WorldWideScience

Sample records for aulladores alouatta sara

  1. Caracterización del cariotipo del mono aullador colorado Alouatta seniculus que habita en Colombia

    Directory of Open Access Journals (Sweden)

    Torres Olga María

    2001-12-01

    Full Text Available Presentamos cariotipos con bandas Q, G, R Y C del mono aullador colorado de Colombia, con base en el análisis de los cariotipos de 12 ejemplares cautivos y la reevaluación de los cariotipos de bandas Q de un macho y de una hembra publicados (Yunis et al. 1976. Reinterpretamos el mecanismo cromosómico de determinación del sexo y la morfología del cromosoma X de Alouatta seniculus seniculus. Los resultados indican que el cromosoma X es un metacéntrico de tamaño medio (4.85 % TCL similar al cromosoma X de otros primates de los géneros Cebus, Aotus y Ateles estudiados hasta la fecha, así como al cromosoma X humano. Además, los machos portan una translocación entre el cromosoma Y y el autosoma 3, demostrando un mecanismo cromosómico de  determinación del sexo XIXI X2X2 IXIX2 YIY2, diferente del convencional XX I XV. Todos los animales estudiados presentaron un número diploide de 44.This paper presents Q- G- R- and C-bands karyotypes ofred howler from Colombia, based on analyses of karyotypes oftwelve caught specimens besides a female and a male Q banding karyotypes (Yunis et al. 1976 reevaluated. We reappraisal X chromosome morphology and sex determination chromosome mechanism of Alouatta seniculus seniculus. This work shows X chromosome is a nearly metacentric médium sized chromosome (4.85 %TCL, similar to other primates X chromosome from Cebus, Aotus and Ateles genus up to now studied, as well as human X chromosome. Further in males, Y chromosome undergone a translocation onto autosome 3, named X1X2Y1Y2• Al! specimens studied shows 44 chromosomes diploid number.

  2. A phylogeny of howler monkeys (Cebidae: Alouatta based on mitochondrial, chromosomal and morphological data

    Directory of Open Access Journals (Sweden)

    Federico Villalobos

    2004-09-01

    Full Text Available The current taxonomic status of the species and subspecies belonging to the genus Alouatta is addressed by combined phylogenetic analysis using morphological, kariotipyc and molecular data (mitochondrial genes cytocrome oxidase II and cytochrome B. Our result demonstrated that Alouatta palliata is the most basal taxon for the genus in concordance with previous studies, as well as showing the validity of the taxon Alouatta sara as a species. Also our analysis shows that the sex chromosome has evolved from a XY/XX system to a X1X2Y1Y2/X1X1X2X2 system within the genus, as well as an increase in the size and complexity of the hioideal bone. Rev. Biol. Trop. 52(3: 665-677. Epub 2004 Dic 15.El estado taxonómico actual de las especies y subespecies del genero Alouatta (Lacépède, 1799 fue estudiado empleando un análisis filogenético combinado de datos morfológicos, cariotipicos y moleculares (genes mitocontridales del Citocromo Oxidasa II y el Citocromo B. Nuestros resultados demuestran que Alouatta palliata (Gray 1949 es la especie mas basal del genero en concordancia con propuestas previas para el grupo, también muestran la valides de Alouatta sara (Elliot 1910 como una especie. Nuestros análisis también muestra que los cromosomas sexuales evolucionaron de un sistema XY/XX a un sistema X1X2Y1Y2/X1X1X2X2 dentro del genero así como también un incremento en el tamaño y complejidad del hueso hioideo.

  3. Distribución geográfica del mono aullador rojo (Alouatta seniculus y la fiebre amarilla en Colombia

    Directory of Open Access Journals (Sweden)

    Juan Piedrahita-Cortés

    2016-08-01

    Conclusiones. En 69,5 % de los departamentos con antecedentes de fiebre amarilla se registró la presencia de A. seniculus, lo cual resulta relevante por el papel que los primates no humanos desempeñan como reservorio natural del virus y por su contribución en la presentación de la fiebre amarilla, lo cual les confiere gran utilidad como centinelas.

  4. News developments at Sara

    International Nuclear Information System (INIS)

    Belmont, J.L.; Fruneau, M.; Martin, P.

    1989-05-01

    SARA was one of the first cyclotrons to operate with an ECR ion source. Experience since 1983 showed it would be useful to have two sources situated outside the cyclotron vault to manage continuous operation of the accelerator and development of new ions. A 18 m long injection line for FERROMAFIOS and MINIMAFIOS has been constructed. One of its principal features is a 11 m long electrostatic guide with periodic focusing. Transmission ratios from the source to the internal beam are close to 30%. Experiences involving time of flight measurements require short beam bunches; in order to reduce their duration, a phase selecting system will be installed in the centre of the injector of SARA. A RF voltage at four times the frequency of the dees will vertically deflect early orbits while particles close to the central phase will cross the deflector at zero voltage and will undergo normal acceleration

  5. Parásitos intestinales en monos congo Alouatta palliata (Primates: Cebidae de Costa Rica

    Directory of Open Access Journals (Sweden)

    Misael Chinchilla Carmona

    2005-09-01

    Full Text Available Se estudiaron las heces de 102 monos de la especie Alouatta palliata (monos aulladores o congos de las siguientes regiones de Costa Rica. Valle Central: San Ramón (Alajuela; Pacífico Central: Isla Chira y Parque Manuel Antonio (Puntarenas; Pacífico Norte: Palo Verde, Playa Potrero, Nicoya (Guanacaste y Caribe: Cahuita (Limón. Los animales capturados fueron anestesiados con dardos conteniendo Telazol®. La mayoría defecaron espontáneamente o se les estimulaba a defecar. Las muestras se estudiaron en el laboratorio en forma directa en solución salina (0.85% y una solución de yodo o teñidas con hematoxilina para identificar los parásitos correspondientes. El material fue cultivado en el medio de Dobell para determinar la presencia de amebas y flagelados. Se encontraron helmintos de los géneros Trypanoxyuris, Strongyloides y Controrchis y protozoarios de los géneros Endolimax, Entamoeba, Trichomonas y Giardia. Los porcentajes de infección por protozoarios oscilaron entre 16.7% y 80% y se encontraron helmintos en un 3.4% a un 80% de los animales de acuerdo con la zona estudiada. No se encontraron diferencias importantes de parasitosis relacionadas con el sexo pero si existió mayor infección en los animales más jóvenes. Se establece la relación entre los índices de infección y algunos parámetros tales como las áreas estudiadas, el peso de los animales y el contacto con el ser humano.Intestinal parasites in howler monkeys Alouatta palliata (Primates: Cebidae of Costa Rica. Fecal samples of 102 howler monkeys (Alouatta palliata from several sites of Costa Rica were studied for intestinal parasites. The zones studied were: Central Valley (San Ramón, Alajuela, Central Pacific (Chomes and Manuel Antonio National Park, Puntarenas, North Pacific (Palo Verde Park and Playa Potrero, Guanacaste, Chira Island in the Nicoya Gulf and Caribean area (Cahuita, Limón. Animals were anesthetized with dards containing Telazol in order to collect

  6. 2012 SARA Students Technical Report

    International Nuclear Information System (INIS)

    Briccetti, Angelo; Lorei, Nathan; Yonkings, David; Lorio, David; Goorley, John T.; Sood, Avneet

    2012-01-01

    The Service Academy Research Associates (SARA) program provides an opportunity for Midshipmen and Cadets from US Service Academies to participate in research at Los Alamos National Laboratory (LANL), Lawrence Livermore National Laboratory (LLNL), and Sandia National Laboratory for several weeks during the summer as part of their summer training assignments. During the summer of 2012, three Midshipmen were assigned to work with the XCP Division at LANL for approximately 5-6 weeks. As one of the nation's top national security science laboratories, LANL stretches across 36 square miles, has over 2,100 facilities, and employs over 9,000 individuals including a significant number of students and postdocs. LANL's mission is to 'apply science and technology to: ensure the safety, security, and reliability of the US nuclear deterrent, reduce global threats, and solve other emerging national security challenges.' While LANL officially operates under the US Department of Energy (DoE), fulfilling this mission requires mutual cooperation with the US Department of Defense (DoD) as well. LANL's high concentration of knowledge and experience provides interns a chance to perform research in many disciplines, and its connection with the DoD in both operation and personnel gives SARA students insight to career possibilities both during and after military service. SARA students have plenty of opportunity to enjoy hiking, camping, the Los Alamos YMCA, and many other outdoor activities in New Mexico while staying at the Buffalo Thunder Resort, located 20 miles east of the lab. XCP Division is the Computational Physics division of LANL's Weapons Department. Working with XCP Division requires individuals to be Q cleared by the DoE. This means it is significantly more convenient for SARA students to be assigned to XCP Division than their civilian counterparts as the DoD CNWDI clearance held by SARA students is easily transferred to the lab prior to the students arriving at the start of

  7. 2012 SARA Students Technical Report

    Energy Technology Data Exchange (ETDEWEB)

    Briccetti, Angelo [Los Alamos National Laboratory; Lorei, Nathan [Los Alamos National Laboratory; Yonkings, David [Los Alamos National Laboratory; Lorio, David [Los Alamos National Laboratory; Goorley, John T. [Los Alamos National Laboratory; Sood, Avneet [Los Alamos National Laboratory

    2012-07-30

    The Service Academy Research Associates (SARA) program provides an opportunity for Midshipmen and Cadets from US Service Academies to participate in research at Los Alamos National Laboratory (LANL), Lawrence Livermore National Laboratory (LLNL), and Sandia National Laboratory for several weeks during the summer as part of their summer training assignments. During the summer of 2012, three Midshipmen were assigned to work with the XCP Division at LANL for approximately 5-6 weeks. As one of the nation's top national security science laboratories, LANL stretches across 36 square miles, has over 2,100 facilities, and employs over 9,000 individuals including a significant number of students and postdocs. LANL's mission is to 'apply science and technology to: ensure the safety, security, and reliability of the US nuclear deterrent, reduce global threats, and solve other emerging national security challenges.' While LANL officially operates under the US Department of Energy (DoE), fulfilling this mission requires mutual cooperation with the US Department of Defense (DoD) as well. LANL's high concentration of knowledge and experience provides interns a chance to perform research in many disciplines, and its connection with the DoD in both operation and personnel gives SARA students insight to career possibilities both during and after military service. SARA students have plenty of opportunity to enjoy hiking, camping, the Los Alamos YMCA, and many other outdoor activities in New Mexico while staying at the Buffalo Thunder Resort, located 20 miles east of the lab. XCP Division is the Computational Physics division of LANL's Weapons Department. Working with XCP Division requires individuals to be Q cleared by the DoE. This means it is significantly more convenient for SARA students to be assigned to XCP Division than their civilian counterparts as the DoD CNWDI clearance held by SARA students is easily transferred to the lab prior to the

  8. The SARA REU Site Program

    Science.gov (United States)

    Wood, M. A.; Oswalt, T. D.; SARA Collaboration

    2000-12-01

    We present an overview of the Research Experiences for Undergraduates (REU) Site Program hosted by the Southeastern Association for Research in Astronomy (SARA) for the past 6 years. SARA is a consortium of the six universities: Florida Institute of Technology, East Tennessee State University, Florida International University, The University of Georgia, Valdosta State University, and Clemson University. We host 10-11 student interns per year out of an application pool of ~150-200. Recruiting flyers are sent to the ~3400 undergraduate institutions in the United States, and we use a web-based application form and review process. We are a distributed REU Site, but come together for group meetings at the beginning and end of the summer program and stay in contact in between using email list manager software. Interns complete a research project working one-on-one with a faculty mentor, and each intern travels to observe at the SARA Observatory at Kitt Peak National Observatory. Interns give both oral and display presentations of their results at the final group meeting. In addition, all interns write a paper for publication in the IAPPP Communications, an international amateur-professional journal, and several present at professional meetings and in refereed publications. We include in the group meetings a ``how-to'' session on giving talks and posters, an Ethics Session, and a session on Women in Astronomy. This work was supported by the NSF Research Experiences for Undergraduates (REU) Site Program through grant AST 96169939 to The Florida Institute of Technology.

  9. Sara

    International Nuclear Information System (INIS)

    Aparo, M.; Dionisi, M.; Vicini, C.; Zeppa, P.; Frazzoli, F.V.; Remetti, R.; Portale, C.

    1989-01-01

    Nuclear Material Accountability, supported by Containment and Surveillance measures, is a foundamental means for an effective International Safeguard implemention in nuclear plants. Accountability is based on the verification that difference between a material quantity entering a given material balance and the quantity leaving that area in a given period of time, correspond and the amount of material actually present at the moment of the inspection. In the recent years International Safeguards appealing to the needs of timeliness in detecting diversion and concealing activities, devoted ReD efforts on a new Dynamic Accountability procedures (NRTMA) with particular concern with reprocessing plants. The present paper, which is the result of a research activity carried out in the frame of the Italian Support Programme to IAEA for Safeguards implementation, deals with a feasibility study of a NRTMA system to be applied to the EUREX pilot reprocessing plant. Such a feasibility study was performed by developing a computer program based on simulated plant generated data

  10. River crossings by Ateles geoffroyi and Alouatta pigra in southern Mexico: A preliminary report Habilidad para cruzar ríos en Ateles geoffroyi y Alouatta pigra en el sur de México: Un reporte preliminar

    Directory of Open Access Journals (Sweden)

    ÓSCAR M CHAVES

    2010-01-01

    Full Text Available During a nine month field study, we assess the ability of spider (Ateles geoffroyi and howler (Alouatta pigra monkeys to cross a large Mesoamerican river, and if this behavior is related to deforestation and/or human population size on the disturbed riverbank. The study was conducted along the Lacantún River, southern Mexico, which .divides the Montes Azules Biosphere Reserve and the Marqués de Comillas disturbed region. We collected data on river crossings by both monkey species from 428 hours of surveys along the river and 58 questionnaires completed by knowledgeable local informants. Furthermore, we determined the frequency of river crossing by the two species, location and direction of river-crossing, bank-to-bank river width at the location of reported sighting, and the relationship with deforestation rates and/or human population size in the Marqués de Comillas region. We observed on two separate occasions spider monkeys crossing the river from the disturbed area to the reserve, but howler monkeys were never observed crossing. Interviews suggest, however, that howler monkeys cross the river more frequently than spider monkeys (13 versus 8 reports, respectively. We found that bank-to-bank river width was smaller at river crossing locations in each study site than along the river in general. Furthermore, we found no relationship between river crossings and some human pressures such as deforestation and population size in the region. Whatever the underlying pressures that drive river-crossing events in these two primate species in this region, they appear to be sufficiently strong to stimulate this behavior to occur from time to time.Durante nueve meses evaluamos si los monos araña (Ateles geoffroyi y los monos aulladores (Alouatta pigra tenían la capacidad para cruzar uno de los ríos más grandes de México, y si este comportamiento estaba relacionado con la deforestación y/o el tamaño de las poblaciones humanas en la margen alterada

  11. Severe Accident Recriticality Analyses (SARA)

    Energy Technology Data Exchange (ETDEWEB)

    Frid, W. [Swedish Nuclear Power Inspectorate, Stockholm (Sweden); Hoejerup, F. [Risoe National Lab. (Denmark); Lindholm, I.; Miettinen, J.; Puska, E.K. [VTT Energy, Helsinki (Finland); Nilsson, Lars [Studsvik Eco and Safety AB, Nykoeping (Sweden); Sjoevall, H. [Teoliisuuden Voima Oy (Finland)

    1999-11-01

    Recriticality in a BWR has been studied for a total loss of electric power accident scenario. In a BWR, the B{sub 4}C control rods would melt and relocate from the core before the fuel during core uncovery and heat-up. If electric power returns during this time-window unborated water from ECCS systems will start to reflood the partly control rod free core. Recriticality might take place for which the only mitigating mechanisms are the Doppler effect and void formation. In order to assess the impact of recriticality on reactor safety, including accident management measures, the following issues have been investigated in the SARA project: 1. the energy deposition in the fuel during super-prompt power burst, 2. the quasi steady-state reactor power following the initial power burst and 3. containment response to elevated quasi steady-state reactor power. The approach was to use three computer codes and to further develop and adapt them for the task. The codes were SIMULATE-3K, APROS and RECRIT. Recriticality analyses were carried out for a number of selected reflooding transients for the Oskarshamn 3 plant in Sweden with SIMULATE-3K and for the Olkiluoto 1 plant in Finland with all three codes. The core state initial and boundary conditions prior to recriticality have been studied with the severe accident codes SCDAP/RELAP5, MELCOR and MAAP4. The results of the analyses show that all three codes predict recriticality - both superprompt power bursts and quasi steady-state power generation - for the studied range of parameters, i. e. with core uncovery and heat-up to maximum core temperatures around 1800 K and water flow rates of 45 kg/s to 2000 kg/s injected into the downcomer. Since the recriticality takes place in a small fraction of the core the power densities are high which results in large energy deposition in the fuel during power burst in some accident scenarios. The highest value, 418 cal/g, was obtained with SIMULATE-3K for an Oskarshamn 3 case with reflooding

  12. Severe accident recriticality analyses (SARA)

    Energy Technology Data Exchange (ETDEWEB)

    Frid, W. E-mail: wiktor.frid@ski.se; Hoejerup, F.; Lindholm, I.; Miettinen, J.; Nilsson, L.; Puska, E.K.; Sjoevall, H

    2001-11-01

    Recriticality in a BWR during reflooding of an overheated partly degraded core, i.e. with relocated control rods, has been studied for a total loss of electric power accident scenario. In order to assess the impact of recriticality on reactor safety, including accident management strategies, the following issues have been investigated in the SARA project: (1) the energy deposition in the fuel during super-prompt power burst; (2) the quasi steady-state reactor power following the initial power burst; and (3) containment response to elevated quasi steady-state reactor power. The approach was to use three computer codes and to further develop and adapt them for the task. The codes were SIMULATE-3K, APROS and RECRIT. Recriticality analyses were carried out for a number of selected reflooding transients for the Oskarshamn 3 plant in Sweden with SIMULATE-3K and for the Olkiluoto 1 plant in Finland with all three codes. The core initial and boundary conditions prior to recriticality have been studied with the severe accident codes SCDAP/RELAP5, MELCOR and MAAP4. The results of the analyses show that all three codes predict recriticality--both super-prompt power bursts and quasi steady-state power generation--for the range of parameters studied, i.e. with core uncovering and heat-up to maximum core temperatures of approximately 1800 K, and water flow rates of 45-2000 kg s{sup -1} injected into the downcomer. Since recriticality takes place in a small fraction of the core, the power densities are high, which results in large energy deposition in the fuel during power burst in some accident scenarios. The highest value, 418 cal g{sup -1}, was obtained with SIMULATE-3K for an Oskarshamn 3 case with reflooding rate of 2000 kg s{sup -1}. In most cases, however, the predicted energy deposition was smaller, below the regulatory limits for fuel failure, but close to or above recently observed thresholds for fragmentation and dispersion of high burn-up fuel. The highest calculated

  13. Severe accident recriticality analyses (SARA)

    International Nuclear Information System (INIS)

    Frid, W.; Hoejerup, F.; Lindholm, I.; Miettinen, J.; Nilsson, L.; Puska, E.K.; Sjoevall, H.

    2001-01-01

    Recriticality in a BWR during reflooding of an overheated partly degraded core, i.e. with relocated control rods, has been studied for a total loss of electric power accident scenario. In order to assess the impact of recriticality on reactor safety, including accident management strategies, the following issues have been investigated in the SARA project: (1) the energy deposition in the fuel during super-prompt power burst; (2) the quasi steady-state reactor power following the initial power burst; and (3) containment response to elevated quasi steady-state reactor power. The approach was to use three computer codes and to further develop and adapt them for the task. The codes were SIMULATE-3K, APROS and RECRIT. Recriticality analyses were carried out for a number of selected reflooding transients for the Oskarshamn 3 plant in Sweden with SIMULATE-3K and for the Olkiluoto 1 plant in Finland with all three codes. The core initial and boundary conditions prior to recriticality have been studied with the severe accident codes SCDAP/RELAP5, MELCOR and MAAP4. The results of the analyses show that all three codes predict recriticality--both super-prompt power bursts and quasi steady-state power generation--for the range of parameters studied, i.e. with core uncovering and heat-up to maximum core temperatures of approximately 1800 K, and water flow rates of 45-2000 kg s -1 injected into the downcomer. Since recriticality takes place in a small fraction of the core, the power densities are high, which results in large energy deposition in the fuel during power burst in some accident scenarios. The highest value, 418 cal g -1 , was obtained with SIMULATE-3K for an Oskarshamn 3 case with reflooding rate of 2000 kg s -1 . In most cases, however, the predicted energy deposition was smaller, below the regulatory limits for fuel failure, but close to or above recently observed thresholds for fragmentation and dispersion of high burn-up fuel. The highest calculated quasi steady

  14. Severe Accident Recriticality Analyses (SARA)

    International Nuclear Information System (INIS)

    Frid, W.; Hoejerup, F.; Lindholm, I.; Miettinen, J.; Puska, E.K.; Nilsson, Lars; Sjoevall, H.

    1999-11-01

    Recriticality in a BWR has been studied for a total loss of electric power accident scenario. In a BWR, the B 4 C control rods would melt and relocate from the core before the fuel during core uncovery and heat-up. If electric power returns during this time-window unborated water from ECCS systems will start to reflood the partly control rod free core. Recriticality might take place for which the only mitigating mechanisms are the Doppler effect and void formation. In order to assess the impact of recriticality on reactor safety, including accident management measures, the following issues have been investigated in the SARA project: 1. the energy deposition in the fuel during super-prompt power burst, 2. the quasi steady-state reactor power following the initial power burst and 3. containment response to elevated quasi steady-state reactor power. The approach was to use three computer codes and to further develop and adapt them for the task. The codes were SIMULATE-3K, APROS and RECRIT. Recriticality analyses were carried out for a number of selected reflooding transients for the Oskarshamn 3 plant in Sweden with SIMULATE-3K and for the Olkiluoto 1 plant in Finland with all three codes. The core state initial and boundary conditions prior to recriticality have been studied with the severe accident codes SCDAP/RELAP5, MELCOR and MAAP4. The results of the analyses show that all three codes predict recriticality - both superprompt power bursts and quasi steady-state power generation - for the studied range of parameters, i. e. with core uncovery and heat-up to maximum core temperatures around 1800 K and water flow rates of 45 kg/s to 2000 kg/s injected into the downcomer. Since the recriticality takes place in a small fraction of the core the power densities are high which results in large energy deposition in the fuel during power burst in some accident scenarios. The highest value, 418 cal/g, was obtained with SIMULATE-3K for an Oskarshamn 3 case with reflooding

  15. Interpreting the SARA and RCRA training requirements

    International Nuclear Information System (INIS)

    Moreland, W.M.; Wells, S.M.

    1987-01-01

    The Resource Conservation and Recovery Act (RCRA) and the Superfund Amendments and Reauthorization Act (SARA) promulgated by the EPA (RCRA) and the OSHA (SARA) require hazardous materials training for all individuals working with hazardous materials. Facilities that are involved in the generation, storage, treatment, transportation, or disposal/removal of hazardous materials/waste must comply with all relevant training regulations. Using the guidelines contained in the RCRA and SARA regulations, decisions must be made to determine: the type of regulatory requirement based on facility function (i.e., whether the facility is a RCRA or CERCLA facility). The type of training required for specific categories of workers (e.g. managers, supervisors, or general site workers). The level of training needed for each category of worker. This presentation outlines how the Environmental Compliance and Health Protection Technical Resources and Training Group, working with waste operations personnel, establishes specific training requirements

  16. System Analysis and Risk Assessment (SARA) system

    International Nuclear Information System (INIS)

    Krantz, E.A.; Russell, K.D.; Stewart, H.D.; Van Siclen, V.S.

    1986-01-01

    Utilization of Probabilistic Risk Assessment (PRA) related information in the day-to-day operation of plant systems has, in the past, been impracticable due to the size of the computers needed to run PRA codes. This paper discusses a microcomputer-based database system which can greatly enhance the capability of operators or regulators to incorporate PRA methodologies into their routine decision making. This system is called the System Analysis and Risk Assessment (SARA) system. SARA was developed by EG and G Idaho, Inc. at the Idaho National Engineering Laboratory to facilitate the study of frequency and consequence analyses of accident sequences from a large number of light water reactors (LWRs) in this country. This information is being amassed by several studies sponsored by the United States Nuclear Regulatory Commission (USNRC). To meet the need of portability and accessibility, and to perform the variety of calculations necessary, it was felt that a microcomputer-based system would be most suitable

  17. Cranial shape variation in adult howler monkeys (Alouatta seniculus).

    Science.gov (United States)

    Fiorenza, Luca; Bruner, Emiliano

    2018-01-01

    Howler monkeys (genus Alouatta) display a distinctive cranial architecture characterized by airorhynchy (or retroflexion of the facial skeleton on the cranial base), a small braincase, and a posteriorly oriented foramen magnum. This configuration has been associated with distinct factors including a high folivory diet, locomotion, and the presence of a specialized vocal tract characterized by large hyoid bone. However, the morphological relationships between the facial and neurocranial blocks in Alouatta have been scarcely investigated. In this study we quantitatively analyzed the cranial shape variation in Alouatta seniculus, to evaluate possible influences and constraints in face and braincase associated with airorhynchy. We also considered the structural role of the pteric area within the cranial functional matrix. We applied landmark-based analysis and multivariate statistics to 31 adult crania, computing shape analyses based on 3D coordinates registration as well as the analysis of the Euclidean distance matrix to investigate patterns of intraspecific morphological variability. Our results suggest that allometry is the main source of variation involved in shaping cranial morphology in howlers, influencing the degree of facial proportions and braincase flattening, and generating the main sexual differences. Larger individuals are characterized by a higher degree of airorhynchy, neurocranial flattening, and expansion of the zygomatic arch. Allometric variations influence the skull as a whole, without distinct patterns for face and braincase, which behave as an integrated morphological unit. A preliminary survey on the pteric pattern suggests that the morphology of this area may be the result of variations in the vertical growth rates between face and braincase. Future studies should be dedicated to the ontogenetic series and focus on airorhynchy in terms of differential growth among distinct cranial districts. © 2017 Wiley Periodicals, Inc.

  18. Anotaciones de la ecología alimentaria de monos aulladores negros en un fragmento con condiciones de hacinamiento (Balancán, Tabasco, México

    Directory of Open Access Journals (Sweden)

    John Aristizábal-Borja

    2011-08-01

    Full Text Available Annotations on the feeding ecology of black howler monkeys in an overcrowded fragment in Balancán, Tabasco, México. Wedescribed the feeding behavior of Central-American black howler monkey (Alouatta pigra in a fragment of less than one hectare ofhumid evergreen forest surrounded by grassland for livestock use, isolated trees and mango orchards, in the region of Balancán (Tabasco,México. Objective: To record the diet and activity of black howler monkeys in crowded conditions during the wettest month in Balancán(Tabasco, México. Methods and methods: The behavioral observations (81 h were made using the focal animal methodology withan A. pigra troop made up of three individuals (1 adult male, 1 adult female and 1 infant. Results: Feeding time represented 15.97%,rest 78% and locomotion 4.57% of total time. In the study area we recorded 14 plant species, with 10 being consumed by howlermonkeys. 55% of feeding time was devoted to the consumption of fruits, 27% to leaves, 17% to stems, and 1% to sprouts. Spondiasmombin was the tree species most consumed, with 61% of the time invested on it. Conclusion: Like other studies, we confirmed thefrugivore-folivore feeding tendency of the genus Alouatta. We provide information on the black howler monkey flexibility to live andmaintain themselves in extreme perturbation conditions, where their habitat is 0.1 ha with few tree species to use, forcing individualsto move around the ground.

  19. The relationship between SARA fractions and crude oil stability

    Directory of Open Access Journals (Sweden)

    Siavash Ashoori

    2017-03-01

    Full Text Available Asphaltene precipitation and deposition are drastic issues in the petroleum industry. Monitoring the asphaltene stability in crude oil is still a serious problem and has been subject of many studies. To investigate crude oil stability by saturate, aromatic, resin and asphaltene (SARA analysis seven types of crudes with different components were used. The applied methods for SARA quantification are IP-143 and ASTM D893-69 and the colloidal instability index (CII is computed from the SARA values as well. In comparison between CII results, the values of oil compositions demonstrated that the stability of asphaltenes in crude oils is a phenomenon that is related to all these components and it cannot be associated only with one of them, individually.

  20. Layering of life (Sara novel of Peter Sarić

    Directory of Open Access Journals (Sweden)

    Kostić Dragomir J.

    2015-01-01

    Full Text Available Novel Sara of Petar Sarić consists of two parts; in it are processed or present two wars, two major wars in the region of Montenegro and Herzegovina, the First and Second World War. However, it is more novel about divisions within the family and the man himself, (and infamous assault of godfather Luka on Sarah also and his murder are in that function, in the first part; and on the divisions among the people, in general, in the second part of the novel. The second part is, in fact, the image layering of life, not a symbolic one, full of hope, faith, reliance, rather than a concrete, real life, that life which is transformed into a fear of life. Separate, poetical, part of the novel, is his main character, Sara. It is no coincidence that her name novel entitled. Because she is one of most beautiful characters in the newer Serbian prose. Speech about the Sara precedes speech about her book. The book is Sara, Sara's book! Possession of book is her main feature of the exterior. Sara comes out from the Book and disappears in the book. Self contained and independent, therefore doomed to conflict with the environment. Loyal to husband and family, loyal to the truth and for justice, she ,,not hurt anything and anyone, no one is standing in the way, to anyone not wroth, nor has anyone looked wrong.' At the same time, the strange beauty, beauty that could not fit into some sort of scheme, one particular image or idea of beauty that again and again renewed, changed, remaining distant, and unmet. Strange goodness, marvelous beauty, she suffered unusual way; her life was transformed into continuous abstinence, repression, in anxiety and fear. In a word: in martirizam! Finally, in order to safe­guard children, sacrificed herself. Novel is a strong critique of society which is not able to recognize the beauty / goodness!.

  1. First New World Primate Papillomavirus Identification in the Atlantic Forest, Brazil: Alouatta guariba papillomavirus 1.

    Science.gov (United States)

    Silvestre, Rodrigo Vellasco Duarte; de Souza, Alex Junior Souza; Júnior, Edivaldo Costa Sousa; Silva, Allan Kaio; de Mello, Wyller Alencar; Nunes, Marcio Roberto T; Júnior, João Lídio S G V; Cardoso, Jedson Ferreira; de Vasconcelos, Janaina Mota; de Oliveira, Layanna Freitas; da Silva, Sandro Patroca; da Silva, Adriana Marques J; Fries, Brigida Gomes; Summa, Maria Eugênia L; de Sá, Lilian Rose M

    2016-08-18

    We report here the complete genome sequence of the first papillomavirus detected in a New World primate, howler monkey, Alouatta guariba clamitans papillomavirus 1 (AgPV1), from the Atlantic Forest in São Paulo State, Brazil. Copyright © 2016 Silvestre et al.

  2. Subacute ruminal acidosis (SARA) in grazing Irish dairy cows.

    Science.gov (United States)

    O'Grady, Luke; Doherty, Michael L; Mulligan, Finbar J

    2008-04-01

    Subacute ruminal acidosis (SARA) is a significant production disease of dairy cattle. Previous concerns have been raised over the occurrence of SARA in pasture-fed dairy cattle and the potential consequences of laminitis and lameness. Highly digestible perennial rye grass contains high concentrations of rapidly fermentable carbohydrate and low concentrations of physical effective fibre that may result in SARA. This study conducted a point prevalence survey of rumen health status in grazing Irish dairy cattle fed predominantly perennial rye grass-based pasture. The survey assessed rumen fluid, animal health status, milk production data and pasture composition. A total of 144 cows between 80 and 150 days in milk were sampled on 12 farms. Eleven percent of cows were classified as affected with SARA (pH 5.8). The study showed that low rumen pH is prevalent in grazing Irish dairy cattle consuming perennial rye grass-based pasture and raises concerns regarding effective pasture utilisation and possible consequences for animal health.

  3. Gene : CBRC-SARA-01-1996 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1996 Novel UN D UNKNOWN NU2C_ANTFO 0.004 26% gb|AAQ05281.1| NADH dehydrogenase subunit B [Metas...equoia glyptostroboides] 0.044 26% MILMLFLLGSSPRSLIHPRAILKTFPIVCCCLYAFCSLTSLILSLAVL

  4. Dental disorders in brown howler monkeys (Alouatta guariba clamitans) maintained in captivity.

    Science.gov (United States)

    Dias Neto, Ramiro das Neves; Fecchio, Roberto Silva; Rahal, Sheila Canevese; Teixeira, Carlos Roberto; Gioso, Marco Antônio; Pereira, Camila Trevisan; Santos, Maria Augusta Adami Pereira Dos; Milanelo, Liliane

    2016-04-01

    The aim of this study was to investigate dental disorders of brown howler monkeys maintained in captivity. The hypothesis is that the identification and diagnosis of the lesions may contribute to control and prevention. Sixteen intact brown howler monkeys (Alouatta guariba clamitans), eight females and eight males, weighing from 3.9 to 6.8 kg, were studied. Under general anesthesia, the teeth were evaluated by visual inspection, probing, palpation, and intra-oral radiographic exam. The findings were registered on a dental chart specific for primates. Of the 16 monkeys evaluated in the present study, 94% (n = 15) had some type of dental disorder. The lesions observed were dental calculus (88%), dental wear (81%), missing teeth (38%), gingivitis (19%), gingival recession (6%), dental fracture (19%), pulp exposure (19%), and dental staining (25%). Alouatta guariba clamitans maintained in captivity have a high rate of dental problems. © 2016 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.

