    Adriana Kelmer Siano

    2011-12-01

    Full Text Available OBJECTIVE: Assess the odds of having an initial claim for statutory sickness benefit awarded (ascribed to mental disorder as the main registered diagnosis, in relation to institutional, clinical, sociodemographic and welfare factors in Juiz de Fora-MG, Brazil. METHOD: Two models of logistic regression, taking into account the categories of the medical examiners, were built with the aim of characterizing the relative weight of several variables affecting the medical conclusion. RESULTS: The factors more strongly related to an award of benefit were claimants assessed by a physician without a specialization in psychiatry; with a diagnosis of psychosis; up to 29 years of age; with other non-psychiatric (musculoskeletal and cardiovascular co-morbidities; registered with the national insurance system as employed; and male. DISCUSSION: In both models, examiners with a specialization in psychiatry were associated with a lower likelihood of award of benefit. This suggests that examinations undertaken by doctors having a specialty related to the diagnosis supporting the sickness benefit claim are stricter than those undertaken by non-specialists. CONCLUSION: The results suggest that benefit award odds were associated with the specialty of the examiner, medical diagnosis, age, gender and claimant category.OBJETIVO: Avaliar a chance de deferimento em relação a fatores institucionais, clínicos, sociodemográficos e previdenciários em exames periciais iniciais de requerentes de auxílio-doença com registro de algum transtorno mental como diagnóstico principal em Juiz de Fora-MG. MÉTODO: Considerando as categorias de peritos médicos avaliadores, foram construídos dois modelos de regressão logística buscando caracterizar o peso relativo de diversas variáveis sobre a conclusão médico-pericial. RESULTADOS: Os fatores que se mostraram fortemente associados a maior chance de deferimento foram: segurado avaliado por perito médico sem especialidade em

  10. Concession of sickness benefit to social security beneficiaries due to mental disorders Chance de deferimento de requerimentos de auxílio-doença a segurados do Instituto Nacional do Seguro Social com transtornos mentais

    Directory of Open Access Journals (Sweden)

    Adriana Kelmer Siano

    2011-01-01

    Full Text Available OBJECTIVE: Assess the odds of having an initial claim for statutory sickness benefit awarded (ascribed to mental disorder as the main registered diagnosis, in relation to institutional, clinical, sociodemographic and welfare factors in Juiz de Fora-MG, Brazil. METHOD: Two models of logistic regression, taking into account the categories of the medical examiners, were built with the aim of characterizing the relative weight of several variables affecting the medical conclusion. RESULTS: The factors more strongly related to an award of benefit were a claimant assessed by a physician without a specialization in psychiatry; with a diagnosis of psychosis; up to 29 years of age; with other non-psychiatric (musculoskeletal and cardiovascular co-morbidities; registered with the national insurance system as employed; and male. DISCUSSION: In both models, examiners with a specialization in psychiatry were associated with a lower likelihood of award of benefit. This suggests that examinations undertaken by doctors having a specialty related to the diagnosis supporting the sickness benefit claim are stricter than those undertaken by non-specialists. CONCLUSION: The results suggest that benefit award odds were associated with the specialty of the examiner, medical diagnosis, age, gender and claimant category.OBJETIVO: Avaliar a chance de deferimento em relação a fatores institucionais, clínicos, sociodemográficos e previdenciários em exames periciais iniciais de requerentes de auxílio-doença com registro de algum transtorno mental como diagnóstico principal em Juiz de Fora-MG. MÉTODO: Considerando as categorias de peritos médicos avaliadores, foram construídos dois modelos de regressão logística buscando caracterizar o peso relativo de diversas variáveis sobre a conclusão médico-pericial. RESULTADOS: Os fatores que se mostraram fortemente associados a maior chance de deferimento foram: segurado avaliado por perito médico sem especialidade em

  11. Non-destructive analysis of major components in plant materials by mean of 14-MeV neutrons; Analyse ''non destructrice'' des principaux constituants de la matiere vegetale apres irradiation aux neutrons de 14 MeV

    Energy Technology Data Exchange (ETDEWEB)

    Garrec, J P [Commissariat a l' Energie Atomique, Grenoble (France). Centre d' Etudes Nucleaires

    1968-07-01

    (n,p) , (n,{alpha}) et (n,2n). Les recherches actuelles portent sur l'exploitation complete du spectre gamma de matiere vegetale activee. Le spectre est decompose en 7 spectres principaux suivant La methode des moindres carres, par une calculatrice. En premiere approximation, ce sont ceux que donnent des etalons d'aluminium, de calcium, de potassium, de magnesium, de phosphore, de silicium et de chlore, dans des conditions standard d'activation et de decroissance radioactive. L'avantage recherche par ce moyen d'analyse n'est pas l'extreme sensibilite, mais la rapidite et, par cela, il est particulierement bien adapte aux dosages rapides et simultanes d'elements interessant l'agronomie. (auteur)

  12. La gestion marchande, arme de destruction massive de l'Université

    DEFF Research Database (Denmark)

    Bouchet, Dominique

    2014-01-01

    de se plier aux exigences du marketing et du management. Cependant, c’est la finalité même des universités qui est remise en question par l’introduction de la logique de gestion issue du marché. Comment peut-on espérer que l’Université puisse contribuer à une compréhension de la crise quand tout est......Tout comme les sociétés chrétiennes au temps de l’émergence de l’économie politique, les sociétés d’aujourd’hui sont confrontées à l’inadéquation de leur mode d’organisation et de représentation face aux conséquences mêmes de leurs choix antérieurs. On a vu s’opérer une dissociation de l...

  13. Masculinité et relations de genre dans la société secrète abakuá

    OpenAIRE

    Morel, Géraldine

    2013-01-01

    La société secrète abakuá fait partie intégrante de l’univers religieux afro-cubain. Toutefois, son mode de fonctionnement ainsi que son système de recrutement « au mérite » s’inscrivent aux antipodes de la logique religieuse commune aux autres modalités de culte présentes sur l’île et reposant sur un échange de bons procédés entre hommes et dieux (transe, sacrifice, divination). En effet, être abakuá implique avant tout une construction de genre spécifique fondée sur une masculinité de type ...

  14. Lens Opacification in Mice Exposed to Monoenergetic Fast Neutrons; Opacite du Cristallin chez la Souris Exposee aux Neutrons Rapides; Katarakty u myshej, obluchennykh monoehnergeticheskimi bystrymi nejtronami; Opacidad del Cristalino en los Ratones Expuestos a los Neutrones Rapidos Monoenergeticos

    Energy Technology Data Exchange (ETDEWEB)

    Bateman, J. L.; Bond, V. P.; Rossi, H. H. [Medical Research Center, Brookhaven National Laboratory, Upton, NY (United States); Radiological Research Laboratory, Department of Radiology, Columbia University, New York, NY (United States)

    1964-05-15

    cates ranging from 0.2 to 100 rad/min. (author) [French] On a procede a de nombreuses experiences pour etudier les divers effets des rayonnements sur de petits mammiferes, depuis le niveau sub-cellulaire jusqu'a l'organisme entier; on a utilise surtout des rayonnements a faible transfert lineaire d'energie (TLE), tels que les rayons X et les rayons gamma; mais quelques experiences on fait intervenir des rayonnements a TLE plus eleve, comme les neutrons rapides. Dans ce dernier cas, on a expose les animaux a des neutrons ayant des energies tres variees et, par consequent, des TLE tres divers. Certaines reactions particules chargees-cible produisent des neutrons dont les energies dependent etroitement de l'angle de leur trajectoire avec l'axe faisceau-cible. Le laboratoire des auteurs a utilise la reaction protons-tritium pour certaines etudes. Les experiences sur la diminution du poids de la rate et du thymus chez la souris ont montre que l'HiR par rapport aux rayons X de 250 kV-crete est d'environ 4 pour les neutrons de 0,43 MeV et tombe a 3 pour les neutrons de 1, 80 MeV. L'etude de la diminution des spermatogonies donne des EBR legerement plus elevees, mais on constate la meme baisse de leur valeur quand l'energie des neutrons augmente. On a etudie, dans la meme gamme d'energies, l'inhibition du metabolisme de l'acide nucleique dans l'intestin et dans la moelle osseuse (en utilisant des precurseurs de l'acide nucleique marques avec des radioisotopes) et on a obtenu des valeurs de l'EBR generalement plus faibles. L'efficacite des neutrons dans les experiences ci-dessus etait a peu pres proportionnelle a la valeur calculee du TLE. On procede actuellement a l'etude de l'effet tardif (la cataracte) en fonction de l'energie des neutrons; les resultats obtenus jusqu'ici montrent qu'une energie de 0,43 MeV est plus efficace qu'une energie de 1,80 MeV. Une amelioration de la methode de la lampe a fente a permis de deceler des manifestations precoces d'opacite du cristallin

  15. Jan Woleński, L’École de Lvov-Varsovie. Philosophie et logique en Pologne (1895-1939

    Directory of Open Access Journals (Sweden)

    Sébastien Richard

    2012-06-01

    Full Text Available Le présent ouvrage est la traduction de Filozoficzna szkoła lwowsko-warszawska, paru en en polonais en 1985 et déjà traduit en anglais (1989 et en russe (2004. Il s’agit assurément d’un livre désormais classique sur la philosophie de l’École de Lvov-Varsovie. Celle-ci y est principalement étudiée durant la période qui s’étend de 1895 à 1939, c’est-à-dire durant la période qui sépare la nomination de Kazimierz Twardowski à la chaire de philosophie de l’Université de Lvov, considérée comme l’...

  16. Installation of a freezer building : a logical, innovative and profitable decision; Installation d'un batiment congelateur : une decision logique, innovatrice et rentable

    Energy Technology Data Exchange (ETDEWEB)

    Vaillancourt, G. [Nutrifrance Ltd. Saint-Jean-Sur-Richelieu, PQ (Canada)

    2009-12-15

    This article reported on a food company in Saint-Jean-sur-Richelieu, Quebec that has recently modernized its operations by constructing an entire freezer building. Nutrifrance Ltd made the decision to modernize its facility based on long-term energy savings. Three scenarios were analysed for the construction of the freezer building in terms of interior and exterior walls, panels and shelving. The final plans consisted of a freezer within the building, where the outer walls were used as the structure to insulate against heat loss. A heated attic was built to avoid condensation on top of the freezer. Forced air ventilation with a header space was also integrated. The floor consists of 18 centimetres of reinforced concrete every 13 centimetres, giving a thermal resistance of R40. A rapid defrosting process through hot gas is used to recuperate 100 per cent of the heat. Waste heat is used to heat the floors of the office building, the loading areas, and to warm the hot water. The system is controlled by automated machinery to maximize efficiency and costs. The construction offers optimal thermal comfort for employees, which has helped reduce employee turnover. The economical impact has been significant, even after one year of operation, and the energy savings for the electricity bill is 30 per cent lower than predicted. Nutrifrance chose not to use the lowest bid for construction since the ultimate goal was comfort and security. The company predicts a payback period of 14 years. 5 figs.

  17. Voyage au centre du monde. Logiques narratives et cohérence du projet dans la Rihla d’Ibn Jubayr

    OpenAIRE

    Dejugnat, Yann

    2013-01-01

    Le récit de voyage (rihla) d’Ibn Jubayr est une source bien connue des historiens spécialistes de la Méditerranée médiévale. Loué pour sa qualité et sa densité informative, ce texte a été abondamment utilisé comme réservoir de données de toutes natures. Mais l’œuvre en elle-même, paradoxalement, n’a pas fait l’objet de beaucoup d’études. Plus précisément, le principal défaut des recherches est de l’aborder avec une approche « trop synthétique », puisque trop générale, dont l’emploi générique ...

  18. Validation fonctionnelle de contrôleurs logiques : contribution au test de conformité et à l'analyse en boucle fermée

    OpenAIRE

    Guignard , Anaïs

    2014-01-01

    The results presented in this PhD thesis deal with functional validation of logic controllers using conformance test and closed-loop validation techniques. The specification model is written in the Grafcet language and the logic controller is assumed to be a Programmable Logic Controller (PLC). In order to contribute to these validation techniques, this thesis presents:- An axtension to a fomalization methods for Grafcet languages by translation to a Mealy machine. This extension generates a ...

  19. Méthode de synthèse d'un contrôleur logique à partir des spécifications algébriques

    OpenAIRE

    Medina Rodriguez , Antonio

    2007-01-01

    We present a synthesis method for the control of discrte event systems (DES). This method is an alternative to the supervisory contol theory (SCT). The method uses a control specification described in natural language and finishes with the implantation of control functions calculated in a logic controller, such as the Programmable Logic Controller (PLC).; Nous présentons une méthode de synthèse de la commande d'un système à événements discrets (SED). Cette méthode est une alternative à la tec...

  20. Criminalité, police et gouvernement : trajectoires post-communistes, Sous la direction de Gilles Favarel-Garrigues, Paris, l’Harmattan, collection logiques politiques, 2003, 304 pages.

    Directory of Open Access Journals (Sweden)

    Anne Wuilleumier

    2004-11-01

    Full Text Available Voici un ouvrage singulier ne serait-ce que de par la pluralité de lectures qu’il autorise ! Issues d’un colloque organisé par Gilles Favarel-Garrigues au CERI en mars 2002 sur le thème du traitement des questions de sécurité dans les pays de « l’Europe post-communiste », les huit contributions présentées ici peuvent nourrir le cas échéant une réflexion de type area studies (y compris s’agissant de discuter de la pertinence de la terminologie et de la délimitation zonale aussi bien que de « ...

  1. Concept de l'autisme bleulérien dans la logique freudienne de l'aliénation et de la séparation

    OpenAIRE

    Gailis , Janis

    2010-01-01

    "Autism is more or less the same thing Freud called auto-eroticism" - this is what Paul Eugen Bleuler writes in his fundamental work "Dementia praecox or the group of schizophrenias". However, if we take a closer look at other definitions of autism, offered by Bleuler, works, on which he relied in his proceedings, as well as Sigmund Freud's texts, he wrote, to answer Paul Eugen Bleuler, we can find that this remark about substituting auto-eroticism with autism, avoiding any mention of sexuali...

  2. Fuzzy logic and modeling of ventilation networks in the nuclear industry; Logique floue et modelisation des reseaux de ventilation dans l'industrie nucleaire

    Energy Technology Data Exchange (ETDEWEB)

    Floquet, P.; Lhoste, J.C.; Domenech, S.; Pibouleau, L. [Ecole Nationale Superieure des Arts Chimiques et Technologiques, Lab. de Genie Chimique, LGC, UMR CNRS/INP/UPS 5503, 31 - Toulouse (France); Laborde, J.C. [CEA Saclay, Institut de la Protection et de la Surete Nucleaire, IPSN, DPEA/SERAC, 91 - Gif-sur-Yvette (France)

    2001-07-01

    This article presents the implementation of fuzzy logic in the modeling of ducts, filters and pressures of the ventilation networks of the nuclear industry, taking into account the uncertainties of the aeraulic parameters. (J.S.)