  5. Feeding ecology of the black howler monkey (Alouatta pigra) in northern Belize.

    Science.gov (United States)

    Silver, S C; Ostro, L E; Yeager, C P; Horwich, R

    1998-01-01

    We studied the feeding ecology of the black howler monkey (Alouatta pigra) from March 1994 to April 1995 in the Community Baboon Sanctuary in northern Belize, Central America. Activity and diet composition were recorded using continuous focal animal sampling. Diet composition was compared with the relative abundance of plant parts eaten by the howlers within the study site. The study animals spent an average of 24.4% of their time feeding, 61.9% resting, and approximately 9.8% traveling. In contrast to previously published reports on A. pigra, we found the diet composition to be similar to that of other Alouatta species (conforming to the folivore/frugivore profile), with 41% of feeding time spent eating fruit, 45% foliage, and 11% flowers. This contrast may indicate a wide degree of dietary flexibility that allows A. pigra to inhabit a variety of habitat types. We suggest that a high level of resource abundance throughout the year makes the Community Baboon Sanctuary excellent habitat for Alouatta pigra.

  6. SARAS MEASUREMENT OF THE RADIO BACKGROUND AT LONG WAVELENGTHS

    International Nuclear Information System (INIS)

    Patra, Nipanjana; Subrahmanyan, Ravi; Sethi, Shiv; Shankar, N. Udaya; Raghunathan, A.

    2015-01-01

    SARAS is a correlation spectrometer connected to a frequency independent antenna that is purpose-designed for precision measurements of the radio background at long wavelengths. The design, calibration, and observing strategies admit solutions for the internal additive contributions to the radiometer response, and hence a separation of these contaminants from the antenna temperature. We present here a wideband measurement of the radio sky spectrum by SARAS that provides an accurate measurement of the absolute brightness and spectral index between 110 and 175 MHz. Accuracy in the measurement of absolute sky brightness is limited by systematic errors of magnitude 1.2%; errors in calibration and in the joint estimation of sky and system model parameters are relatively smaller. We use this wide-angle measurement of the sky brightness using the precision wide-band dipole antenna to provide an improved absolute calibration for the 150 MHz all-sky map of Landecker and Wielebinski: subtracting an offset of 21.4 K and scaling by a factor of 1.05 will reduce the overall offset error to 8 K (from 50 K) and scale error to 0.8% (from 5%). The SARAS measurement of the temperature spectral index is in the range −2.3 to −2.45 in the 110–175 MHz band and indicates that the region toward the Galactic bulge has a relatively flatter index

  7. Teologi Politik Berbalu SARA Antara Ambisi dan Konspirasi

    Directory of Open Access Journals (Sweden)

    M. Sidi Ritau'din

    2017-06-01

    Full Text Available In a multi-cultural democracy based on Pancasila philosophy of independence, ethnic, religious, racial and intergroup issues it call (SARA are political indicators that can trigger conflict and division. If the player is ambitious and power-hungry, then he will not hesitate to do everything he can to gain power, even build a big conspiracy using SARA as a tool to divide the ummah, then he emerges as a unifier and presents programs prestigious sympathetic, there Imaging actions and slogans of the pro poor people, but essentially no more as political deceit, a false gift of hope, it familiar said (PHP that never realized, only reap the political advantage in the game of SARA, even not hesitate to shout thief when he Itself is a thieving thief based on greed and greed where the horizontal relations of fellow human beings deny the bond of faith as the foundation. Political conspiracy based on political interests and abuse of power, an action of political pathology that is not civilized that has become a trend of contemporary politics and globalization.

  8. Layering of life (Sara novel of Peter Sarić)

    OpenAIRE

    Kostić, Dragomir J.

    2015-01-01

    Novel Sara of Petar Sarić consists of two parts; in it are processed or present two wars, two major wars in the region of Montenegro and Herzegovina, the First and Second World War. However, it is more novel about divisions within the family and the man himself, (and infamous assault of godfather Luka on Sarah also and his murder are in that function), in the first part; and on the divisions among the people, in general, in the second part of the novel. The second part is, in fact, the image ...

  9. A simple blowdown code for SUPER-SARA loop conditions

    International Nuclear Information System (INIS)

    Fritz, G.

    1981-01-01

    The Super Sara test programme (SSTP) is aimed to study in pile the fuel and cluster behaviour under two types of accident conditions: - the ''Large break loss of coolant'' condition (LB-Loca), - the ''Severe fuel damage'' (SFD) in a boildown caused by a small break. BIVOL was developed for the LB-Loca situation. This code is made for a loop where essentially two volumes define the thermohydraulics during the blowdown. In the SUPERSARA loop these two volumes are represented by the hot leg and cold leg pipings together with the respective upper and lower plenum of the test section

  10. Rumen Microbiome Composition in Cattle during Grain-Induced Subacute Ruminal Acidosis (SARA)

    DEFF Research Database (Denmark)

    Danscher, Anne Mette; Derakshani, Hooman; Li, Shucong

    2014-01-01

    at the genus level. The rumen bacterial communities were altered in response to SARA (P=0.01). The proportion of several taxa was significantly higher in SARA samples, including S24-7, Erysipelotrichales. Lactobacillus, C lostridia, Moryella, Butyrivibrio, Olsenella, and C oprococcus. Microbiome profiling...

  11. Parasites of free-ranging black howler monkeys (Alouatta pigra) from Belize and Mexico.

    Science.gov (United States)

    Vitazkova, Sylvia K; Wade, Susan E

    2006-11-01

    Parasites are important members of the ecological web within which an animal lives, and can be used as indicators of ecosystem health. However, few baseline parasitological data are available for free-ranging animals, particularly for the black howler monkey (Alouatta pigra). In this study a total of 283 fecal samples were collected from 50 individually identified A. pigra during 2003 and 2004 and examined for parasites. The samples were processed using standard quantitative centrifugation concentration techniques, with sugar and zinc sulfate used as flotation media. The slides were examined using bright-field and phase microscopy. Antigen capture enzyme-linked immunosorbent assays (ELISAs) were used to detect protozoa. Four parasites were detected: 1) Controrchis biliophilus (Dicrocoeliidae), 2) Trypanoxyuris minutus (Oxyuridae), 3) Giardia sp. (Hexamitidae), and 4) Entamoeba sp. (Endamoebidae). Controrchis biliophilus was detected in 80% (wet season) and 81% (dry season) of the A. pigra samples; Trypanoxyuris minutus was detected in 8% (wet season) and 27% (dry season) of samples; and Giardia sp. was detected in 40% (wet season) and 27% (dry season) of samples. For the first time, DNA from Giardia sp.-positive fecal samples was extracted from A. pigra. Alouatta pigra individuals that lived near human settlements in Belize were infected with Giardia duodenalis (syn. G. lamblia, G. intestinalis) Assemblages A and B. These results suggest that G. duodenalis is transmitted from people and/or domestic animals to A. pigra. (c) 2006 Wiley-Liss, Inc.

  12. Alouatta trichromatic color vision: cone spectra and physiological responses studied with microspectrophotometry and single unit retinal electrophysiology.

    Science.gov (United States)

    Silveira, Luiz Carlos L; Saito, Cézar A; da Silva Filho, Manoel; Kremers, Jan; Bowmaker, James K; Lee, Barry B

    2014-01-01

    The howler monkeys (Alouatta sp.) are the only New World primates to exhibit routine trichromacy. Both males and females have three cone photopigments. However, in contrast to Old World monkeys, Alouatta has a locus control region upstream of each opsin gene on the X-chromosome and this might influence the retinal organization underlying its color vision. Post-mortem microspectrophotometry (MSP) was performed on the retinae of two male Alouatta to obtain rod and cone spectral sensitivities. The MSP data were consistent with only a single opsin being expressed in each cone and electrophysiological data were consistent with this primate expressing full trichromacy. To study the physiological organization of the retina underlying Alouatta trichromacy, we recorded from retinal ganglion cells of the same animals used for MSP measurements with a variety of achromatic and chromatic stimulus protocols. We found MC cells and PC cells in the Alouatta retina with similar properties to those previously found in the retina of other trichromatic primates. MC cells showed strong phasic responses to luminance changes and little response to chromatic pulses. PC cells showed strong tonic response to chromatic changes and small tonic response to luminance changes. Responses to other stimulus protocols (flicker photometry; changing the relative phase of red and green modulated lights; temporal modulation transfer functions) were also similar to those recorded in other trichromatic primates. MC cells also showed a pronounced frequency double response to chromatic modulation, and with luminance modulation response saturation accompanied by a phase advance between 10-20 Hz, characteristic of a contrast gain mechanism. This indicates a very similar retinal organization to Old-World monkeys. Cone-specific opsin expression in the presence of a locus control region for each opsin may call into question the hypothesis that this region exclusively controls opsin expression.

  13. Sara, a patient with borderline personality structure: A "crisis" management

    Directory of Open Access Journals (Sweden)

    Paola Marinelli

    2015-05-01

    Full Text Available In this article the author examines some significant passages of his treatment of a patient with borderline personality structure, with the intention of giving a formative contribution to the delicate issue of the search for congruence between theory and clinic operations. This reflection is therefore an opportunity to integrate these aspects. The individualization of the therapeutic relationship in the theoretical framework of group analysis allowed the emotional investment in the person of the therapist, which is useful in the construction of a meaningful relationship on the human, emotional and cognitive plane; a space within which it has become increasingly possible for Sara, share and process emotions, re-build, contact parts of the self frustrated and disappointed, perceive less and less the void and become less vulnerable, being able to pull over to the original trauma. 

  14. Staphylococcus aureus sarA regulates inflammation and colonization during central nervous system biofilm formation.

    Directory of Open Access Journals (Sweden)

    Jessica N Snowden

    Full Text Available Infection is a frequent and serious complication following the treatment of hydrocephalus with CSF shunts, with limited therapeutic options because of biofilm formation along the catheter surface. Here we evaluated the possibility that the sarA regulatory locus engenders S. aureus more resistant to immune recognition in the central nervous system (CNS based on its reported ability to regulate biofilm formation. We utilized our established model of CNS catheter-associated infection, similar to CSF shunt infections seen in humans, to compare the kinetics of bacterial titers, cytokine production and inflammatory cell influx elicited by wild type S. aureus versus an isogenic sarA mutant. The sarA mutant was more rapidly cleared from infected catheters compared to its isogenic wild type strain. Consistent with this finding, several pro-inflammatory cytokines and chemokines, including IL-17, CXCL1, and IL-1β were significantly increased in the brain following infection with the sarA mutant versus wild type S. aureus, in agreement with the fact that the sarA mutant displayed impaired biofilm growth and favored a planktonic state. Neutrophil influx into the infected hemisphere was also increased in the animals infected with the sarA mutant compared to wild type bacteria. These changes were not attributable to extracellular protease activity, which is increased in the context of SarA mutation, since similar responses were observed between sarA and a sarA/protease mutant. Overall, these results demonstrate that sarA plays an important role in attenuating the inflammatory response during staphylococcal biofilm infection in the CNS via a mechanism that remains to be determined.

  15. System Analysis and Risk Assessment system (SARA) Version 4.0

    International Nuclear Information System (INIS)

    Sattison, M.B.; Russell, K.D.; Skinner, N.L.

    1992-01-01

    This NUREG is the tutorial for the System Analysis and Risk Assessment System (SARA) Version 4.0, a microcomputer-based system used to analyze the safety issues of a family [i.e., a power plant, a manufacturing facility, any facility on which a probabilistic risk assessment (PRA) might be performed]. A series of lessons are provided that walk the user through some basic steps common to most analyses performed with SARA. The example problems presented in the lessons build on one another, and in combination, lead the user through all aspects of SARA sensitivity analysis

  16. The new species of Mysidacea (Crustacea), Anchialina labatus and Gastrosaccus sarae, from south west Australia

    Digital Repository Service at National Institute of Oceanography (India)

    Panampunnayil, S.U.

    on the third segment of the mandibular palp and by the modification of the exopod of the third pleopod of the male. G. sarae is distinguished from the other species by the shape and armature of the telson...

  17. New Entamoeba group in howler monkeys (Alouatta spp.) associated with parasites of reptiles.

    Science.gov (United States)

    Villanueva-García, Claudia; Gordillo-Chávez, Elías José; Baños-Ojeda, Carlos; Rendón-Franco, Emilio; Muñoz-García, Claudia Irais; Carrero, Julio César; Córdoba-Aguilar, Alex; Maravilla, Pablo; Galian, José; Martínez-Hernández, Fernando; Villalobos, Guiehdani

    2017-08-01

    Our knowledge of the parasite species present in wildlife hosts is incomplete. Protozoans such as amoebae of the genus Entamoeba infect a large variety of vertebrate species, including NHPs. However, traditionally, their identification has been accomplished through microscopic evaluation; therefore, amoeba species have not always been identified correctly. We searched for Entamoeba spp. using a fragment of the small subunit rDNA in free-ranging howler monkeys (Alouatta palliata and A. pigra) from southeast Mexico. One hundred fifty five samples were collected, with 46 from A. palliata and 109 from A. pigra and 8 of the total samples were positive. We detected a new clade of Entamoeba, which was separated from other described species but closer to E. insolita, as well as an unnamed sequence typically found in iguana species with low shared identity values (reptiles.

  18. Calculations for the design and modification of the 2 cyclotrons of S.A.R.A

    International Nuclear Information System (INIS)

    Albrand, P.S.; Belmont, J.L.; Ripouteau, F.

    1983-09-01

    S.A.R.A. is a heavy ion accelerator constituted by 2 cyclotrons. The second cyclotron (post-accelerator) was entirely calculated at the I.S.N. The pole tips of the first cyclotron which is much older, have recently been modified. An almost identical procedure was used for the calculation of each element of the post-accelerator of S.A.R.A. and also for the modifications to the first cyclotron

  19. Geographical distribution of the red howler monkey (Alouatta seniculus) and yellow fever in Colombia.

    Science.gov (United States)

    Piedrahita-Cortés, Juan; Soler-Tovar, Diego

    2016-02-11

    Colombia is a country with an important diversity of non-human primates, of which the red howler monkey (Alouatta seniculus) stands out because of its distribution and the role it plays in the occurrence of yellow fever.  To describe the geographic co-occurrence of Alouatta seniculus and the reported presence of yellow fever.  We conducted a descriptive study. The reported presence of yellow fever in Colombia was obtained from the reports and bulletins issued by the Instituto Nacional de Salud, and the study by Segura, et al. (2013). The occurrence of A. seniculus was determined based on the data from the Global Biodiversity Information Facility and the Colombian Biodiversity Information System. A map of the occurrence was developed using the DIVA-GIS program, and the ecological niche model under current conditions was created with the Maxent program.  The departments with the highest occurrence of A. seniculus were Antioquia, Meta and Casanare; 69.5% of the departments with reported history of yellow fever had co-occurrence with A. seniculus. The ecological niche model showed that Antioquia, Bolívar, La Guajira, Magdalena, Meta, Santander, Norte de Santander and Vichada had geographical portions with a probability rate nearing to 0.9 (90%).  In 69.5% of the departments with a history of yellow fever there was co-occurrence with A. seniculus, which is relevant because non-human primates play a well-known role as natural reservoirs of the virus, and they might contribute to the occurrence of the yellow fever, which makes them very useful as sentinels.

  20. Ovarian cycle of southern brown howler monkey (Alouatta guariba clamitans) through fecal progestin measurement.

    Science.gov (United States)

    Silvestre, Thiago; Zanetti, Eveline S; Duarte, José M B; Barriento, Fernando G; Hirano, Zelinda M B; Souza, Júlio C; Passos, Fernando C

    2017-01-01

    The ovarian cycle in howler monkeys (genus Alouatta) has beean investigated through several biological parameters (ranging between 16.3 and 29.5 days); however, no data exist concerning the ovarian activity of the southern brown howler monkey (Alouatta guariba clamitans). This study aimed to describe the ovarian cycle of A. g. clamitans by profiling fecal progestin concentrations. Over 20 weeks, fecal samples of eight captive adult females of A. g. clamitans were collected. The collections were made at dawn, 5 days a week, and the samples were frozen immediately following collection. Next, they were dried, pulverized and hormonal metabolites were extracted to determine progestin concentrations by enzyme immunoassay. Of the 758 samples tested, the mean concentration of fecal progestins was 2866.40 ± 470.03 ng/g of dry feces, while the mean concentration at baseline was 814.47 ± 164.36 ng/g of dry feces. Among the eight females, one showed no ovarian cyclicity and three presented periods of probable absence of cyclicity and low progestin concentrations. A mean duration of 16 ± 0.52 days was observed for the 35 cycles studied. The interluteal phase lasted 4 ± 0.37 days on average, with a mean concentration of fecal progestins of 467.98 ± 29.12 ng/g of dry feces, while the luteal phase lasted 11 ± 0.50 days, with a mean concentration of 4283.27 ± 193.31 ng/g of dry feces. Besides describing the characteristics of the ovarian cycle, possible causes for the low concentrations of fecal progestins and periods of absence of cyclicity are also discussed.

  1. Análise do líquido cefalorraquidiano de bugio-ruivo (Alouatta guariba

    Directory of Open Access Journals (Sweden)

    Marcos V. Tranquilim

    2013-12-01

    Full Text Available A presente pesquisa foi realizada com o objetivo de desenvolver e adaptar técnicas diagnósticas em neurologia para primatas não humanos, da espécie Alouatta guariba Geoffroy Saint-Hilaire, 1812 (bugio-ruivo saudáveis e mantidos em cativeiro. Foram realizadas análises físico-químicas e citológicas do líquido cefalorraquidiano obtido na cisterna magna de oito bugios-ruivos. Para realização dos exames, todos os animais foram contidos quimicamente com associação de cetamina, xilazina e midazolam e anestesia inalatória com isoflurano. Os resultados das análises do líquido cefalorraquidiano demonstraram valores médios de proteína: 16,92mg/dL±9,84; glicose: 131,25mg/dL±106,7; pH: 8,37±0,69; células nucleadas: 0,5/mm³±0,75; hemácias: 49,37/mm³±111,76 e pressão: 7,37cm H2O±1,77. O trabalho demonstrou a segurança e a eficácia da colheita do líquido cefalorraquidiano na cisterna magna de Alouatta guariba e os valores de referência para a espécie.

  2. Social humanoid robot SARA: development of the wrist mechanism

    Science.gov (United States)

    Penčić, M.; Rackov, M.; Čavić, M.; Kiss, I.; Cioată, V. G.

    2018-01-01

    This paper presents the development of a wrist mechanism for humanoid robots. The research was conducted within the project which develops social humanoid robot Sara - a mobile anthropomorphic platform for researching the social behaviour of robots. There are two basic ways for the realization of humanoid wrist. The first one is based on biologically inspired structures that have variable stiffness, and the second one on low backlash mechanisms that have high stiffness. Our solution is low backlash differential mechanism that requires small actuators. Based on the kinematic-dynamic requirements, a dynamic model of the robot wrist is formed. A dynamic simulation for several hand positions was performed and the driving torques of the wrist mechanism were determined. The realized wrist has 2 DOFs and enables movements in the direction of flexion/extension 115°, ulnar/radial deviation ±45° and the combination of these two movements. It consists of a differential mechanism with three spur bevel gears, two of which are driving and identical, while the last one is the driven gear to which the robot hand is attached. Power transmission and motion from the actuator to the input links of the differential mechanism is realized with two parallel placed identical gear mechanisms. The wrist mechanism has high carrying capacity and reliability, high efficiency, a compact design and low backlash that provides high positioning accuracy and repeatability of movements, which is essential for motion control.

  3. Phylogenetic relationships among Brazilian howler monkeys, genus Alouatta (Platyrrhini, Atelidae, based on g1-globin pseudogene sequences

    Directory of Open Access Journals (Sweden)

    Carla Maria Meireles

    1999-09-01

    Full Text Available The genus Alouatta (howler monkeys is the most widely distributed of New World primates, and has been arranged in three species groups: the Central American Alouatta palliata group and the South American Alouatta seniculus and Alouatta caraya groups. While the latter is monotypic, the A. seniculus group encompasses at least three species (A. seniculus, A. belzebul and A. fusca. In the present study, approximately 600 base pairs of the g1-globin pseudogene were sequenced in the four Brazilian species (A. seniculus, A. belzebul, A. fusca and A. caraya. Maximum parsimony and maximum likelihood methods yielded phylogenetic trees with the same arrangement: {A. caraya [A. seniculus (A. fusca, A. belzebul]}. The most parsimonious tree had bootstrap values greater than 82% for all groupings, and strength of grouping values of at least 2, supporting the sister clade of A. fusca and A. belzebul. The study also confirmed the presence of a 150-base pair Alu insertion element and a 1.8-kb deletion in the g1-globin pseudogene in A. fusca, features found previously in the remaining three species. The cladistic classification based on molecular data agrees with those of morphological studies, with the monospecific A. caraya group being clearly differentiated from the A. seniculus group.Os guaribas, do gênero Alouatta, que são os primatas do Novo Mundo com maior distribuição geográfica, têm sido colocados em três grupos de espécies: o grupo Alouatta palliata da América central, e os grupos sulamericanos Alouatta seniculus e Alouatta caraya. Este último é monotípico, mas o grupo A. seniculus inclui pelo menos três espécies (A. seniculus, A. belzebul e A. fusca. Neste estudo, foram seqüenciados aproximadamente 600 pares de base do pseudogene globina g1 nas quatro espécies brasileiras (A. seniculus, A. belzebul, A. fusca e A. caraya. Os métodos de máxima parcimônia e máxima verossimilhança produziram árvores filogenéticas com o mesmo arranjo

  4. Lianas as a food resource for brown howlers (Alouatta guariba) and southern muriquis (Brachyteles arachnoides) in a forest fragment

    OpenAIRE

    M. M. Martins

    2009-01-01

    Lianas as a food resource for brown howlers (Alouatta guariba) and southern muriquis (Brachyteles arachnoides) in a forest fragment.— Lianas, woody vines, are abundant and diverse in tropical forests, but their relative contribution as a source of food for herbivores has been neglected. I compared feeding rates on lianas and trees of two sympatric primates, A. guariba and B. arachnoides, in Southeastern Brazil. Availability of liana foods was gathered in parallel with primate behavioral data ...

  5. Risk factors connected to gastrointestinal parasites in mantled Alouatta palliata mexicana and black howler monkeys Alouatta pigra living in continuous and in fragmented rainforests in Mexico

    Directory of Open Access Journals (Sweden)

    Genoveva TREJO-MACÍAS, Alejandro ESTRADA

    2012-06-01

    Full Text Available In this study we document the prevalence of gastrointestinal parasites (helminths and protozoans found in fecal samples of populations of Alouatta palliata mexicana and of A. pigra in Los Tuxtlas and in Palenque, southeast Mexico, and its relation to habitat condition, sex/age and season. Nineteen parasite morphotypes were detected in the fecal samples from populations of the two howler monkeys, of which 58% were shared by both species. When considering all parasite species, populations of the two howler species were more likely to be parasitized in fragmented habitat compared to continuous habitat. Individuals of both howler monkey species that lived in fragmented habitat had a higher prevalence of Controrchis biliophilus. A. p. mexicana individuals had a higher prevalence of Trypanoxyuris minutus than A. pigra, probably the result of the larger group sizes found in the former species, and T. minutus was more likely to be found in A. palliata individuals that lived in fragmented habitat. Adult A. p. mexicana males had a higher risk of being parasitized compared to adult females, but these differences were not detected in A. pigra. Parasite species such as Entamoeba sp., Nematoda sp. 28, Nematoda sp. B and Parabronema sp. where only found during the wet season in both howler monkey species. Populations of both howler monkey species had a higher prevalence of Nematoda sp. A in the wet season and Ascaridae eggs were only detected during the wet season in A. pigra. Other parasites detected displayed no clear seasonal pattern [Current Zoology 58 (3: 375-383, 2012].

  6. Mengukur Politisasi Agama dalam Ruang Publik: Komunikasi SARA dalam Perdebatan Rational Choice Theory

    Directory of Open Access Journals (Sweden)

    Mohammad Supriyadi

    2015-12-01

    Full Text Available Tulisan ini memberikan gambaran runtuhnya pengaruh isu primordialisme di ruang publik dan digantikan dengan kearifan konvensional. Penelitian ini mengambil aspek pengaruh isu SARA pada aspek rasionalitas pemilih. Penulis menemukan beberapa aspek yang mendukung kesimpulan penelitian, antara lain; bahwa isu SARA tidak terlalu direspek pemilih rasional. Pemilih rasional lebih melihat masalah yang ada dan mengevaluasi kinerja pemerintahan sebelumnya. Di lain pihak, emosi antusias terhadap isu etnisitas akan memantabkan pilihan politik terhadap pemilih etnis minoritas, sebagai bentuk penguatan komunitas. Dengan menggunakan pendekatan teori pilihan rasional (rational choice theory, penulis melihat bahwa komunikasi politik yang dibangun melalui isu SARA di ruang publik dalam kehidupan masyarakat modern, tidak lagi mampu memengaruhi pemilih rasional. Pemilih rasional (rational choice, menentukan pilihan berdasarkan pada keuntungan yang diperolehnya (maximizing benefit. Dalam faktor ini sikap pemilih lebih dipengaruhi karakteristik dan track record kandidat.

  7. Concurrent software system design supported by SARA at the age of one

    Energy Technology Data Exchange (ETDEWEB)

    Campos, I.M.; Estrin, G.

    A multilevel modeling method suitable for the design of concurrent hardware or software systems is presented. The methodology is requirement driven and uses tools incorporated in a programming system called SARA (Systems ARchitect's Apprentice). Both top-down refinement and bottom-up abstraction are supported. The design of an asynchronous sender-receiver illustrates the key steps in going smoothly from programing in the large to programing in the small or actual code. The same methodology can be used to design hardware systems by applying different pragmatics from those proposed for software systems. SARA consists of a set of interactive tools implemented both at UCLA and also on the MIT-Multics system. Although SARA continues in long-term development, completed design tools are accessible for experimentation by authorized users at either location via the ARPANET. 9 figures, 2 tables.

  8. ESTETIKA TARIAN SARA DOUDA DALAM MASYARAKAT ADAT LOLI (SEBUAH PENDEKATAN LINGUISTIK KEBUDAYAAN

    Directory of Open Access Journals (Sweden)

    Sulistyastuti Sutomo

    2015-01-01

    Full Text Available Not only does art   have   self-fullfillment, but  it also has axiological  benefits both socially, culturally, religiously, and economiclally.  So does Sara Douda dance.  Sara Douda aesthetics  is first contained  in its whole dance movements. In addition, it  can also be found in the whole dance equipments.  Moreover,  this dance aesthetics  may  also be contained in the verbal symbols in the speech forms  prior to the dance performance. However,  both verbal and non-verbal aesthetical forms are incorporated by the pieces of socio-cultural and  religious values in the Loli community about  their honoring their ancestors,  having social harmony, and  highly respecting each other among the community members. This study uses a cultural linguistic approach to find out and to review the aesthetics of Sara Douda dance.   Seni memang memiliki kepenuhan dalam dirinya sendiri. Tetapi ia juga sekaligus punya faedah aksiologis, baik secara sosial, kultural, religius maupun secara ekonomis. Tarian Sara Douda pun demikian. Estetika Sara Douda pertama-tama ada dalam semua gerak tariannya. Juga dalam seluruh perlengkapan tarian tersebut. Bukan itu saja, estetika tarian ini juga ada dalam simbol-simbol verbal berupa tuturan menjelang tarian. Tetapi baik bentuk-bentuk estetisasi nonverbal maupun verbal, sama-sama disatukan oleh kepingan-kepingan nilai-nilai sosio-kultural dan religius masyarakat Loli tentang penghormatan kepada leluhur, tentang harmoni sosial, dan tentang penghargaan yang tinggi terhadap satu sama lain. Penelitian ini menggunakan pendekatan linguistik kebudayaan demi menemukan dan menelaah estetika dalam tarian Sara Douda

  9. Gastrointestinal Parasites of Ecuadorian Mantled Howler Monkeys (Alouatta palliata aequatorialis) Based on Fecal Analysis.

    Science.gov (United States)

    Helenbrook, William D; Wade, Susan E; Shields, William M; Stehman, Stephen V; Whipps, Christopher M

    2015-06-01

    An analysis of gastrointestinal parasites of Ecuadorian mantled howler monkeys, Alouatta palliata aequatorialis, was conducted based on examination of fecal smears, flotations, and sedimentations. At least 1 type of parasite was detected in 97% of the 96 fecal samples screened across 19 howler monkey groups using these techniques. Samples averaged 3.6 parasite species per individual (±1.4 SD). Parasites included species representing genera of 2 apicomplexans: Cyclospora sp. (18% of individual samples) and Isospora sp. (3%); 6 other protozoa: Balantidium sp. (9%), Blastocystis sp. (60%), Chilomastix sp. (4%), Dientamoeba sp. (3%), Entamoeba species (56%), Iodamoeba sp. (5%); 4 nematodes: Enterobius sp. (3%), Capillaria sp. (78%), Strongyloides spp. (88%) which included 2 morphotypes, Trypanoxyuris sp. (12%); and the platyhelminth Controrchis sp. (15%). A statistically significant positive correlation was found between group size and each of 3 different estimators of parasite species richness adjusted for sampling effort (ICE: r(2) = 0.24, P = 0.05; Chao2: r(2) = 0.25, P = 0.05, and Jackknife: r(2) = 0.31, P = 0.03). Two significant associations between co-infecting parasites were identified. Based on the prevalence data, individuals infected with Balantidium sp. were more likely to also be infected with Isospora sp. (χ(2) = 6.02, P = 0.01), while individuals harboring Chilomastix sp. were less likely to have Capillaria sp. present (χ(2) = 4.03, P = 0.04).

  10. Antimicrobial Susceptibility of Escherichia coli Strains Isolated from Alouatta spp. Feces to Essential Oils

    Directory of Open Access Journals (Sweden)

    Valéria Maria Lara

    2016-01-01

    Full Text Available This study evaluated the in vitro antibacterial activity of essential oils from Lippia graveolens (Mexican oregano, Origanum vulgaris (oregano, Thymus vulgaris (thyme, Rosmarinus officinalis (rosemary, Cymbopogon nardus (citronella, Cymbopogon citratus (lemongrass, and Eucalyptus citriodora (eucalyptus against Escherichia coli (n=22 strains isolated from Alouatta spp. feces. Minimum inhibitory concentration (MIC and minimum bactericidal concentration (MBC were determined for each isolate using the broth microdilution technique. Essential oils of Mexican oregano (MIC mean = 1818 μg mL−1; MBC mean = 2618 μg mL−1, thyme (MIC mean = 2618 μg mL−1; MBC mean = 2909 μg mL−1, and oregano (MIC mean = 3418 μg mL−1; MBC mean = 4800 μg mL−1 showed the best antibacterial activity, while essential oils of eucalyptus, rosemary, citronella, and lemongrass displayed no antibacterial activity at concentrations greater than or equal to 6400 μg mL−1. Our results confirm the antimicrobial potential of some essential oils, which deserve further research.

  11. Antimicrobial Susceptibility of Escherichia coli Strains Isolated from Alouatta spp. Feces to Essential Oils

    Science.gov (United States)

    Carregaro, Adriano Bonfim; Santurio, Deise Flores; de Sá, Mariangela Facco; Santurio, Janio Moraes; Alves, Sydney Hartz

    2016-01-01

    This study evaluated the in vitro antibacterial activity of essential oils from Lippia graveolens (Mexican oregano), Origanum vulgaris (oregano), Thymus vulgaris (thyme), Rosmarinus officinalis (rosemary), Cymbopogon nardus (citronella), Cymbopogon citratus (lemongrass), and Eucalyptus citriodora (eucalyptus) against Escherichia coli (n = 22) strains isolated from Alouatta spp. feces. Minimum inhibitory concentration (MIC) and minimum bactericidal concentration (MBC) were determined for each isolate using the broth microdilution technique. Essential oils of Mexican oregano (MIC mean = 1818 μg mL−1; MBC mean = 2618 μg mL−1), thyme (MIC mean = 2618 μg mL−1; MBC mean = 2909 μg mL−1), and oregano (MIC mean = 3418 μg mL−1; MBC mean = 4800 μg mL−1) showed the best antibacterial activity, while essential oils of eucalyptus, rosemary, citronella, and lemongrass displayed no antibacterial activity at concentrations greater than or equal to 6400 μg mL−1. Our results confirm the antimicrobial potential of some essential oils, which deserve further research. PMID:27313638

  12. NCBI nr-aa BLAST: CBRC-SARA-01-1323 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1323 ref|NP_001008277.1| rhodopsin [Canis lupus familiaris] ref|XP_855...608.1| PREDICTED: rhodopsin [Canis familiaris] emb|CAA70209.1| unnamed protein product [Canis familiaris] NP_001008277.1 2e-62 94% ...

  13. NCBI nr-aa BLAST: CBRC-SARA-01-1746 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1746 ref|NP_001100989.1| non imprinted in Prader-Willi/Angelman syndro...me 1 homolog [Rattus norvegicus] gb|EDL86455.1| non imprinted in Prader-Willi/Angelman syndrome 1 homolog (human) (predicted) [Rattus norvegicus] NP_001100989.1 1e-113 80% ...

  14. NCBI nr-aa BLAST: CBRC-SARA-01-1273 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1273 ref|ZP_00367235.1| competence locus E (comE3), putative [Campylob...acter coli RM2228] gb|EAL57139.1| competence locus E (comE3), putative [Campylobacter coli RM2228] ZP_00367235.1 0.001 28% ...

  15. NCBI nr-aa BLAST: CBRC-SARA-01-1089 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1089 ref|ZP_00518636.1| Major facilitator superfamily [Crocosphaera watson...ii WH 8501] gb|EAM48279.1| Major facilitator superfamily [Crocosphaera watsonii WH 8501] ZP_00518636.1 1.3 32% ...

  16. NCBI nr-aa BLAST: CBRC-SARA-01-0322 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0322 ref|ZP_01459778.1| conserved hypothetical protein [Stigmatella au...rantiaca DW4/3-1] gb|EAU69359.1| conserved hypothetical protein [Stigmatella aurantiaca DW4/3-1] ZP_01459778.1 5.2 34% ...

  17. NCBI nr-aa BLAST: CBRC-SARA-01-1488 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1488 ref|ZP_01187451.1| conserved hypothetical protein [Bacillus weihenstep...hanensis KBAB4] gb|EAR73176.1| conserved hypothetical protein [Bacillus weihenstephanensis KBAB4] ZP_01187451.1 0.78 25% ...