  3. Analysis of resonances due to 'S' neutrons in experiments on transmission by time-of-flight. 1. without the interference term; Analyse des resonances dues aux neutrons 'S' dans les experiences de transmission par temps de vol. 1. sans terme d'interference

    Energy Technology Data Exchange (ETDEWEB)

    Corge, C R [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

    1961-07-01

    Various methods of transmission resonance analysis for 's' wave neutrons in time of flight experiments are described in this report. Only the case when the interference term can be neglected is treated in this first part. Results are given relative to a more complete partial area method and also to a new method so-called the width at half depth method. (author) [French] Le present rapport est consacre a l'expose de differentes methodes d'analyse des resonances dues aux neutrons d'ondes 's' dans les experiences de transmission par temps de vol, cette premiere partie traitant uniquement le cas ou l'on peut negliger le terme d'interference. Y figurent en particulier sous forme de reseaux de courbes, les resultats relatifs a une methode des aires partielles amelioree et ceux relatifs a une nouvelle methode dite de la largeur a mi-profondeur. (auteur)

  4. Al Sharpton’s 2004 Presidential Campaign: Has the Reverend Lost the Faith? Le révérend aurait-il perdu la foi ? La candidature d’Al Sharpton aux élections présidentielles américaines de 2004

    Directory of Open Access Journals (Sweden)

    Anne Urbanowski

    2011-03-01

    Full Text Available Cet article se propose d’étudier la tactique électorale mise en place par Al Sharpton au cours de la campagne pour les élections présidentielles de 2004 aux États-Unis. Cette tactique dite de « déracialisation » l’a conduit à minimiser l’aspect religieux de sa candidature dans un contexte où précisément, les électeurs souhaitaient entendre davantage les candidats expliquer leurs rapports au religieux. Loin de lui faire gagner les voix espérées, ce choix lui a aliéné une partie de l’électorat noir, sans pour autant lui attirer d’autres électeurs.

  5. Actes de la conférence " Aux frontières de l'urbain. Petites villes du monde : émergence, croissance, rôle économique et social, intégration territoriale, gouvernance "
    Conference Proceedings "At the Frontiers of Urban Space. Small towns of the world: emergence, growth, economic and social role, territorial integration, governance"

    OpenAIRE

    Moriconi Ebrard, François; Chatel, Catherine; Bordagi, Julien

    2014-01-01

    Sous la Direction de François Moriconi-Ebrard, Catherine Chatel et Julien Bordagi Éditeur : UMR ESPACE - Avignon, Case 19, 74 rue Louis Pasteur, 84029 Avignon Cedex Collection : Actes Avignon - ISBN : 978‐2‐9105‐4509‐1; Publication collective. La conférence internationale " Aux frontières de l'urbain " s'est déroulée à l'Université d'Avignon et des Pays de Vaucluse du 22 au 24 janvier 2014. Elle a été organisée à l'initiative d'un groupe de chercheurs de l'UMR 7300 ESPACE spécialistes de la v...

  6. Mémoire du travail et des expositions professionnelles aux cancérogènes Work account and occupational exposures to carcinogens. Survey in Seine-Saint-Denis (France) Memoria del trabajo y de las exposiciones profesionales a agentes cancerígenos. Encuesta en Seine-Saint-Denis (Francia)

    OpenAIRE

    Annie Thébaud-Mony; Béatrice Leconte

    2010-01-01

    Selon les estimations officielles, en 2000 environ 32 millions de travailleurs européens (de l’Europe des 15) étaient exposés à des cancérogènes. Depuis 2002, considérant la maladie comme « événement-sentinelle » pour la connaissance des activités de travail exposant aux cancérogènes, le Groupement d’intérêt scientifique sur les cancers d’origine professionnelle (GISCOP93) mène une enquête permanente auprès de patients atteints de cancer en Seine Saint Denis (France). S’appuyant sur les récit...

  7. Radioisotopes and Radiation in Animal and Plant Insect Pest Control; Emploi des radioisotopes et des rayonnements dans la lutte contre les insectes nuisibles aux plantes et aux animaux; Ispol'zovanie radioizotopov i radiashchi v bor'be s nasekomymi-vreditelyami rastenij i zhivotnykh; Utilizacion de los radioisotopos y de las radiaciones en la lucha contra los insectos nocivos para las plantas y los animales

    Energy Technology Data Exchange (ETDEWEB)

    Andreev, S. V.; Martens, B. K.; Samojlova, V. A.; Molchanova, Z. I. [Vsesoyuznyj Institut Zashchity Rastenij, Leningrad, SSSR (Russian Federation)

    1963-09-15

    degrees of stability when subjected to the action of herbicides. Pesticides containing trace quantities of isotopes with short half-lives can be used as a means of judging the merits of various spraying systems for treating seeds and agricultural crops with pesticides; this method also provides information about the optimum doses. Experiments have shown that ionizing radiations can be used to increase the virulence of insect nosophytes (Beauveria vassiana Unill.) and thus improve the efficiency of microbiological insect-pest-control methods. The sterilizing and lethal effects of ionizing radiations are also useful in combatting insect pests. Gamma-ray experiments have made it possible to establish sterilizing doses for a number of insect pests which attack crops and stored products (Calandra granaria L., Acanthoscelides obtectus Say, Pectinophora malvella Hb., Leptinotarsa decemlineota Say, Chloridea obsoleta F.). The data obtained in these investigations will be used to develop and improve the methods of insect-pest control used in agriculture. (author) [French] Le probleme de la lutte contre les parasites des cultures presente une grande importance pour l'economie nationale. Il importe, pour le resoudre, de tirer parti des realisations scientifiques les plus recentes. Pour rationaliser les methodes actuelles de lutte contre les insectes nuisibles et accroitre l'efficacite de ces methodes, on a fait appel aux radioisotopes et aux rayonnements. Grace a remploi des radioisotopes et des rayonnements, il est possible de rationaliser dans une large mesure les methodes utilisees et d'augmenter leur efficacite. A cet effet, il est indispensable d'etudier a fond les problemes d'ecologie, de toxicologie, etc. Dans le domaine de l'ecologie, la methode du radiomarquage des insectes est particulierement prometteuse. L'emploi de radioisotopes pour le marquage des insectes ravageurs des cereales (Eurygaster integriceps Put. et Hadena sordida Skh.) et de leurs parasites (Meniscus

  8. Vulnérabilité et Stratégies durables de gestion des risques : Une étude appliquée aux ménages ruraux de Madagascar

    Directory of Open Access Journals (Sweden)

    Sophie Rousseau

    2004-02-01

    Full Text Available L’objet de cet article est de comprendre la façon dont les individus, évoluant dans un environnement risqué, élaborent des stratégies durables de gestion des risques. Au sens général, on définit la vulnérabilité comme la probabilité de voir sa situation ou ses conditions de vie se dégrader, quel que soit son niveau de richesse, face à un choc ou un aléa. Pour analyser la vulnérabilité, il faut non seulement identifier le risque global encouru par chaque ménage ou individu dans un lieu et à une époque donnés, mais aussi leurs capacités de réaction, c’est-à-dire l’ensemble des capabilités permettant de mettre en œuvre toutes les possibilités qui s’offrent pour résister aux effets négatifs du choc et remonter la pente. Cette résistance est l’atout dont disposent les ménages face à l’adversité. Ainsi, l’homme, en tant qu’individu responsable, élabore des stratégies destinées à se prémunir contre le risque et améliorer ses conditions de vie. L’acteur est donc un individu conscient des risques qu’il encourt et de ses possibilités d’agir sur son capital dans le cadre de stratégies préventives et offensives. Dans ce contexte, l’approche des capabilités de Sen apparaît comme la référence de base. Elle met l’accent sur la manière la plus efficiente de réduire la pauvreté en améliorant les capabilités des individus à long terme. Par ailleurs ce cadre théorique sera complété par l’analyse compréhensive des stratégies adoptées par les ménages ruraux des Hautes Terres de Madagascar. Cette étude a été menée au printemps 2003 dans le cadre du réseau des observatoires ruraux (ROR, système d’information sur les campagnes malgaches mis en place par le projet MADIO (Madagascar, Dial, INSTAT, IRD ex-ORSTOM.The goal of this article is to understand the way people living in a risky environment find durable strategies to handle these risks. Generally the definition of

  9. Some Non-Destructive Testing Methods Applicable to Sintered Materials; Quelques Methodes d'Essais Non Destructifs Applicables aux Materiaux Frittes; Nekotorye metody nedestruktivnykh ispytanii, primenimye k spechennym materialam; Algunos Metodos de Ensayo No Destructivo Aplicables a los Materiales Sinterizados

    Energy Technology Data Exchange (ETDEWEB)

    Labusca, Elena; Mirion, I.; Andreescu, N.; Alecu, M.; Biscoveanu, I. [Institut de Physique Atomique, Bucarest (Romania)

    1965-10-15

    solides frittes, a l'aide de la metallographie et de la microscopie electronique. Ces methodes mettent en evidence l'homogeneite de la structure, les dimensions et l'orientation des grains, la presence de defauts divers (inclusions, pores) et revolution meme du processus de frittage, y compris la formation des cristaux, la croissance granulaire, etc. Dans quelques cas, on peut combiner l'examen microscopique a des essais de microdurete. Cet examen de la structure microcristalline represente l'une des methodes principales de controle qualitatif des materiaux frittes, et ne peut etre remplace par aucun autre moyen d'investigation. 2. Controle du degre de consolidation, qui determine essentiellement la qualite des materiaux frittes. Ce controle est effectue par la mesure de quelques proprietes, telles que la conductibilite electrique et thermique, en correlation avec la densite, etant donne que la conductibilite des materiaux frittes est directement porportionnelle au degre de frittage. On a essaye aussi une methode adequate de controle de la porosite; on a obtenu des donnees experimentales interessantes, surtout au point de vue de la porosite libre, laquelle est susceptible aux inclusions gazeuses. Le memoire contient des donnees experimentales concernant l'application de ces methodes de controle a quelques materiaux frittes interessants pour la technologie nucleaire. (author) [Spanish] Teniendo en cuenta la estructura granular especifica de los materiales sinterizados, elaborados a partir de polvos, cuyo proceso de consolidacion se desarrolla en funcion del tratamiento de sinterizacion, los autores han estudiado algunos metodos para verificar el grado de sinterizacion y controlar ciertas propiedades. Entre los metodos no destructivos utilizados, se mencionan en la presente memoria: 1. Examen de la estructura cristalina de los solidos sinterizados por metalografia y microscopfa electronica. Estos metodos ponen de manifiesto el giado de homogeneidad estructural, la dimension

  10. Modélisation du procédé de soudage hybride Arc / Laser par une approche level set application aux toles d'aciers de fortes épaisseurs A level-set approach for the modelling of hybrid arc/laser welding process application for high thickness steel sheets joining

    Directory of Open Access Journals (Sweden)

    Desmaison Olivier

    2013-11-01

    Full Text Available Le procédé de soudage hybride Arc/Laser est une solution aux assemblages difficiles de tôles de fortes épaisseurs. Ce procédé innovant associe deux sources de chaleur : un arc électrique produit par une torche MIG et une source laser placée en amont. Ce couplage améliore le rendement du procédé, la qualité du cordon et les déformations finales. La modélisation de ce procédé par une approche Level Set permet une prédiction du développement du cordon et du champ de température associé. La simulation du soudage multi-passes d'une nuance d'acier 18MnNiMo5 est présentée ici et les résultats sont comparés aux observations expérimentales. The hybrid arc/laser welding process has been developed in order to overcome the difficulties encountered for joining high thickness steel sheets. This innovative process gathers two heat sources: an arc source developed by a MIG torch and a pre-located laser source. This coupling improves the efficiency of the process, the weld bead quality and the final deformations. The Level-Set approach for the modelling of this process enables the prediction of the weld bead development and the temperature field evolution. The simulation of the multi-passes welding of a 18MnNiMo5 steel grade is detailed and the results are compared to the experimental observations.

  11. La fonction logistique, un outil performant d'analyse et de prévision à moyen terme. Application à la production de pétrole et de gaz aux Etats-Unis, en URSS et dans d'autres pays The Logistic Function, an Efficient Medium-Range Analysis and Forecasting Method

    Directory of Open Access Journals (Sweden)

    Seguret J.

    2006-11-01

    Full Text Available A partir de la similitude observée entre l'évolution de la production pétrolière d'un pays et celle de la pénétration d'un produit dans un marché (fonction logistique, l'auteur expose le principe d'une méthode originale qui permet, sous certaines conditions, de prévoir quelle sera la production annuelle probable d'un pays producteur à un horizon de 10 à 15 ans. La validité de cette méthode est d'abord démontrée sur l'exemple de la production pétrolière aux Etats-Unis. Elle est ensuite illustrée par les résultats obtenus pour un certain nombre de pays : production future de gaz aux Etats-Unis, production pétrolière future du Canada, de l'URSS, du Venezuela et de l'ensemble du monde hors Moyen-Orient. On the basis of the similarity observed between the variation in the petroleum production of a country and that of the penetration of a product into the market (logistic function, this article describes the principle of an original method that can be used, under certain conditions, to forecast the probable annual production of a producing country in 10 to 15 years. The validity of this method is first demonstrated for the example of oil production in the United States. It is then illustrated by results obtained for various other countries, i. e. future gas production in the United States, future oil production of Canada, the Soviet Union, Venezuela and the world as a whole outside of the Middle East.

  12. Accès aux ressources internationales aux fins de la lutte antitabac ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Canada-Latin America and Caribbean Zika Virus Research Program. A new funding opportunity on Zika virus is responding to the virus outbreak and the health threat it represents for the affected populations in the hardest hit countries in Latin America and the... View moreCanada-Latin America and Caribbean Zika Virus ...

  13. Participation des hommes aux soins aux enfants avant la mise en ...

    African Journals Online (AJOL)

    Journal de la Recherche Scientifique de l'Université de Lomé ... before the implementation of the family and community component of the IMCI strategy in Togo. ... Despite the cultural diversity that characterizes African societies, it is necessary ...

  14. Donner aux filles et aux femmes le pouvoir de décider | CRDI ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    éclampsie et d'hypertension artérielle, et peuvent également entraîner un faible poids à la naissance et des naissances prématurées. La Federation of Muslim Women's Association of Nigeria et l'Université McGill à Montréal, ...