  18. Reading, Laterality, and the Brain: Early Contributions on Reading Disabilities by Sara S. Sparrow

    Science.gov (United States)

    Fletcher, Jack M.; Morris, Robin D.

    2014-01-01

    Although best known for work with children and adults with intellectual disabilities and autism spectrum disorders, training in speech pathology and a doctorate in clinical psychology and neuropsychology was the foundation for Sara Sparrow's long-term interest in reading disabilities. Her first papers were on dyslexia and laterality, and the…

  19. NCBI nr-aa BLAST: CBRC-SARA-01-1967 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1967 ref|ZP_00370594.1| Predicted DNA repair exonuclease [Campylobacter upsaliens...is RM3195] gb|EAL53370.1| Predicted DNA repair exonuclease [Campylobacter upsaliensis RM3195] ZP_00370594.1 0.047 31% ...

  20. NCBI nr-aa BLAST: CBRC-SARA-01-0488 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0488 ref|YP_064024.1| sulfate permease (SulP) [Desulfotalea psychrophi...la LSv54] emb|CAG35017.1| probable sulfate permease (SulP) [Desulfotalea psychrophila LSv54] YP_064024.1 6.1 37% ...

  1. NCBI nr-aa BLAST: CBRC-SARA-01-0900 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0900 ref|YP_898010.1| phosphatidylserine synthase [Francisella tularen...sis subsp. novicida U112] gb|ABK89256.1| phosphatidylserine synthase [Francisella tularensis subsp. novicida U112] YP_898010.1 3.0 27% ...

  2. NCBI nr-aa BLAST: CBRC-SARA-01-0144 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0144 ref|YP_438659.1| alcohol dehydrogenase, zinc-containing [Burkholderia thailand...ensis E264] gb|ABC35120.1| alcohol dehydrogenase, zinc-containing [Burkholderia thailandensis E264] YP_438659.1 0.69 35% ...

  3. NCBI nr-aa BLAST: CBRC-SARA-01-0472 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0472 sp|Q8NH41|OR4KF_HUMAN Olfactory receptor 4K15 dbj|BAC05798.1| sev...en transmembrane helix receptor [Homo sapiens] gb|EAW66492.1| olfactory receptor, family 4, subfamily K, member 15 [Homo sapiens] Q8NH41 1e-164 89% ...

  4. NCBI nr-aa BLAST: CBRC-SARA-01-1206 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1206 sp|Q8NH41|OR4KF_HUMAN Olfactory receptor 4K15 dbj|BAC05798.1| sev...en transmembrane helix receptor [Homo sapiens] gb|EAW66492.1| olfactory receptor, family 4, subfamily K, member 15 [Homo sapiens] Q8NH41 1e-40 85% ...

  5. NCBI nr-aa BLAST: CBRC-SARA-01-1608 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1608 ref|XP_513201.1| PREDICTED: cannabinoid receptor 2 (macrophage) i...soform 2 [Pan troglodytes] ref|XP_001166334.1| PREDICTED: cannabinoid receptor 2 (macrophage) isoform 1 [Pan troglodytes] XP_513201.1 1e-155 77% ...

  6. Indicators of induced subacute ruminal acidosis (SARA) in Danish Holstein cows

    DEFF Research Database (Denmark)

    Danscher, Anne Mette; Li, Shucong; Andersen, Pia H.

    2015-01-01

    BACKGROUND: The prevalence of subacute ruminal acidosis (SARA) in dairy cows is high with large impact on economy and welfare. Its current field diagnosis is based on point ruminal pH measurements by oral probe or rumenocentesis. These techniques are invasive and inaccurate, and better markers fo...

  7. NCBI nr-aa BLAST: CBRC-SARA-01-1419 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1419 ref|YP_101126.1| hypothetical protein BF3850 [Bacteroides fragili...s YCH46] dbj|BAD50592.1| hypothetical protein [Bacteroides fragilis YCH46] YP_101126.1 5e-09 92% ...

  8. NCBI nr-aa BLAST: CBRC-SARA-01-1309 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1309 ref|YP_001125845.1| hypothetical protein GTNG_1736 [Geobacillus thermoden...itrificans NG80-2] gb|ABO67100.1| Conserved hypothetical protein [Geobacillus thermodenitrificans NG80-2] YP_001125845.1 0.47 23% ...

  9. NCBI nr-aa BLAST: CBRC-SARA-01-0256 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0256 ref|ZP_00739965.1| Integral membrane protein [Bacillus thuringiensis serovar israel...ensis ATCC 35646] gb|EAO55770.1| Integral membrane protein [Bacillus thuringiensis serovar israelensis ATCC 35646] ZP_00739965.1 1.3 24% ...

  10. NCBI nr-aa BLAST: CBRC-SARA-01-1804 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1804 ref|ZP_00743402.1| Sensory box/GGDEF family protein [Bacillus thuringiensis serovar israel...ensis ATCC 35646] gb|EAO52327.1| Sensory box/GGDEF family protein [Bacillus thuringiensis serovar israelensis ATCC 35646] ZP_00743402.1 0.20 36% ...

  11. NCBI nr-aa BLAST: CBRC-SARA-01-0522 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0522 ref|YP_001499570.1| Peptidyl-tRNA hydrolase [Rickettsia massiliae... MTU5] gb|ABV85023.1| Peptidyl-tRNA hydrolase [Rickettsia massiliae MTU5] YP_001499570.1 4.7 36% ...

  12. NCBI nr-aa BLAST: CBRC-SARA-01-1578 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1578 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 1e-146 78% ...

  13. NCBI nr-aa BLAST: CBRC-SARA-01-1099 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1099 ref|YP_001337495.1| hypothetical protein KPN_03841 [Klebsiella pneumoniae subsp. pneumonia...e MGH 78578] gb|ABR79228.1| hypothetical protein KPN_03841 [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] YP_001337495.1 0.93 29% ...

  14. NCBI nr-aa BLAST: CBRC-SARA-01-0489 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0489 ref|ZP_01035526.1| exopolysaccharide biosynthesis domain protein [Rose...ovarius sp. 217] gb|EAQ25691.1| exopolysaccharide biosynthesis domain protein [Roseovarius sp. 217] ZP_01035526.1 1.0 26% ...

  15. Konflik SARA pada Pilkada DKI Jakarta di Grup WhatsApp dengan Anggota Multikultural

    Directory of Open Access Journals (Sweden)

    Tiara Kharisma

    2017-12-01

    Full Text Available Keanekaragaman SARA di Indonesia melahirkan masyarakat multikultural. Dalam kehidupannya, komunikasi antarbudaya tidak dapat dihindarkan. Salah satu medium dalam melakukan komunikasi antarbudaya adalah media sosial. Pada masyarakat multikultural isu SARA menjadi faktor utama penyebab terjadinya konflik. Di Pilkada DKI Jakarta 2017, isu SARA di grup WhatsApp marak menyebar termasuk anggota grup yang heterogen. Penelitian ini bertujuan untuk mengetahui pengelolaan konflik isu SARA pada Pilkada DKI Jakarta 2017 di grup WhatsApp dengan anggota multikultural. Penelitian ini menggunakan pendekatan kualitatif dengan teknik pengumpulan data melalui wawancara dan studi literatur. Dalam membahas penelitian ini, peneliti menggunakan kerangka teori manajemen konflik dari Martin, J. N. dan Nakayama. Hasil penelitian menunjukkan bahwa konflik terjadi karena ada anggota grup menyampaikan pesan bukan berangkat dari kesamaan anggota grup, yakni kepentingan dan tujuan awal dibentuknya grup. Pesan disebarkan dengan menganggap wujud pembelaan terhadap suatu agama. Ketika konflik terjadi, strategi pengelolaan konflik yang diterapkan adalah strategi mengompromikan (compromising dan menghindar (avoiding. Dalam grup terdapat anggota yang berperan sebagai cultural brokers.

  16. NCBI nr-aa BLAST: CBRC-SARA-01-1753 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1753 ref|YP_001476411.1| amino acid permease-associated region [Serratia proteam...aculans 568] gb|ABV39283.1| amino acid permease-associated region [Serratia proteamaculans 568] YP_001476411.1 0.83 35% ...

  17. NCBI nr-aa BLAST: CBRC-SARA-01-0771 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0771 ref|NP_001029253.1| progestin and adipoQ receptor family member V...II [Rattus norvegicus] gb|AAY67652.1| progestin membrane receptor alpha [Rattus norvegicus] NP_001029253.1 1e-167 82% ...

  18. NCBI nr-aa BLAST: CBRC-SARA-01-0771 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0771 ref|NP_001033642.1| progestin and adipoQ receptor family member V...II [Bos taurus] gb|AAI11285.1| Progestin and adipoQ receptor family member VII [Bos taurus] NP_001033642.1 1e-180 87% ...

  19. Predation on Alouatta guariba clamitans Cabrera (Primates, Atelidae by Leopardus pardalis (Linnaeus (Carnivora, Felidae Predação em Alouatta guariba clamitans Cabrera (Primates, Atelidae por Leopardus pordalis (Linnaeus (Carnivora, Felidae

    Directory of Open Access Journals (Sweden)

    João M. D. Miranda

    2005-09-01

    Full Text Available There are a few studies about predation on primates. Howler monkeys, being relatively large animals, were believed to be preyed on successfully only by medium to large-sized carnivores and large birds of prey. Our study took place at Chácara Payquerê, which is situated in the municipality of Balsa Nova, State of Paraná, Southern Brazil. Fingers and nails from Alouatta guariba clamitans Cabrera, 1940 were founded in two faecal samples from Leopardus pardalis (Linnaeus, 1758. With our documentation large howler monkey remains in faeces, the possibility of ocelot being a potential predator of all Neotropical primates should be taken into consideration.São poucos os estudos sobre a predação de primatas. Sendo os bugios animais relativamente grandes, acredita-se que somente médios e grandes carnívoros e grandes rapineiros possam lograr sucesso em sua predação. O estudo foi realizado na Chácara Payquerê, situada no município de Balsa Nova, Estado do Paraná, sul do Brasil. Dedos e unhas de Alouatta guariba clamitans Cabrera, 1940 foram encontradas em duas amostras fecais de Leopardus pardalis (Linnaeus, 1758 que foram coletadas. Com este registro de grande primata em fezes, a possibilidade de a jaguatirica ser um potencial predador de todos os primatas neotropicais pode ser levada em consideração.

  20. Timing of births in sympatric brown howler monkeys (Alouatta fusca clamitans) and northern muriquis (Brachyteles arachnoides hypoxanthus).

    Science.gov (United States)

    Strier, K B; Mendes, S L; Santos, R R

    2001-10-01

    We monitored the birth patterns of sympatric brown howler monkeys (Alouatta fusca clamitans) and northern muriquis (Brachyteles arachnoides hypoxanthus) during a 4-yr period from October 1996 to August 2000 at the Estação Biológica de Caratinga, Minas Gerais, Brazil. Brown howler monkey births (n = 34) occurred throughout the year, and birth frequencies did not differ between rainy and dry season months. The aseasonal birth patterns of the howler monkeys differed significantly from the dry season concentration and dry month peak in muriqui births (n = 23). We found no effects of infant sex or the number of females on interbirth intervals (IBIs) in our 10 howler monkey study troops. IBIs of brown howler monkeys averaged 21.2 +/- 2.5 mo (n = 8, median = 21.0 mo), and were significantly shorter following dry season births than rainy season births. Their IBIs and yearling survivorship (74%) were similar to those reported for other species of howler monkeys, but yearling survivorship was much lower than that of muriquis (94%), whose IBIs were more than 12 mo longer than those of the howler monkeys. Our study extends comparative knowledge of birth patterns in Alouatta to a poorly known species, and provides insights into the different ways in which diet and life history may affect the timing of births in large-bodied platyrrhines under the same seasonal ecological conditions. Copyright 2001 Wiley-Liss, Inc.

  1. Differential distribution of sperm subpopulations and incidence of pleiomorphisms in ejaculates of captive howling monkeys ( Alouatta caraya)

    Science.gov (United States)

    Valle, R. R.; Carvalho, F. M.; Muniz, J. A. P. C.; Leal, C. L. V.; García-Herreros, M.

    2013-10-01

    The aim of this study was to develop an objective method to determine the incidence of pleiomorphisms and its influence on the distribution of sperm morphometric subpopulations in ejaculates of howling monkeys ( Alouatta caraya) by using a combination of computerized analysis system (ASMA) and principal component analysis (PCA) methods. Ejaculates were collected by electroejaculation methods on a regular basis from five individuals maintained under identical captive environmental, nutritional, and management conditions. Each sperm head was measured for dimensional parameters (Area [ A, (square micrometers)], Perimeter [ P, (micrometers)], Length [ L, (micrometers)], and Width [ W, (micrometers)]) and shape-derived parameters (Ellipticity [( L/ W)], Elongation [( L - W)/( L + W)], and Rugosity [(4л A/ P 2)]). PCA revealed two principal components explaining more than the 96 % of the variance. Clustering methods and discriminant analyzes were performed and seven separate subpopulations were identified. There were differences ( P ASMA and PCA is a useful clinical diagnostic resource for detecting deficiencies in sperm morphology and sperm subpopulations in A. caraya ejaculates that could be used in ex situ conservation programs of threatened species in Alouatta genus or even other endangered neotropical primate species.

  2. Molecular characterization of trypanosomatid infections in wild howler monkeys (Alouatta caraya in northeastern Argentina

    Directory of Open Access Journals (Sweden)

    Mariela Florencia Martínez

    2016-08-01

    Full Text Available The transmission of Trypanosoma cruzi by vectors is confined to the Americas, and the infection circulates in at least two broadly defined transmission cycles occurring in domestic and sylvatic habitats. This study sought to detect and characterize infection by T. cruzi and other trypanosomes using PCR strategies in blood samples from free-ranging howler monkeys, Alouatta caraya, in the northeastern Argentina. Blood samples were collected at four sites with variable levels of habitat modification by human activity. PCR was conducted using primers for kinetoplast DNA, satellite DNA and ribosomal DNA of the trypanosomatid parasites. Ribosomal and satellite DNA fragments were sequenced to identify the trypanosomatid species and to characterize the discrete typing units (DTUs of T. cruzi. Overall, 46% (50/109 of the howlers were positive according to the kDNA-PCR assay, but only 7 of the howlers were positive according to the SatDNA-PCR protocol. We sequenced the amplicons of the satellite DNA obtained from five specimens, and the sequences were 99% and 100% similar to T. cruzi. A sequence typical of DTU T. cruzi I was found in one howler monkey from the “remote” site, while sequences compatible with DTUs II, V, and VI were found in howlers from the “remote”, “rural” and “village” sites. We detected 96% positive samples for RibDNA-PCR, 9 of which were sequenced and displayed 99% identity with Trypanosoma minasense, while none showed identity with T. cruzi. The results demonstrated the presence of T. cruzi and a species closely related to T. minasense in blood samples from free-ranging A. caraya, belonging to different T. cruzi DTUs circulating in these howler monkey populations. The results obtained in this study could help evaluate the role of A. caraya as a reservoir of T. cruzi in regions where Chagas disease is hyper-endemic and where the human-wildlife interface is increasing.

  3. Modeling the impacts of hunting on the population dynamics of red howler monkeys (Alouatta seniculus)

    Science.gov (United States)

    Wiederholt, Ruscena; Fernandez-Duque, Eduardo; Diefenbach, Duane R.; Rudran, Rasanayagam

    2010-01-01

    Overexploitation of wildlife populations occurs across the humid tropics and is a significant threat to the long-term survival of large-bodied primates. To investigate the impacts of hunting on primates and ways to mitigate them, we developed a spatially explicit, individual-based model for a landscape that included hunted and un-hunted areas. We used the large-bodied neotropical red howler monkey (Alouatta seniculus) as our case study species because its life history characteristics make it vulnerable to hunting. We modeled the influence of different rates of harvest and proportions of landscape dedicated to un-hunted reserves on population persistence, population size, social dynamics, and hunting yields of red howler monkeys. In most scenarios, the un-hunted populations maintained a constant density regardless of hunting pressure elsewhere, and allowed the overall population to persist. Therefore, the overall population was quite resilient to extinction; only in scenarios without any un-hunted areas did the population go extinct. However, the total and hunted populations did experience large declines over 100 years under moderate and high hunting pressure. In addition, when reserve area decreased, population losses and losses per unit area increased disproportionately. Furthermore, hunting disrupted the social structure of troops. The number of male turnovers and infanticides increased in hunted populations, while birth rates decreased and exacerbated population losses due to hunting. Finally, our results indicated that when more than 55% of the landscape was harvested at high (30%) rates, hunting yields, as measured by kilograms of biomass, were less than those obtained from moderate harvest rates. Additionally, hunting yields, expressed as the number of individuals hunted/year/km2, increased in proximity to un-hunted areas, and suggested that dispersal from un-hunted areas may have contributed to hunting sustainability. These results indicate that un

  4. Transferring generic SARA/OSHA training to US Department of Energy facilities

    International Nuclear Information System (INIS)

    White, A.; McKinley, T.

    1989-01-01

    The Technical Resources and Training Section staff at Oak Ridge National Laboratory have developed three extensive training programs for hazardous waste treatment, storage, and disposal facility workers a required by SARA/OSHA, 29 CFR 1910.120. The ORNL program is widely recognized as one of the best in the DOE system. ORNL and ORAU, who manages the Training Resources and Data Exchange (TRADE) network for DOE, entered into as cooperative relationship to respond to the many requests from DOE contractors for copies of the ORNL training materials. This discussion will describe the ORNL program and the process of turning it into a series of generic tools which can be used by additional DOE facilities to meet the training requirements established by SARA/OSHA, 20 CFR 1910.120. The speakers will describe how the materials are being used by DOE facilities as well as plans for additional resources to be developed through TRADE. 5 refs

  5. SarA is a negative regulator of Staphylococcus epidermidis biofilm formation

    DEFF Research Database (Denmark)

    Martin, Christer; Heinze, C.; Busch, M.

    2012-01-01

    Biofilm formation is essential for Staphylococcus epidermidis pathogenicity in implant-associated infections. Nonetheless, large proportions of invasive S. epidermidis isolates fail to show accumulative biofilm growth in vitro. We here tested the hypothesis that this apparent paradox is related...... virulence. Genetic analysis revealed that inactivation of sarA induced biofilm formation via over-expression of the giant 1 MDa extracellular matrix binding protein (Embp), serving as an intercellular adhesin. In addition to Embp, increased extracellular DNA (eDNA) release significantly contributed...... to biofilm formation in mutant 1585ΔsarA. Increased eDNA amounts indirectly resulted from up-regulation of metalloprotease SepA, leading to boosted processing of major autolysin AtlE, in turn inducing augmented autolysis and release of chromosomal DNA. Hence, this study identifies sarA as a negative...

  6. NCBI nr-aa BLAST: CBRC-SARA-01-0756 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0756 gb|AAW70053.1| MRGX2 [Homo sapiens] gb|AAW70054.1| MRGX2 [Homo sapiens...] gb|AAW70055.1| MRGX2 [Homo sapiens] gb|AAW70070.1| MRGX2 [Homo sapiens] gb|AAW70083.1| MRGX2 [Homo sapiens] AAW70053.1 1e-66 52% ...

  7. NCBI nr-aa BLAST: CBRC-SARA-01-1400 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1400 gb|AAW70053.1| MRGX2 [Homo sapiens] gb|AAW70054.1| MRGX2 [Homo sapiens...] gb|AAW70055.1| MRGX2 [Homo sapiens] gb|AAW70070.1| MRGX2 [Homo sapiens] gb|AAW70083.1| MRGX2 [Homo sapiens] AAW70053.1 4e-34 52% ...

  8. NCBI nr-aa BLAST: CBRC-SARA-01-1746 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1746 ref|NP_653200.2| non-imprinted in Prader-Willi/Angelman syndrome ...1 [Homo sapiens] sp|Q7RTP0|NIPA1_HUMAN Non-imprinted in Prader-Willi/Angelman syndrome region protein 1 tpg|...DAA01477.1| TPA_exp: non-imprinted in Prader-Willi/Angelman syndrome 1 [Homo sapiens] NP_653200.2 1e-113 81% ...

  9. Reading, Laterality, and the Brain: Early Contributions on Reading Disabilities by Sara S. Sparrow

    OpenAIRE

    Fletcher, Jack M.; Morris, Robin D.

    2014-01-01

    Although best known for work with children and adults with intellectual disabilities and autism spectrum disorders, training in speech pathology and a doctorate in clinical psychology and neuropsychology was the foundation for Sara Sparrow’s long-term interest in reading disabilities. Her first papers were on dyslexia and laterality, and the maturational lag theory of developmental dyslexia proposed with Paul Satz, her mentor. The research program that emerged from this work had a wide impact...

  10. NCBI nr-aa BLAST: CBRC-SARA-01-1488 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1488 ref|YP_001474562.1| DNA internalization-related competence protei...n ComEC/Rec2 [Shewanella sediminis HAW-EB3] gb|ABV37434.1| DNA internalization-related competence protein ComEC/Rec2 [Shewanella sediminis HAW-EB3] YP_001474562.1 1.7 33% ...

  11. Identification of Differentially Expressed Proteins in Liver in Response to Subacute Ruminal Acidosis (SARA Induced by High-concentrate Diet

    Directory of Open Access Journals (Sweden)

    X. Y. Jiang

    2014-08-01

    Full Text Available The aim of this study was to evaluate protein expression patterns of liver in response to subacute ruminal acidosis (SARA induced by high-concentrate diet. Sixteen healthy mid-lactating goats were randomly divided into 2 groups and fed either a high-forage (HF diet or a high-concentrate (HC diet. The HC diet was expected to induce SARA. After ensuring the occurrence of SARA, liver samples were collected. Proteome analysis with differential in gel electrophoresis technology revealed that, 15 proteins were significantly modulated in liver in a comparison between HF and HC-fed goats. These proteins were found mainly associated with metabolism and energy transfer after identified by matrix-assisted laser desorption ionization/time of flight. The results indicated that glucose, lipid and protein catabolism could be enhanced when SARA occurred. It prompted that glucose, lipid and amine acid in the liver mainly participated in oxidation and energy supply when SARA occurred, which possibly consumed more precursors involved in milk protein and milk fat synthesis. These results suggest new candidate proteins that may contribute to a better understanding of the mechanisms that mediate liver adaptation to SARA.

  12. SARAS 2 Constraints on Global 21 cm Signals from the Epoch of Reionization

    Science.gov (United States)

    Singh, Saurabh; Subrahmanyan, Ravi; Udaya Shankar, N.; Sathyanarayana Rao, Mayuri; Fialkov, Anastasia; Cohen, Aviad; Barkana, Rennan; Girish, B. S.; Raghunathan, A.; Somashekar, R.; Srivani, K. S.

    2018-05-01

    Spectral distortions in the cosmic microwave background over the 40–200 MHz band are imprinted by neutral hydrogen in the intergalactic medium prior to the end of reionization. This signal, produced in the redshift range z = 6–34 at the rest-frame wavelength of 21 cm, has not been detected yet; and a poor understanding of high-redshift astrophysics results in a large uncertainty in the expected spectrum. The SARAS 2 radiometer was purposely designed to detect the sky-averaged 21 cm signal. The instrument, deployed at the Timbaktu Collective (Southern India) in 2017 April–June, collected 63 hr of science data, which were examined for the presence of the cosmological 21 cm signal. In our previous work, the first-light data from the SARAS 2 radiometer were analyzed with Bayesian likelihood-ratio tests using 264 plausible astrophysical scenarios. In this paper we reexamine the data using an improved analysis based on the frequentist approach and forward-modeling. We show that SARAS 2 data reject 20 models, out of which 15 are rejected at a significance >5σ. All the rejected models share the scenario of inefficient heating of the primordial gas by the first population of X-ray sources, along with rapid reionization. Joint Astronomy Program, Indian Institute of Science, Bangalore 560012, India.

  13. The Remote Observatories of the Southeastern Association for Research in Astronomy (SARA)

    Science.gov (United States)

    Keel, William C.; Oswalt, Terry; Mack, Peter; Henson, Gary; Hillwig, Todd; Batcheldor, Daniel; Berrington, Robert; De Pree, Chris; Hartmann, Dieter; Leake, Martha; Licandro, Javier; Murphy, Brian; Webb, James; Wood, Matt A.

    2017-01-01

    We describe the remote facilities operated by the Southeastern Association for Research in Astronomy (SARA) , a consortium of colleges and universities in the US partnered with Lowell Observatory, the Chilean National Telescope Allocation Committee, and the Instituto de Astrofísica de Canarias. SARA observatories comprise a 0.96 m telescope at Kitt Peak, Arizona; one of 0.6 m aperture on Cerro Tololo, Chile; and the 1 m Jacobus Kapteyn Telescope at the Roque de los Muchachos, La Palma, Spain. All are operated using standard VNC or Radmin protocols communicating with on-site PCs. Remote operation offers considerable flexibility in scheduling, allowing long-term observational cadences difficult to achieve with classical observing at remote facilities, as well as obvious travel savings. Multiple observers at different locations can share a telescope for training, educational use, or collaborative research programs. Each telescope has a CCD system for optical imaging, using thermoelectric cooling to avoid the need for frequent local service, and a second CCD for offset guiding. The Arizona and Chile telescopes also have fiber-fed echelle spectrographs. Switching between imaging and spectroscopy is very rapid, so a night can easily accommodate mixed observing modes. We present some sample observational programs. For the benefit of other groups organizing similar consortia, we describe the operating structure and principles of SARA, as well as some lessons learned from almost 20 years of remote operations.

  14. System Analysis and Risk Assessment System (SARA), Version 4.0

    International Nuclear Information System (INIS)

    Russell, K.D.; Sattison, M.B.; Skinner, N.L.; Stewart, H.D.; Wood, S.T.

    1992-02-01

    This NUREG is the reference manual for the System Analysis and Risk Assessment (SARA) System Version 4.0, a microcomputer-based system used to analyze the safety issues of a family [i.e., a power plant, a manufacturing facility, any facility on which a probabilistic risk assessment (PRA) might be performed]. The SARA data base contains PRA data for the dominant accident sequences of a family and descriptive information about the family including event trees, fault trees, and system model diagrams. The number of facility data bases that can be accessed is limited only by the amount of disk storage available. To simulate changes to family systems, SARA users change the failure rates of initiating and basic events and/or modify the structure of the cut sets that make up the event trees, fault trees, and systems. The user then evaluates the effects of these changes through the recalculation of the resultant accident sequence probabilities and importance measures. The results are displayed in tables and graphs

  15. Reactivity of Athabasca residue and of its SARA fractions during residue hydroconversion

    Energy Technology Data Exchange (ETDEWEB)

    Verstraete, J.; Danial-Fortain, P.; Gauthier, T.; Merdrignac, I. [IFP-Lyon, Vermaison (France); Budzinski, H. [Bordeaux Univ. (France). ISM-LPTC, UMR CNRS

    2009-07-01

    Residue conversion processes are becoming increasingly important because of the declining market for residual fuel oil and a greater demand for middle distillates. Ebullated-bed hydroconversion is a commercially proven technology for converting heavy feedstocks with high amounts of impurities. The process enables the conversion of atmospheric or vacuum residues at temperatures up to 440 degrees C, and at liquid hourly space velocity (LHSV) conditions in the range of 0.15 to 0.5 per hour. A 540 degrees C conversion of up to 80 weight per cent can be achieved under these conditions. This paper reported on a research study conducted at IFP Lyon in which the residue hydroconversion in a large-scale ebullated bed bench unit was investigated to determine the impact of operating conditions and feed properties on yield and product qualities. Hydrogen was added to the feed in the bench units to keep a high hydrogen partial pressure and favour the catalytic hydroconversion reactions. In a typical test, the reactor was fed with 50 g of feedstock and 0.45 g of crushed equilibrium industrial NiMo catalyst, pressurized hydrogen and quickly heated at the reaction temperature. This paper also discussed the conversion of Athabasca bitumen residue in the large-scale pilot plant and also in the small scale batch reactor. The effect of operating temperature and space velocity was examined. The reactivity of the saturates, aromatics, resins and asphaltenes (SARA) fractions of the bitumen was studied separately in order to better understand the conversion mechanisms and reactivities. The Athabasca bitumen feed and SARA fractions were also analyzed in terms of standard petroleum analysis, SARA fractionation, elemental analysis, size exclusion chromatography (SEC) and 13C NMR. Hydroconversion experiments were conducted in the batch unit at different reaction temperatures and reaction times. A comparison of small-scale batch results with those obtained with the continuous large-scale bench

  16. Innovative Stormwater Quality Tools by SARA for Holistic Watershed Master Planning

    Science.gov (United States)

    Thomas, S. M.; Su, Y. C.; Hummel, P. R.

    2016-12-01

    Stormwater management strategies such as Best Management Practices (BMP) and Low-Impact Development (LID) have increasingly gained attention in urban runoff control, becoming vital to holistic watershed master plans. These strategies can help address existing water quality impairments and support regulatory compliance, as well as guide planning and management of future development when substantial population growth and urbanization is projected to occur. However, past efforts have been limited to qualitative planning due to the lack of suitable tools to conduct quantitative assessment. The San Antonio River Authority (SARA), with the assistance of Lockwood, Andrews & Newnam, Inc. (LAN) and AQUA TERRA Consultants (a division of RESPEC), developed comprehensive hydrodynamic and water quality models using the Hydrological Simulation Program-FORTRAN (HSPF) for several urban watersheds in the San Antonio River Basin. These models enabled watershed management to look at water quality issues on a more refined temporal and spatial scale than the limited monitoring data. They also provided a means to locate and quantify potential water quality impairments and evaluate the effects of mitigation measures. To support the models, a suite of software tools were developed. including: 1) SARA Timeseries Utility Tool for managing and processing of large model timeseries files, 2) SARA Load Reduction Tool to determine load reductions needed to achieve screening levels for each modeled constituent on a sub-basin basis, and 3) SARA Enhanced BMP Tool to determine the optimal combination of BMP types and units needed to achieve the required load reductions. Using these SARA models and tools, water quality agencies and stormwater professionals can determine the optimal combinations of BMP/LID to accomplish their goals and save substantial stormwater infrastructure and management costs. The tools can also help regulators and permittees evaluate the feasibility of achieving compliance

  17. Demographic survey of black howler monkey (Alouatta pigra) in the Lachuá Eco-region in Alta Verapaz, Guatemala.

    Science.gov (United States)

    Rosales-Meda, Marleny; Estrada, Alejandro; López, Jorge E

    2008-03-01

    Guatemala harbors three species of primates (Alouatta palliata, Alouatta pigra and Ateles geoffroyi), but the distribution and state of conservation of populations of these species are poorly documented. In the case of A. pigra, populations have been studied recently and documented in several sites in Mexico and Belize, and only in one site in Guatemala (Tikal National Park). In this study, we report first-time population data for A. pigra existing in the Lachuá Eco-region in northwestern Guatemala. Surveys were conducted between September 2002 and April 2003 in the northern portion (32 km2) of the Lachuá National Park (LLNP; 145 km2) and in a fragmented landscape north of the protected area. In this latter area we surveyed a large forest fragment (17.14 km2), "Nueve Cerros", and 26 small forest fragments that ranged in size from 0.01 to 3.9 km2. Surveys resulted in a total count of 414 howler monkeys of which 403 belonged to 80 mixed-sex groups, four were solitary males, two were solitary females and five were found in two male groups. Standardized sampling effort among sites indicated 16.7 monkeys/100 survey hours at LLNP, 35.8 individuals/100 survey hours at "Nueve Cerros" and 71.0+/-62.2 individuals/100 survey hours in the forest fragments. Mean group size varied from 4.07 individuals at LLNP to 5.19 individuals in the forest fragments. Conservation problems for the black howler population surveyed are discussed, along with possible conservation scenarios.

  18. Development of an ion guide coupled to an on-line isotope separation system on Sara. Identification and study of isospin exotic nuclei at Isolde and Sara

    International Nuclear Information System (INIS)

    Bouldjedri, A.

    1992-06-01

    This work is concerned with the study of exotic nuclei located on both sides of the stability-line and known as neutron rich and neutron deficient respectively. For the former, produced by alpha particle-induced fission, an on-line isotope separation with an ion guide (IGISOL) has been developed and submitted to several off-line and on-line optimization tests showing capacity to spectroscopic studies. In the case of neutron deficient nuclei near the magicity Z=82, 182 Tl(3s) has been identified and its decaying modes and those of 183 Tl ground state, studied, using the on-line separator ISOLDE. On the other hand, the β decay of 172,175 Ir produced in 32 S induced reaction is studied using a helium jet system on the SARA accelerator. Existence of isomers is derived from half-lives measurements

  19. Building a Species Conservation Strategy for the brown howler monkey (Alouatta guariba clamitans) in Argentina in the context of yellow fever outbreaks

    OpenAIRE

    Agostini, Ilaria; Holzmann, Ingrid; Di Bitetti, Mario Santiago; Oklander, Luciana Inés; Kowalewski, Martín M.; Beldomenico, Pablo Martín; Goenaga, Silvina; Martinez, Mariela; Moreno, Eduardo S.; Lestani, Eduardo; Desbiez, Arnaud L.J.; Miller, Philip

    2017-01-01

    The brown howler monkey (Alouatta guariba clamitans) is endemic to South America’s Atlantic Forest, with a small population extending into the northern portion of Misiones province in northeastern Argentina. In 2012, the species was classified as Critically Endangered in Argentina due to its highly restricted distribution, low population density and dramatic declines from recent Yellow Fever outbreaks. In March 2013, we organized an international workshop in Misiones to evaluate population st...

  20. NCBI nr-aa BLAST: CBRC-SARA-01-0195 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0195 ref|NP_036916.1| cannabinoid receptor 1 (brain) [Rattus norvegicu...s] sp|P20272|CNR1_RAT Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) emb|CAA39332.1| CB1 cann...abinoid receptor [Rattus norvegicus] gb|AAA99067.1| neuronal cannabinoid receptor gb|EDL98589.1| cann...abinoid receptor 1 (brain) [Rattus norvegicus] prf||1613453A cannabinoid receptor NP_036916.1 0.0 97% ...