  15. Theoretical Interpretation of Pulsed Neutron Phenomena; Interpretation Theorique des Phenomenes dus aux Neutrons Pulses; Teoreticheskaya interpretatsiya yavlenij, svyazannykh s impul'snymi nejtronami; Interpretacion Teorica de los Fenomenos Debidos a Neutrones Pulsados

    Energy Technology Data Exchange (ETDEWEB)

    Corngold, N. [Brookhaven National Laboratory, Upton, NY (United States)

    1965-08-15

    The author discusses the present understanding of transient effects in the variation of neutron distributions in space, time and energy. In the analysis, particular attention is given to the pulsed neutron experiment in non-multiplying media, and to its interpretation in terms of space-energy modes and (time) decay constants. Theoretical research in this field, much of which has come from the Brookhaven National Laboratory, has been built upon the exact solution of several special problems, and approximate, numerical solutions in more realistic situations. Recently, a unified point of view, based on the Van Hove-Glauber theory of the scattering of slow neutrons, has been proposed. It has been found that the long-time behaviour of the pair correlation function, which enables one to distinguish between different types of moderating materials, also controls the type of decay-constant spectrum that one finds. In his discussion the author emphasizes the case of infinite medium solutions that are proportional to exp(iB * r), in media having 1/v absorption. The analytical work is concerned with modal solutions, proportional to exp({lambda}t) as well, while the numerical work is directed at the full, ''life-history'' solution, as well as the modal solutions. The author also remarks on phenomena encountered when the absorption is not 1/v and when the moderator sample is so small that the long-time solutions are no longer separable in space and energy. Finally, the paper discusses the bearing of these recent developments upon the interpretation of pulsed experiments. Particular reference is made to the measurement of diffusion and diffusion cooling coefficients, and to the nature of the approach to the asymptotic distribution. (author) [French] L'auteur examine la conception actuelle des effets transitoires dans la variation des distributions des neutrons dans l'espace, dans le temps et selon l'energie. Dans son etude, il accorde une attention particuliere aux experiences

  16. The countdown for the negotiations on the exit of Great Britain from the EU and Euratom has begun; Alea iacta est. Der Countdown fuer die Verhandlungen ueber den Ausstieg Grossbritanniens aus EU und EURATOM hat begonnen

    Energy Technology Data Exchange (ETDEWEB)

    Feldmann, Ulrike

    2017-07-15

    On 29 March 2017 the official letter from the United Kingdom to the President of the EU Council was presented to inform the European Council of its intention to withdraw from the European Union (EU). The period of 2 years in Article 50 of the EU Treaty provided for the exit negotiations has thus begun to run. In the letter to the President of the Council, the UK Government expressly declares its intention to withdraw from the EU and from the Euratom Treaty (EAV). Thus the controversy about the conjunction of the withdrawal from the EU and Euratom has become obsolete.

  17. Seismic rupture modelling, strong motion prediction and seismic hazard assessment: fundamental and applied approaches; Modelisation de la rupture sismique, prediction du mouvement fort, et evaluation de l'alea sismique: approches fondamentale et appliquee

    Energy Technology Data Exchange (ETDEWEB)

    Berge-Thierry, C

    2007-05-15

    The defence to obtain the 'Habilitation a Diriger des Recherches' is a synthesis of the research work performed since the end of my Ph D. thesis in 1997. This synthesis covers the two years as post doctoral researcher at the Bureau d'Evaluation des Risques Sismiques at the Institut de Protection (BERSSIN), and the seven consecutive years as seismologist and head of the BERSSIN team. This work and the research project are presented in the framework of the seismic risk topic, and particularly with respect to the seismic hazard assessment. Seismic risk combines seismic hazard and vulnerability. Vulnerability combines the strength of building structures and the human and economical consequences in case of structural failure. Seismic hazard is usually defined in terms of plausible seismic motion (soil acceleration or velocity) in a site for a given time period. Either for the regulatory context or the structural specificity (conventional structure or high risk construction), seismic hazard assessment needs: to identify and locate the seismic sources (zones or faults), to characterize their activity, to evaluate the seismic motion to which the structure has to resist (including the site effects). I specialized in the field of numerical strong-motion prediction using high frequency seismic sources modelling and forming part of the IRSN allowed me to rapidly working on the different tasks of seismic hazard assessment. Thanks to the expertise practice and the participation to the regulation evolution (nuclear power plants, conventional and chemical structures), I have been able to work on empirical strong-motion prediction, including site effects. Specific questions related to the interface between seismologists and structural engineers are also presented, especially the quantification of uncertainties. This is part of the research work initiated to improve the selection of the input ground motion in designing or verifying the stability of structures. (author)

  18. Seismic rupture modelling, strong motion prediction and seismic hazard assessment: fundamental and applied approaches; Modelisation de la rupture sismique, prediction du mouvement fort, et evaluation de l'alea sismique: approches fondamentale et appliquee

    Energy Technology Data Exchange (ETDEWEB)

    Berge-Thierry, C

    2007-05-15

    The defence to obtain the 'Habilitation a Diriger des Recherches' is a synthesis of the research work performed since the end of my Ph D. thesis in 1997. This synthesis covers the two years as post doctoral researcher at the Bureau d'Evaluation des Risques Sismiques at the Institut de Protection (BERSSIN), and the seven consecutive years as seismologist and head of the BERSSIN team. This work and the research project are presented in the framework of the seismic risk topic, and particularly with respect to the seismic hazard assessment. Seismic risk combines seismic hazard and vulnerability. Vulnerability combines the strength of building structures and the human and economical consequences in case of structural failure. Seismic hazard is usually defined in terms of plausible seismic motion (soil acceleration or velocity) in a site for a given time period. Either for the regulatory context or the structural specificity (conventional structure or high risk construction), seismic hazard assessment needs: to identify and locate the seismic sources (zones or faults), to characterize their activity, to evaluate the seismic motion to which the structure has to resist (including the site effects). I specialized in the field of numerical strong-motion prediction using high frequency seismic sources modelling and forming part of the IRSN allowed me to rapidly working on the different tasks of seismic hazard assessment. Thanks to the expertise practice and the participation to the regulation evolution (nuclear power plants, conventional and chemical structures), I have been able to work on empirical strong-motion prediction, including site effects. Specific questions related to the interface between seismologists and structural engineers are also presented, especially the quantification of uncertainties. This is part of the research work initiated to improve the selection of the input ground motion in designing or verifying the stability of structures. (author)

  19. Caractérisation rhéologique et modélisation structurelle des systèmes argile-polymère. Application aux fluides de forage Rheometry and Structural Modelling of Clay-Polymer Systems. Application to Drilling Fluids

    Directory of Open Access Journals (Sweden)

    Cartalos U.

    2006-12-01

    Full Text Available Le comportement rhéologique des systèmes argile-polymère couramment utilisés dans les formulations des fluides de forage est examiné dans cet article. Un protocole d'essai adapté à leur nature thixotrope qui permet d'effectuer des mesures reproductibles est mis au point. Les propriétés intrinsèques du matériau sont ainsi déterminées sur toute la gamme de sollicitations : du comportement solide aux faibles déformations au comportement fluide aux taux de déformations intenses. Il est montré que ces systèmes sont caractérisés par des temps de restructuration longs, par des rhéogrammes en régime permanent présentant un minimum de contrainte et par des dépassements importants de la contrainte lors des essais transitoires. Ces effets peuvent être complètement masqués par des procédures d'essai préconisés par les normes en vigueur dans le forage. Une loi de comportement structurelle récente qui relie les propriétés thixotropes et viscoélastiques du matériau aux mécanismes de création et de rupture des flocs peut reproduire l'ensemble des phénomènes observés. Sa capacité de décrire le changement de structure au sein du fluide sous écoulement ou au repos et les variations associées de la contrainte permet d'envisager une meilleure modélisation de l'hydraulique du forage. The rheological behaviour of clay-polymer systems that are currently used in the formulation of drilling fluids was studied. A specific experimental procedure was used to account for thixotropic effects and obtain, thus, reproducible results. In this way it was possible to determine intrinsic properties in the whole range, from solid behaviour below the yield stress to liquid behaviour at very high shear. These systems are shown to be characterised by very long time scales of structure recovery, by the existence of a minimum shear stress in the steady state flow curve and by important stress overshoots in transient flows. These effects can be

  20. Centralisation, décentralisation et accès aux services urbains : le cas de l’enlèvement des ordures ménagères à Abidjan Centralization, decentralization, access to urban public services : waste collection in Abidjan

    Directory of Open Access Journals (Sweden)

    Amandine Henry

    2013-03-01

    Full Text Available Cet article traite de l’inégalité d’accès aux services publics urbains dans les pays en développement et, plus particulièrement, de la question de l’accès au service d’enlèvement des ordures ménagères à Abidjan. Cette question est étroitement liée au mouvement de centralisation, décentralisation et recentralisation qui a affecté la gestion de ce service au cours des dernières décennies. Chaque étape de l’avancée de la Côte d’Ivoire dans le processus de décentralisation a provoqué des changements institutionnels dans la gestion des ordures ménagères à Abidjan ; tous ont eu des effets spécifiques sur l’accès de la population à ce service. Ces effets sont étudiés à l’échelle des communes et des quartiers à travers une enquête de terrain, et sont liés aux caractéristiques socio-économiques des quartiers. Une analyse comparative entre deux communes de standing opposé, ainsi que l’examen des aspects historiques de la problématique, s’attachent à identifier les facteurs-clés d’une telle inégalité d’accès au service d’enlèvement des ordures ménagères à Abidjan.This paper deals with the inequality of access to the urban public utilities in developing countries, and more accurately with the issue of the access to the waste collection in Abidjan. This question is closely linked with the centralization, decentralization and recentralization movements that affected this service management for the last decades. Each stage of the decentralization process in Ivory Coast brought institutional changes in waste collection management in Abidjan. Each of them had specific consequences on the access of people to this service. These consequences are investigated on a local scale and are linked to the socio-economic characteristics of the studied areas. Together with the focus on the historical aspects of the problematic, a comparative analysis between two districts of opposite standing attempts

  1. Theory of high frequency discharge in gases under low pressures. Experimental investigation of high-frequency type ion sources; Theorie de la decharge haute frequence dans les gaz aux faibles pressions. Etude experimentale des sources d'ions du type haute frequence

    Energy Technology Data Exchange (ETDEWEB)

    Salmon, Jean

    1955-03-02

    The first part of this research thesis addresses the theory of high frequency discharge in gases under low pressures, and first proposes a calculation of the distribution function for electrons present within the gas. The author then studies the evolution of electron density within a discharge tube by assigning the governing role in electron multiplication to the secondary emission of tube walls. The second part proposes a detailed description of a source operating at 96.5 Mc/s, a discussion of measurements performed on this source, and the search for a theoretical explanation of some of its properties. The author then briefly analyses various existing types of high frequency sources, and finally discusses their use in corpuscular microscopy and in particle accelerators [French] La presente these comprend deux parties. La premiere est consacree a la theorie de la decharge haute frequence dans les gaz aux faibles pressions et comporte tout d'abord le calcul de la fonction de distribution des electrons presents au sein du gaz. Nous etudions ensuite l'evolution de la densite electronique a l'interieur d'un tube a decharge en attribuant, a l'emission secondaire des parois de ce dernier, le role essentiel dans la multiplicalion des electrons. Nous obtenons ainsi les conditions d'amorcage. Tout au long de cette etude, on doit distinguer soigneusement le cas ou le libre parcours moyen des electrons dans le gaz est inferieur aux dimensions de l'enceinte et le cas ou il leur est superieur. La deuxieme partie comprend la description detaillee d'une source fonctionnant sur 96.5 Mc/s, l'expose des mesures effectuees sur celle-ci et la recherche d'une explication theorique de certaines de ses proprietes. Nous faisons ensuite une breve analyse des divers types de sources d'ions haute frequence existant a l'heure actuelle et nous terminons en traitant de leur utilisation en microscopie corpusculaire et dans les accelerateurs de particules.

  2. The Impulse Response of an Exponential Assembly; Reponse d'un Assemblage Exponentiel aux Impulsions; Impul'snaya kharakteristika ehksponentsial'noj sborki; Respuesta de un Conjunto Exponencial a los Impulsos

    Energy Technology Data Exchange (ETDEWEB)

    Uhrig, R. E. [University of Florida, Gainesville, FL (United States)

    1964-04-15

    -neutron pulse has been demonstrated experimentally in 1962 at the University of Florida using a pulsed-neutron source and a ''Thermalizer box''. However, the method used for the experiments reported here was the cross correlation between the pseudo-random binary (off-on) variation of source strength and the resulting variation of neutron density in the exponential assembly. Data are given for experiments carried out on both light- and heavy-water moderated assemblies using natural uranium. The results are discussed in terms of the theoretical relations derived and the physical phenomena taking place. The validity of the derived relationships and the need for considering higher harmonics for various arrangements of fuel and moderator are discussed briefly. (author) [French] En utilisant la theorie de la diffusion et les approximations habituelles, l'auteur a etabli une fonction de transfert dependant de l'espace d'un assemblage exponentiel a geometrie rectangulaire, l'origine etant au milieu de l'un des cotes ou la source de neutrons est placee. Si Ton neglige le facteur de correction final, on obtient l'expression suivante: G (x, y, z, s) = ({Delta}#Greek Phi Symbol#(x, y, z, s))/{Delta}S (o, o, o, o, s) = 2/abD {sup {infinity}}{Sigma}{sub m} {sub =} {sub 1} {sup {infinity}}{Sigma}{sub n} {sub =} {sub 1} 1/({rho}{sub mn}(s) cos (m{pi}x)/a cos (n{pi}y)/b e{sup -{rho}}mn{sup (s)Z} (1) dans laquelle {rho}{sub mn}{sup (s)} = [s/(VD) + B{sup 2}{sub Up-Tack mn} - B{sup 2}{sub m}]{sup 1/2} = [s/VD - {gamma}{sup 2}{sub mn}]{sup 1/2} (2) L'inverse de la transformee de Laplace de l'equation (1) donne comme fonction de reponse aux impulsions dependant de l'espace (fonction de Green) g (x, y, z, t) = 2/ab Square-Root v/{pi}D 1/ Square-Root t e{sup -z{sup 2/4}} {sup VDt} {sup {infinity}}{Sigma}{sub m} {sub =} {sub 1} {sup {infinity}}{Sigma}{sub n} {sub =} {sub 1} cos m{pi}x/a cos n{pi}y/b e{sup -VD{gamma}{sup 2mn{sup t}}} (3) Si l'on considere uniquement les termes de l'equation (3) sans

  3. ORF Alignment: NC_006138 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available alea ... psychrophila LSv54] ... Length = 49 ... Query: 174 APLDSSRCTYCGQCGITCPEKCISHSLQFDFSACTFC...KKCEEICPQGAI 222 ... APLDSSRCTYCGQCGITCPEKCISHSLQFDFSACTFCKKCEEICPQGAI Sbjct: 1 ... APLDSSRCTYCGQCGITCPEKCISHSLQFDFSACTFCKKCEEICPQGAI 49

  4. Algeria facing the challenges of Europe natural gas supply and the respect of the environment.; L'Algerie face aux defis de l'approvisionnement de l'Europe en gaz naturel et le respect de l'environnement

    Energy Technology Data Exchange (ETDEWEB)

    Ali, Nadia Nait

    2010-09-15

    Taking into account the expectations, for the next decades, of a strong increase in the demand for gas in Europe, Algeria has committed to large structuring projects, adding to the two gas pipeline linking Algeria to Spain via Morocco and Algeria to Italy via Tunisia. Two more undertakings are added linking Algeria directly to two European partners. Sonatrach will play an important role in global environment protection, natural gas being less polluting than oil and coal and emitting less co2. Substitution of coal by natural gas will generate socio economical advantages and will preserve the environment. [French] Compte tenu des attentes, pour les decennies prochaines, d'une forte croissance de la demande de gaz en Europe, l'Algerie s'est engagee dans de grands projet structurants s'ajoutant aux deux gazoducs reliant l'Algerie a l'Espagne via le Maroc et l'Algerie a l'Italie via la Tunisie, viennent s'ajouter deux autres ouvrages reliant directement l'Algerie a deux partenaires europeens. Sonatrach Jouera un role important dans la protection de l'environnement a l'echelle mondiale, le gaz naturel est moins polluants que le petrole, le charbon et emet moins de co2. La substitution du charbon par le gaz naturel generera des avantages socio-economiques, preservation de l'environnement.