  1. Nuclear spectroscopy of exotic nuclei with the SARA/IGISOL facility

    International Nuclear Information System (INIS)

    Beraud, R.; Emsallem, A.; Astier, A.; Duffait, R.; Aerje, J.; Aeystoe, J.; Jauho, P.; Barneoud, D.; Genevey, J.; Gizon, A.

    1995-01-01

    Some recent decay studies of neutron-rich and proton-rich nuclei are presented for nuclear structure investigations far off the valley of stability. The experiments, carried out at SARA, are based either on charged particle-induced fission of 238 U or on HI-induced fusion-evaporation reactions in combination with the IGISOL technique. The basic principle of this latter is recalled together with its advantages and limitations. The spectroscopic results obtained in three different regions of the chart of nuclei are sketched. (authors). 30 refs., 7 figs

  2. NCBI nr-aa BLAST: CBRC-SARA-01-1597 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1597 sp|Q9XT58|ADRB3_SHEEP Beta-3 adrenergic receptor (Beta-3 adrenoce...ptor) (Beta-3 adrenoreceptor) gb|AAG31165.1|AF314202_1 beta 3 adrenergic receptor [Ovis aries] gb|AAG31167.1|AF314204_1 beta 3 adrene...rgic receptor [Ovis aries] gb|ABB71185.1| beta 3 adrenergic reecptor [Ovis aries] Q9XT58 1e-140 75% ...

  3. Sara Wasson and Emily Alder, Gothic Science Fiction 1980-2010

    OpenAIRE

    Beaulé, Sophie

    2014-01-01

    With their collection of essays Gothic Science Fiction 1980-2010, Sara Wasson and Emily Alder illustrate the richness of gothic tropes in contemporary forms, from novels and movies to card games. More than cliché, melodrama, or gore, the “gothick” (to borrow Adam Roberts’s term, xi) allows for the hybridity in contemporary production, especially in science fiction, that the collected articles examine. The book is divided into three parts, “Redefining Genres”, “Biopower and Capital”, and “Gend...

  4. NCBI nr-aa BLAST: CBRC-SARA-01-1750 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1750 gb|ABR53744.1| opsin 1 short-wavelength senstive protein [Daubentonia madagascar...iensis] gb|ABR53745.1| opsin 1 short-wavelength senstive protein [Daubentonia madagascariensi...s] gb|ABR53746.1| opsin 1 short-wavelength senstive protein [Daubentonia madagascariensis] gb|ABR53747.1| op...sin 1 short-wavelength senstive protein [Daubentonia madagascariensis] gb|ABR5374...8.1| opsin 1 short-wavelength senstive protein [Daubentonia madagascariensis] gb|ABR53749.1| opsin 1 short-w

  5. Lepidoptera, Nymphalidae, Heliconiinae, Heliconius sara apseudes (Hübner, 1813: Distribution extension

    Directory of Open Access Journals (Sweden)

    Iserhard, C. A.

    2010-01-01

    Full Text Available This work presents new records and extends the geographic distribution of Heliconius sara apseudes in theAtlantic Forest of the state of Rio Grande do Sul. Five new records were taken along butterfly inventories carried outbetween 2005 and 2010 in distinct phytophysiognomies at Rio Grande do Sul northeast region: Swamp Forest, AtlanticForest stricto sensu and Araucaria Moist Forest. The fact that all registers occurred in well preserved habitats of the AtlanticForest emphasizes the need of conservation of this biome in Rio Grande do Sul.

  6. PLS models for determination of SARA analysis of Colombian vacuum residues and molecular distillation fractions using MIR-ATR

    Directory of Open Access Journals (Sweden)

    Jorge A. Orrego-Ruiz

    2014-06-01

    Full Text Available In this work, prediction models of Saturates, Aromatics, Resins and Asphaltenes fractions (SARA from thirty-seven vacuum residues of representative Colombian crudes and eighteen fractions of molecular distillation process were obtained. Mid-Infrared (MIR Attenuated Total Reflection (ATR spectroscopy in combination with partial least squares (PLS regression analysis was used to estimate accurately SARA analysis in these kind of samples. Calibration coefficients of prediction models were for saturates, aromatics, resins and asphaltenes fractions, 0.99, 0.96, 0.97 and 0.99, respectively. This methodology permits to control the molecular distillation process since small differences in chemical composition can be detected. Total time elapsed to give the SARA analysis per sample is 10 minutes.

  7. The SARA Consortium: Providing Undergraduate Access to a 0.9-m Telescope at Kitt Peak National Observatory

    Science.gov (United States)

    Wood, M. A.

    2003-12-01

    The Southeastern Research for Astronomy (SARA) operates a 0.9-m telescope at Kitt Peak National Observatory (KPNO). The member institutions are Florida Institute of Technology, East Tennessee State University, Florida International University, The University of Georgia at Athens, Valdosta State University, and Clemson University. The NSF awarded the KPNO #1 0.9-m telescope to the SARA Consortium in 1990. We built a new facility and began routine on-site observations in 1995. We began routine remote observations in 1999 using VNC to export the telescope and CCD control screens, and a web-cam in the dome to provide critical visual feedback on the status of the telescope and dome. The mission of the SARA Consortium is to foster astronomical research and education in the Southeastern United States. Although only two of the member institutions have no graduate programs, all six have a strong emphasis on undergraduate research and education. By pooling our resources, we are able to operate a research-grade facility that none of the individual schools could manage by itself, and in the process we can offer our undergraduate students the opportunity to assist in our research projects as well as to complete their own independent research projects using a facility at a premier site. The SARA Consortium also hosts a NSF REU Summer Intern Program in Astronomy, in which we support 11-12 students that work one-on-one with a SARA faculty mentor. Most of these interns are selected from primarily undergraduate institutions, and have not had significant previous research experience. As part of the program, interns and mentors travel to KPNO for a 4-5 night observing run at the telescope. The SARA NSF REU Program is funded through NSF grant AST-0097616.

  8. Inhibition of transforming growth factor-beta1-induced signaling and epithelial-to-mesenchymal transition by the Smad-binding peptide aptamer Trx-SARA.

    Science.gov (United States)

    Zhao, Bryan M; Hoffmann, F Michael

    2006-09-01

    Overexpression of the inhibitory Smad, Smad7, is used frequently to implicate the Smad pathway in cellular responses to transforming growth factor beta (TGF-beta) signaling; however, Smad7 regulates several other proteins, including Cdc42, p38MAPK, and beta-catenin. We report an alternative approach for more specifically disrupting Smad-dependent signaling using a peptide aptamer, Trx-SARA, which comprises a rigid scaffold, the Escherichia coli thioredoxin A protein (Trx), displaying a constrained 56-amino acid Smad-binding motif from the Smad anchor for receptor activation (SARA) protein. Trx-SARA bound specifically to Smad2 and Smad3 and inhibited both TGF-beta-induced reporter gene expression and epithelial-to-mesenchymal transition in NMuMG murine mammary epithelial cells. In contrast to Smad7, Trx-SARA had no effect on the Smad2 or 3 phosphorylation levels induced by TGF-beta1. Trx-SARA was primarily localized to the nucleus and perturbed the normal cytoplasmic localization of Smad2 and 3 to a nuclear localization in the absence of TGF-beta1, consistent with reduced Smad nuclear export. The key mode of action of Trx-SARA was to reduce the level of Smad2 and Smad3 in complex with Smad4 after TGF-beta1 stimulation, a mechanism of action consistent with the preferential binding of SARA to monomeric Smad protein and Trx-SARA-mediated disruption of active Smad complexes.

  9. Sara John: Ethnisierte Arbeit. Eine feministische Perspektive. Marburg: Tectum Wissenschaftsverlag 2009.

    Directory of Open Access Journals (Sweden)

    Grit Grigoleit

    2011-03-01

    Full Text Available Auch bei steigender Erwerbsbeteiligung von Frauen ist der deutsche Arbeitsmarkt von einer weitverbreitenden Chancenungleichheit gekennzeichnet. Die Lebenswirklichkeiten von Migrant/-innen und ihre Einbindung in die vergeschlechtlichten Prozesse am Arbeitsmarkt wurden bislang nicht systematisch erfasst. An diesem Punkt setzt Sara John an, indem sie theoretische Konzeptionen zur Vergeschlechtlichung und zur Ethnisierung auf dem Arbeitsmarkt zusammenführt. In einem multidisziplinären Ansatz werden die zahlreichen Verschränkungen um das Phänomen ‚ethnisierte Arbeit‘ aufgegriffen, die vor dem Hintergrund der Debatte um Deutschland als Einwanderungsland zunehmend an Bedeutung und Brisanz gewinnen.Although women’s labor force participation is rising, the German job market is characterized by a widespread lack of equal opportunities. Thus far, the everyday realities of migrants and their integration into the gendered processes on the job market have not been collected systematically. This is where Sara John begins her study by combining theoretical conceptions about gendering and ethnicizing on the job market. In a multidisciplinary approach, several entanglements surrounding the phenomenon ‘ethnicized labor’ are taken into account. These entanglements keep gaining importance and topicality against the backdrop of Germany as a country of immigration.

  10. Fruit diet of Alouatta guariba and Brachyteles arachnoides in Southeastern Brazil: comparison of fruit type, color, and seed size.

    Science.gov (United States)

    Martins, Milene Moura

    2008-01-01

    Fruit is an important food resource for neotropical primates. In this study I compare the fruit diet of sympatric brown howlers (Alouatta guariba) and southern muriquis (Brachyteles arachnoides). Feeding behavior was studied over 12 months and fruit species consumed were identified and assigned to the categories fruit type, fruit color, and seed size. Observed-fruit feeding records were compared with expected records determined from local availability of the fruit of the tree species. I also determined dietary overlap. Fruit consumption occupied 8 and 12% of the feeding time of A. guariba and B. arachnoides, respectively. Fruit from eight tree species were consumed by the former and fruit from twenty-two species by the latter. Patterns of fruit selection of A. guariba and B. arachnoides varied widely. Although howlers and muriquis converge behaviorally by selecting fruit with common attributes (fleshy/unprotected, violet and brown/black-colored), unlike A. guariba, B. arachnoides fed on immature seeds of fleshy/protected and dry fruit. Large seeds were ingested, and defecated intact, by B. arachnoides only. There was little overlap of fruit diet even within categories that had been selected by both, suggesting that dietary divergence is occurring at the interspecific level. Different resource exploitation probably mediates the coexistence of A. guariba and B. arachnoides in low diversity, semideciduous forests, where the environment imposes narrow limits on primate food choices.

  11. Lianas as a food resource for brown howlers (Alouatta guariba and southern muriquis (Brachyteles arachnoides in a forest fragment

    Directory of Open Access Journals (Sweden)

    M. M. Martins

    2009-01-01

    Full Text Available Lianas as a food resource for brown howlers (Alouatta guariba and southern muriquis (Brachyteles arachnoides in a forest fragment.— Lianas, woody vines, are abundant and diverse in tropical forests, but their relative contribution as a source of food for herbivores has been neglected. I compared feeding rates on lianas and trees of two sympatric primates, A. guariba and B. arachnoides, in Southeastern Brazil. Availability of liana foods was gathered in parallel with primate behavioral data collection. Liana represented 33.9% and 27.3% of food sources for A. guariba and B. arachnoides, respectively. Foods coming from trees, rather than from lianas, were significantly more consumed by B. arachnoides. However, both species took advantage of the continuously renewable and ephemeral food resources provided by liana. Availability of liana flowers correlated positively with A. guariba feeding proportions. The nutritional supply provided by lianas is apparently beneficial, or at least unharmful, but experiments comparing primate choices in forests with different liana abundances will help to shed light on their possible negative effect on communities.

  12. The gut microbiota appears to compensate for seasonal diet variation in the wild black howler monkey (Alouatta pigra).

    Science.gov (United States)

    Amato, Katherine R; Leigh, Steven R; Kent, Angela; Mackie, Roderick I; Yeoman, Carl J; Stumpf, Rebecca M; Wilson, Brenda A; Nelson, Karen E; White, Bryan A; Garber, Paul A

    2015-02-01

    For most mammals, including nonhuman primates, diet composition varies temporally in response to differences in food availability. Because diet influences gut microbiota composition, it is likely that the gut microbiota of wild mammals varies in response to seasonal changes in feeding patterns. Such variation may affect host digestive efficiency and, ultimately, host nutrition. In this study, we investigate the temporal variation in diet and gut microbiota composition and function in two groups (N = 13 individuals) of wild Mexican black howler monkeys (Alouatta pigra) over a 10-month period in Palenque National Park, Mexico. Temporal changes in the relative abundances of individual bacterial taxa were strongly correlated with changes in host diet. For example, the relative abundance of Ruminococcaceae was highest during periods when energy intake was lowest, and the relative abundance of Butyricicoccus was highest when young leaves and unripe fruit accounted for 68 % of the diet. Additionally, the howlers exhibited increased microbial production of energy during periods of reduced energy intake from food sources. Because we observed few changes in howler activity and ranging patterns during the course of our study, we propose that shifts in the composition and activity of the gut microbiota provided additional energy and nutrients to compensate for changes in diet. Energy and nutrient production by the gut microbiota appears to provide an effective buffer against seasonal fluctuations in energy and nutrient intake for these primates and is likely to have a similar function in other mammal species.

  13. Cascading impacts of anthropogenically driven habitat loss: deforestation, flooding, and possible lead poisoning in howler monkeys (Alouatta pigra).

    Science.gov (United States)

    Serio-Silva, Juan Carlos; Olguín, Eugenia J; Garcia-Feria, Luis; Tapia-Fierro, Karla; Chapman, Colin A

    2015-01-01

    To construct informed conservation plans, researchers must go beyond understanding readily apparent threats such as habitat loss and bush-meat hunting. They must predict subtle and cascading effects of anthropogenic environmental modifications. This study considered a potential cascading effect of deforestation on the howler monkeys (Alouatta pigra) of Balancán, Mexico. Deforestation intensifies flooding. Thus, we predicted that increased flooding of the Usumacinta River, which creates large bodies of water that slowly evaporate, would produce increased lead content in the soils and plants, resulting in lead exposure in the howler monkeys. The average lead levels were 18.18 ± 6.76 ppm in the soils and 5.85 ± 4.37 ppm in the plants. However, the average lead content of the hair of 13 captured howler monkeys was 24.12 ± 5.84 ppm. The lead levels in the animals were correlated with 2 of 15 blood traits (lactate dehydrogenase and total bilirubin) previously documented to be associated with exposure to lead. Our research illustrates the urgent need to set reference values indicating when adverse impacts of high environmental lead levels occur, whether anthropogenic or natural, and the need to evaluate possible cascading effects of deforestation on primates.

  14. A Different Curriculum of Preparation for Work: Commentary on Mike Rose, Sara Goldrick-Rab, Kris Gutierrez and Norton Grubb

    Science.gov (United States)

    Worthen, Helena Harlow

    2012-01-01

    The January 2012 issue of "Mind, Culture, and Activity" published the Invited Presidential Address "Rethinking Remedial Education and the Academic-Vocational Divide," given by Mike Rose at the 2011 meeting of the American Educational Research Association in New Orleans, along with responses and commentary by Sara Goldrick-Rab, Kris Gutierrez, and…

  15. Hemolytic disease of the fetus and newborn caused by an antibody to a low-prevalence antigen, anti-SARA.

    Science.gov (United States)

    Towns, Dale; Hannon, Judith; Hendry, Julia; Barnes, Janet; Goldman, Mindy

    2011-09-01

    The first case describing the SARAH (SARA) antigen occurred in 1990, in an Australian blood donor. Hemolytic disease of the fetus and newborn (HDFN) due to anti-SARA has not been previously described. We report a case of HDFN in a multiparous female. The pregnancy was unremarkable except that she was involved in a seemingly minor motor vehicle accident at 25 weeks' gestation. Routine prenatal antibody screening was negative throughout the pregnancy. She presented at 37 weeks' gestation because of decreased fetal movements. Labor was induced and a 2702-g infant male was delivered. The infant's hemoglobin was 49 g/L and the bilirubin was 153 µmol/L. Blood samples from the parents and infant were referred to Canadian Blood Services National Immunohematology Reference Laboratory and subsequently to the Australian Red Cross Red Cell Reference Service. The father's and infant's red blood cells were confirmed to be SARA positive, and the mother's plasma contained anti-SARA. The infant was successfully treated with a double-volume exchange transfusion. This is the first example of HDFN associated with this antibody. © 2011 American Association of Blood Banks.

  16. Should Community College Be Free? Forum. "Education Next" Talks with Sara Goldrick-Rab and Andrew P. Kelly

    Science.gov (United States)

    Goldrick-Rab, Sara; Kelly, Andrew P.

    2016-01-01

    In this article, "Education Next" talks with Sara Goldrick-Rab and Andrew Kelly. President Obama's proposal for tuition-free community college, seems to have laid down a marker for the Democratic Party. Vermont senator Bernie Sanders is touting his plan for free four-year public college on the primary trail; Massachusetts senator…

  17. NCBI nr-aa BLAST: CBRC-SARA-01-1608 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1608 ref|NP_001832.1| cannabinoid receptor 2 (macrophage) [Homo sapien...s] sp|P34972|CNR2_HUMAN Cannabinoid receptor 2 (CB2) (CB-2) (CX5) emb|CAA52376.1| CB2 (peripheral) cannabino...id receptor [Homo sapiens] emb|CAD22548.1| peripheral cannabinoid receptor CB2 [Homo sapiens] emb|CAD22549.1| peripheral cann...abinoid receptor CB2 [Homo sapiens] gb|AAO92299.1| cannabinoid r...eceptor 2 [Homo sapiens] emb|CAI14799.1| cannabinoid receptor 2 (macrophage) [Homo sapiens] emb|CAJ42137.1| cann

  18. NCBI nr-aa BLAST: CBRC-SARA-01-0948 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-0948 ref|NP_473371.1| MAS-related GPR, member X2 [Homo sapiens] sp|Q96...LB1|MRGX2_HUMAN Mas-related G-protein coupled receptor member X2 gb|AAK91805.1| G protein-coupled receptor [Homo sapiens...] dbj|BAB89339.1| putative G-protein coupled receptor [Homo sapiens] dbj|BAC06030.1| seven trans...membrane helix receptor [Homo sapiens] gb|AAH63450.1| MAS-related GPR, member X2 [Homo sapiens...] gb|AAW70056.1| MRGX2 [Homo sapiens] gb|AAW70057.1| MRGX2 [Homo sapiens] gb|AAW70058.1| MRGX2 [Homo sapiens

  19. NCBI nr-aa BLAST: CBRC-SARA-01-1066 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1066 ref|NP_473371.1| MAS-related GPR, member X2 [Homo sapiens] sp|Q96...LB1|MRGX2_HUMAN Mas-related G-protein coupled receptor member X2 gb|AAK91805.1| G protein-coupled receptor [Homo sapiens...] dbj|BAB89339.1| putative G-protein coupled receptor [Homo sapiens] dbj|BAC06030.1| seven trans...membrane helix receptor [Homo sapiens] gb|AAH63450.1| MAS-related GPR, member X2 [Homo sapiens...] gb|AAW70056.1| MRGX2 [Homo sapiens] gb|AAW70057.1| MRGX2 [Homo sapiens] gb|AAW70058.1| MRGX2 [Homo sapiens

  20. NCBI nr-aa BLAST: CBRC-SARA-01-1746 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1746 ref|NP_705806.1| non-imprinted in Prader-Willi/Angelman syndrome ...1 [Mus musculus] sp|Q8BHK1|NIPA1_MOUSE Non-imprinted in Prader-Willi/Angelman syndrome region protein 1 homo...protein product [Mus musculus] gb|AAH55828.1| Non imprinted in Prader-Willi/Angel...man syndrome 1 homolog (human) [Mus musculus] gb|EDL21870.1| non imprinted in Prader-Willi/Angelman syndrome 1 homolog (human) [Mus musculus] NP_705806.1 1e-113 81% ... ...log gb|AAM34534.1| non-imprinted in Prader-Willi/Angelman syndrome 1 [Mus musculus] dbj|BAC32809.1| unnamed

  1. NCBI nr-aa BLAST: CBRC-SARA-01-1942 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1942 ref|NP_000669.1| alpha-1D-adrenergic receptor [Homo sapiens] sp|P...25100|ADA1D_HUMAN Alpha-1D adrenergic receptor (Alpha 1D-adrenoceptor) (Alpha 1D-adrenoreceptor) (Alpha-1A adrenergic... receptor) (Alpha adrenergic receptor 1a) gb|AAB60351.1| adrenergic alpha-1a receptor protein gb|AAB59487.1| alpha 1a/d adre...nergic receptor dbj|BAA06222.1| alpha1A/D adrenergic rec...eptor [Homo sapiens] emb|CAH70478.1| adrenergic, alpha-1D-, receptor [Homo sapiens] emb|CAC00601.2| adrenergic

  2. NCBI nr-aa BLAST: CBRC-SARA-01-1691 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1691 ref|NP_000854.1| 5-hydroxytryptamine (serotonin) receptor 1B [Hom...o sapiens] ref|NP_001009102.1| 5-hydroxytryptamine (serotonin) receptor 1B [Pan troglodytes] sp|P28222|5HT1B...HT-1B) (Serotonin receptor 1B) (5-HT1B) gb|AAA58675.1| serotonin 1Db receptor gb|AAA36029.1| serotonin recep...tor gb|AAA36030.1| 5-hyroxytryptamine 1D receptor dbj|BAA01763.1| serotonin 1B receptor [Homo sapiens] gb|AAA60316.1| serotonin... 1D receptor emb|CAB51537.1| 5-hydroxytryptamine (serotonin) r

  3. Escribiendo el silencio: la contemplación poética de Sara Pujol

    Directory of Open Access Journals (Sweden)

    Gala, Candelas

    2005-06-01

    Full Text Available Reading Sara Pujol Russell's El fuego tiende su aire (1999 and Intacto asombro de la luz del silencio (2001, is entering into a poetic world whose content and form are both innovative and complex. This poetry invites the reader into a state of meditative contemplation that seeks correspondences among different elements in reality as the key to access a superior type of knowledge. Pujol's writing moves in the fringes between voice and silence, art and nature, meaning and nothingness, identity and difference, it seeks to surpass its own verbal texture while only in that texture does it find articulation and only through it does transcendence becones accessible. The focus of the present reading centers on the point where Pujol's language seeks to transcend the disjunction between sign and surrounding, the point where synthesis is fusion about to dissolve.La lectura de El fuego tiende su aire (1999 e Intacto asombro en la luz del silencio (2001 de Sara Pujol Russell, supone la entrada en un discurso poético innovador y complejo tanto en contenido como en forma. Esta poesía invita a una contemplación meditativa que busca las correspondencias entre los diversos elementos de la realidad como clave para acceder a un conocimiento superior. Su escritura se mueve en los bordes entre la voz y el silencio, el arte y la naturaleza, el sentido y el vacío, la identidad y la diferencia, buscando trascender lo que está más allá de su misma urdimbre verbal pero que sólo en ella se configura, y sólo desde ella se puede acceder. En el movimiento de esta escritura por superar la disyunción entre signo y entorno, en esa síntesis a punto de disolverse, es donde se enfoca la lectura en este ensayo.

  4. Ecologia e comportamento de Alouatta guariba clamitans Cabrera, 1940, em um fragmento de mata de araucária na serra gaúcha

    OpenAIRE

    Guzzo, Guilherme Brambatti

    2009-01-01

    Alterações na disponibilidade de itens alimentares e variações na temperatura ambiente geralmente induzem mudanças no padrão de atividades dos animais e em seus comportamentos posturais e de seleção de micro-hábitat. O presente trabalho avaliou a ecologia e o comportamento de um grupo composto por seis bugios-ruivos, Alouatta guariba clamitans, habitante de um fragmento de mata de araucária de 2,2 ha na serra gaúcha, para verificar se mudanças na dieta e na temperatura do ambiente influenciar...

  5. Black howler monkey (Alouatta pigra) activity, foraging and seed dispersal patterns in shaded cocoa plantations versus rainforest in southern Mexico.

    Science.gov (United States)

    Zárate, Diego A; Andresen, Ellen; Estrada, Alejandro; Serio-Silva, Juan Carlos

    2014-09-01

    Recent evidence has shown that primates worldwide use agroecosystems as temporary or permanent habitats. Detailed information on how these primates are using these systems is scant, and yet their role as seed dispersers is often implied. The main objective of this study was to compare the activity, foraging patterns and seed dispersal role of black howler monkeys (Alouatta pigra) inhabiting shaded cocoa plantations and rainforest in southern Chiapas, Mexico. We gathered data on three monkey groups living in shaded cocoa plantations and three groups living in rainforest, using focal sampling, and collecting fecal samples. General activity and foraging patterns were similar in both habitats, with the exception that monkeys in the cocoa habitat spent more time feeding on petioles. Monkeys in shaded cocoa plantations dispersed 51,369 seeds (4% were seeds ≥3 mm width) of 16 plant species. Monkeys in the rainforest dispersed 6,536 seeds (78% were seeds ≥3 mm width) of 13 plant species. Our data suggest that the difference between habitats in the proportion of large versus small seeds dispersed reflects differences in fruit species abundance and availability in cocoa versus forest. Mean seed dispersal distances were statistically similar in both habitats (cocoa = 149 m, forest = 86 m). We conclude that the studied cocoa plantations provide all elements necessary to constitute a long-term permanent habitat for black howler monkeys. In turn, howler monkeys living in these plantations are able to maintain their functional role as seed dispersers for those native tree and liana species present within their areas of activities. © 2014 Wiley Periodicals, Inc.

  6. A demographic history of a population of howler monkeys (Alouatta palliata living in a fragmented landscape in Mexico

    Directory of Open Access Journals (Sweden)

    Jurgi Cristóbal Azkarate

    2017-08-01

    Full Text Available Long-term field studies are critical for our understanding of animal life history and the processes driving changes in demography. Here, we present long-term demographic data for the northernmost population of mantled howler monkeys (Alouatta palliata residing in a highly anthropogenically fragmented landscape in Los Tuxtlas, Mexico. We carried out 454 monthly group visits to 10 groups of mantled howler monkeys between 2000 and 2011. The population remained relatively stable over the 11-year study period, with an overall increase in the total number of individuals. Birth rates and inter-birth intervals were comparable to those of howler monkeys at non-fragmented sites, suggesting that living in a fragmented landscape did not affect the reproductive output of our study population. Moreover, despite the landscape, dispersal events were commonplace, including many secondary dispersals (individuals emigrating from groups that they had previously immigrated into. Finally, we found a marked effect of seasonality on the dynamics of our study population. In particular, the period of lowest temperatures and resource scarcity between November and March was associated with higher mortality and reproductive inhibition, while the period of resource abundance between April and May was associated with the majority of conceptions and weaning of offspring. This, in turn, could be influencing dispersal patterns in our study area, as male howler monkeys seem to time some of their immigrations into new groups to coincide with the start of the period of higher fertility, while females preferentially joined new groups several months before the onset of this period. These data have important implications for the conservation and management of howler monkeys in fragmented landscapes, as well as for our understanding of the effect of seasonality over howler monkey dispersal, reproduction and survival.

  7. Differences in diet and activity pattern between two groups of Alouatta palliata associated with the availability of big trees and fruit of top food taxa.

    Science.gov (United States)

    Dunn, Jacob C; Cristóbal-Azkarate, Jurgi; Veà, Joaquím J

    2009-08-01

    The threat that forest fragmentation and habitat loss presents for several Alouatta taxa requires us to determine the key elements that may promote the persistence of howler monkeys in forest fragments and to evaluate how changes in the availability of these elements may affect their future conservation prospects. In this study we analyzed the relationship between the availability of both big trees of top food taxa (BTTFT) (diameter at breast height>60) and fruit of top food taxa (FrTFT) in the home ranges of two groups of Alouatta palliata mexicana occupying different forest fragments in Los Tuxtlas, Mexico, and their diet and activity pattern. Both study groups preferred big trees for feeding and the group with lower availability of BTTFT in their home range fed from more, smaller food sources. Furthermore, both study groups also increased the number of food sources when their consumption of fruit decreased, and the group with lower availability of FrTFT in their home range fed from more food sources. The increase in the number of food sources used under such conditions, in turn, set up a process of higher foraging effort and lower rest. In summary, our results support other studies that suggest that the availability of big trees and fruit may be two important elements influencing the persistence of howler monkeys in forest fragments.

  8. Pinworm diversity in free-ranging howler monkeys (Alouatta spp.) in Mexico: Morphological and molecular evidence for two new Trypanoxyuris species (Nematoda: Oxyuridae).

    Science.gov (United States)

    Solórzano-García, Brenda; Nadler, Steven A; Pérez-Ponce de León, Gerardo

    2016-10-01

    Two new species of Trypanoxyuris are described from the intestine of free-ranging howler monkeys in Mexico, Trypanoxyuris multilabiatus n. sp. from the mantled howler Alouatta palliata, and Trypanoxyuris pigrae n. sp. from the black howler Alouatta pigra. An integrative taxonomic approach is followed, where conspicuous morphological traits and phylogenetic trees based on DNA sequences are used to test the validity of the two new species. The mitochondrial cytochrome oxidase subunit 1 gene, and the nuclear ribosomal 18S and 28S rRNA genes were used for evolutionary analyses, with the concatenated dataset of all three genes used for maximum likelihood and Bayesian phylogenetic analyses. The two new species of pinworms from howler monkeys were morphologically distinct and formed reciprocally monophyletic lineages in molecular phylogenetic trees. The three species from howler monkeys, T. multilabiatus n. sp., T. pigrae n. sp., and Trypanoxyuris minutus, formed a monophyletic group with high bootstrap and posterior probability support values. Phylogenetic patterns inferred from sequence data support the hypothesis of a close evolutionary association between these primate hosts and their pinworm parasites. The results suggest that the diversity of pinworm parasites from Neotropical primates might be underestimated. Copyright © 2016 Elsevier Ireland Ltd. All rights reserved.

  9. Intravenous immunoglobulin in the management of a rare cause of hemolytic disease of the newborn: Anti-SARA antibodies.

    Science.gov (United States)

    Venkataraman, Rohini; Yusuf, Kamran

    2017-01-01

    Hemolytic disease of newborn (HDN) is a condition that develops in a fetus, when the IgG molecules produced by the mother pass through the placenta and attack the fetal red blood cells. HDN can occur due to Rh and ABO incompatibilities between the mother and the fetus as well as due to other allo-immune antibodies belonging to Kell (K and k), Duffy (Fya), Kidd (Jka and Jkb), and MNS (M, N, S, and s) systems. Role of intravenous immunoglobulin in management of HDN is not clear.SARA red blood cell antigen, first discovered in 1990 is a low frequency antigen. We report, a multiparous female whose pregnancy was complicated by HDN due to anti-SARA antibodies requiring both exchange transfusion and intravenous immunoglobulin. The response was sustained after intravenous immunoglobulin (IVIG) rather than after exchange transfusion.

  10. Saras Cranes in Palwal District in Southern Haryana are Asking for Immediate Attention for Their Last Rescue Effort

    Directory of Open Access Journals (Sweden)

    Tirshem Kumar Kaushik

    2015-05-01

    Full Text Available Saras Cranes Grus antigone are endangered birds of open wetlands with highly worrying depletion trends being witnessed related with disappearance of marshy and shallow perennial, expansive wetlands throughout northern India. Alongside, massive hunting in 18th, 19th and 20th centuries and even today is another serious cause for their worrisome deterioration. Also, destruction of nests, eggs, fledglings and adults by aboriginals indeliberately or deliberately is causing these cranes to perish sooner than latter, completely. Now, Saras Cranes are found in limited number and domain as four populations in the entire world including India, China, Burma, South East Asia and northern Australia. The population of Indian Saras Crane is pitiably restricted to Etawa and Mainpuri districts of Uttar Pradesh. Stray birds of this species are restricted to Kanha National Park in Madhya Pradesh and in some parts of Gujarat and Assam. It is interesting to note that few pairs have been seen in Faridabad and Palwal districts in southern Haryana, India. These need to be protected and conserved.

  11. Changes in Microbiota in Rumen Digesta and Feces Due to a Grain-Based Subacute Ruminal Acidosis (SARA) Challenge

    DEFF Research Database (Denmark)

    Plaizier, Jan C.; Li, Shucong; Danscher, Anne Mette

    2017-01-01

    The effects of a grain-based subacute ruminal acidosis (SARA) challenge on bacteria in the rumen and feces of lactating dairy cows were determined. Six lactating, rumen-cannulated Danish Holstein cows were used in a cross-over study with two periods. Periods included two cows on a control diet...... and two cows on a SARA challenge. The control diet was a total mixed ration containing 45.5% dry matter (DM), 43.8% DM neutral detergent fiber, and 19.6% DM starch. The SARA challenge was conducted by gradually substituting the control diet with pellets containing 50% wheat and 50% barley over 3 days...... to reach a diet containing 55.6% DM, 31.3% DM neutral detergent fiber, and 31.8% DM starch, which was fed for four more days. Rumen fluid samples were collected at day 7 and 10 of experimental periods. Feces samples were collected on days 8 and 10 of these periods. Extracted DNA from the rumen and feces...

  12. TRADE instructional materials for SARA/OSHA training. Volume 2, Managers and supervisors training

    Energy Technology Data Exchange (ETDEWEB)

    1989-03-01

    This document provides instructional materials for an eight-hour training course for managers and supervisors of hazardous waste sites. It is one of three volumes of course materials TRADE is preparing to help DOE contractor training staff comply with 29 CFR 1910.120, the Occupational Health and Safety Administration (OSHA) rule that implements Title I of the Superfund Amendments and Reauthorization Act (SARA) of 1986. OSHA`s final rule for hazardous waste operators was published in the Federal Register of March 6, 1989 (54 FR 9294). Combined with the materials in Volumes I and III and with appropriate site-specific information, these materials will help DOE contractors to meet the requirements of 1910.120 (e) that ``on-site management and supervisors directly responsible for, or who supervise employees engaged in, hazardous waste operations`` receive the same initial training as that of the employees they supervise and at least eight additional hours of specialized training in managing hazardous waste operations.

  13. Nuclear spectroscopy of exotic nuclei with the Sara/Igisol facility

    International Nuclear Information System (INIS)

    Beraud, R.; Emsallem, A.; Astier, A.; Duffait, R.; Le Coz, Y.; Redon, N.; Barneoud, D.; Genevey, J.; Gizon, A.

    1994-11-01

    The authors review their recent studies on alpha and beta decay of exotic nuclei performed with the on-line mass separator at the Igisol/Sara facility in Grenoble. The experiments using charged particle induced fission have given new information on production cross section and properties of n-rich nuclei with A=110-130 whereas by means of heavy ion induced fusion evaporation reactions the authors have investigated two regions close to the proton drip line around A=180 and A=130. This paper gives first a brief description of the Igisol technique and shows its application in case of two different production modes: charged particle-induced fission and heavy ion -induced fusion-evaporation reactions. The systematic study of the low-lying levels in n-rich Ru isotopes has allowed to show an axial symmetry breaking, whereas complementary investigations are necessary to clarify the case of 180 Tl decay. A number of new spectroscopic data such as new isotopes identification have been gained in the region of light rare earth nuclei. (N.T.)

  14. Instructional materials for SARA/OSHA training. Volume 1, General site working training

    Energy Technology Data Exchange (ETDEWEB)

    Copenhaver, E.D.; White, D.A.; Wells, S.M. [Oak Ridge National Lab., TN (United States)

    1988-04-01

    This proposed 24 hour ORNL SARA/OSHA training curriculum emphasizes health and safety concerns in hazardous waste operations as well as methods of worker protection. Consistent with guidelines for hazardous waste site activities developed jointly by National Institute for Occupational Safety and Health, Occupational Safety and Health Administration, US Coast Guard, and the Envirorunental Protection Agency, the program material will address Basic Training for General Site Workers to include: ORNL Site Safety Documentation, Safe Work Practices, Nature of Anticipated Hazards, Handling Emergencies and Self-Rescue, Employee Rights and Responsibilities, Demonstration of Use, Care, and Limitations of Personal Protective, Clothing and Equipment, and Demonstration of Monitoring Equipment and Sampling Techniques. The basic training courses includes major fundamentals of industrial hygiene presented to the workers in a format that encourages them to assume responsibility for their own safety and health protection. Basic course development has focused on the special needs of ORNL facilities. Because ORNL generates chemical wastes, radioactive wastes, and mixed wastes, we have added significant modules on radiation protection in general, as well as modules on radiation toxicology and on radiation protective clothing and equipment.

  15. La difesa della donna ebrea: Sara Copio Sullam e Debora Ascarelli

    Directory of Open Access Journals (Sweden)

    Umberto Fortis

    2014-04-01

    Full Text Available Sara Copio Sullam and Debora Ascarelli, the best-known Jewish women poets of the age of the Italian ghetto, have often been studied with a focus on the distinctive features of their writing: the former as a translator of sacred texts, the latter as the author of original verses, sometimes written as a risposta per le rime (reply through rhymes or in defence of her orthodoxy. They share, however, a common theme, which has often been neglected: the defence of the Jewish woman, which is overt in some of Copio’s sonnets and prose, whereas it has not yet been properly pointed out in some of Ascarelli’s verses. This paper aims at bringing this theme to the fore not only in Copio, through a rereading of some passages of her Manifesto, but also in Debora Ascarelli, through an analysis of her few original verses. These hendecasyllables certainly reflect the Petrarchan and classicistic atmosphere of the late 16th century in Rome, but they are far from the mainstream modes of women’s poetry of the age. They allow us, therefore, to highlight, besides the differences, the similarities between the two poetesses; their commitment, in the late 16th and early 17th century, to the intellectual and moral defence of the Jewish woman, in a context of general depreciation of women, but also in the background of the claim to the “nobility and excellence of women”.

  16. Reading Sara Pujol Russell’s Poetry of Contemplation and Connection

    Directory of Open Access Journals (Sweden)

    Anita M. Hart

    2012-06-01

    Full Text Available Sara Pujol Russell’s poetry captures a process of expanding consciousness and personal renewal. Through contemplation and attention to nature, the poet-speaker in her works generates a sense of connection that moves her beyond daily concerns. Pujol’s poetry is both metaphysical and also different in that it resists easy classification and is not representative of mainstream trends. This essay approaches the distinctiveness of Pujol’s work by studying selected poems from her third book of poetry in Spanish, Para decir sí a la carencia, sí a la naranja, al azafrán en el pan (2004 ‘To Say Yes to Lack, Yes to the Orange, to the Saffron in the Bread.’ Incorporating philosopher María Zambrano’s thoughts on contemplation, it shows Pujol’s poet-speaker establishing a connection with nature and spirit, experiencing a heightened consciousness, and searching for expression. The poetic language is characterized by vision, intimacy, enigma, and contradiction. In its subjective, intuitive way, Pujol’s work reveals the poet-speaker’s winding path of discovery and challenges the reader to look closely inside and outside in engaging life’s mysteries.

  17. SAPHIRE technical reference manual: IRRAS/SARA Version 4.0

    International Nuclear Information System (INIS)

    Russell, K.D.; Atwood, C.L.; Sattison, M.B.; Rasmuson, D.M.

    1993-01-01

    This report provides information on the principles used in the construction and operation of Version 4.0 of the Integrated Reliability and Risk Analysis System (IRRAS) and the System Analysis and Risk Assessment (SARA) system. It summarizes the fundamental mathematical concepts of sets and logic, fault trees, and probability. The report then describes the algorithms that these programs use to construct a fault tree and to obtain the minimal cut sets. It gives the formulas used to obtain the probability of the top event from the minimal cut sets, and the formulas for probabilities that are appropriate under various assumptions concerning repairability and mission time. It defines the measures of basic event importance that these programs can calculate. The report gives an overview of uncertainty analysis using simple Monte Carlo sampling or Latin Hypercube sampling, and states the algorithms used by these programs to generate random basic event probabilities from various distributions. Further references are given, and a detailed example of the reduction and quantification of a simple fault tree is provided in an appendix

  18. Comparison of the diet of Alouatta caraya (Primates: Atelidae between a riparian island and mainland on the Upper Parana River, southern Brazil Comparação da dieta de Alouatta caraya (Primates: Atelidae em mata ciliar insular e continental na região do Alto rio Paraná, Sul do Brasil

    Directory of Open Access Journals (Sweden)

    Gabriela Ludwig

    2008-09-01

    Full Text Available Howler monkeys (Alouatta Lacèpéde, 1799 are folivores-frugivores with flexible diets depending on conditions. Here, we compare the diets of Alouatta caraya (Humboldt, 1812 in two riparian forests (island and mainland, in Porto Rico region, Upper Paraná River, Southern Brazil. Howlers were followed from October 2004 to September 2005 in the riparian forest of a 1,050 ha island and in the continuous riparian forest on the mainland (left bank of the river. The "scan sampling" method with instantaneous samples every 15 minutes was used. Besides vines, diet breadth was similar: 17 species consumed on the island versus 16 species on the mainland. Both consumed leaves followed by fruits more than any other food type (leaves: island - 65%, mainland - 49%, fruits: island - 24%, mainland - 46%. Even though the plant Cecropia pachystachya Trécul is less abundant in the mainland it was the item most consumed in both locations all year long, which suggests its importance for the howlers. Diet also varied both seasonally and between the island and mainland, apparently following changes in local abundance of each item and due to plant phenologies.Os bugios (Alouatta Lacèpéde, 1799 são primatas folívoros-frugívoros que podem adaptar suas dietas dependendo das condições do ambiente. O presente trabalho compara a dieta de grupos de Alouatta caraya (Humboldt, 1812 presentes em matas ciliares estruturalmente diferentes (ilha e continente, na região de Porto Rico, Alto rio Paraná, sul do Brasil. Os bugios-pretos foram seguidos de outubro de 2004 a setembro de 2005 em mata ciliar de uma ilha fluvial de 1050 ha e em mata ciliar contínua da margem esquerda do rio. Foi utilizado o método "scan sampling" em amostragens instantâneas com intervalos de 15 minutos. Além das lianas, 17 espécies foram consumidas na ilha versus 16 espécies no continente. Ambos os grupos consumiram mais folhas seguido de frutos do que qualquer outro tipo de alimento (folhas

  19. SEROLOGICAL DETECTION OF HEPATITIS A VIRUS IN FREE-RANGING NEOTROPICAL PRIMATES (Sapajus spp., Alouatta caraya) FROM THE PARANÁ RIVER BASIN, BRAZIL.

    Science.gov (United States)

    Svoboda, Walfrido Kühl; Soares, Manoel do Carmo Pereira; Alves, Max Moreira; Rocha, Tatiana Carneiro; Gomes, Eliane Carneiro; Menoncin, Fabiana; Batista, Paulo Mira; Silva, Lineu Roberto da; Headley, Selwyn Arlington; Hilst, Carmen Lúcia Scortecci; Aguiar, Lucas M; Ludwig, Gabriela; Passos, Fernando de Camargo; Souza, Júlio Cesar de; Navarro, Italmar Teodorico

    2016-01-01

    Nonhuman primates are considered as the natural hosts of Hepatitis A virus (HAV), as well as other pathogens, and can serve as natural sentinels to investigate epizootics and endemic diseases that are of public health importance. During this study, blood samples were collected from 112 Neotropical primates (NTPs) (Sapajus nigritus and S. cay, n = 75; Alouatta caraya, n = 37) trap-captured at the Paraná River basin, Brazil, located between the States of Paraná and Mato Grosso do Sul. Anti-HAV IgG antibodies were detected in 4.5% (5/112) of NTPs, specifically in 6.7% (5/75) of Sapajus spp. and 0% (0/37) of A. caraya. In addition, all samples were negative for the presence of IgM anti-HAV antibodies. These results suggest that free-ranging NTPs were exposed to HAV within the geographical regions evaluated.

  20. Tentativa de infanticídio por um macho dominante de Alouatta caraya (Humboldt (Primates, Atelidae em um infante extra-grupo devido a influência do observador Infanticide attempt by a dominant male of Alouatta caraya (Humboldt (Primates, Atelidae against an extra-group infant due to the influence of the observer

    Directory of Open Access Journals (Sweden)

    Lucas M. Aguiar

    2005-12-01

    Full Text Available Este trabalho relata um caso de tentativa de infanticídio por um macho residente e dominante de um grupo de Alouatta caraya (Humboldt, 1812 em um infante extra-grupo, em ilha do rio Paraná, Paraná, Brasil. O encontro do par fêmea-infante com o macho residente foi propiciado pela interferência humana. Devido às circunstâncias em que ocorreu o fato e a posição hierárquica do agressor, a hipótese de patologia social pareceu plausível na explicação do comportamento.This work reports on an infanticide attempt by a dominant resident male in a group of Alouatta caraya (Humboldt, 1812 on an extra-group infant in an Island in the Paraná river, Paraná, Brazil. The encounter of an infant-female pair with a resident male was brought about by human interference. Give the circumstances in which the event ocurred and the hierarchical position of the agressor, the social pathology hypothesis seems the most plausible explanation for such behavior.

  1. Women Empowerment in the Realms of Institutionalized Religion and Patriarchy: El Saadawi’s Firdaus and Yezierska’s Sara as Examples

    Directory of Open Access Journals (Sweden)

    Abdullah K. Shehabat

    2016-09-01

    Full Text Available This paper explains how the two protagonists, Firdaus and Sara, successfully paved their own ways in search of self-liberation despite the authoritarian patriarchy and institutionalized religions that plagued them. El Saadawi's Woman at Point Zero and Yezierska’s Bread Givers represent the fruitful struggle these protagonists experienced as they come to forge an identity and be themselves. The paper argues that the protagonists manage to free themselves, establish their own spiritual homes at their own homes and assert the potentials of their femininity despite their endings. Empowered by the powers of reading, strong will and meticulous work, the protagonists were able to realize their own material independence and achieve their lifelong ambitions. However, through Firdaus' and Sara's journeys of breaking their silence, they were subject to different patterns of self-annihilation. While Firdaus was sentenced to death for killing a pimp, Sara embraced living under the hegemony of an authoritarian husband.

  2. Systems Analysis Programs for Hands-on Integrated Reliability Evaluations (SAPHIRE), Version 5.0. Volume 5, Systems Analysis and Risk Assessment (SARA) tutorial manual

    International Nuclear Information System (INIS)

    Sattison, M.B.; Russell, K.D.; Skinner, N.L.

    1994-07-01

    The Systems Analysis Programs for Hands-on Integrated Reliability Evaluations (SAPHIRE) refers to a set of several microcomputer programs that were developed to create and analyze probabilistic risk assessments (PRAs) primarily for nuclear power plants. This volume is the tutorial manual for the Systems Analysis and Risk Assessment (SARA) System Version 5.0, a microcomputer-based system used to analyze the safety issues of a open-quotes familyclose quotes [i.e., a power plant, a manufacturing facility, any facility on which a probabilistic risk assessment (PRA) might be performed]. A series of lessons is provided that guides the user through some basic steps common to most analyses performed with SARA. The example problems presented in the lessons build on one another, and in combination, lead the user through all aspects of SARA sensitivity analysis capabilities

  3. SARA South Observations and Analysis of the Solar Type, Totally Eclipsing, Over Contact Binary, PY Aquarii

    Science.gov (United States)

    Chamberlain, Heather; Samec, Ronald G.; Caton, Daniel Bruce; Van Hamme, Walter

    2018-01-01

    PY Aqr (GSC 05191-00853) is a solar Type (T ~ 5750K) eclipsing binary. It was observed in July to October, 2017 at Cerro Tololo in remote mode with the 0.6-m SARA South reflector. Two times of minimum light were calculated from our present observations, a primary and a secondary eclipse:HJD Min I = 2457951.7762±0.0006 HJD Min II = 2458019.5295±00.0003. Both weighted as 1.0.In addition, four timings were determined from online data given in IBVS 5600 and five observations at minima were determined from archived All Sky Automated Survey Data:HJD Min I = 2452908.3165, 2452912.33612 HJD Min II = 2452877.5621, 2452913.34465. All weighted as 0.5.ASAS Observations at minima: 2452094.688, 2453478.882, 2453266.576, 2452093.685 and 54729.600. Each weighted as 0.10The following linear and quadratic ephemerides were determined from all available times of minimum light:JD Hel Min I=2452951.7443±0.0008d + 0.402093441±0.000000099 X E {1} JD Hel Min I=2452951.7439±0.0007d + 0.4020912±0.0000007 X E +0.00000000018 ± 0.00000000006 X E2 {2}A BVRI Bessell filtered simultaneous Wilson-Devinney Program (W-D) solution reveals that the system has a mass ratio of ~0.34 and a component temperature difference of only ~40 K. One low luminosity (Tfact ~ 0.94, ~66 degree radius) large cool region of spots was iterated on the primary component in the WD Synthetic Light Curve computations. It appears in the Southern Hemisphere (colatitude 155 degrees). The Roche Lobe fill-out of the binary is ~17%. The inclination is ~86 degrees. An eclipse duration of ~10 minutes was determined for the primary eclipse and the light curve solution. Additional and more detailed information is given in this report.

  4. DETERMINACIÓN DE LAS FRACCIONES SARA DE ASFALTOS COLOMBIANOS ENVEJECIDOS AL MEDIO AMBIENTE EMPLEANDO CROMATOGRAFÍA LÍQUIDA EN COLUMNA DETERMINAÇÃO DAS FRAÇÕES SARA DE ASFALTOS COLOMBIANOS ENVELHECIDOS AO MÉDIO AMBIENTE EMPREGANDO CROMATOGRAFIA LÍQUIDA EM COLUNA DETERMINATION OF SARA FRACTIONS OF ENVIRONMENTALLY AGED COLOMBIAN ASPHALTS USING LIQUID CHROMATOGRAPHY COLUMN

    Directory of Open Access Journals (Sweden)

    Fredy Alberto Reyes

    2012-06-01

    Full Text Available En este artículo presentamos un método basado en cromatografía líquida en columna para cuantificar la composición química de los cementos asfálticos fabricados en Colombia, sometidos al medio ambiente, mediante la determinación de las fracciones SARA. El método fue aplicado sobre películas de asfalto 60/70 y 80/100 para determinar los cambios en la composición química del material luego de ser expuesto durante 12 meses a las condiciones de intemperie de la ciudad de Bogotá; los ensayos de SARA fueron efectuados para el asfalto original a 1, 3, 6, 9 y 12 meses respectivamente. Los fraccionamientos SARA evidenciaron que el envejecimiento produjo una disminución de la fracción de aromáticos y un incremento en la de asfaltenos respecto al asfalto no envejecido. La disminución de los compuestos aromáticos y de resinas pudo ser responsable del endurecimiento observado en los asfaltos, que presentaron una consistencia dura y quebradiza, lo que está de acuerdo con la obtención de índices coloidales elevados. El método empleado permitió establecer correlaciones entre la composición química del asfalto y sus propiedades mecánicas.Neste artigo apresentamos um método baseado em cromatografia líquida em coluna para quantificar a composição química dos cimentos asfálticos fabricados em Colômbia, submetidos ao médio ambiente, mediante a determinação das frações SARA. O método foi aplicado sobre películas de asfalto 60/70 e 80/100 para determinar as mudanças na composição química do material depois de ser exposto durante 12 meses às condições de intempérie da cidade de Bogotá; os ensaios de SARA foram efetuados para o asfalto original a 1, 3, 6, 9 e 12 meses respectivamente. Os fraccionamentos SARA evidenciaram que o envelhecimento produziu uma diminuição da fração de aromáticos e um incremento na de asfaltenos com respeito ao asfalto não envelhecido. A diminuição dos compostos aromáticos e de resinas p

  5. The first seven months of an infant of Alouatta guariba (Humboldt (Primates, Atelidae: interactions and the development of behavioral patterns Os sete primeiros meses de um infante de Alouatta guariba (Humboldt (Primates, Atelidae: interações e desenvolvimento dos padrões comportamentais

    Directory of Open Access Journals (Sweden)

    João M. D. Miranda

    2005-12-01

    Full Text Available The development of the interactions of an infant primate with its mother and the other members of its social group plays a special role in the ethology and demography of the species, with consequences for their survive and their conservation. The objective of the present study is to investigate the development of an infant of Alouatta guariba (Humboldt, 1812 in the wild, its behavior and interactions during its first seven months of age, in a remnant of Araucaria Pine Forest in Paraná State, Brazil. Using the method of instantaneous scanning with 5 min intervals, a total of 46 hours and 15 minutes of direct observation (555 individual records showed that the infant behavioral patterns during its first four months were characterized by high dependency, which decreased progressively until the appearance of typically juvenile behaviors during the remaining 3 months. The first records of feeding on solid food, tail functionality and allomaternal care were also recorded and discussed. This work contributes to an understanding of the ontogenetic development of a poorly known aspect of this species, and thus for a more understanding of the genus Alouatta Lacépède, 1799.O desenvolvimento das interações do infante primata com a mãe e demais membros do grupo social tem importância na etologia e na demografia da espécie, apresentando profundas conseqüências para sua sobrevivência e portanto, na conservação da espécie. O objetivo deste trabalho foi estudar o desenvolvimento de um infante de Alouatta guariba (Humboldt, 1812 em vida livre, seu comportamento e interações durante os sete primeiros meses de vida, em um remanescente de Floresta Ombrófila Mista, Estado do Paraná, Brasil. Através do método de varredura instantânea com intervalo de cinco minutos, um total de 46 horas e 15 minutos de observações diretas (555 registros individuais mostraram que os padrões comportamentais do infante foram de alta dependência nos primeiros

  6. Construct Validity and Reliability of the SARA Gait and Posture Sub-scale in Early Onset Ataxia

    Directory of Open Access Journals (Sweden)

    Tjitske F. Lawerman

    2017-12-01

    Full Text Available Aim: In children, gait and posture assessment provides a crucial marker for the early characterization, surveillance and treatment evaluation of early onset ataxia (EOA. For reliable data entry of studies targeting at gait and posture improvement, uniform quantitative biomarkers are necessary. Until now, the pediatric test construct of gait and posture scores of the Scale for Assessment and Rating of Ataxia sub-scale (SARA is still unclear. In the present study, we aimed to validate the construct validity and reliability of the pediatric (SARAGAIT/POSTURE sub-scale.Methods: We included 28 EOA patients [15.5 (6–34 years; median (range]. For inter-observer reliability, we determined the ICC on EOA SARAGAIT/POSTURE sub-scores by three independent pediatric neurologists. For convergent validity, we associated SARAGAIT/POSTURE sub-scores with: (1 Ataxic gait Severity Measurement by Klockgether (ASMK; dynamic balance, (2 Pediatric Balance Scale (PBS; static balance, (3 Gross Motor Function Classification Scale -extended and revised version (GMFCS-E&R, (4 SARA-kinetic scores (SARAKINETIC; kinetic function of the upper and lower limbs, (5 Archimedes Spiral (AS; kinetic function of the upper limbs, and (6 total SARA scores (SARATOTAL; i.e., summed SARAGAIT/POSTURE, SARAKINETIC, and SARASPEECH sub-scores. For discriminant validity, we investigated whether EOA co-morbidity factors (myopathy and myoclonus could influence SARAGAIT/POSTURE sub-scores.Results: The inter-observer agreement (ICC on EOA SARAGAIT/POSTURE sub-scores was high (0.97. SARAGAIT/POSTURE was strongly correlated with the other ataxia and functional scales [ASMK (rs = -0.819; p < 0.001; PBS (rs = -0.943; p < 0.001; GMFCS-E&R (rs = -0.862; p < 0.001; SARAKINETIC (rs = 0.726; p < 0.001; AS (rs = 0.609; p = 0.002; and SARATOTAL (rs = 0.935; p < 0.001]. Comorbid myopathy influenced SARAGAIT/POSTURE scores by concurrent muscle weakness, whereas comorbid myoclonus predominantly influenced

  7. sarA negatively regulates Staphylococcus epidermidis biofilm formation by modulating expression of 1 MDa extracellular matrix binding protein and autolysis‐dependent release of eDNA

    DEFF Research Database (Denmark)

    Christner, Martin; Heinze, Constanze; Busch, Michael

    2012-01-01

    to biofilm formation in mutant 1585ΔsarA. Increased eDNA amounts indirectly resulted from upregulation of metalloprotease SepA, leading to boosted processing of autolysin AtlE, in turn inducing augmented autolysis and release of eDNA. Hence, this study identifies sarA as a negative regulator of Embp‐ and e...

  8. Pushing and Pulling Sara: A Case Study of the Contrasting Influences of High School and University Experiences on Engineering Agency, Identity, and Participation

    Science.gov (United States)

    Godwin, Allison; Potvin, Geoff

    2017-01-01

    This manuscript reports a longitudinal case study of how one woman, Sara, who had previously considered dropping out of high school, authored strong mathematics and science identities and purposefully exhibited agency through her experiences in high school science. These experiences empowered her to choose an engineering major in college; however,…

  9. Staphylococcus aureus Quorum Regulator SarA Targeted Compound, 2-[(Methylaminomethyl]phenol Inhibits Biofilm and Down-Regulates Virulence Genes

    Directory of Open Access Journals (Sweden)

    P. Balamurugan

    2017-07-01

    Full Text Available Staphylococcus aureus is a widely acknowledged Gram-positive pathogen for forming biofilm and virulence gene expressions by quorum sensing (QS, a cell to cell communication process. The quorum regulator SarA of S. aureus up-regulates the expression of many virulence factors including biofilm formation to mediate pathogenesis and evasion of the host immune system in the late phases of growth. Thus, inhibiting the production or blocking SarA protein might influence the down-regulation of biofilm and virulence factors. In this context, here we have synthesized 2-[(Methylaminomethyl]phenol, which was specifically targeted toward the quorum regulator SarA through in silico approach in our previous study. The molecule has been evaluated in vitro to validate its antibiofilm activity against clinical S. aureus strains. In addition, antivirulence properties of the inhibitor were confirmed with the observation of a significant reduction in the expression of representative virulence genes like fnbA, hla and hld that are governed under S. aureus QS. Interestingly, the SarA targeted inhibitor showed negligible antimicrobial activity and markedly reduced the minimum inhibitory concentration of conventional antibiotics when used in combination making it a more attractive lead for further clinical tests.

  10. The acquisition and supervision system of S.A.R.A.'s (Accelerator system Rhone-Alpes) parameters

    International Nuclear Information System (INIS)

    Iazzourene, F.

    1982-01-01

    The acquisition and supervision system of SARA's (Systeme Accelerateur Rhone-Alpes) parameters is built up. The basic hardware consists of: - A PDP 11/10 computer with a 64 K bytes memory capacity. The system and load device is a floppy disk of 28 megabytes capacity. - A CAMAC crate including a data logger with 224 input channels, a terminal driver (JTY21) and three modules designed for reading out a few digital data, for instance polarities of power supplies. The software provides three distinct programs: AKITS, which uses 3 commands, detects and signals functioning defects in the CAMAC modules used. AKIDO which uses 11 commands, is the acquisition and organization program of the accelerator's functioning parameters. AKISUR is the supervision program of the functioning parameter's stability, within a fixed gap, during the accelerator running [fr

  11. Memoria de la guerra civil española. Entre el sol y la tormenta de Sara Berenguer

    Directory of Open Access Journals (Sweden)

    Helena López

    2013-07-01

    Full Text Available En este artículo pretendo analizar dos cuestiones en relación con las memorias de guerra de la militante anarquista Sara Berenguer. En primer lugar, quiero atender a las estrategias discursivas (clase, género, sexualidad de construcción de la subjetividad en este texto. Además, me interesa indagar cómo estos discursos se interseccionan con la posición espacio-temporal (tiempo de la memoria y tiempo-espacio del exilio del sujeto autobiográfico. Mi objetivo principal es proponer una problematización de los conceptos de “memoria colectiva” y de “experiencia femenina” y reivindicar, por lo tanto, la relevancia tanto teórica como política de análisis críticos basados en narrativas personales.

  12. Os suínos da raça Bísara – oportunidades e desafios

    OpenAIRE

    Carvalho, Marieta

    2015-01-01

    A procura mundial de produtos de origem animal aumentará cerca de 70% em 2050. Estima-se que mil milhões de pobres dependam dos animais para a sua alimentação e criação de riqueza1. A carne de porco é um dos alimentos mais consumidos mundialmente, representando em 2012: 43,3% em todo o mundo2, 45,9% na União Europeia1 e 39,8 % em Portugal da carne total consumida3. Este trabalho tem como objetivo, fazer uma caracterização atual da suinicultura, com base nos suínos da raça Bísara, enumer...

  13. The Missing Fellow: First Description of the Trypanoxyuris pigrae Male (Nematoda: Oxyuridae), a Parasite of the Black Howler Monkey (Alouatta pigra) in Mexico.

    Science.gov (United States)

    Solórzano-García, B; Andrade, D M Güiris; de León, G Pérez-Ponce

    2017-08-01

    The first morphological description of the male of Trypanoxyuris pigrae Solórzano-García, Nadler, and Pérez-Ponce de León, 2016 , is presented in this study. Morphological data are supported by molecular data. Specimens of T. pigrae were recovered after the necropsy of a roadkill black howler monkey (Alouatta pigra) in southeastern Mexico. Males of T. pigrae are characterized by having 3 notched lips and a long esophagus with a posterior bulb; they also show a single crested lateral alae, a single spicule, and 4 caudal papillae. Morphological features coincide with those of the previously described T. pigrae females, and molecular profiles confirmed species identification. Males of T. pigrae are very similar to those of Trypanoxyuris minutus, another species of pinworm that also parasitizes the black howler monkey, A. pigra; however, the shape of the lips represents a very reliable diagnostic feature. Because of this, detailed en face observations are recommended to discriminate between these pinworm species.

  14. Feminism and Faith: Exploring Christian Spaces in the Writing of Sara Maitland and Michèle Roberts

    Directory of Open Access Journals (Sweden)

    Arina LUNGU-CIRSTEA

    2011-03-01

    Full Text Available En 1983, les féministes britanniques Sara Maitland et Jo Garcia ont publié Walking on the Water (London : Virago, une collection d’essais, de récits, de poèmes et de photos produits par des femmes sur le thème de la spiritualité. Les contributrices ont été en particulier invitées à explorer la relation entre leur identité féministe et leurs croyances religieuses. Le ton de ces contributions varie fortement, allant de l’envie passionnée de concilier les objectifs du féminisme avec le christianisme à un rejet total de l’Eglise comme institution patriarcale suprême. Cet article met en dialogue des récits diamétralement opposés du rapport entre christianisme et féminisme en s’intéressante plus particulièrement à deux des contributrices, Sara Maitland (1950 - et Michèle Roberts (1949 - . Ces deux écrivaines, qui se sont activement impliquées dans les mouvements féministes des années 1970, ont toutes deux lutté pour se réconcilier avec leur héritage chrétien. Néanmoins, alors que Maitland tente essentiellement de revisiter le christianisme en y incorporant les points essentiels d’une idéologie féministe, Roberts sent le besoin impérieux de se défaire de son identité religieuse afin de devenir indépendante ; en effet, dans son autobiographie Paper Houses (2007 elle décrit son éducation catholique comme “autoritaire et misogyne” (16. Cet article explore les façons dont l’identité spirituelle se construit dans le jeu complexe des interactions entre féminisme et foi. Il se propose, dans une perspective comparatiste, d’analyser d’une part le recueil de nouvelles de Sara Maitland intitulé A Book of Spells, et d’autre part, le roman acclamé de Michèle Roberts, Daughters of the House. Dans ces écrits, Maitland et Roberts ont un objectif commun qui est de renégocier la place des femmes dans l’histoire chrétienne dont elles reconnaissent – il est vrai à partir de perspectives diff

  15. Black and gold howler monkeys (Alouatta caraya) as sentinels of ecosystem health: patterns of zoonotic protozoa infection relative to degree of human-primate contact.

    Science.gov (United States)

    Kowalewski, Martin M; Salzer, Johanna S; Deutsch, Joseph C; Raño, Mariana; Kuhlenschmidt, Mark S; Gillespie, Thomas R

    2011-01-01

    Exponential expansion of human populations and human activities within primate habitats has resulted in high potential for pathogen exchange creating challenges for biodiversity conservation and global health. Under such conditions, resilient habitat generalists such as black and gold howler monkeys (Alouatta caraya) may act as effective sentinels to overall ecosystem health and alert us to impending epidemics in the human population. To better understand this potential, we examined noninvasively collected fecal samples from black and gold howler monkeys from remote, rural, and village populations in Northern Argentina. We examined all samples (n=90) for the zoonotic protozoa Cryptosporidium sp. and Giardia sp. via immunofluorescent antibody (IFA) detection. All samples were negative for Cryptosporidium sp. The prevalence of Giardia sp. was significantly higher at the rural site (67%) compared with the remote forest (57%) and village (40%) sites. A lack of Cryptosporidium sp. in all samples examined suggests that this pathogen is not a natural component of the howler parasite communities at these sites and that current land-use patterns and livestock contact are not exposing Argentine howler monkeys to this pathogen. High prevalence of Giardia sp. at all sites suggests that howler monkeys may serve as a viable reservoir for Giardia. Significantly higher prevalence of Giardia sp. at the rural site, where primate-livestock contact is highest, suggests the presence of multiple Giardia clades or increased exposure to Giardia through repeated zoonotic transmission among nonhuman primates, livestock, and/or people. These results highlight the need for future research into the epidemiology, cross-species transmission ecology, and clinical consequences of Giardia and other infectious agents not only in humans and livestock, but also in the wild animals that share their environments. © 2010 Wiley-Liss, Inc.

  16. Epizootic amebiasis outbreak in wild black howler monkeys (Alouatta caraya in a wildlife facility during captivity prior to translocation - Recommendations to wildlife management programs

    Directory of Open Access Journals (Sweden)

    Alexander Genoy-Puerto

    2016-09-01

    Full Text Available Óbitos por infecções causadas por protozoários intestinais são indesejáveis para programas de manejo de fauna, exigidos no âmbito do licenciamento ambiental e que demandam a captura e quarentena de primatas não humanos. Exames coproparasitológicos, necroscópicos, microbiológicos e moleculares foram utilizados para a confirmação do diagnóstico de uma severa enterite necrótica que levou a óbito três fêmeas e dois machos de Alouatta (A. caraya capturados e mantidos em quarentena prévia à translocação. Exames coproparasitológicos revelaram a presença de cistos de Entamoeba (E. histolytica/dispar (5/5, Entamoeba (E. coli (5/5 e Giardia (G. duodenalis (1/5. A avaliação necroscópica revelou áreas de necrose multifocal severa na mucosa e submucosa intestinal. A análise microscópica revelou a presença de estruturas morfologicamente compatíveis com trofozoítos do gênero Entamoeba spp. em todos os indivíduos examinados. Além disso, G. duodenalis (1/5 foi demonstrada pela técnica de Nested PCR. Sugere-se que quando for necessário o cativeiro temporário de primatas, deverão ser adotados protocolos de manejo adequados buscando a destinação imediata dos animais, de moto a mitigar os efeitos negativos do estresse e reduzir o risco da ocorrência de infecções.