  5. Study of the retention of fission products by a few common minerals. Application to the treatment of medium activity effluents (1962); Etude de la retention des produits de fission par quelques mineraux usuels. Application aux traitements d'effluents de moyenne activite specifique (1962)

    Energy Technology Data Exchange (ETDEWEB)

    Auchapt, J M [Commissariat a l' Energie Atomique, Centre de Production de Plutonium, Marcoule (France). Centre d' Etudes Nucleaires

    1962-07-01

    The conditions in which strontium is fixed on calcite (the object of the Geneva report P/395 - USA - 1958) are more closely studied and the work is extended to five fission products present in the effluents, and to 17 common rocks and minerals. Although as it turns out this fixation is not suitable as a method of treating the S.T.E. effluents (i.e. those from the Effluent Treatment plant at Marcoule), the study shows that all the crystals considered are strongly contaminated by simple contact with the effluents. (author) [French] Les conditions de fixation du strontium sur la calcite (objet du rapport de Geneve P/395 - USA - 1958) sont approfondies et l'etude est etendue aux cinq produits de fission presents dans les effluents et a 17 roches et minerais courants. Bien qu'en definitive cette fixation se revele inutilisable comme procede de traitement d'effluents S.T.E. (Station de Traitement des Effluents, Marcoule), l'etude montre que tous les cristaux consideres se contaminent fortement par simple contact avec les effluents. (auteur)

  6. ÉTUDE SUR LES CAPACITÉS DE FRANCHISSEMENT DES CABOTS BOUCHE-RONDES (SICYOPTERUS LAGOCEPHALUS, PALLAS, 1770 EN VUE DE LA CONCEPTION DE DISPOSITIFS ADAPTÉS AUX PRISES D’EAU DU TRANSFERT SALAZIE (ÎLE DE LA REUNION.

    Directory of Open Access Journals (Sweden)

    VOEGTLÉ B.

    2002-01-01

    puissent franchir un mur vertical, le pourcentage de passage et le taux de réussite est beaucoup plus faible que pour les autres pentes testées. Une pente à 50°, et une charge de l’ordre de 1-2 mm sont les deux conditions ayant permis sur le pilote d’obtenir les meilleurs résultats. Le revêtement de la rampe s’est révélé être un facteur secondaire, le béton lisse constituant cependant le meilleur support. Les résultats de cette étude ont permis de proposer des critères de dimensionnement pour des dispositifs de franchissement adaptés aux sites et à l’espèce. La passe consiste en une rampe en béton lisse installée à une pente de 50° alimentée par déversement. Une alimentation non uniforme sur la largeur de la rampe permet d’obtenir, quel que soit le niveau amont, une zone favorable à la remontée du poisson.

  7. Auxílio-reclusão: a bizarra transmutação de um direito social e sua colonização perversa por um populismo punitivo = Imprisonment-relief: the bizarre transmutation of a social right and its perverse colonization by a punitive populism

    Directory of Open Access Journals (Sweden)

    Chies, Luiz Antônio Bogo

    2012-01-01

    Full Text Available Tendo como eixo a análise do instituto previdenciário do auxílio-reclusão – pago aos dependentes do segurado de baixa renda preso – este artigo aborda de forma crítica e reflexiva a relação entre políticas sociais e políticas penais. Sustenta-se em dados de uma pesquisa cujo campo empírico foi o ambiente virtual da internet e explora tanto as trajetórias da Proteção Social como dimensões legislativas do Brasil contemporâneo. Verifica que as conquistas e direitos sociais também estão vulneráveis a apropriações utilitárias, especialmente por lógicas de governabilidade e por um sistema punitivo que se ampliam como promotores de segregações e exclusões sociais

  8. Aux origines de la préoccupation marchande à la SNCF (1960-2011 Origins of the SNCF French State Railways’ commercial focus (1960-2011 Los orígenes de la preocupación mercantil en la SNCF (1960-2011

    Directory of Open Access Journals (Sweden)

    Jean Finez

    2013-03-01

    Full Text Available Cet article se propose d’étudier la convergence du secteur ferroviaire français, traditionnellement contrôlé par l’État, en direction du modèle de l’entreprise privée. Dans un premier temps, nous interrogeons l’opposition public/privé et soulignons que l’intensification de la régulation marchande dans les chemins de fer est une réalité ancienne, entamée dans les 1960, mais selon des degrés différents en fonction des sous-marchés ferroviaires considérés. Nous décrivons ensuite le cas spécifique d’une branche de la Sncf ayant adoptée de manière précoce une logique marchande. Dans un troisième temps, nous analysons les mutations du secteur en mobilisant le principe d’« isomorphisme institutionnel » : la réorganisation des chemins de fer français est tout à la fois le produit de la contrainte des institutions qui souhaitent intégrer les entreprises publiques dans l’économie de marché, du mimétisme de la Sncf qui reproduit les pratiques d’entreprises privées jugées performantes et d’un rapport de force interne en faveur de « nouveaux dirigeants » favorables à l’orientation marchande de l’entreprise publique.The paper studies the convergence between France’s traditionally State-controlled railway sector and the model of a commercial enterprise. It starts with the distinction between public and private sectors, emphasizing that the intensification of market regulation in the railway sector started as far back as the 1960s, albeit to varying degrees in different market segments. The discussion then covers the specific case of a Sncf branch that adopted a market-oriented approach at an early stage, before analyzing changes in the industry based on the theory of institutional isomorphism. The reorganization of the French railways is as much the product of constraints coming from institutions hoping to join state-owned enterprises in the market economy, as a reflection of the Sncf’s own

  9. Hybrid Scenario Development Methodology and Tool: An Arctic-Oriented Scenario Example

    Science.gov (United States)

    2011-07-01

    Monitoring; Aid to Law Enforcement Authorities ( ALEA ); Environmental Response; Non-combatant Evacuation Operations (NEO) & Disaster Relief; Sea...Approach Doctrine & impact on type of expeditionary Military Mission: Surveillance & Monitoring ALEA Environmental Incident Response SAR (inc CSAR...symbols/abbreviations/acronyms/initialisms ALEA Aid to Law Enforcement Authorities C4ISTAR Command, Control, Communications, Computers, Intelligence

  10. Tradução, Adaptação, Validação e Avaliação para Uso no Brasil de um Instrumento Britânico de Auxílio à Escolha da Especialidade Médica

    Directory of Open Access Journals (Sweden)

    Iago da Silva Caires

    Full Text Available RESUMO O objetivo deste estudo foi traduzir, validar e avaliar um instrumento britânico de auxílio à escolha da especialidade médica. Esse instrumento processa as respostas a 130 questões e fornece uma classificação de 59 especialidades médicas, em ordem decrescente de recomendação, em função do ajuste do perfil do candidato às características das especialidades. As dez primeiras recomendações são consideradas positivas, e as dez últimas, negativas. A tradução e a adaptação semântica seguiram os passos técnicos recomendados para esse tipo de trabalho, resultando no instrumento em português denominado SCIB (Special Choice Inventory - Brasil. A melhor versão das questões traduzidas foi escolhida. Em seguida, o instrumento foi aplicado a 120 médicos brasileiros (85 médicos especialistas e 35 médicos residentes, representando 38 diferentes especialidades. Foi também aplicado a 79 estudantes dos dois últimos anos do curso de graduação em Medicina. Os participantes da amostra de médicos responderam a um questionário no qual indicavam duas outras especialidades que cogitariam exercer além da atual, bem como outras três que dificilmente exerceriam. O instrumento foi considerado adequado ou muito adequado à realidade brasileira por 85,8% (103/120 dos médicos e por 73,4% (58/79 dos estudantes. Entre estes últimos, 60,8% (48/79 consideraram a escala útil ou muito útil. Os resultados da aplicação do SCIB permitiram verificar que a concordância global das recomendações positivas do instrumento foi de 67,5% (81/120 com a especialidade atualmente exercida e de 72,5% (87/120 com as especialidades que os participantes cogitaram exercer. A concordância entre as recomendações negativas da escala e as especialidades que os médicos dificilmente exerceriam foi de 87,5% (105/120. Os dados das etapas de tradução e adaptação do instrumento original trouxeram elementos para a validação de face, de conteúdo e sem

  11. Potentiel des moteurs à mélange pauvre face aux moteurs actuels à réglage stoechiométrique : consommation, émissions, exigence en octane The Challenge to Modern Stoichiometric Engines by the Potential Lean-Burn Engine: Consumption, Emissions, Fuel Requirements

    Directory of Open Access Journals (Sweden)

    Douaud A. M.

    2006-11-01

    Full Text Available Le moteur à allumage commandé pour application automobile aux États-Unis est généralement dépollué par catalyse trifonctionnelle qui impose un contrôle stoechiométrique du mélange air-carburant. Le contexte européen de 1990 pour la qualité de l'air stimule l'industrie automobile dans ses recherches de solutions techniques performantes. Le moteur à mélange pauvre, performant en consommation, est une solution potentielle si l'émission de NOx peut être maîtrisée par la combustion. Cet objectif nécessite une conception du moteur contrôlant la turbulence et l'hétérogénéité du mélange air + carburant + résiduels pendant la combustion. La longévité de l'adaptation optimale moteur-carburant nécessitera un contrôle électronique de l'allumage et l'utilisation d'additifs détergents. Pour satisfaire les réglementations les plus sévères, les émissions de CO et HC pourront être contrôlées par un simple pot catalytique d'oxydation. Des oxydes de métaux non précieux introduits dans la formule catalytique en addition aux métaux précieux maintiennent la fonction oxydante pendant les transitoires en mélange riche tout en réduisant partiellement les NOx. Une vue d'ensemble de ce concept basé sur des simulations numériques et des résultats expérimentaux de consommation, d'émission, d'exigence en octane, etc. est présentée. Spark-ignition engines for automotive applications in the United States are currently depolluted by a 3-way catalyst that requires air-fuel control at stoichiometry. The 1990 European context for air pollution control is stimulating the automotive industry to search for improved technical solutions. The lean-burn engine is a potential fuel-efficient answer if its combustion can be optimized for low NOx emissions. Achieving this challenging approach requires engine design to control the turbulence and heterogeneity of the air + fuel + residual mixture during combustion. Electronic ignition

  12. Auxílio à detecção de anormalidade perfusional miocárdica utilizando atlas de SPECT e registro de imagens: resultados preliminares Aid in the detection of myocardial perfusion abnormality utilizing SPECT atlas and images registration: preliminary results

    Directory of Open Access Journals (Sweden)

    Rodrigo Donizete Santana de Pádua

    2008-12-01

    Full Text Available OBJETIVO: Criar um atlas de cintilografia de perfusão miocárdica e verificar sua aplicabilidade no auxílio computadorizado à detecção de defeitos perfusionais miocárdicos em pacientes portadores de cardiopatia isquêmica. MATERIAIS E MÉTODOS: O atlas foi criado com imagens de cintilografia de perfusão miocárdica, em condições de repouso e estresse, de 20 pacientes de ambos os gêneros com baixa probabilidade de doença arterial coronariana e julgadas normais por dois observadores experientes. Técnicas de registro de imagens e operações matemáticas sobre imagens foram utilizadas para obtenção de modelos de média e desvio-padrão da captação miocárdica percentual de cada gênero e condição fisiológica. RESULTADOS: Imagens de um paciente masculino e um feminino foram alinhadas com os atlas correspondentes, e os voxels apresentando valores de captação percentual dois desvios-padrão abaixo da média da respectiva região do atlas foram destacados nos cortes tomográficos e confirmados como defeitos de perfusão por dois observadores experientes. CONCLUSÃO: Demonstramos a criação de um atlas de cintilografia de perfusão miocárdica e obtivemos resultados promissores na sua utilização para auxílio à detecção de defeitos perfusionais. Entretanto, uma validação prospectiva com um número mais representativo de casos é necessária.OBJECTIVE: To develop an atlas of myocardial perfusion scintigraphy and evaluating its applicability in computer-aided detection of myocardial perfusion defects in patients with ischemic heart disease. MATERIALS AND METHODS: The atlas was created with rest-stress myocardial perfusion scintigraphic images of 20 patients of both genders with low probability of coronary artery disease and considered as normal by two experienced observers. Techniques of image registration and mathematical operations on images were utilized for obtaining template images depicting mean myocardial uptake and

  13. EDUCACIÓN EN VALORES Y EDUCACIÓN EMOCIONAL: PROPUESTAS PARA LA ACCIÓN PEDAGÓGICA EDUCATION IN VALUES AND EMOTIONAL EDUCATION: PROPOSALS FOR THE PEDAGOGICAL ACTION Éducation aux valeurs et éducation émotionnelle: propositions pour une action pédagogique

    Directory of Open Access Journals (Sweden)

    María Rosa Buxarrais Estrada

    2010-12-01

    so that this educational innovation could be considered and developed in the educational institutions.Établir une relation entre l’éducation aux valeurs et l’éducation émotionnelle suppose emphatiser l’idée que Éducation signifie donner un réponse de la part de l’institution scolaire à toutes les dimensions de la personne : cognitives, conductuelles et affectives – penser, faire et sentir- des réponses qui semblent ne pas avoir été données par les systèmes éducatifs antérieurs. Dans cet article nous envisageons la nécessité de récupérer une éducation aux valeurs qui n’oublie pas l’éducation émotionnelle si non qu’elle soit explicitée au travers des programmes d’action pédagogique dans lesquels les objectifs se concrètent dans la construction de la personnalité éthique, l’éducation des sentiments et la compétence communicationnelle, l’acquisition des compétences éthiques, l’acceptation des limites et normes de cohabitation ainsi que la gestion des émotions et sa conséquence conductuelle: l’autorégulation du comportement. La sensibilisation et la formation des professeurs seront indispensables pour pouvoir envisager et développer dans les institutions éducatives cette innovation éducative.