  17. Primatology in southern Brazil: a transdisciplinary approach to the conservation of the brown-howler-monkey Alouatta guariba clamitans (Primates, Atelidae

    Directory of Open Access Journals (Sweden)

    Leandro Jerusalinsky

    2010-12-01

    Full Text Available Human interventions in natural environments are the main cause of biodiversity loss worldwide. The situation is not different in southern Brazil, home of five primate species. Although some earlier studies exist, studies on the primates of this region began to be consistently carried out in the 1980s and have continued since then. In addition to important initiatives to study and protect the highly endangered Leontopithecus caissara Lorrini & Persson, 1990 and Brachyteles arachnoides E. Geoffroy, 1806, other species, including locally threatened ones, have been the focus of research, management, and protection initiatives. Since 1993, the urban monkeys program (PMU, Programa Macacos Urbanos has surveyed the distribution and assessed threats to populations of Alouatta guariba clamitans (Cabrera, 1940 in Porto Alegre and vicinity. PMU has developed conservation strategies on four fronts: (1 scientific research on biology and ecology, providing basic knowledge to support all other activities of the group; (2 conservation education, which emphasizes educational presentations and long-term projects in schools near howler populations, based on the flagship species approach; (3 management, analyzing conflicts involving howlers and human communities, focusing on mitigating these problems and on appropriate relocation of injured or at-risk individuals; and finally, (4 Public Policies aimed at reducing and/or preventing the impact of urban expansion, contributing to create protected areas and to strengthen environmental laws. These different approaches have contributed to protect howler monkey populations over the short term, indicating that working collectively and acting on diversified and interrelated fronts are essential to achieve conservation goals. The synergistic results of these approaches and their relationship to the prospects for primatology in southern Brazil are presented in this review.

  18. Impact of the Regulators SigB, Rot, SarA and sarS on the Toxic Shock Tst Promoter and TSST-1 Expression in Staphylococcus aureus.

    Directory of Open Access Journals (Sweden)

    Diego O Andrey

    Full Text Available Staphylococcus aureus is an important pathogen manifesting virulence through diverse disease forms, ranging from acute skin infections to life-threatening bacteremia or systemic toxic shock syndromes. In the latter case, the prototypical superantigen is TSST-1 (Toxic Shock Syndrome Toxin 1, encoded by tst(H, and carried on a mobile genetic element that is not present in all S. aureus strains. Transcriptional regulation of tst is only partially understood. In this study, we dissected the role of sarA, sarS (sarH1, RNAIII, rot, and the alternative stress sigma factor sigB (σB. By examining tst promoter regulation predominantly in the context of its native sequence within the SaPI1 pathogenicity island of strain RN4282, we discovered that σB emerged as a particularly important tst regulator. We did not detect a consensus σB site within the tst promoter, and thus the effect of σB is likely indirect. We found that σB strongly repressed the expression of the toxin via at least two distinct regulatory pathways dependent upon sarA and agr. Furthermore rot, a member of SarA family, was shown to repress tst expression when overexpressed, although its deletion had no consistent measurable effect. We could not find any detectable effect of sarS, either by deletion or overexpression, suggesting that this regulator plays a minimal role in TSST-1 expression except when combined with disruption of sarA. Collectively, our results extend our understanding of complex multifactorial regulation of tst, revealing several layers of negative regulation. In addition to environmental stimuli thought to impact TSST-1 production, these findings support a model whereby sporadic mutation in a few key negative regulators can profoundly affect and enhance TSST-1 expression.

  19. Women Empowerment in the Realms of Institutionalized Religion and Patriarchy: El Saadawi’s Firdaus and Yezierska’s Sara as Examples

    OpenAIRE

    Abdullah K. Shehabat

    2016-01-01

    This paper explains how the two protagonists, Firdaus and Sara, successfully paved their own ways in search of self-liberation despite the authoritarian patriarchy and institutionalized religions that plagued them. El Saadawi's Woman at Point Zero and Yezierska’s Bread Givers represent the fruitful struggle these protagonists experienced as they come to forge an identity and be themselves. The paper argues that the protagonists manage to free themselves, establish their own spiritual homes at...

  20. Numerical studies of the heat-up-phase of Super-Sara 'severe fuel damage'. Boildown tests

    International Nuclear Information System (INIS)

    Eifler, W.; Shepherd, I.M.

    1983-01-01

    Calculations to investigate the heat-up phase of the Super-Sara 'severe fuel damage' test matrix have been performed using a simple computer code which models a typical pin. In particular the effect of the exothermic zirconium water reaction on the transient is considered. It is shown that it is possible to achieve the desired objectives of all the tests by a test procedure involving a constant power level a simple flow history. This flow history consists of an initial inlet flow, that has the water saturated at outlet. It is then linearly decreased in a time of the order of 200 seconds to a steady lower value. The clad temperature ramp rate is defined by the power and the peak clad temperature by the ratio of the power of the final steady inlet flow rate. If the final inlet flow rate for a particular power is below a certain critical value then the clad will reach melting temperature. The sensitivity of the results are discussed and a sample calculation is made for each test in the matrix

  1. Land-use evaluation for sustainable construction in a protected area: A case of Sara mountain national park.

    Science.gov (United States)

    Ristić, Vladica; Maksin, Marija; Nenković-Riznić, Marina; Basarić, Jelena

    2018-01-15

    The process of making decisions on sustainable development and construction begins in spatial and urban planning when defining the suitability of using land for sustainable construction in a protected area (PA) and its immediate and regional surroundings. The aim of this research is to propose and assess a model for evaluating land-use suitability for sustainable construction in a PA and its surroundings. The methodological approach of Multi-Criteria Decision Analysis was used in the formation of this model and adapted for the research; it was combined with the adapted Analytical hierarchy process and the Delphi process, and supported by a geographical information system (GIS) within the framework of ESRI ArcGIS software - Spatial analyst. The model is applied to the case study of Sara mountain National Park in Kosovo. The result of the model is a "map of integrated assessment of land-use suitability for sustainable construction in a PA for the natural factor". Copyright © 2017 Elsevier Ltd. All rights reserved.

  2. Composição e dinâmica de grupos de Alouatta guariba clamitans Cabrera (Primates, Atelidae em Floresta Ombrófila Mista no Estado do Paraná, Brasil Composition and dynamics of Alouatta guariba clamitans Cabrera, groups (Primates, Atelidae on an Araucaria Pine Forest remnant on Paraná State, Brazil

    Directory of Open Access Journals (Sweden)

    João M. D. Miranda

    2005-03-01

    Full Text Available As espécies do gênero Alouatta Lacépède, 1799 são sociais e formam grupos que mostram grandes variações na sua composição sexo-etária. Alouatta guariba clamitans Cabrera, 1940 é uma das espécies com escassos trabalhos que mostrem aspectos sociais deste primata. O estudo foi conduzido na Chácara Payquerê, localizada no Município de Balsa Nova, Estado do Paraná, Sul do Brasil. A área é inserida no contexto da Floresta Ombrófila Mista e faz parte da Área de Proteção Ambiental da Escarpa Devoniana. O trabalho foi conduzido de fevereiro de 2002 até junho de 2004, identificando grupos, registrando a composição sexo-etária e sua dinâmica. Foram identificados seis grupos na área de estudo, no decorrer dos três anos as médias de suas composições foram: 6,33 indivíduo/grupo; 1,47 Macho Adulto (MA/grupo; 0,46 Machos subadultos/grupo; 2,2 Fêmeas Adultas(FA/grupo; 1,13 Juvenis II/grupo; 0,8 Juvenis I/grupo e 0,27 Infantes/grupo. Para uma análise sobre a composição sexo-etária da espécie, os dados obtidos neste trabalho foram somados a 66 outros grupos de A. g. clamitans disponíveis na literatura (totalizando 72 grupos, sendo que as médias para a espécie foram: 6,25 indiv./grupo; 1,39 MA/grupo; 2,26 FA/grupo e 2,62 Indivíduos Imaturos/grupo. Quanto à dinâmica dos grupos registraram-se: 11 nascimentos; 25 mudanças de categoria etária; 4 indivíduos transeuntes; 1 morte/desaparecimento e a quebra de um grupo em dois. Este trabalho analisa a composição sexo-etária de A. g. clamitans além de discutir alguns aspectos da dinâmica dos grupos.Species in the genus Alouatta Lacépède, 1799 are social, and their groups display considerable variation in their age and sex composition. Little is known about the social organization of groups of Alouatta guariba clamitans Cabrera, 1940. This study was carried out between February 2002 and June 2004 in the Chácara Payquerê, located in the municipality of Balsa Nova in the

  3. Probabilistic model fitting for spatio-temporal variability studies of precipitation: the Sara-Brut system - a case study

    International Nuclear Information System (INIS)

    Dorado Delgado, Jennifer; Burbano Criollo, Juan Carlos; Molina Tabares, Jose Manuel; Carvajal Escobar, Yesid; Aristizabal, Hector Fabio

    2006-01-01

    In this study, space and time variability of monthly and annual rainfall was analyzed for the downstream influence zone of a Colombian supply-regulation reservoir, Sara-Brut, located on the Cauca valley department. Monthly precipitation data from 18 gauge stations and for a 29-year record (1975-2003) were used. These data were processed by means of time series completion, consistency analyses and sample statistics computations. Theoretical probabilistic distribution models such as Gumbel, normal, lognormal and wake by, and other empirical distributions such as Weibull and Landwehr were applied in order to fit the historical precipitation data set. The fit standard error (FSE) was used to test the goodness of fit of the theoretical distribution models and to choose the best of this probabilistic function. The wake by approach showed the best goodness of fit in 89% of the total gauges taken into account. Time variability was analyzed by means of wake by estimated values of monthly and annual precipitation associated with return periods of 1,052, 1,25, 2, 10, 20 and 50 years. Precipitation space variability is presents by means of ArcGis v8.3 and using krigging as interpolation method. In general terms the results obtained from this study show significant distribution variability in precipitation over the whole area, and particularity, the formation of dry and humid nucleus over the northeastern strip and microclimates at the southwestern and central zone of the study area were observed, depending on the season of year. The mentioned distribution pattern is likely caused by the influence of pacific wind streams, which come from the Andean western mountain range. It is expected that the results from this work be helpful for future planning and hydrologic project design

  4. Estudo florístico de segmentos de Mata Atlântica em Parelheiros, São Paulo, SP, para soltura de bugio-ruivo Alouatta clamitans (Cabrera, 1940. Floristic survey of Atlantic Rain Forest in the District of Parelheiros, São Paulo, southeastern Brazil, for reintroduction of the Brown Howler Monkey, Alouatta clamitans (Cabrera, 1940

    Directory of Open Access Journals (Sweden)

    Ricardo José Francischetti GARCIA

    2014-06-01

    Full Text Available A fim de minimizar os efeitos da pressão da urbanização sobre bugios-ruivos, Alouatta clamitans (Cabrera, 1940, a Divisão de Fauna em parceria com o Herbário Municipal realiza, desde 1996, o Programa de Reintrodução de Bugios, com o objetivo de viabilizar o retorno à vida livre dos indivíduos aptos. Entre várias áreas prospectadas para possível soltura de bugios-ruivos, o Sítio Roda d’Água, distrito de Parelheiros, município de São Paulo, foi selecionado para realização do presente estudo. Todos os componentes da mata, em uma área de 89,9 hectares, foram amostrados para avaliação da disponibilidade de alimentos. Foram registradas 251 espécies vasculares, sendo 13 pteridófitas, uma gimnosperma e 237 angiospermas. O material testemunho está depositado no Herbário Municipal. Na área estudada foram registradas duas espécies ameaçadas e quatro quase ameaçadas. As espécies dos componentes arbóreo-arbustivo e epifítico, que constituem o hábitat preferencial dos bugios-ruivos, correspondem a 73,7% do total levantado. Dentro deste grupo de espécies, 17,8% já foram registradas como fontes alimentares para a espécie-alvo. Dentre as espécies já referidas na dieta de bugios-ruivos, registradas na área de estudo, todas apresentam distribuição geográfica ampla. Desta forma, a área estudada foi considerada apropriada para a soltura de bugios-ruivos, quanto à disponibilidade de recursos para alimentação. In order to minimize the urbanization pressure effects over Brown Howler Monkeys, Alouatta clamitans (Cabrera, 1940, the Fauna Division in partnership with the Municipal Herbarium carries out a Brown Howler Monkey Reintroduction Program since 1996, with the aim of enabling the return of fit individuals to the wild. Among several areas prospected for possible reintroduction of the Brown Howler Monkey, Roda d’Água Ranch, District of Parelheiros, City of São Paulo, was selected to carry out this study. All

  5. The comparison of naturally weathered oil and artificially photo-degraded oil at the molecular level by a combination of SARA fractionation and FT-ICR MS

    International Nuclear Information System (INIS)

    Islam, Ananna; Cho, Yunju; Yim, Un Hyuk; Shim, Won Joon; Kim, Young Hwan; Kim, Sunghwan

    2013-01-01

    Highlights: • Weathered oils from the Hebei Spirit oil spill and photo degraded oils are compared. • We investigate changes of polar species at the molecular level by 15T FT-ICR MS. • Significant reduction of sulfur class compounds in saturates fraction is observed. • The relative abundance of protonated compounds (presumably basic nitrogen compounds) increase after degradation. • Changes of polar compounds occurred by natural and photo degradation are similar. -- Abstract: Two sets of oil samples, one obtained from different weathering stages of the M/V Hebei Spirit oil spill site and the other prepared by an in vitro photo-degradation experiment, were analyzed and compared at the molecular level by atmospheric pressure photo-ionization coupled with Fourier transform ion cyclotron resonance mass spectrometry (FT-ICR MS). For a more detailed comparison at the molecular level, the oil samples were separated into saturate, aromatic, resin, and asphaltene (SARA) fractions before MS analysis. Gravimetric analysis of the SARA fractions revealed a decreased weight percentage of the aromatic fraction and an increased resin fraction in both sets of samples. Molecular-level investigations of the SARA fractions showed a significant reduction in the S 1 class in the saturate fraction and increase of S 1 O 1 class compounds with high DBE values in resin fraction. Levels of N 1 and N 1 O 1 class compounds resulting in protonated ions (presumably basic nitrogen compounds) increased after degradation compared to compounds generating molecular ions (presumably non-basic nitrogen compounds). This study revealed changes occurring in heteroatom polar species of crude oils such as sulfur and nitrogen containing compounds that have not been easily detected with conventional GC based techniques

  6. SARAS 2: a spectral radiometer for probing cosmic dawn and the epoch of reionization through detection of the global 21-cm signal

    Science.gov (United States)

    Singh, Saurabh; Subrahmanyan, Ravi; Shankar, N. Udaya; Rao, Mayuri Sathyanarayana; Girish, B. S.; Raghunathan, A.; Somashekar, R.; Srivani, K. S.

    2018-04-01

    The global 21-cm signal from Cosmic Dawn (CD) and the Epoch of Reionization (EoR), at redshifts z ˜ 6-30, probes the nature of first sources of radiation as well as physics of the Inter-Galactic Medium (IGM). Given that the signal is predicted to be extremely weak, of wide fractional bandwidth, and lies in a frequency range that is dominated by Galactic and Extragalactic foregrounds as well as Radio Frequency Interference, detection of the signal is a daunting task. Critical to the experiment is the manner in which the sky signal is represented through the instrument. It is of utmost importance to design a system whose spectral bandpass and additive spurious signals can be well calibrated and any calibration residual does not mimic the signal. Shaped Antenna measurement of the background RAdio Spectrum (SARAS) is an ongoing experiment that aims to detect the global 21-cm signal. Here we present the design philosophy of the SARAS 2 system and discuss its performance and limitations based on laboratory and field measurements. Laboratory tests with the antenna replaced with a variety of terminations, including a network model for the antenna impedance, show that the gain calibration and modeling of internal additive signals leave no residuals with Fourier amplitudes exceeding 2 mK, or residual Gaussians of 25 MHz width with amplitudes exceeding 2 mK. Thus, even accounting for reflection and radiation efficiency losses in the antenna, the SARAS 2 system is capable of detection of complex 21-cm profiles at the level predicted by currently favoured models for thermal baryon evolution.

  7. A dinâmica dos mercados associados ao suínos de raça Bísara na Terra Fria Transmonta

    OpenAIRE

    Carvalho, Marieta

    2014-01-01

    A procura mundial de produtos de origem animal aumentará cerca de 70% em 2050, com especial relevância para a de origem do porco (FAO, 2014). Este trabalho visa estudar: · A dinâmica dos mercados associados aos suínos da raça Bísara: animais, carne e fumeiro de Vinhais. · Os circuitos de comercialização, os preços ao criador de suínos de animais vivos, da carne e fumeiro de Vinhais. A metodologia utilizada baseou-se na análise descritiva, referente aos de 2013 e 2014, dos ...

  8. Assessing impact of hunting mammals in Alto Itaya river basin, Peruvian Amazon

    OpenAIRE

    Aquino, Rolando; Terrones, C.; Navarro, R.; Terrones, Wagner

    2013-01-01

    En el presente trabajo se informa sobre la abundancia, presión de caza y el impacto de la caza en mamíferos que habitan los bosques de la cuenca del río Alto Itaya. La información procede de censos por transectos y registros de caza llevados a cabo en seis comunidades. Entre los mamíferos de caza, el choro (Lagothrix poeppigii Schinz) fue el más abundante con 15,4 individuos/km², mientras que el mono aullador (Alouatta seniculus Linnaeus) y el venado colorado (Mazama americana Erxleben) fuero...

  9. The staphylococcal accessory regulator, SarA, is an RNA-binding protein that modulates the mRNA turnover properties of late-exponential and stationary phase Staphylococcus aureus cells

    Directory of Open Access Journals (Sweden)

    John M Morrison

    2012-03-01

    Full Text Available The modulation of mRNA turnover is gaining recognition as a mechanism by which Staphylococcus aureus regulates gene expression, but the factors that orchestrate alterations in transcript degradation are poorly understood. In that regard, we previously found that 138 mRNA species, including the virulence factors protein A (spa and collagen binding protein (cna, are stabilized in a sarA-dependent manner during exponential phase growth, suggesting that SarA protein may directly or indirectly effect the RNA turnover properties of these transcripts. Herein, we expanded our characterization of the effects of sarA on mRNA turnover during late exponential and stationary phases of growth. Results revealed that the locus affects the RNA degradation properties of cells during both growth phases. Further, using gel mobility shift assays and RIP-ChIP, it was found that SarA protein is capable of binding mRNA species that it stabilizes both in vitro and within bacterial cells. Taken together, these results suggest that SarA post-transcriptionally regulates S. aureus gene expression in a manner that involves binding to and consequently altering the mRNA turnover properties of target transcripts.

  10. Identification of new proton-rich rare earth nuclei by means of the coupled system helium jet-isotope separator of SARA

    International Nuclear Information System (INIS)

    Ollivier, T.

    1986-01-01

    In order to study new exotic nuclei far from stability we built a fast separation system by coupling a helium jet with the medium-current source of the mass separator. First the tests were made in Lyon and then the system used on line with the heavy ion accelerator SARA, in Grenoble. We obtained efficiency greater than 1% for each element and a better chemical independence. This allowed us to perform experiments on rare-earth region near N=82, with fusion-evaporation reactions after an investigation of various ranges of beam energies. The first results allow to identify two new isotopes, 143 Tb (12s) and 138 Eu (12s). The decay schemes obtained are analysed in the frame of existing models [fr

  11. Análise SWOT global da exploração dos suínos da raça Bísara

    OpenAIRE

    Carvalho, Marieta

    2015-01-01

    A procura mundial de produtos de origem animal aumentará cerca de 70% em 2050. Estima-se que mil milhões de pobres dependam dos animais para a sua alimentação e criação de riqueza (FAO, 2014). A raça Bísara, são suínos autóctones portugueses do tronco Celta em risco de extinção. Apesar do seu reduzido efetivo representa para as populações locais um elevado peso económico e social. Este trabalho tem como objetivo, fazer uma caracterização atual da suinicultura, com base nos suínos da ra...

  12. Valorización del arte en los textos periodísticos de Clarice Lispector y Sara Gallardo (1967-1973

    Directory of Open Access Journals (Sweden)

    Guillermina Feudal

    2017-12-01

    Full Text Available En el contexto regional de democratización en el acceso a los bienes culturales, un aspecto nuclear de la producción periodística de Clarice Lispector y Sara Gallardo revela una sintonía común en el comentario y apropiación de recursos estéticos de las vanguardias “de los sesenta”. La apelación al arte como referencia para evaluar la vida cotidiana constituye una decisión comunicacional que funciona, desde el planteo formal y temático, como eje de las intervenciones críticas que ellas operan en el periodismo. El artículo analiza y compara la fundamentación de las elecciones artísticas de las autoras, así como los universos de discusión en los que desarrollan la contienda estética y debaten sobre los alcances de las nuevas modalidades de interacción cultural.

  13. Detection of the mosquito-borne flaviviruses, West Nile, Dengue, Saint Louis Encephalitis, Ilheus, Bussuquara, and Yellow Fever in free-ranging black howlers (Alouatta caraya of Northeastern Argentina.

    Directory of Open Access Journals (Sweden)

    María A Morales

    2017-02-01

    Full Text Available Several medically important mosquito-borne flaviviruses have been detected in Argentina in recent years: Dengue (DENV, St. Louis encephalitis (SLEV, West Nile (WNV and Yellow Fever (YFV viruses. Evidence of Bussuquara virus (BSQV and Ilheus virus (ILHV activity were found, but they have not been associated with human disease. Non-human primates can act as important hosts in the natural cycle of flaviviruses and serological studies can lead to improved understanding of virus circulation dynamics and host susceptibility. From July-August 2010, we conducted serological and molecular surveys in free-ranging black howlers (Alouatta caraya captured in northeastern Argentina. We used 90% plaque-reduction neutralization tests (PRNT90 to analyze 108 serum samples for antibodies to WNV, SLEV, YFV, DENV (serotypes 1and 3, ILHV, and BSQV. Virus genome detection was performed using generic reverse transcription (RT-nested PCR to identify flaviviruses in 51 antibody-negative animals. Seventy animals had antibodies for one or more flaviviruses for a total antibody prevalence of 64.8% (70/108. Monotypic (13/70, 19% and heterotypic (27/70, 39% patterns were differentiated. Specific neutralizing antibodies against WNV, SLEV, DENV-1, DENV-3, ILHV, and BSQV were found. Unexpectedly, the highest flavivirus antibody prevalence detected was to WNV with 9 (8.33% monotypic responses. All samples tested by (RT-nested PCR were negative for viral genome. This is the first detection of WNV-specific antibodies in black howlers from Argentina and the first report in free-ranging non-human primates from Latin-American countries. Given that no animals had specific neutralizing antibodies to YFV, our results suggest that the study population remains susceptible to YFV. Monitoring of these agents should be strengthened to detect the establishment of sylvatic cycles of flaviviruses in America and evaluate risks to wildlife and human health.

  14. Sharing AIS Related Anomalies (SARA)

    Science.gov (United States)

    2016-03-01

    78 6.3.7 SQL Versus NoSQL . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 81 6.4 Data Processing...43 6.1 Overview of SQL and NoSQL differences, from [56]. . . . . . . . . . . . . . . . . . 82 A.1 Description of the ship anomaly upload use...constraints must be considered. These requirements, however, can only be defined when lower level implementation decisions, such as SQL versus NoSQL

  15. Severe accident recriticality analyses (SARA)

    DEFF Research Database (Denmark)

    Frid, W.; Højerup, C.F.; Lindholm, I.

    2001-01-01

    with all three codes. The core initial and boundary conditions prior to recriticality have been studied with the severe accident codes SCDAP/RELAP5, MELCOR and MAAP4. The results of the analyses show that all three codes predict recriticality-both super-prompt power bursts and quasi steady-state power......Recriticality in a BWR during reflooding of an overheated partly degraded core, i.e. with relocated control rods, has been studied for a total loss of electric power accident scenario. In order to assess the impact of recriticality on reactor safety, including accident management strategies......, which results in large energy deposition in the fuel during power burst in some accident scenarios. The highest value, 418 cal g(-1), was obtained with SIMULATE-3K for an Oskarshamn 3 case with reflooding rate of 2000 kg s(-1). In most cases, however, the predicted energy deposition was smaller, below...

  16. Associação de cetamina S(+ e midazolam pelo método convencional de cálculo e pela extrapolação alométrica em bugios-ruivo (Alouatta guariba clamitans: resposta clínica e cardiorrespiratória S(+ ketamine and midazolam association by the conventional method of calculation and allometric extrapolation in red howler monkeys (Alouatta guariba clamitans: clinical and cardiopulmonary response

    Directory of Open Access Journals (Sweden)

    Joana Aurora Braun Chagas

    2010-02-01

    Full Text Available O objetivo deste estudo foi avaliar o protocolo de contenção química com cetamina S(+ e midazolam em bugios-ruivos, comparando o cálculo de doses pelo método convencional e o método de extrapolação alométrica. Foram utilizados 12 macacos bugios (Alouatta guariba clamitans hígidos, com peso médio de 4,84±0,97kg, de ambos os sexos. Após jejum alimentar de 12 horas e hídrico de seis horas, realizou-se contenção física manual e aferiram-se os seguintes parâmetros: frequência cardíaca (FC, frequência respiratória (f, tempo de preenchimento capilar (TPC, temperatura retal (TR, pressão arterial sistólica não invasiva (PANI e valores de hemogasometria arterial. Posteriormente, os animais foram alocados em dois grupos: GC (Grupo Convencional, n=06, os quais receberam cetamina S(+ (5mg kg-1 e midazolam (0,5mg kg-1, pela via intramuscular, com doses calculadas pelo método convencional; e GA (Grupo Alometria, n=06, os quais receberam o mesmo protocolo, pela mesma via, utilizando-se as doses calculadas pelo método de extrapolação alométrica. Os parâmetros descritos foram mensurados novamente nos seguintes momentos: M5, M10, M20 e M30 (cinco, 10, 20 e 30 minutos após a administração dos fármacos, respectivamente. Também foram avaliados: qualidade de miorrelaxamento, reflexo podal e caudal, pinçamento interdigital, tempo para indução de decúbito, tempo hábil de sedação, qualidade de sedação, e tempo e qualidade de recuperação. O GA apresentou menor tempo para indução ao decúbito, maior grau e tempo de sedação, bem como redução significativa da FC e PANI de M5 até M30, quando comparado ao GC. Conclui-se que o grupo no qual o cálculo de dose foi realizado por meio da alometria (GA apresentou melhor grau de relaxamento muscular e sedação, sem produzir depressão cardiorrespiratória significativa.The aim of this study was to evaluate a protocol of chemical restraint comparing the conventional method of

  17. Notas sobre Feral y las cigüeñas, de Fernando Alonso, y la "Historia del califa cigüeña" (Wilhelm Hauff, Sara Cone Bryant

    Directory of Open Access Journals (Sweden)

    Hans Christian Hagedorn

    2011-01-01

    Full Text Available En el presente estudio se analizan las fuentes de la versión de la "Historia del califa cigüeña", incluida en la narración Feral y las cigüeñas (1971, de Fernando Alonso. Para ello se tienen en cuenta el cuento original del autor postromántico alemán Wilhelm Hauff ("Die Geschichte von Kalif Storch", 1825, y la adaptación de este cuento que Sara Cone Bryant realizó para su libro How to tell stories to children (1905, traducción española: El arte de contar cuentos, 1965.

  18. Evaluación del impacto de la caza en mamíferos de la cuenca del río Alto Itaya, Amazonía peruana

    Directory of Open Access Journals (Sweden)

    Rolando Aquino

    2013-04-01

    Full Text Available En el presente trabajo se informa sobre la abundancia, presión de caza y el impacto de la caza en mamíferos que habitan los bosques de la cuenca del río Alto Itaya. La información procede de censos por transectos y registros de caza llevados a cabo en seis comunidades. Entre los mamíferos de caza, el choro (Lagothrix poeppigii Schinz fue el más abundante con 15,4 individuos/km², mientras que el mono aullador (Alouatta seniculus Linnaeus y el venado colorado (Mazama americana Erxleben fueron los menos abundantes con 0,15 individuos/km² y 0,5 individuos/ km2, respectivamente. Por otro lado, del área fueron cosechados un promedio anual de 1176 mamíferos, equivalente a 14184,6 kg. Finalmente, el modelo de cosecha sugiere sobrecaza del tapir (Tapirus terrestris Linnaeus, huangana (Tayassu pecari Link, choro (L. poeppigii, mono aullador (A. seniculus y machín negro (Cebus apella Linnaeus, cuyas cosechas en algunos casos alcanzaron el 100% de la producción anual.

  19. Avaliação ultrassonográfica e mensurações das glândulas adrenais em primatas não humanos neotropicais: mico-de-cheiro (Saimiri sciureus, macaco-da-noite (Aotus azarae infulatus e bugio-ruivo (Alouatta guariba clamitans

    Directory of Open Access Journals (Sweden)

    Andressa C. Souza

    2014-09-01

    Full Text Available As glândulas adrenais possuem funções endócrinas relacionadas a múltiplas funções vitais, estando intimamente relacionadas à capacidade do animal em se adaptar ao estresse. O exame ultrassonográfico é o método diagnóstico de escolha para avaliação das glândulas em diferentes espécies. Considerando a escassa literatura, questiona-se se as doenças adrenais em primatas não humanos são incomuns ou subdiagnosticadas, havendo a hipótese desse fato ser determinado pela falta de parâmetros. Objetivou-se descrever as características ultrassonográficas das glândulas adrenais para três espécies de primatas não humanos mantidas em cativeiro: Saimiri sciureus (mico-de-cheiro, Aotus azarae infulatus (macaco-da-noite e Alouatta guariba clamitans (bugio-ruivo. Conclui-se que é possível a identificação das glândulas adrenais por meio de exame ultrassonográfico, sendo que os padrões de referência foram estabelecidos com sucesso para as espécies em questão. Ressalta-se que a adequação de animais em ambientes estressantes é frequentemente acompanhada por uma hipertrofia das glândulas adrenais, portanto deve-se levar em consideração que as mensurações realizadas nesse estudo foram estabelecidas em animais de cativeiro.

  20. 1980 Annual status report: super-SARA

    International Nuclear Information System (INIS)

    1981-01-01

    The essential tasks of the JRC for the SUPERSARA project during 1980 were therefore twofold: 1. Actuation of an international Task Force with which to: a. discuss in depth the test objectives and the relationships between the SSTP and the world mosaic of activities in the field of LWR fuel behaviour; b. establish a consensus test matrix; c. identify and discuss the major technological problems affecting the feasibility of attaining the consensus test objectives, especially for the boil-down SFD tests. A Task Force with these objectives was necessary in order to provide the elements for a Council decision on phase II. 2. Conservation of the rythm of the main contractor (UKAEA-Harwell) and subcontractors for the timely fabrication of loop components and the timely design of those new aspects of the plant necessary for the boil-down SFD tests

  1. Ergenlik Dönemi Okuma Tutumu Ölçeği’nin Türkçe’ye Uyarlanması The Adaptasyon Of Survey Of Adolescent Reading Attitudes (Sara Into Turkish

    Directory of Open Access Journals (Sweden)

    Muhammet BAŞTUĞ

    2013-07-01

    Full Text Available The aim of this study is to adapt the Survey of Adolescent Reading Attitudes SARA to Turkish, which was developed by McKenna, Conradi, Lawrance, Jang, and Meyer (2012, and to test it for validity and reliability. The rationale is that the scale involves one’s attitude towards digital reading. The sample was comprised of 702 sixth,seventh and eighth grade students in Konya- 343 of them being femaleand the remaining 359 being male. The original scale had 18 items infour sub-dimensions, namely academic reading in digital settings (AD,recreational reading in digital settings (RD, academic reading in printsettings (AP and recreational reading in print settings (RP. Theexploratory factor analysis and confirmatory factor analysis revealedthat the four original sub-dimensions were retained when two itemswere omitted. Cronbach’s alpha coefficients were 0.691, 0.802, 0.690,0.660 and 0.623 for the overall scale, RD, RP, AP and AD respectively.The results suggest that the adapted scale is reliable and valid. The 15-item finalized version is appropriate for the Turkish language and use inTurkey. In the development of reading environments and materials,identification of students’ attitudes toward reading in a multidimensionalway is expected to make great contributions to morequalified learning environments. Bu araştırmanın amacı, McKenna, Conradi, Lawrence, Jang ve Meyer (2012 tarafından geliştirilen Ergenlik Dönemi Okuma Tutumu Ölçeği’nin geçerlik ve güvenirliğinin yapılarak Türkçe’ye uyarlanmasıdır. Ölçeğin dijital okumaya karşı tutumu da kapsaması sebebiyle uyarlama çalışmasının uygun olacağı düşünülmüştür. Çalışma grubunu Konya ilinde yer alan ve 6,7 ve 8. Sınıflara devam eden 343’ü kız, 359’u erkek toplam 702 öğrenci oluşturmuştur. Ölçeğin orjinali 18 maddeden ve “Akademik Dijital, Serbest Dijital, Akademik Kağıt ve Serbest Kağıt” olmak üzere 4 alt boyuttan olu

  2. INTEGRATIVE PSYCHOTHERAPY AND MINDFULNESS: THE CASE OF SARA

    Directory of Open Access Journals (Sweden)

    Mihael Černetič

    2015-02-01

    Full Text Available The article explores the relationship between Integrative Psychotherapy and mindfulness on a theoretical as well as practical level. Although mindfulness is not an explicit constituent of Integrative Psychotherapy, the two are arguably a natural fit. Mindfulness has the potential to enhance internal and external contact, a central concept in Integrative Psychotherapy, as well as strengthen a client’s Adult ego state. This article presents a case study whereby Integrative Psychotherapy is analysed from the perspective of mindfulness. Within the course of therapy, parallels were observed between the client's increased mindfulness, improved internal and external contact, strengthened Adult ego state, mastery of introjections, as well as diminished feelings of guilt, improved mood, self care and ability to engage in appropriate separation and individuation. These gains support the conclusion that Integrative Psychotherapy and mindfulness are inherently related and that explicit incorporation of mindfulness may enhance the therapeutic process of Integrative Psychotherapy.

  3. Discovery of carbon nanotubes. Sara ni carbon nanotube e

    Energy Technology Data Exchange (ETDEWEB)

    Iijima, S

    1994-01-20

    This paper describes the following matters on carbon nanotubes (CNt): CNt is discovered in carbon deposits generated in the tip of a negative electrode during DC arc discharge between carbon electrodes. CNt has a construction in which cylinders made of normally several layers are superposed, based on cylindrical crystals in a single layer with six-member rings of carbon atoms laid out. Spiral arrangement of carbon six-member rings has been discovered in the single-layered crystals. Five-member rings exist in a location where the CNt tip is closed, and seven-member rings in a location where the CNt presents a saddle-like curve, without exceptions. It is introduced theoretically that the electronic structure of the single-layered CNt depends on the cylinder diameter and spiral pitch. Replacing part of the carbon negative electrode with iron, and vaporizing iron and carbon simultaneously through arc discharge can result in a single-layered CNt with a diameter of 1 nm. Heating the CNt deposited with metallic lead in an oxygen atmosphere can form CNt containing lead compounds. 19 refs., 9 figs.

  4. AFSC/REFM: Alaska Stock Assessment Results Archive (SARA)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Each year over 50 Alaskan groundfish stock assessments report the condition of Alaskan fisheries resources in the U.S. Exclusive Economic Zone. Stock assessment...

  5. INTEGRATIVE PSYCHOTHERAPY AND MINDFULNESS: THE CASE OF SARA

    OpenAIRE

    Mihael Černetič

    2015-01-01

    The article explores the relationship between Integrative Psychotherapy and mindfulness on a theoretical as well as practical level. Although mindfulness is not an explicit constituent of Integrative Psychotherapy, the two are arguably a natural fit. Mindfulness has the potential to enhance internal and external contact, a central concept in Integrative Psychotherapy, as well as strengthen a client’s Adult ego state. This article presents a case study whereby Integrative Psychotherapy is ana...

  6. Gene : CBRC-SARA-01-0604 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available and polyadenylation specific factor 1, 160kDa, isoform CRA_a [Homo sapiens] gb|EAW82107.1| cleavage and poly...adenylation specific factor 1, 160kDa, isoform CRA_a [Homo sapiens] gb|EAW82108.1| cleavage and polyadenylat...ion specific factor 1, 160kDa, isoform CRA_a [Homo sapiens] 3e-16 77% MSTVPTVSCTS...TDRWGLVGTGRCYGSGRGGSMLASCGELSQAIALPKPVLSGHQAGSDPAGSSLYLVLPEGRCLPSVPAHVCPGTAEPAQHSQTPLQRELRISVLPAYLSYDAPWPVRKIPLRCTAHYVAYHVESKVCPWAGVPRAGRPGPQAQPALSFRCMQWPPAPIRHAPASHA ...

  7. Synteny of human chromosomes 14 and 15 in the platyrrhines (Primates, Platyrrhini)

    Science.gov (United States)

    2009-01-01

    In order to study the intra- and interspecific variability of the 14/15 association in Platyrrhini, we analyzed 15 species from 13 genera, including species that had not been described yet. The DNA libraries of human chromosomes 14 and 15 were hybridized to metaphases of Alouatta guariba clamitans, A. caraya, A. sara, Ateles paniscus chamek, Lagothrix lagothricha, Brachyteles arachnoides, Saguinus midas midas, Leontopithecus chrysomelas, Callimico goeldii, Callithrix sp., Cebus apella, Aotus nigriceps, Cacajao melanocephalus,Chiropotes satanas and Callicebus caligatus. The 14/15 hybridization pattern was present in 13 species, but not in Alouatta sara that showed a 14/15/14 pattern and Aotus nigriceps that showed a 15/14/15/14 pattern. In the majority of the species, the HSA 14 homologue retained synteny for the entire chromosome, whereas the HSA 15 homologue displayed fragmented segments. Within primates, the New World monkeys represent the taxon with the highest variability in chromosome number (2n = 16 to 62). The presence of the HSA 14/15 association in all species and subspecies studied herein confirms that this association is the ancestral condition for platyrrhines and that this association has been retained in most platyrrhines, despite the occurrence of extensive inter- and intrachromosomal rearrangements in this infraorder of Primates. PMID:21637455

  8. Synteny of human chromosomes 14 and 15 in the platyrrhines (Primates, Platyrrhini).

    Science.gov (United States)

    Gifalli-Iughetti, Cristiani; Koiffmann, Célia P

    2009-10-01

    In order to study the intra- and interspecific variability of the 14/15 association in Platyrrhini, we analyzed 15 species from 13 genera, including species that had not been described yet. The DNA libraries of human chromosomes 14 and 15 were hybridized to metaphases of Alouatta guariba clamitans, A. caraya, A. sara, Ateles paniscus chamek, Lagothrix lagothricha, Brachyteles arachnoides, Saguinus midas midas, Leontopithecus chrysomelas, Callimico goeldii, Callithrix sp., Cebus apella, Aotus nigriceps, Cacajao melanocephalus,Chiropotes satanas and Callicebus caligatus. The 14/15 hybridization pattern was present in 13 species, but not in Alouatta sara that showed a 14/15/14 pattern and Aotus nigriceps that showed a 15/14/15/14 pattern. In the majority of the species, the HSA 14 homologue retained synteny for the entire chromosome, whereas the HSA 15 homologue displayed fragmented segments. Within primates, the New World monkeys represent the taxon with the highest variability in chromosome number (2n = 16 to 62). The presence of the HSA 14/15 association in all species and subspecies studied herein confirms that this association is the ancestral condition for platyrrhines and that this association has been retained in most platyrrhines, despite the occurrence of extensive inter- and intrachromosomal rearrangements in this infraorder of Primates.

  9. Synteny of human chromosomes 14 and 15 in the platyrrhines (Primates, Platyrrhini

    Directory of Open Access Journals (Sweden)

    Cristiani Gifalli-Iughetti

    2009-01-01

    Full Text Available In order to study the intra- and interspecific variability of the 14/15 association in Platyrrhini, we analyzed 15 species from 13 genera, including species that had not been described yet. The DNA libraries of human chromosomes 14 and 15 were hybridized to metaphases of Alouatta guariba clamitans, A. caraya, A. sara, Ateles paniscus chamek, Lagothrix lagothricha, Brachyteles arachnoides, Saguinus midas midas, Leontopithecus chrysomelas, Callimico goeldii, Callithrix sp., Cebus apella, Aotus nigriceps, Cacajao melanocephalus, Chiropotes satanas and Callicebus caligatus. The 14/15 hybridization pattern was present in 13 species, but not in Alouatta sara that showed a 14/15/14 pattern and Aotus nigriceps that showed a 15/14/15/14 pattern. In the majority of the species, the HSA 14 homologue retained synteny for the entire chromosome, whereas the HSA 15 homologue displayed fragmented segments. Within primates, the New World monkeys represent the taxon with the highest variability in chromosome number (2n = 16 to 62. The presence of the HSA 14/15 association in all species and subspecies studied herein confirms that this association is the ancestral condition for platyrrhines and that this association has been retained in most platyrrhines, despite the occurrence of extensive inter- and intrachromosomal rearrangements in this infraorder of Primates.

  10. Evaluación del estado de conservación de los mamíferos de caza: un modelo comparativo en comunidades de la Reserva Nacional Pacaya Samiria (Loreto, Peru

    Directory of Open Access Journals (Sweden)

    Rolando Aquino

    2013-06-01

    Full Text Available El presente trabajo contiene información relacionada a la caza, la abundancia y el impacto de la caza de los mamíferos que habitan los bosques inundables aledaños a dos comunidades asentadas en el interior de la Reserva Nacional Pacaya Samiria. Está basado en registros de caza y censos por transectos. Los registros de caza muestran un promedio de cosecha anual de 190,3 mamíferos del área de San Miguel, equivalente a 2275,9 kg de carne de monte, y 104,5 mamíferos del área de Parinari, equivalente a 985,9 kg de carne de monte. Los primates fueron los más abundantes en ambas áreas de estudio; sin embargo, las densidades estimadas fueron mayores para el área de Parinari. Ninguna especie de ungulados fue observada en el área de San Miguel, mientras que para el área de Parinari la densidad del tapir (Tapirus terrestris Linnaeus fue estimada en 0,2 individuos/ km2 y para el pecarí labiado (Tayassu pecari Link en 6,6 individuos/ km2 . Finalmente, el modelo de cosecha sugiere sobrecaza para el tapir, maquisapa cenizo (Ateles belzebuth E. Geoffroy, choro (Lagothrix lagotricha Humboldt y mono aullador (Alouatta seniculus Linnaeus, cuyas cosechas en algunos casos alcanzaron el 100% de la producción. Se discuten los factores que podrían influir para la escasez y/o ausencia de algunas especies, particularmente ungulados y primates.

  11. Análise comparativa dos aspectos da ultraestrutura do espermatozoide de Mico-Leão-de-Cara-Dourada (Leontopithecus chrysomelas) e Bugio (Alouatta caraya e Alouatta guariba clamitans)

    OpenAIRE

    Ana Paula Grabner

    2016-01-01

    Os primatas neotropicais, ou primatas do novo mundo, são pertencentes a um grupo diverso e variado de animais, com características anatômicas, comportamentais e taxonômicas próprias, que os diferem dos primatas do velho mundo. Estima-se que representem 31% dos primatas não-humanos do planeta. Têm sofrido com as altas taxas de crescimento populacional e perturbação antrópica resultante do desflorestamento, agricultura e criação de gado. Com o intuito de reverter esta situação e maximizar o pot...

  12. NCBI nr-aa BLAST: CBRC-SARA-01-1746 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available 1| unnamed protein product [Mus musculus] gb|EAW65549.1| non imprinted in Prader-Willi/Angelman syndrome 1, ...isoform CRA_a [Homo sapiens] gb|EAW65551.1| non imprinted in Prader-Willi/Angelman syndrome 1, isoform CRA_a... [Homo sapiens] gb|ABM82178.1| non imprinted in Prader-Willi/Angelman syndrome 1 ...[synthetic construct] gb|ABM85364.1| non imprinted in Prader-Willi/Angelman syndrome 1 [synthetic construct] CAD97953.1 1e-113 81% ...

  13. Sara Lipton in Conversation with Eva Janáčová. [Interview

    Czech Academy of Sciences Publication Activity Database

    Janáčová, Eva; Lipton, S.

    2017-01-01

    Roč. 65, č. 1 (2017), s. 66-70 ISSN 0049-5123 Institutional support: RVO:68378033 Keywords : Judaism * Middle Ages * art Subject RIV: AL - Art, Architecture, Cultural Heritage OBOR OECD: Arts, Art history

  14. Low energy neutral atom imaging on the Moon with the SARA ...

    Indian Academy of Sciences (India)

    (LENA) imaging mass spectrometer, which will perform remote sensing of the lunar surface via detection of neutral atoms in the energy range from 10eV to 3keV from a 100km polar orbit. ..... as studying the existence of ion void regions around.

  15. NCBI nr-aa BLAST: CBRC-SARA-01-1549 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available ndent protein export [Herminiimonas arsenicoxydans] emb|CAL63167.1| twin-arginine translocase subunit, sec-i...ndependent protein export [Herminiimonas arsenicoxydans] YP_001101288.1 2.0 37% ...

  16. The State Authorization Reciprocity Agreement (SARA): A Good Idea Whose Time Has Come

    Science.gov (United States)

    Longanecker, David; Hill, Marshall A.

    2014-01-01

    In this article the authors argue that states need a new way to oversee the delivery of postsecondary distance education across state borders. They assert that the current process is too spotty to assure consistent consumer protection and too cumbersome and expensive for institutions. Because education is not specified in the US Constitution as a…

  17. 75 FR 67770 - Sara Lee Corporation Including On-Site Leased Workers From EDS, Hewitt Packard, Sapphire...

    Science.gov (United States)

    2010-11-03

    ..., Deductions, Collections, Call Center, Information Technology, Accounts Payable, General Accounts, Financial... this certification to include workers providing shared financial and information technology services at..., Deductions, Collections, Call Center, Information Technology, Accounts Payable, General Accounts, Financial...

  18. In Ukraine, Fear of Being a Resurgent Russiaѫs Next Target / Nicholas Kulish, Sara Rhodin

    Index Scriptorium Estoniae

    Kulish, Nicholas

    2008-01-01

    Gruusia ja Venemaa vaheline konflikt on suurendanud ebakindlust Venemaa suhtes ka Ukrainas, Poolas ja Balti riikides. Eesti president Toomas Hendrik Ilves leiab, et Gruusia sündmustel on tõsised tagajärjed rahvusvahelise rahu jaoks. Vabariigi President töövisiidil Gruusias 12.-13.08.2008

  19. Feminism and Childcare: A Roundtable with Sara de Benedictis, Gideon Burrows, Tracey Jensen, Jill Rutter and Victoria Showunmi

    OpenAIRE

    Jo Littler; Alison Winch

    2016-01-01

    This is an edited transcript of a roundtable event held at City University London in late 2014. The point of this seminar was to ask: what progress have we made towards men and women equally sharing the childcare? Rearranging the domestic division of labour was a crucial issue foregrounded by second-wave feminism: but how much progress has actually been made since then? Second-wave feminists and beyond have recently been vocal in replying: ‘not so much.’ For example, Bea Campbell has argued t...

  20. Motivating the European voter: Parties, issues and campaigns in European Parliament elections / Sara B. Hobolt, Jae-Jae Spoon

    Index Scriptorium Estoniae

    Hobolt, Sara B.

    2012-01-01

    Valijate käitumisest Euroopa Parlamendi (EP) valimistel liikmesriikides (sh Eesti), valijakäitumise erinevustest võrreldes siseriiklike valimistega ja parteide mõjust valijakäitumisele. Tabelid, joonised

  1. When top-down becomes bottom up: behaviour of hyperdense howler monkeys (Alouatta seniculus) trapped on a 0.6 ha island.

    Science.gov (United States)

    Orihuela, Gabriela; Terborgh, John; Ceballos, Natalia; Glander, Kenneth

    2014-01-01

    Predators are a ubiquitous presence in most natural environments. Opportunities to contrast the behaviour of a species in the presence and absence of predators are thus rare. Here we report on the behaviour of howler monkey groups living under radically different conditions on two land-bridge islands in Lago Guri, Venezuela. One group of 6 adults inhabited a 190-ha island (Danto) where they were exposed to multiple potential predators. This group, the control, occupied a home range of 23 ha and contested access to food resources with neighbouring groups in typical fashion. The second group, containing 6 adults, was isolated on a remote, predator-free 0.6 ha islet (Iguana) offering limited food resources. Howlers living on the large island moved, fed and rested in a coherent group, frequently engaged in affiliative activities, rarely displayed agonistic behaviour and maintained intergroup spacing through howling. In contrast, the howlers on Iguana showed repulsion, as individuals spent most of their time spaced widely around the perimeter of the island. Iguana howlers rarely engaged in affiliative behaviour, often chased or fought with one another and were not observed to howl. These behaviors are interpreted as adjustments to the unrelenting deprivation associated with bottom-up limitation in a predator-free environment.

  2. Survey of black howler (Alouatta pigra) and spider (Ateles geoffroyi) monkeys in the Mayan sites of Calakmul and Yaxchilán, Mexico and Tikal, Guatemala.

    Science.gov (United States)

    Estrada, Alejandro; Luecke, Leandra; Van Belle, Sarie; Barrueta, Emilio; Meda, Marleny Rosales

    2004-01-01

    Surveys of populations of spider and howler monkeys were conducted at the Mayan sites of Calakmul and Yaxchilán, Mexico and Tikal, Guatemala. The forests in which these sites are found are part of the largest landmass of tropical rain forests present in Mesoamerica, encompassing about 4 million ha. Triangulation of monkey vocalization combined with ground surveys was used to determine the presence of howler and spider monkey groups. Howler monkey mean troop size at these sites varied from 6.6+/-2.1 individuals in Yaxchilán to 7.5+/-1.9 in Calakmul to 8.7+/-2.2 in Tikal. Density estimates varied from 12.8 individuals/km(2 )in Yaxchilán to 15.2 individuals/km(2 )in Calakmul to 17.8 individuals/km(2 )in Tikal. Mean spider monkey subgroup size varied from 4.7+/-2.6 individuals in Tikal to 5.6+/-3.0 individuals in Yaxchilán to 7.7+/-3.8 individuals in Calakmul. Spider monkey density varied from 17.0 individuals/km(2 )in Yaxchilán to 17.2 individuals/km(2 )in Calakmul to 56.4 individuals/km(2 )in Tikal. All sightings of both howler and spider monkeys at the three sites were in undisturbed rain forest vegetation and spider monkeys in general were more frequently sighted at higher tree heights than howlers. We discuss the value of further acquiring data on howler and spider monkey populations existing in extensive forest tracts and on the conservation value for both primate species of the forests surrounding the Mayan ruins found in this area of Mesoamerica.

  3. Nota sobre infecção por Salmonella sp. e Shigella sp. em bugios-ruivos, Alouatta clamitans Cabrera, 1940 (Primates: Atelidae mantidos em cativeiro

    Directory of Open Access Journals (Sweden)

    Júlio César de Souza Júnior

    2008-08-01

    Full Text Available Amostras de fezes de bugios-ruivos cativos foram investigadas quanto a presença de Salmonella sp. e Shigella sp. O padrão de sensibilidade a antibióticos foi testado. Este é o primeiro relato de infecção assintomática por Salmonella sp. nesta espécie. Não foi detectada infecção por Shigella sp. Destaca-se a importância de investigação em animais submetidos a translocação ou a reintrodução e a necessidade de inquéritos periódicos em populações cativas a fim de se evitar agravos ocupacionais.

  4. When top-down becomes bottom up: behaviour of hyperdense howler monkeys (Alouatta seniculus trapped on a 0.6 ha island.

    Directory of Open Access Journals (Sweden)

    Gabriela Orihuela

    Full Text Available Predators are a ubiquitous presence in most natural environments. Opportunities to contrast the behaviour of a species in the presence and absence of predators are thus rare. Here we report on the behaviour of howler monkey groups living under radically different conditions on two land-bridge islands in Lago Guri, Venezuela. One group of 6 adults inhabited a 190-ha island (Danto where they were exposed to multiple potential predators. This group, the control, occupied a home range of 23 ha and contested access to food resources with neighbouring groups in typical fashion. The second group, containing 6 adults, was isolated on a remote, predator-free 0.6 ha islet (Iguana offering limited food resources. Howlers living on the large island moved, fed and rested in a coherent group, frequently engaged in affiliative activities, rarely displayed agonistic behaviour and maintained intergroup spacing through howling. In contrast, the howlers on Iguana showed repulsion, as individuals spent most of their time spaced widely around the perimeter of the island. Iguana howlers rarely engaged in affiliative behaviour, often chased or fought with one another and were not observed to howl. These behaviors are interpreted as adjustments to the unrelenting deprivation associated with bottom-up limitation in a predator-free environment.

  5. Larger, Higher-level Academic Institutions in the US Do Not Necessarily Have Better-resourced Library Web Teams. A Review of: Connell, Ruth Sara.

    Directory of Open Access Journals (Sweden)

    Suzanne Lewis

    2008-12-01

    Full Text Available Objective – To discover how library Web teams’ staffing, backgrounds, tools, and professional development differ among various types of academic libraries.Design – Survey.Setting – Academic libraries in the United States.Subjects – Academic library Web team members.Methods – A systematic sample of every twelfth institution on The Carnegie Classification of Institutions of Higher Education list was used to establish a sample group. A Web search was carriedout to identify each institution’s library Web site and contact information for the Web site designer or most appropriate alternative person. Institutions were excluded from the sample if they had no Web site at all, had no library Web site, had a Web site that did not mention a library, or had a Spanish language Web site. In September 2006 an e-mail was sent to the contact for each institution in the sample group asking them to participate in an online survey. A follow up e-mail was sent two weeks later and the survey closed after one month. The survey respondents were asked to identify their institutions so that analysis of the results in relation to the sizeand type of institution could be carried out. The researchers used a simplified version of the Carnegie classification to sort the responding institutions into five main groups.Main Results – The systematic sample consisted of 288 institutions (sample size 6.5%. The profile of the responding institutions was as follows: associate’s colleges (35.5%, baccalaureate colleges (18.2%, master’s colleges and universities (20.9%, doctorate-granting universities (9% and special focus institutions (15.5%. A total of 110 institutions completed the survey, yielding a response rate of 38.19%, although not all respondents answered all the survey questions. The final sample of 110 was 2.5% of the total 4384 institutions on the Carnegielist. Seventy-one per cent of institutions with multiple libraries shared Web teams, with two-year colleges more likely (91.7% to share a Web team than four-year or above institutions (60.9%. The majority of responding institutions (94.4% used in-house library Web site design, with only 5.6% of respondents outsourcing this task.Nearly half (49% of respondents indicated that library Web design was done by one person and even the larger libraries did not necessarily have larger Web teams. Very few Web team members (4.9% had Web design as their primary role; the majority (83.5% indicated that it was just one component of their job. Web team members from master’s- and doctorate-granting institutions were more likely to have taught themselves Web design, while those from associate, baccalaureate and special focus colleges were more likely to have taken Web design courses. For all respondents, the most commonly listed quality for selection to the Web team was an interest in Web design and the most valued skill for library Web designers was the ability to organise information effectively.Knowledge of Web authoring software and basic HTML coding were the most commonly listed knowledge requirements for Web team members. A significant number of respondents indicated that they or other Web team members did not have access to Web authoring (36.9% and image editing (52% software. Generally (except for two very large institutions, the larger institutions were more likely to use database-driven systems for their library Web sites and the smaller institutions were more likely to use content management systems. Associate’s and special focus colleges were less likely than other types of institutions to use either database driven or content management systems. Associate’s institutions were more likely to achieve ADA (Americans with Disabilities Act Web accessibility compliance. Only 48.6% of respondents utilised usability testing during Web site design.Conclusion – The author expected that institutions providing higher levels of education would have better-resourced Web design and training, but the results of the survey did not support this expectation. One reason why associate’s colleges performed better than other institutions in some areas of Web design may be that these colleges tend to offer more Web design and computer technology courses than baccalaureate, master’s and doctorate-granting institutions. Web site design and testing attracted fewer resources than might be expected in academic libraries. Across all types of institutions, Web design tended to be the responsibility of a small team or one person, with most Web designers having other responsibilities apart from the library’s Web site. Just over half of the institutions surveyed did not implement usability testing of their library Web sites.

  6. The National Shipbuilding Research Program, 1990 Ship Production Symposium, Paper No. 4B-1: Solving SARA Compliance with Computerized Hazardous Materials Tracking

    National Research Council Canada - National Science Library

    Johnston, Don; Schoenleber, Dave

    1990-01-01

    ...) has forced facilities to keep track of hazardous materials as never before. EPCRA contains five major reporting requirements including planning notification, emergency release notification, Material Safety Data Sheet (MSDS...

  7. MULTICULTURALISM AND RELIGIOUS-BASED CONFLICT: EVENTS OF CONFLICT BASED ON ETHNICITY, RELIGION, RACE, AND INTER-GROUP RELATIONS (SARA IN THE CITY OF PONTIANAK

    Directory of Open Access Journals (Sweden)

    Lailial Muhtifah

    2013-06-01

    Full Text Available There is a tendency of similar idea that caught the conflict prevention and management efforts nowadays to the articles of the Charter of Medina which was religious-based and containing the theory of civil society. It I mostly on the handling of conflict which tends to take preventive measures and to stop the conflict directly, as well as making a comprehensive synergistic effort to mange conflict. Conflict prevention is a core component of a comprehensive Conflict Management Program. This paper explores the conflict that occurred in Ponianak between a group of people from ethnic Dayak and members of an Islamic organization in 2012 which includes an important lesson for the people of West Kalimantan, both for the government and the community elements especially in dealing with a dispute between different groups of people. An integrative prevention has been proven to be able to answer the question of handling a conflict that has a potential to escalate into a full-scale riot. This work concludes that an integrative conflict handling model may become a viable alternative model to be adopted by the community of West Kalimantan in particular and other societies in general. A synergic integrative conflict handling model that reflects local wisdom of the people of Pontianak is expected to inspire real peace for various communities with a multicultural background. Key words: multicultural, religious-based conflict, ethnicity, religion

  8. Screamy Bird

    DEFF Research Database (Denmark)

    Tarby, Sara; Cermak, Daniel

    2016-01-01

    Sara Tarby, Daniel Cermak-Sassenrath. Screamy Bird. Digital game. Kulturnatten 2016, Danish Science Ministry, Copenhagen, DK, Oct 14, 2016.......Sara Tarby, Daniel Cermak-Sassenrath. Screamy Bird. Digital game. Kulturnatten 2016, Danish Science Ministry, Copenhagen, DK, Oct 14, 2016....

  9. Molecular phylogeny of ateline new world monkeys (Platyrrhini, atelinae) based on gamma-globin gene sequences: evidence that brachyteles is the sister group of lagothrix.

    Science.gov (United States)

    Meireles, C M; Czelusniak, J; Schneider, M P; Muniz, J A; Brigido, M C; Ferreira, H S; Goodman, M

    1999-06-01

    Nucleotide sequences, each spanning approximately 7 kb of the contiguous gamma1 and gamma2 globin genomic loci, were determined for seven species representing all extant genera (Ateles, Lagothrix, Brachyteles, and Alouatta) of the New World monkey subfamily Atelinae. After aligning these seven ateline sequences with outgroup sequences from several other primate (non-ateline) genera, they were analyzed by maximum parsimony, maximum likelihood, and neighbor-joining algorithms. All three analyzes estimated the same phylogenetic relationships: [Alouatta [Ateles (Brachyteles, Lagothrix)

  10. Epimural Indicator Phylotypes of Transiently-Induced Subacute Ruminal Acidosis in Dairy Cattle

    OpenAIRE

    Wetzels, Stefanie U.; Mann, Evelyne; Metzler-Zebeli, Barbara U.; Pourazad, Poulad; Qumar, Muhammad; Klevenhusen, Fenja; Pinior, Beate; Wagner, Martin; Zebeli, Qendrim; Schmitz-Esser, Stephan

    2016-01-01

    The impact of a long-term subacute rumen acidosis (SARA) on the bovine epimural bacterial microbiome (BEBM) and its consequences for rumen health is poorly understood. This study aimed to investigate shifts in the BEBM during a long-term transient SARA model consisting of two concentrate-diet-induced SARA challenges separated by a 1-week challenge break. Eight cows were fed forage and varying concentrate amounts throughout the experiment. In total, 32 rumen papilla biopsies were taken for DNA...

  11. The Y chromosome of the Atelidae family (Platyrrhini): study by chromosome microdissection.

    Science.gov (United States)

    Gifalli-Iughetti, C; Koiffmann, C P

    2009-01-01

    In order to study the intergeneric variability of the Y chromosome, we describe the hybridization of the Y chromosome of Brachytelesarachnoides, obtained by microdissection, to metaphases of Atelesbelzebuthmarginatus, Lagothrixlagothricha, and Alouatta male specimens. Brachytelesarachnoides (Atelinae) has 62 chromosomes and a very small Y chromosome. Our results showed that the Brachytelesarachnoides Y chromosome probe hybridized to Lagothrixlagothricha metaphases yielding one hybridization signal on only the tiny Y chromosome, and when hybridized with Atelesbelzebuthmarginatus metaphases it yielded one hybridization signal on two thirds of the small acrocentric Y chromosome. However, no hybridization signal was observed in Alouatta metaphases (subfamily Alouattinae), a closely related genus in the Atelidae family. Furthermore, our data support a close phylogenetic relationship among Brachyteles, Ateles, and Lagothrix and their placement in the Atelinae subfamily, but exclude Alouatta from this group indicating its placement as basal to this group. Copyright 2009 S. Karger AG, Basel.

  12. Book Review: Commemoration as Conflict: Space, Memory and Identity in Peace Processes

    DEFF Research Database (Denmark)

    McQuaid, Sara Dybris

    2016-01-01

    Book rewiew: Commemoration as Conflict: Space, Memory and Identity in Peace Processes / Sara McDowell and Maire Braniff Palgrave Macmillan, 2014, 224pp., ISBN 978-0-230-27375-7......Book rewiew: Commemoration as Conflict: Space, Memory and Identity in Peace Processes / Sara McDowell and Maire Braniff Palgrave Macmillan, 2014, 224pp., ISBN 978-0-230-27375-7...

  13. Butanol/Gasoline Test Plan

    Science.gov (United States)

    2012-03-01

    authorities. METHODS FOR CLEANING UP: Contain spillage and then collect with non-combustible absorbent material, (e.g. sand, soil , diatomaceous earth...SARA 311/312 Hazards: Fire Hazard, Acute Health Hazard, and Chronic Health Hazard CERCLA SECTION 103 and SARA SECTION 304 (RELEASE TO THE ENVIROMENT

  14. En ny flugt ind i skoven

    DEFF Research Database (Denmark)

    Haarder, Jon Helt

    2008-01-01

    Thure Erik Lund: IND. (Inn). Oversat fra norsk af Sara Koch. 192 sider, 199 kr. Gyldendal. UDKOMMER I DAG. Fire stjerner......Thure Erik Lund: IND. (Inn). Oversat fra norsk af Sara Koch. 192 sider, 199 kr. Gyldendal. UDKOMMER I DAG. Fire stjerner...

  15. Journal of Food Technology in Africa - Vol 7, No 3 (2002)

    African Journals Online (AJOL)

    Identification of Lactic Acid Bacteria isolated from Opaque beer (Chibuku) for potential use as a starter culture. Chamunorwa A Togo, Sara B Sara B. Feresu, Anthony Mutukumira. http://dx.doi.org/10.4314/jfta.v7i3.19239 · Performance of different strains of Pleurotus species under Ghanaian conditions. K Vowotor, M Obodai.

  16. Use and Access of Grey Literature in Special Libraries may be Hindered by Lack of Visibility and Cataloguing. A review of: Ranger, Sara L. “Grey Literature in Special Libraries: Access in Use.” Publishing Research Quarterly 21.1 (Spring 2005: 53-63.

    Directory of Open Access Journals (Sweden)

    David Hook

    2006-03-01

    Full Text Available Objective – To examine the barriers to making grey literature (literature not controlled by commercial publishers easier to access in special libraries. Design – Interviews. Setting – Variety of special libraries (government, corporate and specialized academic in the United States. Subjects – Sixteen librarians from fourteen organizations in Washington, Michigan and Texas were interviewed. Four of the organizations were government libraries, four were corporate libraries and five were specialized academic libraries. One of the interviews was not used because the organization did not maintain a collection of paper‐based grey literature. Methods – Librarians were selected as possible interview subjects via three methods: some were previously familiar with the author; some were referred to the author by friends, family and colleagues; two candidates volunteered in response to a presentation of the project at a professional meeting. Interviews were conducted between February 2002 and May 2003. A standard set of seven questions were used, but often followed with further questions. The interviews were conducted either in the library or the librarian’s office. The interviews were tape‐recorded and the answers were written down. Interviews typically lasted between fifteen and thirty minutes and asked about the current state, holdings, access and use of grey literature in the special library. Main Results – Results from the interviews suggest a wide variance in the percentage of users that access grey literature. Grey literature was used less in the corporate libraries than the academic and government libraries. The percentage of the collection made up of grey literature also varied widely between the different libraries. Reports were found to be the most popular form of grey literature, although most of the libraries reported owning conference proceedings and newsletters in addition to reports. One interesting observation found during the interviews was that most of the users of grey literature are also producers of grey literature. The librarians surveyed reported that some of the reasons for using grey literature included use in research, to write (often more grey literature, interest in the topic, for class assignments, as records of previous practices, for localized studies, and for creating models and practices. Results found that for the libraries surveyed, much of the grey literature remains uncatalogued and what has been catalogued was done using a variety of methods. Over half of the libraries surveyed had their grey literature accessible online. Conclusion – Two main reasons were cited as explanations for why grey literature was not used as much as it should be: lack of cataloguing and visibility. In many of the libraries surveyed, much of the grey literature had not been catalogued, making it difficult to find and use the resources. Reasons cited for not cataloguing grey literature include lack of time, funds and/or knowledge. As well, in many of the libraries surveyed, it was found that the holdings of grey literature were not readily visible to the users, so users were not even aware that it existed. To improve the awareness and accessibility of grey literature, the author recommends regional depositories for grey literature, international standards for cataloguing and more cooperation between special libraries.

  17. REPRESENTASI ANTI DISKRIMINASI PADA FILM KARTUN 3D ZOOTOPIA (KAJIAN SEMIOTIKA ROLAND BARTHES

    Directory of Open Access Journals (Sweden)

    Ali Muqoddas

    2016-12-01

    Full Text Available Isu diskriminasi SARA seperti tiada habisnya terjadi di dunia ini, begitu juga di Indonesia. Hal ini mengakibatkan tema-tema tentang SARA menjadi sensitif ketika dibahas atau pun difilmkan. Hal ini mengakibatkan jarang ditemui film yang mengangkat tentang SARA. Lain halnya dengan Walt Disney. Walt Disney baru-baru ini merilis film kartun 3D yang mengangkat tema anti diskriminasi SARA yang berjudul Zootopia. Film ini menjadi menarik karena isu diskriminasi SARA yang diangkat dibalut dengan konsep yang kreatif hingga sensivitas isu SARA tersebut menjadi berkurang. Representasi anti diskriminasi SARA pada film Zootopia ini selanjutnya dikaji dengan metode semiotika Roland Barthes dengan pendekatan deskriptif kualitatif. Berdasarkan dari analisis, dapat disimpulkan bahwa film Zootopia memuat pesan ideologi tentang anti diskriminasi SARA bahwa kedudukan manusia dimata manusia yang lain pada hakikatnya adalah sama. Setiap manusia berhak dan wajib memperlakukan dan diperlakukan secara bijak tanpa memperdulikan background asal manusia itu sendiri. Penghargaan pada setiap individu tidak didasarkan pada faktor keturunan, ras, suku ataupun agama, namun didasarkan pada prestasi dari individu itu sendiri. Kata Kunci: diskriminasi SARA, Zootopia, Roland Barthes Abstract The issue of racial discrimination as an endless happen in this world, so also in Indonesia. This resulted in the themes of SARA be sensitive when discussed or filmed. This resulted in a rare film that raised about SARA. Another case with Walt Disney. Walt Disney recently released 3D animated film that mengangat theme of anti-discrimination SARA entitled Zootopia. This film is interesting because racial discrimination issues raised wrapped with a creative concept to the sensitivity of the racial issues be reduced. SARA anti-discrimination representation on film Zootopia is further studied with Roland Barthes semiotic methods with qualitative descriptive approach. Based on the analysis, it can

  18. The evolution of brachiation in ateline primates, ancestral character states and history.

    Science.gov (United States)

    Jones, Andrea L

    2008-10-01

    This study examines how brachiation locomotion evolved in ateline primates using recently-developed molecular phylogenies and character reconstruction algorithms, and a newly-collected dataset including the fossils Protopithecus, Caipora, and Cebupithecia. Fossils are added to two platyrrhine molecular phylogenies to create several phylogenetic scenarios. A generalized least squares algorithm reconstructs ateline and atelin ancestral character states for 17 characters that differentiate between ateline brachiators and nonbrachiators. Histories of these characters are mapped out on these phylogenies, producing two scenarios of ateline brachiation evolution that have four commonalities: First, many characters change towards the Ateles condition on the ateline stem lineage before Alouatta splits off from the atelins, suggesting that an ateline energy-maximizing strategy began before the atelines diversified. Second, the ateline last common ancestor is always reconstructed as an agile quadruped, usually with suspensory abilities. It is never exactly like Alouatta and many characters reverse and change towards the Alouatta condition after Alouatta separates from the atelins. Third, most characters undergo homoplastic change in all ateline lineages, especially on the Ateles and Brachyteles terminal branches. Fourth, ateline character evolution probably went through a hindlimb suspension with tail-bracing phase. The atelines most likely diversified via a quick adaptive radiation, with bursts of punctuated change occurring in their postcranial skeletons, due to changing climatic conditions, which may have caused competition among the atelines and between atelines and pitheciines.