  14. Thermodynamic Aspects of Supercritical Fluids Processing: Applications of Polymers and Wastes Treatment Aspects thermodynamiques des procédés mettant en oeuvre des fluides supercritiques : applications aux traitements des polymères et des déchets

    Directory of Open Access Journals (Sweden)

    Beslin P.

    2006-11-01

    Full Text Available Supercritical fluid processes are of increasing interest for many fields : in supercritical fluid separation (petroleum-chemistry separation and purification, food industry and supercritical fluid chromatography (analytical and preparative separation, determination of physicochemical properties; as reaction media with continuously adjustable properties from gas to liquid (low-density polyethylene, waste destruction, polymer recycling; in geology and mineralogy (volcanoes, geothermal energy, hydrothermal synthesis; in particle, fibber and substrate formations (pharmaceuticals, explosives, coatings; in drying materials (gels. This paper presents the unusual physicochemical properties of supercritical fluids in relation to their engineering applications. After a short report of fundamental concepts of critical behavior in pure fluids, we develop in more details the tunable physicochemical properties of fluid in the supercritical domain. The second part of this paper describes the engineering applications of supercritical fluids relevant of chemical reactions and polymer processing. Each application presentation is divided in two parts : the first one recalls the basic concepts including general background, physicochemical properties and the second one develops the engineering applications relevant of the advocated domain. La mise en Suvre des fluides supercritiques est d'un intérêt croissant dans de nombreux domaines : pour la séparation (séparation et purification en pétrochimie, industrie alimentaire et la chromatographie par fluides supercritiques (séparation analytique et préparatoire, détermination des propriétés physicochimiques, comme milieux réactifs aux propriétés continûment ajustables allant du gaz au liquide (polyéthylène de faible densité, élimination des déchets, recyclage des polymères, en géologie et en minéralogie (volcanologie, énergie géothermique, synthèse hydrothermique, dans la formation des particules

  15. Les recommandations relatives aux vaccins antigrippaux administrés aux enfants et aux adolescents pour la saison 2017-2018.

    Science.gov (United States)

    Moore, Dorothy L

    2018-02-01

    La Société canadienne de pédiatrie continue d'encourager la vaccination antigrippale annuelle de TOUS les enfants et les adolescents, dès l'âge de six mois. Les recommandations du Comité consultatif national de l'immunisation (CCNI) pour la saison 2017-2018 n'ont pas subi de changements importants par rapport à la saison précédente. Le CCNI a analysé toutes les données sur l'efficacité du vaccin vivant atténué contre l'influenza (VVAI) sur le marché et conclut qu'elles en appuient l'utilisation au Canada, même si les États-Unis ne le recommandent pas en raison de doutes quant à son efficacité.

  16. Diagnóstico de tumores do ângulo ponto-cerebelar com o auxílio de técnicas de inteligência artificial A diagnostic model for cerebellum-pontine angle tumors using artificial intelligence techniques

    Directory of Open Access Journals (Sweden)

    FLÁVIO LEITÃO

    2000-03-01

    Full Text Available Trata-se de estudo multidisciplinar, cujo objetivo é a obtenção de modelo discriminatório entre diagnóstico de tumores do ângulo ponto-cerebelar (APC e de distúrbios otorrinolaringológicos. Presentemente, a realização de um acurado exame neurológico e/ou otorrinolaringológico é incapaz de firmar diagnóstico de tumor do APC, sem valer-se de exames radiológicos de alto custo (tomografia computadorizada, ressonância magnética. O modelo proposto foi obtido através da utilização de técnicas de inteligência artificial e apresentou bom nível de acurácia (88,4% no teste de novos casos, considerando-se apenas o exame clínico e sem o auxílio de exames radiológicos.We are concerned in this paper with learning classification procedures from known cases. More precisely, we provide a diagnostic model that discriminate between cerebellum-pontine angle (CPA tumors and otorhinolaryngological (ENT disorders. Usually, in order to distinguish between CPA tumors and ENT disorders one must perform clinical-neurological examination together with expensive radiological imagery (CT and MRI. The proposed model was obtained through artificial intelligence methods and presented a good accuracy level (88.4% when tested against new cases, considering only clinical examination without radiological imagery results.

  17. Communication Received from Certain Member States Regarding Guidelines for Transfers of Nuclear-related Dual-use Equipment, Material, Software and Related Technology; Communication recue de certains Etats Membres concernant les directives applicables aux transferts d'equipements, de matieres et de logiciels a double usage dans le domaine nucleaire, ainsi que de technologies connexes

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2010-09-09

    The Agency has received a Note Verbale from the Permanent Mission of Hungary, dated 14 June 2010, in which it requests that the Agency circulate to all Member States a letter of 7 May 2010 from the Chairman of the Nuclear Suppliers Group, Ambassador Ms. Gyorgyi Martin Zanathy, to the Director General, on behalf of the Governments of Argentina, Australia, Austria, Belarus, Belgium, Brazil, Bulgaria, Canada, China, Croatia, Cyprus, Czech Republic, Denmark, Estonia, Finland, France, Germany, Greece, Hungary, Iceland, Ireland, Italy, Japan, Kazakhstan, Republic of Korea, Latvia, Lithuania, Luxemburg, Malta, Netherlands, New Zealand, Norway, Poland, Portugal, Romania, Russian Federation, Slovakia, Slovenia, South Africa, Spain, Sweden, Switzerland, Turkey, Ukraine, the United Kingdom of Great Britain and Northern Ireland and the United States of America,1 providing further information on those Governments' Guidelines for Nuclear Transfers [French] L'Agence a recu une note verbale de la mission permanente de la Hongrie, en date du 14 juin 010, lui demandant de communiquer a tous les Etats Membres une lettre du 7 mai 2010 du president du Groupe des fournisseurs nucleaires, l'ambassadeur Gyorgyi Martin Zanathy, adressee au Directeur general au nom des gouvernements des Etats suivants : Afrique du Sud, Allemagne, Argentine, Australie, Autriche, Belarus, Belgique, Bresil, Bulgarie, Canada, Chine, Croatie, Chypre, Danemark, Espagne, Estonie, Etats-Unis d'Amerique, Federation de Russie, Finlande, France, Grece, Hongrie, Irlande, Islande, Italie, Japon, Kazakhstan, Lettonie, Lituanie, Luxembourg, Malte, Norvege, Nouvelle-Zelande, Pays-Bas, Pologne, Portugal, Republique de Coree, Republique tcheque, Roumanie, Royaume-Uni de Grande-Bretagne et d'Irlande du Nord, Slovaquie, Slovenie, Suede, Suisse, Turquie et Ukraine1. Cette lettre apporte des informations supplementaires sur les Directives de ces gouvernements applicables aux transferts nucleaires.

  18. Métodos de auxílio multicritério à decisão aplicados a problemas de PCP: mapeamento da produção em periódicos publicados no Brasil Multicriteria decision aid methods applied to PPC problems: a mapping of papers published in Brazilian journals

    Directory of Open Access Journals (Sweden)

    Dey Salvador Sanchez Rodriguez

    2013-03-01

    Full Text Available O presente trabalho tem por objetivo estabelecer um mapeamento da produção científica divulgada em importantes periódicos publicados no Brasil sobre a aplicação de Métodos de Auxílio Multicritério à Decisão (AMD à modelagem de problemas de Planejamento e Controle da Produção. O mapeamento contemplou 32 artigos, que foram selecionados criteriosamente, tendo como base a lista de periódicos científicos oferecida no Scielo e em importantes sociedades científicas brasileiras no âmbito da Engenharia de Produção. Os resultados permitiram indicar, entre outros aspectos, os periódicos que mais publicam neste contexto, os métodos de AMD mais usados nesta interface, os setores de produção nos quais as aplicações ocorreram e os tópicos de PCP mais abordados. Também foram destacados os aspectos de PCP que ainda carecem de estudos que envolvam métodos multicritério.The objective of this study is to map the Brazilian scientific production based on Brazilian journal publications on the implementation of Multicriteria Decision Aid (MCDA to model Production Planning and Control problems. It consisted of 32 papers that were systematically selected from journals indexed in the Scielo database and also from a list of journals suggested by major Brazilian Industrial Engineering research societies. The results revealed, among other aspects, the journals that publish the most on this topic, the most often used MCDA methods in this interface, the production sectors in which the applications took place, and the most commonly discussed PPC topics. This paper also highlights the PPC aspects that need further research including MCDA methods.

  19. Empirical Calibration for Dolomite Stoichiometry Calculation: Application on Triassic Muschelkalk- Lettenkohle Carbonates (French Jura Calibration empirique pour le calcul de la stoechiométrie de la dolomite : application aux carbonates triasiques du Muschelkalk-Lettenkohle (Jura français

    Directory of Open Access Journals (Sweden)

    Turpin M.

    2012-02-01

    Full Text Available This study concerns an approach for dolomite quantification and stoichiometry calculation by using X-ray diffractometry coupled with cell and Rietveld refinements and equipped with a newly substantial database of dolomite composition. A greater accuracy and precision are obtained for quantifying dolomite as well as other mineral phases and calculating dolomite stoichiometry compared to the classical “Lumsden line” and previous methods. The applicability of this approach is verified on dolomite reference material (Eugui and on Triassic (Upper Muschelkalk-Lettenkohle carbonates from the French Jura. The approach shown here is applicable to bulk dolostones as well as to specific dolomite cements and was combined with petrographical and isotopic analyses. Upper Muschelkalk dolomites were formed during burial dolomitization under fluids characterized by increased temperature and variable isotopic composition through burial. This is clear from their Ca content in dolomites which gradually approaches an ideal stoichiometry (from 53.16% to 51.19% through increasing dolomitization. Lettenkohle dolostones consist of near-ideal stoichiometric (51.06%Ca and well-ordered dolomites associated with anhydrite relicts. They originated through both sabkha and burial dolomitization. This contribution gives an improved method for the characterization of different dolomite types and their distinct traits in sedimentary rocks, which allows a better evaluation of their reservoir potential. Cette étude propose une approche pour la quantification de la dolomite et le calcul de sa stoechiométrie grâce à l’utilisation de la diffraction des rayons X couplée aux affinements de maille et de Rietveld et complétée par de nombreuses données issues de la littérature. Elle permet d’obtenir une meilleure justesse et précision pour la quantification de la dolomite (et des autres phases minérales ainsi que pour le calcul de sa stoechiométrie par rapport à l

  20. La professionnalisation de la formation universitaire d’enseignants de français : quelles compétences visées ?

    Directory of Open Access Journals (Sweden)

    PHAM Duy Thien

    2016-12-01

    Full Text Available Bien former à un métier est devenu une préoccupation de la société vietnamienne. Car la qualité de la formation professionnelle laisse toujours à désirer. L’université dispensant traditionnellement des formations dites académiques les repense dans une perspective de professionnalisation. La logique académique et la logique professionnelle peuvent-elles être compatibles l’une avec l’autre ? Si la formation universitaire se professionnalise, qu’est-ce qu’elle apportera aux étudiants pour que ceux-ci, une fois diplômés, soient reconnus comme étant compétents et aptes à travailler ? Notre article propose de répondre à ces questions. Les réflexions qui y sont présentées proviennent de notre travail de thèse, portant sur la professionnalisation des guides touristiques vietnamiens.

  1.  Avant-propos

    Directory of Open Access Journals (Sweden)

    Georges Martin

    2012-06-01

    Full Text Available Le numéro 13 de la revue e-Spania, désormais ouverte aux études modernes, réunit deux dossiers issus de rencontres scientifiques. Le dossier médiéval (« Convivencia de lenguas y conflictos de poder en la península ibérica durante la Edad Media » trouve son origine dans un colloque organisé à Madrid en novembre 2011 par GRHIDE, partenaire d’AILP à l’Universidad Autónoma de Madrid. Il s’agit d’une contribution à la thématique du GDRE (« approche interdisciplinaire des logiques de pouvoir dans ...

  2. Le marché des jeux vidéo

    OpenAIRE

    Trémel, Laurent

    2012-01-01

    Basé sur les travaux menés par l’auteur sur la pratique des jeux vidéo depuis une dizaine d’années, l’article se situe dans une perspective de sociologie critique et expose les logiques développées dans les jeux vidéo les plus pratiqués, et comment celles‑ci répondent aux attentes d’un « public cible ». En déconstruisant certains artefacts statistiques conçus pour modifier l’image sociale de ces produits, le propos révèle quelles sont les intentions des industriels du loisir et comment ils pe...

  3. Les i-jumelages au service de la solidarité internationale et du développement local

    Directory of Open Access Journals (Sweden)

    Florence Durand-Tornare

    2016-02-01

    Full Text Available L’association « Villes internet » propose depuis plusieurs années aux collectivités françaises de mettre en action des i-jumelages. L’idée est simple : utiliser Internet comme vecteur pour la construction de ces nouvelles solidarités internationales entre acteurs locaux, collectivités locales et acteurs du tiers secteur non marchand. Il s’agit de mettre très concrètement en place via Internet de nouveaux modes de co-développement, basés sur des logiques de réciprocité, d’échanges de savoir et...

  4. Demaria C., 2004, Développement durable et finance, Paris : Maxima Laurent du Mesnil Editeur, 255 p.

    Directory of Open Access Journals (Sweden)

    Marianne Rubinstein

    2005-05-01

    Full Text Available L’objectif de l’ouvrage de Cyril Demaria est de mettre à jour le lien existant entre développement durable et logique financière, de traiter du paradoxe apparent selon lequel la transition des sociétés vers le développement durable doit plus aux forces de marché qu’à toute autre dynamique : « le fait que les principaux leviers au service du développement durable soient les fonds d’investissement et les marchés financiers rompt donc avec une vision ‘révolutionnaire’ associée au développement d...

  5. Enquêtes, observations et analyse de l'activité auprès de conducteurs âgés : comprendre les obstacles pour mieux agir (parcours critique, positions théoriques et perspectives de recherche)

    OpenAIRE

    GABAUDE, Catherine

    2016-01-01

    Afin de préserver l'autonomie et la qualité de vie de nos aînés, il est indispensable de concilier des exigences de sécurité et de mobilité. L'action publique en sécurité routière peut être renouvelée en étant sensibilisée à la question de la sécurité gérée, c'est à dire en procédant à une logique de recherche des rationalités sous-jacentes aux comportements observés. Ceci nécessite d'étudier la sécurité en action à partir de l'analyse de l'activité de conduite de nos ainés. La plupart des co...

  6. La compréhension écrite mal traitée ou maltraitée ?

    OpenAIRE

    Fade, Pascale

    2013-01-01

    Le choix d’enseigner la compréhension écrite aux étudiants de 2e année de Deug, spécialistes d’autres disciplines, n’est plus à justifier. Dans la mesure où une grande majorité d’étudiants a étudié la langue de cinq à sept ans dans le secondaire, l’enseignement devrait logiquement prendre appui sur des connaissances existantes et viser la consolidation et l’approfondissement de compétences acquises précédemment. Dans les faits, les performances en compréhension écrite de bon nombre d’étudiant...

  7. Preparation of Impervious Pyrolytic Carbon Coatings and Application to Dispersed Fuels; Preparation de revetements de carbone pyrolytique etanches - applications aux combustibles disperses; Prigotovlenie nepronitsaemogo uglerodnogo piroliticheskogo pokrytiya dlya dispergirovannogo topliva; Preparacion de revestimientos estancos de carbono piroutico: aplicacion a los combustibles nucleares dispersos

    Energy Technology Data Exchange (ETDEWEB)

    Auriol, A.; David, C. [Battelle Memorial Institute, Geneve (Switzerland); Fillatre, A.; Kurka, G.; Le Boulbin, E.; Rappeneau, J. [Commissariat a l' Energie Atomique (France)

    1963-11-15

    A method of depositing pyrolytic carbon, which adheres well to a graphite support and is gas-tight, was developed and the physical properties of the deposit were evaluated. The fluidized bed technique was used in applying this method of coating to fissile granules of uranium oxide and uranium carbide. After explaining the conditions for coating the granules, the authors examined their macrostructure, microstructure and permeability. Their behaviour at high temperature was investigated with a view to using them in a reactor. (author) [French] Une methode de deposition de carbone pyrolydque adherant bien au graphite support et etanche aux gaz a ete mise au point. Les proprietes physiques du depot ont ete evaluees. Cette methode de revetement a ete transposee a des granules fissiles d'oxyde et de carbure d'uranium en utilisant la technique du lit fluidise. Apres avoir precise les conditions de revetement de ces granules, on etudie leur macrostructure, leur microstructure, ainsi que leur permeabilite. Le comportement de ces granules a haute temperature a ete examine en vue de leur utilisation eventuelle dans un reacteur. (author) [Spanish] Los autores han elaborado un metodo para depositar carbono pirolitico que se adhiere fuertemente al soporte de grafito y es estanco a los gases. Han determinado las propiedades de dicho deposito. Este metodo de revestimiento fue aplicado a granulos fisionables de oxido y de carburo de uranio, utilizando la tecnica del lecho fluidificado. Despues de determinar las condiciones en que se efectua el revestimiento de esos granulos, los autores estudiaron su macroestructura y su microestructura, asi como su permeabilidad. Examinaron tambien su comportamiento a temperatura elevada, con miras a utilizarlos oportunamente en los reactores. (author) [Russian] Razrabotan metod osazhdeniya piroliticheskogo ugleroda, khorosho pokryvayushchego grafitovuyu osnovu s polucheniem nepronitsaemogo dlya gazov pokrytiya. Otseneny fizicheskie svojstva

  8. Analytical Solutions and Optimization of the Exo-Irreversible Schmidt Cycle with Imperfect Regeneration for the 3 Classical Types of Stirling Engine Solutions analytiques et optimisation du cycle de Schmidt irréversible à régénération imparfaite appliquées aux 3 types classiques de moteur Stirling

    Directory of Open Access Journals (Sweden)

    Rochelle P.

    2011-11-01

    Full Text Available The “old” Stirling engine is one of the most promising multi-heat source engines for the future. Simple and realistic basic models are useful to aid in optimizing a preliminary engine configuration. In addition to new proper analytical solutions for regeneration that dramatically reduce computing time, this study of the Schmidt-Stirling engine cycle is carried out from an engineer-friendly viewpoint introducing exo-irreversible heat transfers. The reference parameters are the technological or physical constraints: the maximum pressure, the maximum volume, the extreme wall temperatures and the overall thermal conductance, while the adjustable optimization variables are the volumetric compression ratio, the dead volume ratios, the volume phase-lag, the gas characteristics, the hot-to-cold conductance ratio and the regenerator efficiency. The new normalized analytical expressions for the operating characteristics of the engine: power, work, efficiency, mean pressure, maximum speed of revolution are derived, and some dimensionless and dimensional reference numbers are presented as well as power optimization examples with respect to non-dimensional speed, volume ratio and volume phase-lag angle.analytical solutions. Le “vieux” moteur Stirling est l’un des moteurs a sources multiples d’energie les plus prometteurs pour le futur. Des modeles elementaires simples et realistes sont utiles pour faciliter l’optimisation de configurations preliminaires du moteur. En plus de nouvelles solutions analytiques qui reduisent fortement le temps de calcul, cette etude du cycle moteur de Schmidt-Stirling modifie est entreprise avec le point de vue de l’ingenieur en introduisant les exo-irreversibilites dues aux transferts thermiques. Les parametres de reference sont des contraintes technologiques ou physiques : la pression maximum, le volume maximum, les temperatures de paroi extremes et la conductance totale, alors que les parametres d

  9. Study of the effect of neutron and electron irradiations on the low temperature thermal conductivity of germanium and silicon; Etude de l'effet des irradiations neutronique et electronique sur la conductibilite thermique aux basses temperatures du germanium et du silicium

    Energy Technology Data Exchange (ETDEWEB)

    Vandevyver, M [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

    1967-06-15

    The main results obtained from this work are the following: 1 Neutron irradiation (at 300 deg. K) produces lattice defects in germanium and silicon, and a corresponding very large lowering of the thermal conductivity is observed in the low temperature region (4-300 ). The results obtained have been explained with the help of the following hypotheses: for silicon a scattering of phonons by the stress fields produced by the defects; for germanium, a supplementary scattering of the electron phonon type. 2 Annealing treatments carried out on these materials above 373 deg. K restored the thermal conductivity over the whole temperature range of the measurements (4-300 deg. K); in the case of both germanium and silicon there were two steps in the annealing process. 3 A study of the thermal conductivity of germanium (initially P or N) after an electronic irradiation showed that the scattering of phonons could depend on the state of charge of the defects thus produced. (author) [French] Les principaux resultats obtenus au cours de ce travail sont les suivants : 1 Les irradiations neutroniques (a 300 deg. K) introduisent des defauts de reseau dans le germanium et le silicium et l'on observe correlativement pour ces materiaux, une tres importante diminution de conductibilite thermique dans le domaine des basses temperatures (4-300 deg. K). Les resultats obtenus ont pu etre interpretes en admettant principalement: pour le silicium, une diffusion des phonons par les champs de contrainte dus aux defauts; pour le germanium, une diffusion additionnelle du type electron-phonon. 2 Des recuits effectues sur ces materiaux au-dessus de 373 deg. K ont montre une restauration de la conductibilite thermique dans tout l'intervalle de temperature de mesure (4-300 deg. K) et comportant pour le germanium et le silicium, deux etapes de recuit 3 L'etude de la conductibilite thermique de germanium (initialement N ou P) apres une irradiation electronique, a montre que la diffusion des phonons

  10. Criteria for Special Nuclear Materials Inventory and Control Procedures; Criteres a Suivre Pour Proceder a l'Inventaire des Matieres Nucleaires Speciales et aux Mesures de Controle; Kriterii dlya inventarizatsii spetsial'nykh yadernykh materialov i metody ucheta; Criterios a Que Deben Ajustarse los Procedimientos de Inventario y Control de los Materiales Nucleares Especiales

    Energy Technology Data Exchange (ETDEWEB)

    Kinderman, E. M.; Tarrice, R. R. [Stanford Research Institute, Menlo Park, CA (United States)

    1966-02-15

    and the total inventory of these special nuclear materials. A matrix of solutions to the management and inventory control of special nuclear materials will be presented. The multiplicity and relative effectiveness of varied techniques at key stages of the materials supply, utilization and recovery are assessed. (author) [French] L'un des plus importants problemes qui, dans le domaine nucleaire et notamment dans l'exploitation commerciale de l'energie d'origine nucleaire, se posera aux societes d'investissement, aux directeursetaux exploitants est celui du controle efficace de l'inventaire des matieres nucleaires dont la valeur depassera, d'ici 1980, 5 milliards de dollars des Etats-Unis. Comparativement a la plupart des matieres utilisees commercialement, les matieres nucleaires speciales sont couteuses; aux Etats-Unis par exemple, l'uranium enrichi a 90%, l'uranium enrichi a 3% sous forme d'hexa- fluorure et l'eau lourde coutent respectivement 10808 dollars, 254 dollars et 61,60 dollars le kilo. En outre, ces matieres sont frequemment soumises, pour des raisons de protection sanitaire et de securite, a des controles gouvernementaux speciaux sans rapport direct avec leur valeur monetaire. En depit de leur prix eleve, ces matieres sont destinees a etre utilisees en grandes quantites; par exemple, on utilisera de 50 a 75 t de combustible enrichi a 3{sup o}{r_brace}o dans un reacteur de 500 MW modere a l'eau ordinaire et 200 a 300 reacteurs de cette puissance fonctionneront vraisemblablement dans le monde en 1980. L'experience acquise a permis la mise au point et l'application de methodes speciales pour le controle commercial de grandes quantites de matieres de faible valeur comme le charbon ou le minerai de fer ou de petites quantites de matieres de grande valeur comme les metaux precieux. Tout en ayant des prix comparables a ces derniers, les matieres nucleaires speciales sont de nature differente et seront utilisees en quantites beaucoup plus importantes que les

  11. Pour une nouvelle approche de l'hispanité grâce aux TICE - La formation d'enseignants d'espagnol langue étrangère Towards a new approach of Hispanic culture thanks to ICT - Beginners training for Spanish language teachers

    Directory of Open Access Journals (Sweden)

    Veronique Pugibet

    2006-04-01

    Full Text Available Si désormais les divers pays et cultures du monde hispanique figurent dans les programmes officiels de l'apprentissage de l'espagnol langue étrangère en France, l'approche qui en est proposée demeure encore souvent traditionnelle, une certaine vision de l'histoire et les "beaux" textes dominant largement. Comment amener les jeunes enseignants en formation initiale à porter un regard différent sur l'autre, à atteindre une véritable compétence culturelle dépassant la culture académique ? Nous rendrons compte dans notre étude de la spécificité de la formation initiale des professeurs d'espagnol qui, dorénavant, sont de plus en plus nombreux à être d'origine hispanophone. Nous exposerons leur parcours de formation sur et grâce aux TICE afin de dépasser les clichés réducteurs initiaux comme en témoignent leur approche première sur Internet, et en vue d'atteindre un regard plus ouvert sur l'hispanité et des pratiques pédagogiques différentes.Despite the ongoing presence of several Hispanic countries and cultures in state programs concerning Spanish as a foreign language in French education, the suggested methodology remains very often traditional with a predominantly biased vision of history as well as texts that are considered "beautiful". How can we help young teachers in their initial training to have a different perception of the other, to reach a true cultural competence that surpasses academic culture? We will show in our study the details involved in a Spanish teacher's initial training since, as it appears, they tend to be more and more of Hispanic origin. We will describe their training history through and thanks to the TICE in order to overcome the reductive and stereotyping clichés as they move initially towards the use of Internet, and in order to reach out for a more open perception of the Hispanic World and of different pedagogical practices.

  12. Il mercato del lavoro nel mutamento del sistema penitenziario: dalle rivoluzioni industriali ai networks sociali / Labour market and changement of the penitentiary system: from the Industrial Revolutions to the social networks / Marché du travail et changement du système pénitentiaire à partir des révolutions industrielles jusqu'aux réseaux sociaux

    Directory of Open Access Journals (Sweden)

    Fanci Giovanna

    2008-10-01

    Full Text Available There is a close connection between the prison institution and the labour market which leads back to the origins of prison, in a modern sense. The social, economic and political background of this relationship is marked by the “industrial revolutions”, because during these times the ideas of «division of labour» and «discipline» were defined and consequently influenced the new prison organization models. The Penitentiary Act recognizes the prisoner's right to work. Therefore to fill the gap between the prison and the territory, a political integrated model – both social and penitentiary – is required. In the text, this will be illustrated by experiences of prisoners and ex-prisoners at the Information Office Windows. The network method has given input to a procedure considered as an efficient way of managing the social complexity and a fair services distribution device; but, at the same time, it introduces “alternative” forms of social control.La naissance des prisons et le marché du travail sont liés par une relation qui revient aux origines de la prison en sens moderne. La scène qui fait d’arrière-plan à cette relation est contremarquée par les révolutions industrielles pendant lesquelles les notions de «division du travail» et de «discipline» ont été définies et ont étés décisives afin d'élaborer un modèle nouveau d'organisation des prisons. Aujourd’hui la législation pénitentiaire reconnaît au prisonnier le droit au travail: de cette façon, la liason entre la prison et le territoire requiert un plan intégré composé par de politiques pénitentiaires et sociales, ici expliqué par l’expérience positive des Guichets d'information pour détenus et ancien détenus. Le système de réseau a fait démarrer une “proceduralisation” qui apparaît un outil efficace de gestion de la complexité sociale et d’une equitable destination des services, mais qui risque de produire aussi des systèmes

  13. Organisation of biological research carried out in the United States by the A.E.C. or under her contract (1960); Organisation des recherches biologiques menees aux Etats-Unis par l'A.E.C. ou sous son egide. Compte-rendu sommaire d'une mission d'etude (1960)

    Energy Technology Data Exchange (ETDEWEB)

    Pellerin, J [Commissariat a l' Energie Atomique, Saclay (France).Centre d' Etudes Nucleaires

    1960-07-01

    This report is based on information gathered in the course of a trip to the United States, in November and December 1958 which consisted chiefly of visits to the main biological and medical research laboratories and discussions with the heads of these establishments. A description is given of the general organisation of the Atomic Energy Commission's Division of Biology and Medicine, and of the distribution of responsibility for radiation protection work and for biological, medical and agricultural research amongst the various Services attached to it; this is followed by a more detailed account of the activities carried on in this field at the great national laboratories. Finally, the systems of collaboration set up with external research organisations in the form of research contracts are examined, together with the substantial help provided by the A.E.C. for biological, medical and agricultural research in general, owing to a systematic policy of subsidising the distribution of radioisotopes for this purpose. (author) [French] Le present rapport a ete etabli sur la base des renseignements recueillis au cours d'un voyage d'etude aux Etats-Unis, en novembre et decembre 1958, comportant notamment la visite des principaux laboratoires de recherche biologique et medicale et des entretiens avec les principaux responsables de ces laboratoires. Apres une description de l'organisation generale de la 'Division of Biology and Medicine' de l'Atomic Energy Commission et de la repartition entre les divers Services qui lui sont rattaches des responsabilites concernant la protection contre les radiations et la Recherche biologique, medicale et agronomique, des indications plus detaillees sont donnees au sujet des activites poursuivies dans ce domaine au sein des grands laboratoires nationaux. Sont examinees enfin, l'importance et les modalites de la collaboration instituee avec les Organismes de Recherche exterieurs sous la forme de contrats de recherche ainsi que l

  14. Organisation of biological research carried out in the United States by the A.E.C. or under her contract (1960); Organisation des recherches biologiques menees aux Etats-Unis par l'A.E.C. ou sous son egide. Compte-rendu sommaire d'une mission d'etude (1960)

    Energy Technology Data Exchange (ETDEWEB)

    Pellerin, J. [Commissariat a l' Energie Atomique, Saclay (France).Centre d' Etudes Nucleaires

    1960-07-01

    This report is based on information gathered in the course of a trip to the United States, in November and December 1958 which consisted chiefly of visits to the main biological and medical research laboratories and discussions with the heads of these establishments. A description is given of the general organisation of the Atomic Energy Commission's Division of Biology and Medicine, and of the distribution of responsibility for radiation protection work and for biological, medical and agricultural research amongst the various Services attached to it; this is followed by a more detailed account of the activities carried on in this field at the great national laboratories. Finally, the systems of collaboration set up with external research organisations in the form of research contracts are examined, together with the substantial help provided by the A.E.C. for biological, medical and agricultural research in general, owing to a systematic policy of subsidising the distribution of radioisotopes for this purpose. (author) [French] Le present rapport a ete etabli sur la base des renseignements recueillis au cours d'un voyage d'etude aux Etats-Unis, en novembre et decembre 1958, comportant notamment la visite des principaux laboratoires de recherche biologique et medicale et des entretiens avec les principaux responsables de ces laboratoires. Apres une description de l'organisation generale de la 'Division of Biology and Medicine' de l'Atomic Energy Commission et de la repartition entre les divers Services qui lui sont rattaches des responsabilites concernant la protection contre les radiations et la Recherche biologique, medicale et agronomique, des indications plus detaillees sont donnees au sujet des activites poursuivies dans ce domaine au sein des grands laboratoires nationaux. Sont examinees enfin, l'importance et les modalites de la collaboration instituee avec les Organismes de Recherche exterieurs sous la forme de

  15. Small-Angle Scattering of Neutrons by Iron and Nickel Close to the Curie Point; Diffusion aux petits angles des neutrons par le fer et le nickel au voisinage du point de curie; Rasseyanie nejtronov pod malymi uglami zhelezom i nikelem, blizkikh k tochke kyuri; Dispersion de neutrones en angulos pequenos por el hierro y el niquel cerca del punto de curie

    Energy Technology Data Exchange (ETDEWEB)

    Jacrot, B.; Konstantinovic, J.; Parette, G.; Cribier, D. [Centre d' etudes Nucleaires de Saclay (France)

    1963-01-15

    Recent studies on critical scattering by iron have thrown fresh light on the results obtained previously and shown that: (1) At the Curie point, scattering is inelastic. The Lorentzian form of the lines and their angular dependence establish the existence of a scattering process having the diffusion coefficient 2m {Omega}/n = 7. (2) At the Curie point, the coefficient K{sub 1}{sup 2} is less than 5 x 10{sup -5} A{sup -2}. Iron and nickel have very different angular distribution. Small-angle scattering below T{sub c} has also been studied. (author) [French] De nouveaux travaux sur la diffusion critique par le fer ont permis de completer les resultats obtenus anterieurement. Ils etablissent les faits suivants: 1. Au point de Curie la diffusion est inelastique. La forme lorentzienne des raies et leur dependance angulaire etablissent l'existence d*un processus de diffusion avec un coefficient de diffusion 2m{Omega}/n = 7. 2. Au point de Curie le coefficient K{sub 1}{sup 2} est inferieur a 5 x 10{sup -5} A{sup -2}. La distribution angulaire est tres differente dans le cas du fer et du nickel. On a egalement etudie la diffusion aux petits angles en dessous de T{sub c}. (author) [Spanish] Nuevos trabajos sobre la dispersion critica por el hierro han permitido completar los resultados obtenidos anteriormente. Dichos trabajos prueban los hechos siguientes: 1) La dispersion es inelastica en el punto de Curie. La forma lorentziana de las rayas y su dependencia angular demuestran la existencia de un proceso de dispersion con un coeficiente de dispersion igual a 2m {Omega}/n = 7. 2) En el punto de Curie, el coeficiente K{sub 1}{sup 2} es inferior a 5 x 10{sup -5} A{sup -2}. La distribucion angular es muy diferente en el caso del hierro y del ni quel. Se ha estudiado tambien la dispersion en pequenos angulos por debajo de T{sub c}. (author)

  16. Transport properties of silver telluride in the solid and liquid states; Etude des proprietes de transport dans le tellurure d'argent Ag{sub 2}Te aux hautes temperatures a l'etat solide et a l'etat liquide

    Energy Technology Data Exchange (ETDEWEB)

    Pham, N T [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

    1969-01-01

    comporte comme un semiconducteur. Il est suggere que des ions Ag{sup +} contribuent aux phenomenes de transport pour rendre compte du comportement des proprietes electriques. Les resultats experimentaux ont ete analyses sur la base des theories conventionnelles. (auteur)

  17. Interaction fluide-structure souple et legere, application aux voiliers

    OpenAIRE

    Durand , Mathieu

    2012-01-01

    This thesis, devoted to simulations of sailboat sail, was initiated by K-Epsilon, acompany specialized in numerical computations for naval hydrodynamics, IRENav, the Frenchnaval academy laboratory and LHEEA from Ecole Centrale Nantes. In this context a finiteelement program was developed dedicated to computing sail membranes and sailboat structures.The program was coupled with an inviscid fluid solver. A more detailed modeling of the flow andinteraction was realized by implementing a coupling...

  18. Aquaculture intérieure et adaptation aux changements climatiques ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Risk Management Practices. Briefs. Aquaculture and Climate. Journal articles. River-based cage aquaculture of tilapia in Northern Thailand : sustainability of rearing and business practices. Journal articles. Learning about climate-related risks: decisions of Northern Thailand fish farmers in a role-playing simulation game ...

  19. Aquaculture intérieure et adaptation aux changements climatiques ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    À l'heure actuelle, près de la moitié des animaux aquatiques que consomment les humains sont issus de l'aquaculture, une proportion qui est appelée à augmenter. Une grande partie de la production aquacole mondiale se trouve en Asie tropicale et subtropicale et constitue une importante source d'emploi et de sécurité ...

  20. François-Ronan Dubois, Introduction aux Porn Studies

    OpenAIRE

    Garnier, Guillaume

    2014-01-01

    Partant des débats qui entourent la pornographie et sa consommation (la pornographie est-elle sexiste ? Ou bien féministe ? Qu’en est-il de la moralité et de la législation ?…), François-Ronan Dubois, agrégé de lettres modernes et doctorant en littérature française, s’interroge sur les porn studies discipline novatrice originaire des États-Unis, qui s’est récemment imposée comme essentielle pour apporter un discours compétent sur la pornographie. Les porn studies s’emparant des formes et des ...

  1. Le VIH chez le malade neurologique aux CHU de Lome ...

    African Journals Online (AJOL)

    Etude prospective à propos de 397 malades hospitalisés du 1er Janvier au 31 Décembre 2015. Objectifs: Evaluer l'évolution de la séroprévalence hospitalière et les manifestations cliniques neurologiques de l'infection à VIH. Méthodologie: Notre étude s'est déroulée du 1er Janvier au 31 Décembre 2015 dans les services ...

  2. US nuclear survey; Le panorama nucleaire aux Etats-Unis

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2002-08-01

    This document gives a broad overview of the organization of nuclear activities in the USA: nuclear park and availability (reactors, R and D), fuel cycle (uranium enrichment, wastes management (storage and disposal sites)). (J.S.)

  3. Commission des Nations Unies sur les produits indispensables aux ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    United Nations Commission on Commodities for Women's and Children's Health. Too often, cost effective, high impact medicines - those that could address critical health problems such as pneumonia, diarrhea, and post-partum hemorrhage - don't reach the women and... View moreUnited Nations Commission on ...

  4. Le national-populisme roumain aux portes de Bruxelles

    Directory of Open Access Journals (Sweden)

    Sorina Soare

    2005-09-01

    Full Text Available Le national-populisme marque visiblement le paysage politique roumain, mais c’est surtout le Parti de la Grande Roumanie, devenu récemment le Parti Populaire de la Grande Roumanie, qui réussit à s’assurer une constance électorale. Malgré ses résultats électoraux, son potentiel de coalition est complètement ignoré par tous les partis parlementaires roumains. D’ailleurs, le cordon sanitaire qui l’isole depuis 1996 assure indirectement la stabilité de la démocratie roumaine. Comment appréhender alors le national-populisme roumain ? L’article propose une interprétation socio-historique qui met en évidence le caractère caméléonesque du parti. Plusieurs éléments du discours du parti sont analysés par une grille d’analyse à trois niveaux : le discours populiste, la défense de la nation et le potentiel de rupture. En même temps, dans la perspective de l’élargissement de 2007, les conclusions de l’article portent sur les stratégies échouées de démantèlement de l’ostracisme national et international.El nacional-populismo marca de manera visible el panorama político rumano, pero es sobre todo el Partido de la Gran Rumania, convertido recientemente en el Partido Popular de la Gran Rumania, el que ha conseguido asegurarse una constancia electoral. A pesar de sus resultados electorales, su potencial para formar coalición ha sido ignorado completamente por los partidos parlamentarios rumanos. Por otro lado, el cordón sanitario que le aísla desde 1996, asegura de manera indirecta la estabilidad de la democracia rumana. ¿Cómo se puede temer pues el nacional-populismo rumano? El artículo propone una interpretación socio-histórica que pone en evidencia el carácter camaleónico del partido. En el se analizan otros elementos del discurso del partido a través de tres niveles: el discurso populista, la defensa de la nación y el potencial de ruptura. Al mismo tiempo, dentro de la perspectiva de ampliación del 2007, las conclusiones del artículo fijan nuestras miradas en las estrategias baldías de desarticulación del ostracismo nacional e internacional.National-populism is a major factor in the Romanian political scene, but it is mainly the Great Romania Party, recently transformed into the Great Romania People Party, that consistently exhibits electoral strength. Despite this strength, fixed boundaries built by the other Romanian parliamentary parties nullify any potential of coalition for the Great Romania People's Party. However, this ostracism indirectly contributes to the overall stability of the Romanian democracy. To fully understand this party, the scholar proposes to make a social-historical analysis based on a three levels perspective: the populist theory, its nationalistic elements and its potential to crack the democratic system. In line with the 2007 EU enlargement, the conclusions of this article lay emphasis on the limits of the changes instituted in 2005 and their influence on a continued national and international ostracism.

  5. Aquaculture intérieure et adaptation aux changements climatiques ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Outputs. Papers. The Contributions of Different Patterns and Periods of Mobility in Sustaining Fish Cage Farming in the Ping River. IDL-56229.pdf. Papers. Forming Social Capital for Climate-Related Adaptation of Fish Pond Farming in Northern Thailand. IDL-56227.pdf. Papers. Fish Farmers' Utilization of Social Networks in ...

  6. Loi constitutive chimioplastique pour le beton expose aux hautes temperatures

    Science.gov (United States)

    Hammoud, Rabah

    Concrete is the most widely used construction material in the world. Even though it has been used for several centuries, its behavior to high temperature remains to be understood. In the light of recent extreme events, including accidents, and arson, special attention has been focused on the performance of concrete in the fire safety assessment of buildings and tunnels. Fire represents one of the most severe conditions encountered during the life-time of a structure. Concrete exposed to high temperature can significantly jeopardize the structural integrity and load bearing capacity of the structure. Spalling of concrete remains one of the main issues to be addressed in the case of fire in buildings and tunnels. Successful modeling of this phenomenon depends not only on the accurate prediction of the temperature distribution through structural concrete but also on its mechanical response to the heating and boundaries restrains conditions and the migration of moisture and associated pore pressures. Therefore, it is necessary to develop a reliable formulation of concrete with all required information to understand its behavior during and after exposure to elevated temperature. It is also necessary to properly assess the effects of thermal degradation in order to develop predictive tools and validate design codes. Many structural problems can be adequately worthy by an elastoplastic model. The ultimate goal of this study is the development of a new constitutive model under a chemoplastic framework. To do this, an experimental program is carried out. The purpose of this program is twofold. First, it is essential to calibrate the proposed constitutive law that will be developed, and, second, for defining an inverse a problem. Usually, uniaxial and triaxial tests, conducted with confining pressure varied between 1.3 and 24 MPa and a temperature up to 700°C, allow us to identify the constitutive law parameters. This law reproduces the reduced field strength due to degradation of exothermic origin. This experimental program puts emphasis on the fragile nature of the preheated concrete and demonstrates the non-applicability of two failure criteria often used in engineering calculation. An alternative is proposed and well-tested. Indeed, exposing the concrete to high temperature results in irreversible loss of stiffness as well as a loss of decohesion strength. These losses are, typically, expressed through semi-empirical relationships of the mechanical properties with temperature. Unfortunately, these relationships are inadequate because the direct impact of this degradation, on the macroscopic scale, can result in a dependency relationship between the elastic properties and the hydrates mass. Therefore, unlike traditional methods using conventional elasto-plastic models and adjusting certain parameters with local temperature, the proposed constitutive law that incorporates a function of dehydration similar to the softening index in chemo-plastics gives good results. An Etse and Willam similar criterion is used and modified for the occasion. Hardening and softening mechanisms are then needed to expand and contract the loading surface for defining the strength of the concrete on a wide range of dehydration processes. The direction and magnitude of a permanent deformation, core of the inelastic domain, are defined through the development of non-associated chemoplastic potential and new curve of ductility. The influence of hydrostatic pressure (dilatancy) and dehydration on the concrete behavior are taken into account in our model. The model is implemented in the Matlab(c) code. Strains and stresses generated in the concrete are now accurately predicted. To illustrate the capabilities of the developed model to predict the complex behavior of concrete exposed to high temperature, simulations are performed through numerical loading paths scenarios. The model is able to accurately reproduce all the experimental data.

  7. Les agriculteurs s'adaptent aux changements climatiques en Tunisie ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    23 août 2011 ... À La Soukra, en Tunisie, des centaines de familles à faible revenu vivent des produits de la terre qu'elles cultivent. Or, depuis quelques décennies, ce mode de vie est menacé par l'urbanisation et les changements climatiques.

  8. Adaptation aux changements climatiques en Afrique | Page 2 | IDRC ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Stories from the field : confronting sea level rise on Egypt's Nile Delta coast. Download PDF. Reports. Stories from the field : addressing ... LVIF announces five more funded projects. Eleven world-class research teams set to improve livestock vaccine development and production to benefit farmers across the Global South.

  9. Des connaissances aux politiques : Tirer le meilleur parti possible ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    17 août 2009 ... ... Ottawa, au Canada. En 2007 et en 2008, il a été chercheur invité en science de la durabilité au Center for International Development de l'Université Harvard. Il a écrit dans les domaines de l'évaluation, de la coopération internationale et de la gestion de l'environnement. Edición español: Descargar PDF.

  10. Soutien aux processus d'élaboration des politiques de ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    C'est notamment le cas des plantes génétiquement modifiées (GM), qui permettent d'accroître la production alimentaire tout en réduisant (voire en éliminant complètement) la nécessité de recourir à des engrais et à des pesticides chimiques. Toutefois, de nombreux pays de l'Asie du Sud-Est, comme le Cambodge, ...

  11. Adaptation aux changements climatiques dans deux collectivités ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Les collectivités les plus pauvres et les plus marginalisées au Maroc se trouvent dans des régions arides et semi-arides. Leur survie et leur sécurité alimentaire dépendent dans une large part de l'agriculture. Ces régions, qui sont déjà périodiquement frappées par la sécheresse, connaîtront une variabilité du climat accrue ...

  12. Partage de connaissances sur l'adaptation aux changements ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    GMOs or local crops for climate change adaptation in Africa? : key findings and policy recommendations from the AfricaAdapt network. Download PDF. Briefs. Adapter l'agriculture grâce à la connaissance locale : principales conclusions et recommandations politiques issues d'une discussion en ligne d'AfricaAdapt.

  13. Professionnalisation de l'agriculture : Une alternative aux effets des ...

    African Journals Online (AJOL)

    La démarche méthodologique utilisée s'articule autour de la recherche documentaire et de la collecte des informations socio-économiques détaillées obtenues auprès des ménages sur les organisations professionnelles agricoles et sur le processus de professionnalisation de l'agriculture. Un diagnostic agroclimatique a ...

  14. Permettre aux pauvres de se faire entendre | CRDI - Centre de ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Comme l'explique Touhami Abdelkhalek de l'Institut national de statistique et ... en 2001, du premier rapport sur le développement humain de la province. ... écoles dans les endroits où le manque d'installations limite la fréquentation scolaire. ... à l'Initiative en faveur des pays pauvres très endettés (initiative PPTE), lancée ...

  15. Adaptation de collectivités africaines aux changements climatiques ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Rapports. First General Meeting : the Adaptation Network; We're Up to the Climate Challenge!, Kirstenbosch Botanical Gardens, Cape Town, 4 November 2009. Téléchargez le PDF. Rapports. South African National Networking Meeting on Climate Change Adaptation, the Airport Grand Hotel, Johannesburg, 18 June 2009.

  16. Evolution de la frequence et des problemes lies aux evacuations

    African Journals Online (AJOL)

    EVOLUTION OF THE FREQUENCY AND PROBLEMS ASSOCIATED WITH ... peripheral health facility, inappropriate transportation and the initial management by midwife assistants and .... qualité au Centre Hospitalier Yalgado Ouagadougou.

  17. Aquaculture intérieure et adaptation aux changements climatiques ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Risk aversion and emotions in the management of climate-related risks by fish farmers. IDL-56181.pdf. Papers. Climate-related risks to cage aquaculture in the reservoirs of Northern Thailand. IDL-56141.pdf. Papers. Weighing Costs, Weathering Risks: Adaptive Strategies of Fish Farmers Facing Multiple Risks in Northern ...

  18. Les metiers de la documentation face aux nouvelles technologies ...

    African Journals Online (AJOL)

    With new technologies of information documentary units are being reversed in terms of organisation and professionnel qualifications that need a constant updating with respect to innovations. However, many obstacles can obstruct the adaptation of documentry duties.

  19. Morocco calls for investors; Le Maroc en appelle aux investisseurs

    Energy Technology Data Exchange (ETDEWEB)

    Rigaud, Ch.

    2011-03-15

    Morocco imported more than 96% of its energy between 2002 and 2009. Moreover the economic and social development of the country requires important energy needs that will grow by 5% a year. The Morocco government has launched an ambitious plan for developing renewable energies that aims at trebling its today's production of electricity by 2020. 2000 MW of solar energy will be installed on 5 sites and at least 2000 MW of wind energy will also be installed. Morocco's potential for wind energy is assessed to reach 25000 MW. The investment for the solar program will reach 6.5*10{sup 9} euros. The aim of the energy policy is also to create jobs and develop local skills for manufacturing components of wind turbines and solar panels. The idea is that investors produce in Morocco for the local energy market and for export to African countries. Exports of renewable energy toward Europe will also be possible as Morocco is the only Arab country to be connected on the European frequency. A third submarine power cable between Morocco and Europe is being installed. (A.C.)

  20. Pour en finir avec la violence faite aux Palestiniennes | CRDI ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    4 févr. 2011 ... Je me suis sérieusement brûlée, un jour, en cuisinant », déclare Kameel, rappelant un accident survenu trois ans après son mariage. ... Le projet a été lancé en janvier 1999 par l'établissement d'une équipe de chercheurs, formés par Abdo, lesquels ont à leur tour entrepris de former les dirigeants des ...

  1. Methodes de provision technique et applications aux donnees ...

    African Journals Online (AJOL)

    assurance. Un bref résumé des différentes méthodes a été donné ainsi que les hypothèses des modèles. Une étude plus approfondie montre des limites de ces méthodes dans l'approche actuelle dans le choix d'un Tail Factor. En effet, les valeurs ...

  2. Aux origines de la police politique républicaine

    Directory of Open Access Journals (Sweden)

    Marie Vogel

    2008-01-01

    Full Text Available Le 30 juin 1880, alors que la République semble encore fragile et mal assurée, le directeur de la Sûreté générale adresse au ministre de l’Intérieur un rapport  qui tire les enseignements des actions récemment menées par ses services et expose ce que devraient être les missions, les pratiques et l’organisation d’une police politique républicaine qui reste encore à inventer. Ce texte, d’un grand intérêt pour qui veut connaître les méthodes, l’organisation d’une police à l’état embryonnaire, s’...

  3. Politique commerciale et croissance favorable aux pauvres au Ghana

    International Development Research Centre (IDRC) Digital Library (Canada)

    Addressing Africa's unmet need for family planning by intensifying sexual and reproductive and adolescent health research. ... Special journal issue highlights IDRC-supported findings on women's paid work. Policy in Focus publishes a special issue profiling evidence to empower women in the labour market.

  4. Résilience organisationnelle rebondir face aux turbulences

    CERN Document Server

    Koninckx, Guy

    2010-01-01

    Toutes les organisations traversent des turbulences et des crises. Ces situations conduisent à des pertes de repères et de sens. Les identités ne sont pas épargnées. Dans de telles circonstances, comment rebondir ? Quels moyens mettre en oeuvre pour favoriser la résilience, cette capacité à faire face à l'adversité ? Les auteurs présentent ici le cadre conceptuel de la résilience, différents modèles, une démarche opérationnelle et un ensemble d'outils appropriés. Le modèle CIRERO permet de positionner les organisations sur les trajectoires de résilience. Des stratégies particulières sont recommandées en fonction des situations de crise. Toute personne amenée à mettre en place des conditions favorables à l'émergence de la résilience trouvera, dans ce livre, un guide, une " boîte à outils " et une abondante source d'informations constituées par des retours d'expériences et des études de cas d'organisations amenées à affronter de sérieux bouleversements.

  5. Partage de connaissances sur l'adaptation aux changements ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Driving vaccine innovations to improve lives and livelihoods. Five world-class research teams are working to develop vaccines for neglected livestock diseases in the Global South. View moreDriving vaccine innovations to improve lives and livelihoods ...

  6. Alerte à la luciferine aux abords du CERN

    CERN Multimedia

    2004-01-01

    Strange containers with the CERN logo were found in the woods in neighbouring France on Monday. They were marked as highly dangerous and as containing Luciferine F4-C. However, investigations showed they did not contain Luciferine, nor were they radioactive, nor did they originate from CERN (1.5 pages)

  7. Adaptation aux changements climatiques en ce qui concerne l ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2012-01-31

    First [1st] Country†Wise Inception Workshop of Stakeholders †Sudan, January 31, 2012, Sharija Conference Hall, Khartoum, Sudan. Download PDF. Journal articles. Maize cultivar specific parameters for decision support system for agrotechnology transfer (DSSAT) application in Tanzania. Download PDF. Studies.

  8. Adaptation aux changements climatiques dans les établissements ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Beaucoup de travaux de recherche portent sur les causes de la vulnérabilité, toutefois, pour ... Climate change adaptation in informal settings: Understanding and ... Reducing the Risk of Water Pollution in Vulnerable Coastal Communities of ...

  9. Aquaculture intérieure et adaptation aux changements climatiques ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Gender and the management of climate-related risks in northern Thailand. Papers. Risk aversion and emotions in the management of climate-related risks by fish farmers. Papers. Mainstreaming climate change into inland aquaculture policies in Thailand. Papers. Improving climate risk management as an adaptation ...

  10. Aquaculture intérieure et adaptation aux changements climatiques ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Institution Country. Thailand. Institution Website. http://www.chiangmai.ac.th ... New funding opportunity for gender equality and climate change ... fostering effective, long-term climate action to reduce social inequality, promote greater gender ...

  11. Construction du paludisme et aversion face aux risques dans une ...

    African Journals Online (AJOL)

    The present study is aiming at pointing out the cultural and social mechanisms which are at the basis of malaria risks. Inspite of the knowledge about objective risks presented by preventive information matter of health education, the perception and representation of malaria are not always those conveyed by the health ...

  12. Exploitation Agricole des Berges : Une Strategie D'Adaptation aux ...

    African Journals Online (AJOL)

    et socio-économique. ... dynamique des paysages agraires et son impact sur le capital naturel surtout sur les .... favoriser leur germination et amorcer leur croissance. ..... similaires ont été relevées au Bénin où l'impact humain se traduit par le ...

  13. Conditions de contrat applicables aux travaux de construction

    CERN Document Server

    1999-01-01

    Conditions of Contract for Construction, which are recommended for building or engineering works designed by the Employer or by his representative, the Engineer. Under the usual arrangements for this type of contract, the Contractor constructs the works in accordance with a design provided by the Employer. However, the works may include some elements of Contractor-designed civil, mechanical, electrical and/or construction works.

  14. Aquaculture intérieure et adaptation aux changements climatiques ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Téléchargez le PDF. Articles de revue. Learning about climate-related risks: decisions of Northern Thailand fish farmers in a role-playing simulation game. Téléchargez le PDF. Articles de revue. Effect of Water De-stratification on Dissolved Oxygen and Ammonia in Tilapia Ponds in Northern Thailand. Téléchargez le PDF.

  15. Intoxications aigues aux organophosphores chez la femme enceinte

    Science.gov (United States)

    Barhoumi, Mohamed Hafed; Bannour, Badra; Barhoumi, Tarek; Jouini, Rami; Marwene, Nadia; Fatnassi, Mohamed Ridha

    2016-01-01

    Les intoxications aiguës par les pesticides organophosphorés (OP) au cours de la grossesse sont des événements rares, peu décrites dans la littérature. A travers cette étude rétrospective, nous rapportons les résultats de sept cas d’ingestion suicidaire d’OP chez des femmes enceintes. Cette intoxication était le plus souvent grave. En effet, cinq des sept parturientes avaient un Glasgow initial des cas elle était défavorable pour le fœtus (mort fœtal in utéro). Deux mécanismes peuvent expliquer ces complications fœtales. Le premier est l’hypoxie fœtale associée ou non à un état de choc qui peuvent se traduire au niveau du RCF par une tachycardie ou des décélérations et aboutir ainsi à un décès in utero. Le deuxième mécanisme est le passage de ces pesticides à travers la barrière placentaire, ce qui pose un risque potentiel pour le fœtus par altération des systèmes enzymatiques des microsomes. PMID:28293343

  16. Recours aux droits fonciers collectifs pour renforcer la gouvernance ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Corey Piccioni

    breuses populations à risque, dont les femmes, ne profitent pas pleinement des droits fonciers prévus par ce régime. Cette situation s'explique principalement ... que par la définition imprécise des règles des institutions formelles et coutumières. La recherche. Les chercheurs mènent la toute première étude longitudinale.

  17. Le microdosage des engrais, une innovation qui profite aux femmes

    International Development Research Centre (IDRC) Digital Library (Canada)

    non seulement une diminution de leurs revenus, mais doivent aussi composer avec une pénurie chronique de céréales. Au Niger, par exemple, 2,5 millions de personnes ont eu besoin d'une aide alimentaire en 2005, par suite d'une grave sécheresse (PAM, 2010). Cette situation s'est reproduite en 2010, la mauvaise.

  18. Abonnez-vous aux alertes de financement | CRDI - Centre de ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Afrique subsaharienne. Si vous ne voulez plus recevoir les alertes de financement, vous pouvez toujours vous désabonner. Ce que nous faisons · Financement · Ressources · À propos du CRDI. Savoir. Innovation. Solutions. Carrières · Communiquez avec nous · Plan du site. Abonnez-vous à notre bulletin pour recevoir les ...

  19. Energy prospects in the USA; Les perspectives energetiques aux USA

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2004-03-01

    This article summarizes the main trends of the US national energy plan sustained by the administration of President Bush: national energy policy development (diversification of energy supplies, development of an hydrogen economy), energy legislation (energy saving, development of renewable energy sources, promoting national production, budget discussion), re-launching of the nuclear sector: situation of the nuclear operators, competitiveness of nuclear energy, impact of deregulation on fusion/acquisition operations, role and liability of the federal administration (development of the Yucca Mountain (Nevada) disposal site for spent fuels, 'Nuclear Power 2010' initiative, long-term 'Generation IV' program, advanced fuel cycle program, hydrogen initiative and project of very high temperature reactor (VHTR) at the Idaho national laboratory). (J.S.)

  20. Aux frontières du politique et du religieux

    Directory of Open Access Journals (Sweden)

    Frédéric Sylvanise

    2006-05-01

    Full Text Available The Autobiography of Miss Jane Pittman met en scène de manière spectaculaire deux figures de leadership noir-américain au XIXe siècle (Ned et au XXe siècle (Jimmy. Ned, fils adoptif de Jane Pittman, se rebaptise Professor Douglass en hommage au leader abolitionniste Frederick Douglass. S’il est fondamentalement laïc (il est instituteur, le texte lui confère néanmoins une dimension religieuse, notamment dans le chapitre intitulé « The Sermon at the River » , qui renvoie à la fois à Moïse (le fleuve et à Jésus (le sermon sur la montagne. Abattu par un tueur à gages, Ned est un martyr dont l’histoire était déjà écrite. Le personnage de Jimmy, attendu par toute une communauté comme le messie (alors que lui aussi est un laïc et un homme qui perd la foi, s’inscrit dans la même histoire. Lettré, éloquent et impliqué dans le mouvement pour les droits civils, il est assassiné comme son prédécesseur. Dans les deux cas, le texte lie donc le politique et le biblique comme s’il ne faisait qu’un : être un leader politique, c’est être un preacher et un messie qui guide le peuple. Il est possible de lire l’évocation de ces deux hommes à la lumière d’une certaine actualité. Ned et Jimmy connaissent en effet un sort proche de celui de Malcolm X et de Martin Luther King, récemment assassinés au moment de l’écriture de The Autobiography of Miss Jane Pittman. C’est l’histoire de la répression du leadership noir, au travers du portrait de deux de ses avatars, qui peut donc se lire en creux ici.