  19. The use of sodic monensin and probiotics for controlling subacute ruminal acidosis in sheep

    Directory of Open Access Journals (Sweden)

    Elizabeth Schwegler

    2015-02-01

    Full Text Available The aim of this work was to validate a protocol for induction of subacute ruminal acidosis (SARA (Experiment 1 and test the efficiency of probiotic Saccharomyces cerevisiae or monensin to avoid pH ruminal drops in sheep (Experiment 2. In Experiment 1, six ewes were fasted for two days and then fed most with concentrate during four days. Ewes in this protocol had ruminal fluid pH below 6.0 and kept it for 75 consecutive hours. In Experiment 2, 18 sheep were distributed into three groups: Control (CG, n = 6, monensin (MG, n = 6 and probiotic group (PG, n = 6. SARA was induced according Experiment 1. PG had lower pH (5.7 ± 0.1 than CG (6.0 ± 0.1 (P = 0.05, while MG (5.7 ± 0.1 was similar to both during SARA induction. SARA induction reduced ruminal protozoa population (P < 0.05 and increased chloride concentrations in ruminal fluid (P < 0.01. In serum, SARA increased concentrations of phosphorus (P < 0.01, AST (P < 0.01 and GGT (P < 0.01, but reduced LDH (P < 0.01. In conclusion, the protocol used for SARA induction was able to maintain ruminal pH between 5.5-6.0 for more than 48 hours. However, monensin and probiotics supplementation was not effective in preventing changes in ruminal and serum parameters during SARA.

  20. Alteration in Fecal Microbiota Associated with Grain-induced Subacute Ruminal Acidosis Challenge in Dairy Cows

    DEFF Research Database (Denmark)

    Danscher, Anne Mette; Derakshani, Hooman; Li, Shucong

    2014-01-01

    in the field are often not detected. Thus, other and better markers of SARA are needed. The purpose of this research was to study the feces microbiome during SARA and assess the possibilities of using feces microbial markers as indicators of SARA. Methods: Six lactating, rumen cannulated, Danish Holstein cows...... were used in a blocked design study including two blocks. In the first block, two cows received control diet and two cows received SARA-challenge diet. In the second block, former control cows received SARA diet while two new cows received control diet. Cows received a total mixed ration (TMR; 24......% concentrate) for four weeks before the trial. SARA was induced by gradual substitution of 40% of TMR with grain pellets (50:50 wheat:barley) over 3 days. Full SARA diet was fed for four days. Rumen pH was measured continuously by indwelling probes (eCow). Feces samples were taken at 9 am and 9 pm on last day...

  1. Epimural indicator phylotypes of transiently-induced subacute ruminal acidosis in dairy cattle

    Directory of Open Access Journals (Sweden)

    Stefanie Urimare Wetzels

    2016-03-01

    Full Text Available The impact of a long-term subacute rumen acidosis (SARA on the bovine epimural bacterial microbiome (BEBM and its consequences for rumen health is poorly understood. This study aimed to investigate shifts in the BEBM during a long-term transient SARA model consisting of two concentrate-diet-induced SARA challenges separated by a one-week challenge break. Eight cows were fed forage and varying concentrate amounts throughout the experiment. In total, 32 rumen papilla biopsies were taken for DNA isolation (4 sampling time points per cow: at the baseline before concentrate was fed, after the first SARA challenge, after the challenge break, and after the second SARA challenge. Ruminal pH was continuously monitored. The microbiome was determined using Illumina MiSeq sequencing of the 16S rRNA gene (V345 region. In total 1,215,618 sequences were obtained and clustered into 6,833 operational taxonomic units (OTUs. Campylobacter and Kingella were the most abundant OTUs (16.5% and 7.1%. According to ruminal pH dynamics, the second challenge was more severe than the first challenge. Species diversity estimates and evenness increased during the challenge break compared to all other sampling time points (P<0.05. During both SARA challenges, Kingella- and Azoarcus-OTUs decreased (0.5 and 0.4 fold-change and a dominant Ruminobacter-OTU increased during the challenge break (18.9 fold-change; P<0.05. qPCR confirmed SARA-related shifts. During the challenge break noticeably more OTUs increased compared to other sampling time points. Our results show that the BEBM re-establishes the baseline conditions slower after a SARA challenge than ruminal pH. Key phylotypes that were reduced during both challenges may help to establish a bacterial fingerprint to facilitate understanding effects of SARA conditions on the BEBM and their consequences for the ruminant host.

  2. Epimural Indicator Phylotypes of Transiently-Induced Subacute Ruminal Acidosis in Dairy Cattle.

    Science.gov (United States)

    Wetzels, Stefanie U; Mann, Evelyne; Metzler-Zebeli, Barbara U; Pourazad, Poulad; Qumar, Muhammad; Klevenhusen, Fenja; Pinior, Beate; Wagner, Martin; Zebeli, Qendrim; Schmitz-Esser, Stephan

    2016-01-01

    The impact of a long-term subacute rumen acidosis (SARA) on the bovine epimural bacterial microbiome (BEBM) and its consequences for rumen health is poorly understood. This study aimed to investigate shifts in the BEBM during a long-term transient SARA model consisting of two concentrate-diet-induced SARA challenges separated by a 1-week challenge break. Eight cows were fed forage and varying concentrate amounts throughout the experiment. In total, 32 rumen papilla biopsies were taken for DNA isolation (4 sampling time points per cow: at the baseline before concentrate was fed, after the first SARA challenge, after the challenge break, and after the second SARA challenge). Ruminal pH was continuously monitored. The microbiome was determined using Illumina MiSeq sequencing of the 16S rRNA gene (V345 region). In total 1,215,618 sequences were obtained and clustered into 6833 operational taxonomic units (OTUs). Campylobacter and Kingella were the most abundant OTUs (16.5 and 7.1%). According to ruminal pH dynamics, the second challenge was more severe than the first challenge. Species diversity estimates and evenness increased during the challenge break compared to all other sampling time points (P < 0.05). During both SARA challenges, Kingella- and Azoarcus-OTUs decreased (0.5 and 0.4 fold-change) and a dominant Ruminobacter-OTU increased during the challenge break (18.9 fold-change; P < 0.05). qPCR confirmed SARA-related shifts. During the challenge break noticeably more OTUs increased compared to other sampling time points. Our results show that the BEBM re-establishes the baseline conditions slower after a SARA challenge than ruminal pH. Key phylotypes that were reduced during both challenges may help to establish a bacterial fingerprint to facilitate understanding effects of SARA conditions on the BEBM and their consequences for the ruminant host.

  3. Research Article Special Issue

    African Journals Online (AJOL)

    pc

    2018-03-07

    Mar 7, 2018 ... ation with the pump units of various types operating in the optimal and correct mode. ... In the existing irrigation systems of the Sara- ... Journal of Fundamental and Applied Sciences is licensed under a Creative Commons ...

  4. Annual report of the Grenoble Institute of nuclear science

    International Nuclear Information System (INIS)

    Vignon, B.

    1988-01-01

    Research in theoretical nuclear physics; peripheral reactions and intermediate energy physics; characteristics of reaction mechanisms in heavy ion collisions; nuclear structure; fundamental interactions; interdisciplinary studies; experimental methods and instrumentation; and the SARA accelerator is presented [fr

  5. Basics of SCI Rehabilitation

    Medline Plus

    Full Text Available ... How Peer Counseling Works Julie Gassaway, MS, RN Pediatric Injuries Pediatric Spinal Cord Injury 101 Lawrence Vogel, MD The Basics of Pediatric SCI Rehabilitation Sara Klaas, MSW Transitions for Children ...

  6. Preventing Pressure Sores

    Medline Plus

    Full Text Available ... How Peer Counseling Works Julie Gassaway, MS, RN Pediatric Injuries Pediatric Spinal Cord Injury 101 Lawrence Vogel, MD The Basics of Pediatric SCI Rehabilitation Sara Klaas, MSW Transitions for Children ...

  7. Sex and Fertility After SCI

    Medline Plus

    Full Text Available ... How Peer Counseling Works Julie Gassaway, MS, RN Pediatric Injuries Pediatric Spinal Cord Injury 101 Lawrence Vogel, MD The Basics of Pediatric SCI Rehabilitation Sara Klaas, MSW Transitions for Children ...

  8. Spinal Cord Injury 101

    Medline Plus

    Full Text Available ... How Peer Counseling Works Julie Gassaway, MS, RN Pediatric Injuries Pediatric Spinal Cord Injury 101 Lawrence Vogel, MD The Basics of Pediatric SCI Rehabilitation Sara Klaas, MSW Transitions for Children ...

  9. Hella hingega karmid naised / Krista Kaer

    Index Scriptorium Estoniae

    Kaer, Krista

    1996-01-01

    Tänapäeva kriminaalromaani inglise ja ameerika autoritest (Dame Phyllis Dorothy James, Joan Smith, Lynda La Plante (inglise); Sara Paretsky, Sue Grafton, Patricia Cornwell (ameerika) ja nende poolt loodud naisdetektiivi kujudest

  10. Bridging the gap between farmers and supermarkets in Nicaragua ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2014-07-03

    Jul 3, 2014 ... Elder chose to study smallholder farmers after working in Kenya as an ... Combining this data will help her gain expertise in qualitative and quantitative work. ... Sara Elder interviews smallholder farmers in Nicaragua.

  11. 75 FR 80037 - Poultry Programs; Notice of Request for an Extension and Revision of a Currently Approved...

    Science.gov (United States)

    2010-12-21

    ... DEPARTMENT OF AGRICULTURE Agricultural Marketing Service [Doc. No. AMS-PY-10-0098] Poultry... David Bowden, Jr., Chief, Standards, Promotion, & Technology Branch; Poultry Programs, AMS, U.S.... FOR FURTHER INFORMATION CONTACT: Sara Lutton, Standards, Promotion, & Technology Branch; Poultry...

  12. Investigating Asphaltenes Composition in Crude Oil Samples using ...

    African Journals Online (AJOL)

    MBI

    2015-12-22

    Dec 22, 2015 ... composition of asphaltenes by Iatroscan TLC-FID method was compared with the weight% of asphaltenes precipitated. ... SARA in the crude oil samples were determined in this work ..... Fractionation and characterization of.

  13. Nutrition from aquaculture and home gardens in Cambodia

    International Development Research Centre (IDRC) Digital Library (Canada)

    is about 76% carbohydrate, only 10% protein, and only 14% fat. Foods from animal sources ... to increase and diversify food production and provide low- ... Senior Program Specialist, Ottawa, Canada (awesley@idrc.ca) or. Sara Ahmed, Senior ...

  14. Mind Over Matter: Methamphetamine

    Science.gov (United States)

    ... Teaching Guide and Series / Methamphetamine Mind Over Matter: Methamphetamine (Meth) Print Order Free Publication in: English Spanish ... paranoia, aggressiveness, and hallucinations. The Brain's Response to Methamphetamine Hi, my name's Sara Bellum. Welcome to my ...

  15. Are You Shopping Smart for Prescription Drugs?

    Science.gov (United States)

    ... work well for them through the CR Best Buy Drugs program. Photo courtesy of Sara Jorde Photography A ... National Library of Medicine, the Consumer Reports Best Buy Drugs program helps consumers discuss drug choices with their ...

  16. Policy challenges in modern health care

    National Research Council Canada - National Science Library

    Mechanic, David

    2005-01-01

    ... for the Obesity Epidemic KENNETH E. WARNER 99 8 Patterns and Causes of Disparities in Health DAVID R. WILLIAMS 115 9 Addressing Racial Inequality in Health Care SARA ROSENBAUM AND JOEL TEITELBAU...

  17. Pop / Tõnis Kahu

    Index Scriptorium Estoniae

    Kahu, Tõnis, 1962-

    2008-01-01

    Heliplaatidest: Get Cape. Wear Cape. Fly "Searching For The Hows And Whys", The Black Crowes "Warpaint", Jonny Greenwood "There Will Be Blood", Tegan & Sara "The Con", Teräsbetoni "Myrskyntuoja", REM "Accelerate"

  18. 76 FR 11494 - List of Recipients of Indian Health Scholarships Under the Indian Health Scholarship Program

    Science.gov (United States)

    2011-03-02

    ... Collins, Sara Jane, University of Oklahoma, Cherokee Nation, Oklahoma Cook, David D., Rocky Vista... University, Oglala Sioux Tribe of the Pine Ridge Reservation, South Dakota Jim, Leroy, The Fielding Institute...

  19. 77 FR 44310 - Quarterly Publication of Individuals, Who Have Chosen To Expatriate, as Required by Section 6039G

    Science.gov (United States)

    2012-07-27

    ... JACINTA YEUNG CHEONG CHANG MICHAEL YIO-HOW CHENG NICOLAS VINCENT CHI TELLY TAI HSUAN CHINOY SAMIR MUSTAPHA... TONJA YVONNE SU JIN CHIN SU XIAOBO SARA SHAO SUEN SAMSON C. L. SY KEVIN NEIL TAN LAI HING THARALDSEN...

  20. Sex and Fertility After SCI

    Medline Plus

    Full Text Available ... Pediatric SCI Rehabilitation Sara Klaas, MSW Transitions for Children with Spinal Cord Injury Patricia Mucia, RN Family ... play_arrow How is the delivery of a child affected by the mother's spinal cord injury? play_ ...

  1. Technical Guidance for Hazardous Analysis, Emergency Planning for Extremely Hazardous Substances

    Science.gov (United States)

    This current guide supplements NRT-1 by providing technical assistance to LEPCs to assess the lethal hazards related to potential airborne releases of extremely hazardous substances (EHSs) as designated under Section 302 of Title Ill of SARA.

  2. the capacity of megasphaera elsdenii strain ncimb 41125 to control ...

    African Journals Online (AJOL)

    David

    SARA include grain treatment to reduce starch degradation, feed additives such as ... Keywords: Megasphaera elsdenii, ruminal acidosis, dairy cattle, beef cattle, sheep, ...... Mastitis. Retained foetal membranes. Metritis/endometritis. Ketosis.

  3. Journal of Biosciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Author Affiliations. Kayvan Etebari1 Leila Matindoost2. Department of Sericulture, Faculty of Natural Resources, University of Guilan, Somehe Sara, Iran; Department of Entomology, Faculty of Agriculture, University of Guilan, Rasht, Iran ...

  4. Bacteriophage-antibiotic synergism to control planktonic and biofilm ...

    African Journals Online (AJOL)

    Bacteriophage-antibiotic synergism to control planktonic and biofilm producing clinical isolates of Pseudomonas aeruginosa. Amina Amal Mahmoud Nouraldin, Manal Mohammad Baddour, Reem Abdel Hameed Harfoush, Sara AbdelAziz Mohamed Essa ...

  5. Reforming the American Military Officer Personnel System

    Science.gov (United States)

    2015-12-02

    Lamping Lewis, Henry Leonard, Julia Pollak, Christopher Guo and Bernard Rostker, Tour Lengths, Permanent Changes of Station, and Alternatives for...Raymond E. Conley, Stephanie Young, William A. Williams, Jeffrey Engstrom, Barbara Bicksler, Sara Beth Elson, Joseph Jenkins , Lianne Kennedy

  6. Basics of SCI Rehabilitation

    Medline Plus

    Full Text Available ... Spinal Cord Injury 101 Lawrence Vogel, MD The Basics of Pediatric SCI Rehabilitation Sara Klaas, MSW Transitions for Children with Spinal Cord Injury Patricia Mucia, RN Family Life After Pediatric Spinal Injury Dawn Sheaffer, MSW Rehabilitation ...

  7. Preventing Pressure Sores

    Medline Plus

    Full Text Available ... Spinal Cord Injury 101 Lawrence Vogel, MD The Basics of Pediatric SCI Rehabilitation Sara Klaas, MSW Transitions for Children with Spinal Cord Injury Patricia Mucia, RN Family Life After Pediatric Spinal Injury Dawn Sheaffer, MSW Rehabilitation ...

  8. Sex and Fertility After SCI

    Medline Plus

    Full Text Available ... Spinal Cord Injury 101 Lawrence Vogel, MD The Basics of Pediatric SCI Rehabilitation Sara Klaas, MSW Transitions for Children with Spinal Cord Injury Patricia Mucia, RN Family Life After Pediatric Spinal Injury Dawn Sheaffer, MSW Rehabilitation ...

  9. Spinal Cord Injury 101

    Medline Plus

    Full Text Available ... Spinal Cord Injury 101 Lawrence Vogel, MD The Basics of Pediatric SCI Rehabilitation Sara Klaas, MSW Transitions for Children with Spinal Cord Injury Patricia Mucia, RN Family Life After Pediatric Spinal Injury Dawn Sheaffer, MSW Rehabilitation ...

  10. Review of the Scientific Evidence of Using Population Normative Values for Post-Concussive Computerized Neurocognitive Assessments

    Science.gov (United States)

    2016-02-10

    R, Virginia Commonwealth University  Dr. Chris Giza, Professor of Pediatric Neurology and Neurosurgery, UCLA Brain Injury Research Center October...Sara Higgins , MPH Analyst, Grant Thornton LLP Kendal Brown, MBA Management Analyst, Information Innovators, Inc. Margaret Welsh Management

  11. Eczema (Atopic Dermatitis)Treatment

    Science.gov (United States)

    ... Lubricate or moisturize the skin two to three times a day using ointments such as petroleum jelly. Moisturizers should be ... Freeman Peter Hubbard Sara Jones Tony Lee Lara R. ... Kinyoun Lecture Series 2016 Kinyoun Lecture 2015 Kinyoun Lecture 2014 Kinyoun ...

  12. Depression among Congestive Heart Failure Patients: Results of a Survey from Central China

    Directory of Open Access Journals (Sweden)

    JPMS

    2011-10-01

    Full Text Available Tabish Hussain, Li Yu Shu, Xiang Cheng, Tumenjavkhlan Sosorburam, A.Seid Adji, Sara Tajammul, Aamra Sartaj (Union Hospital, Tongji Medical College, Huazhong University of Sciences and Technology, Wuhan, China (pages 38-42

  13. Assessing the viability of the Species at Risk Act in managing commercial exploitation and recovery of threatened and endangered marine fish in Canada

    OpenAIRE

    Druce, Courtney Danielle

    2012-01-01

    Commercially exploited threatened or endangered marine fish are consistently declined for listing under Canada’s Species at Risk Act (SARA), largely due to predicted socio-economic impacts associated with SARA’s prohibitions. However, commercial exploitation can be exempted from SARA’s general prohibitions. If exemptions were utilized, commercially exploited species could benefit from other aspects of SARA listing, and support continued economic opportunities for fishers. I conducted a litera...

  14. An Investigation into Rumen Fungal and Protozoal Diversity in Three Rumen Fractions, during High-Fiber or Grain-Induced Sub-Acute Ruminal Acidosis Conditions, with or without Active Dry Yeast Supplementation.

    Science.gov (United States)

    Ishaq, Suzanne L; AlZahal, Ousama; Walker, Nicola; McBride, Brian

    2017-01-01

    Sub-acute ruminal acidosis (SARA) is a gastrointestinal functional disorder in livestock characterized by low rumen pH, which reduces rumen function, microbial diversity, host performance, and host immune function. Dietary management is used to prevent SARA, often with yeast supplementation as a pH buffer. Almost nothing is known about the effect of SARA or yeast supplementation on ruminal protozoal and fungal diversity, despite their roles in fiber degradation. Dairy cows were switched from a high-fiber to high-grain diet abruptly to induce SARA, with and without active dry yeast (ADY, Saccharomyces cerevisiae ) supplementation, and sampled from the rumen fluid, solids, and epimural fractions to determine microbial diversity using the protozoal 18S rRNA and the fungal ITS1 genes via Illumina MiSeq sequencing. Diet-induced SARA dramatically increased the number and abundance of rare fungal taxa, even in fluid fractions where total reads were very low, and reduced protozoal diversity. SARA selected for more lactic-acid utilizing taxa, and fewer fiber-degrading taxa. ADY treatment increased fungal richness (OTUs) but not diversity (Inverse Simpson, Shannon), but increased protozoal richness and diversity in some fractions. ADY treatment itself significantly ( P PERMANOVA, P = 0.0001, P = 0.0452, P = 0.0068, Monte Carlo correction, respectively, and location was a significant factor ( P = 0.001, Monte Carlo correction) for protozoa. Diet-induced SARA shifts diversity of rumen fungi and protozoa and selects against fiber-degrading species. Supplementation with ADY mitigated this reduction in protozoa, presumptively by triggering microbial diversity shifts (as seen even in the high-fiber diet) that resulted in pH stabilization. ADY did not recover the initial community structure that was seen in pre-SARA conditions.

  15. Peranan Raja La Maddaremmeng Dalam Penyebaran Islam Di Bone

    Directory of Open Access Journals (Sweden)

    Nasruddin Nasruddin

    2014-06-01

    Full Text Available King Bone to Lamaddaremmeng XIII has a very large role and has the effect of early-early development of Islam in southern Sulawesi. He Maddaremeng is committed to enforce Sharia Law. His efforts were Eliminating slavery, Addition parewa Sara, to revamp the governance structure by adding positions previously unknown structure that positions parewa sara, eradication of idols, eliminating the arbitrary actions on others, Equal rights. Other efforts are trying to eliminate the differences in the degree of the community.

  16. Targets and special materials

    International Nuclear Information System (INIS)

    Blanc, R.; Bouriant, M.; Richaud, J.P.

    1997-01-01

    The target preparation group supplied a large number of samples to nuclear physicists for experiments using SARA and also other accelerators throughout the world. Particular preparation and projects include: 208 Pb, 116 Cd, 6 LiF, 123 Sb, In and Ta targets, strippers for SARA and GANIL, optical silicone disks for POLDER and GRAAL experiments, active participations for the AMS project and finally filament preparation for the GENEPI project. (authors)

  17. Ruminal acidosis: a review with detailed reference to the controlling agent Megasphaera elsdenii NCIMB 41125

    OpenAIRE

    Meissner, H.H.; Henning, P.H.; Horn, C.H.; Leeuw, K-J.; Hagg, F.M.; Fouché, G.

    2010-01-01

    Ruminal acidosis is discussed with reference to causes and economic and health implications. Distinction is made between the acute form which with proper adaptation to high energy diets is seldom encountered and the more problematic chronic or sub-acute form, commonly referred to as sub-acute ruminal acidosis (SARA). Apart from stepwise transition from roughage to concentrates, methods adopted to reduce SARA include grain treatment to reduce starch degradation, feed additives such as buffers ...

  18. Paducah Gaseous Diffusion Plant site environmental report for 1988

    International Nuclear Information System (INIS)

    Rogers, J.G.; Jett, T.G.

    1989-05-01

    Quantities of nonradiological chemical emissions are not included in this report this year. An addendum that will include the information will be published after the Superfund Amendments Reauthorization Act (SARA) Title III report is issued on July 1, 1989. When the addendum is published, probably in late July, a summary of the SARA Title III 313 report will be included. The SARA report provides the community with the opportunity to lean about estimated quantities of certain toxic chemicals used at a facility that are routinely or accidentally released into the environment. The addendum that will be published after the SARA report will summarize the SARA report and is expected to include some additional ''large quantity'' chemicals used or stored at the facilities that are not required to be reported by SARA Title III but are known to be emitted from the facilities. The addendum will not be all inclusive but will provide emissions information on the major chemical emissions to the air, water, or land from processes at the facilities

  19. In vitro residual anti-bacterial activity of difloxacin, sarafloxacin and their photoproducts after photolysis in water

    International Nuclear Information System (INIS)

    Kusari, Souvik; Prabhakaran, Deivasigamani; Lamshoeft, Marc; Spiteller, Michael

    2009-01-01

    Fluoroquinolones like difloxacin (DIF) and sarafloxacin (SARA) are adsorbed in soil and enter the aquatic environment wherein they are subjected to photolytic degradation. To evaluate the fate of DIF and SARA, their photolysis was performed in water under stimulated natural sunlight conditions. DIF primarily degrades to SARA. On prolonged photodegradation, seven photoproducts were elucidated by HR-LC-MS/MS, three of which were entirely novel. The residual anti-bacterial activities of DIF, SARA and their photoproducts were studied against a group of pathogenic strains. DIF and SARA revealed potency against both Gram-positive and -negative bacteria. The photoproducts also exhibited varying degrees of efficacies against the tested bacteria. Even without isolating the individual photoproducts, their impact on the aquatic environment could be assessed. Therefore, the present results call for prudence in estimating the fate of these compounds in water and in avoiding emergence of resistance in bacteria caused by the photoproducts of DIF and SARA. - Assessment of the residual anti-bacterial efficacies of difloxacin, sarafloxacin and their photoproducts in water, and estimating their impact on the aquatic environment in inducing resistance to microorganisms.

  20. [Ecological affinity and current distribution of primates (Cebidae) in Campeche, Mexico].

    Science.gov (United States)

    Navarro Fernández, Eloísa; Pozo de la Tijera, Carmen; Escobedo Cabrera, Enrique

    2003-06-01

    We carried out surveys realized field work from March to September 2000 to get the current distribution of Cebids in the state of Campeche, Mexico. Based on interviews and direct observations. We defined the distribution of Ateles geoffroyi yucatanensis and Alouatta pigra and we documented the first time localities where Allouata palliata is found in the state. We made distributional maps of each species using vegetation overlays from Inventario Nacional Forestal (Inv For) and each point documented during fieldwork. We presented the distribution of species according to confiability of the verified or expected data. Using the attributes table of Inv For, we calculated the areas of distribution which were 22,735 km2 for Alouatta sp. and 18,501 km2 for A. g. yucatanensis. We also presented the area occupied by each species according to vegetation types and the relative proportion of these vegetation types in the state. We confirmed the ability of Alouatta sp. to survive in disturbed environments produced by habitat fragmentation, and the affinity of A. g. yucatanesis to well preserved habitats.

  1. Afinidad ecológica y distribución actual de Primates (Cebidae en Campeche, México

    Directory of Open Access Journals (Sweden)

    Eloísa Navarro Fernández

    2003-06-01

    Full Text Available Realizamos recorridos de campo durante la temporada de marzo a septiembre del 2000 para obtener la distribución actual de cébidos presentes en el estado de Campeche, México. Por medio de encuestas y observaciones directas, se determinó la distribución de Ateles geoffroyi yucatanensis, Alouatta pigra y se documentó por primera vez localidades en Campeche donde se encuentra Alouatta palliata mexicana. Se elaboraron mapas de distribución de las especies con la ayuda de los paquetes ArcInfo y ArcView por medio de la sobreposición de coberturas de vegetación, obtenidas en el Inventario Nacional Forestal (1995 y los puntos de registro obtenidos durante el trabajo de campo. En los mapas se presenta la distribución verificada y probable de cada especie. Con la ayuda de los atributos de dicho inventario se calcularon las áreas de distribución confiable resultando 22 736 km 2 para Alouatta sp. y 18 501 km 2 para A. g. yucatanensis. Se presenta la superficie ocupada por cada especie en los diferentes tipos de vegetación y el porcentaje respectivo, así como el porcentaje de ocupación de las especies en el territorio del Estado, para la discusión de las afinidades ecológicas. Para Alouatta, se corroboró su capacidad para soportar la presión de encontrase en ambientes perturbados ocasionados por la fragmentación del hábitat, al ser este ambiente el ocupado con mayor proporción por este género. En el caso de A. g. yucatanensis encontramos que presenta una mayor afinidad a los ambientes no perturbados.We carried out surveys realized field work from March to September 2000 to get the current distribution of Cebids in the state of Campeche, Mexico. Based on interviews and direct observations. We defined the distribution of Ateles geoffroyi yucatanensis and Alouatta pigra and we documented the first time localities where Allouata palliata is found in the state. We made distributional maps of each species using vegetation overlays from

  2. RNA structure alignment by a unit-vector approach.

    Science.gov (United States)

    Capriotti, Emidio; Marti-Renom, Marc A

    2008-08-15

    The recent discovery of tiny RNA molecules such as microRNAs and small interfering RNA are transforming the view of RNA as a simple information transfer molecule. Similar to proteins, the native three-dimensional structure of RNA determines its biological activity. Therefore, classifying the current structural space is paramount for functionally annotating RNA molecules. The increasing numbers of RNA structures deposited in the PDB requires more accurate, automatic and benchmarked methods for RNA structure comparison. In this article, we introduce a new algorithm for RNA structure alignment based on a unit-vector approach. The algorithm has been implemented in the SARA program, which results in RNA structure pairwise alignments and their statistical significance. The SARA program has been implemented to be of general applicability even when no secondary structure can be calculated from the RNA structures. A benchmark against the ARTS program using a set of 1275 non-redundant pairwise structure alignments results in inverted approximately 6% extra alignments with at least 50% structurally superposed nucleotides and base pairs. A first attempt to perform RNA automatic functional annotation based on structure alignments indicates that SARA can correctly assign the deepest SCOR classification to >60% of the query structures. The SARA program is freely available through a World Wide Web server http://sgu.bioinfo.cipf.es/services/SARA/. Supplementary data are available at Bioinformatics online.

  3. Usaha La Sangkuru Patau Dalam Mengembangkan Agama Islam Di Kerajaan Wajo

    Directory of Open Access Journals (Sweden)

    Nasruddin Nasruddin

    2014-12-01

    Full Text Available La Sangkuru Patau is one of the Arung Matoa Wajo has substantial powers. His remarks could be a law and society Wajo stick to what he says. So when La Sangkuru Patau said that he had converted to Islam, the community participated Wajo also embraced Islam. Arung Matoa Wajo La Sangkuru with doing business in developing Islam in Wajo that bring Datu Sulaiman to provide Islamic religious instruction in public Wajo, then set up a sara officers' special charge of handling issues such royal Friday prayers, warnings Islamic holidays , then hold the officer cadre sara 'that will be placed outside the capital of the kingdom (Tosora, sara officers' given the facilities, such as free of taxes, as well as the parallel position to the position of indigenous stakeholders.

  4. Substorm associated radar auroral surges: a statistical study and possible generation model

    Directory of Open Access Journals (Sweden)

    B. A. Shand

    Full Text Available Substorm-associated radar auroral surges (SARAS are a short lived (15–90 minutes and spatially localised (~5° of latitude perturbation of the plasma convection pattern observed within the auroral E-region. The understanding of such phenomena has important ramifications for the investigation of the larger scale plasma convection and ultimately the coupling of the solar wind, magnetosphere and ionosphere system. A statistical investigation is undertaken of SARAS, observed by the Sweden And Britain Radar Experiment (SABRE, in order to provide a more extensive examination of the local time occurrence and propagation characteristics of the events. The statistical analysis has determined a local time occurrence of observations between 1420 MLT and 2200 MLT with a maximum occurrence centred around 1700 MLT. The propagation velocity of the SARAS feature through the SABRE field of view was found to be predominately L-shell aligned with a velocity centred around 1750 m s–1 and within the range 500 m s–1 and 3500 m s–1. This comprehensive examination of the SARAS provides the opportunity to discuss, qualitatively, a possible generation mechanism for SARAS based on a proposed model for the production of a similar phenomenon referred to as sub-auroral ion drifts (SAIDs. The results of the comparison suggests that SARAS may result from a similar geophysical mechanism to that which produces SAID events, but probably occurs at a different time in the evolution of the event.

    Key words. Substorms · Auroral surges · Plasma con-vection · Sub-auroral ion drifts

  5. Perlindungan Hukum Kelompok Teisme dalam Sistem Negara Hukum Pancasila

    Directory of Open Access Journals (Sweden)

    Tomy Michael

    2017-05-01

    Full Text Available Di era global saat ini, suatu bangsa dituntut mampu bersaing dengan negara lain. Agar tidak terlepas dari unsur khas Indonesia maka penguatan Pancasila sebagai ideologi adalah keharusan. Pancasila yang melingkupi keragaman suku, agama, ras dan antar golongan (SARA kurang tercermin dalam UU Nomor 23 Tahun 2006. Permasalahan yang timbul yaitu hilangnya unsur khas Indonesia yaitu kepercayaan atau agama tradisional karena adanya diskriminasi dengan pengosongan kolom agama dalam Kartu Kelurga (KK dan Kartu Tanda Penduduk (KTP (Pasal 61 dan Pasal 64 UU No. 23-2006. Penelitian ini bertujuan untuk menganalisis korelasi hukum UU No. 23 tahun 2016 dengan keberadaan Pancasila dan SARA di Indonesia. Metode penelitian yang digunakan adalah penelitian hukum normatif. Hasil penelitian ini menunjukkan bahwa UU No. 23 Tahun 2006 tidak selaras dengan semangat Pancasila yang mengakui keragaman SARA dan bertentang dengan asas keadilan dalam UU No. 12Tahun 2011. In the global era, a nation supposedly able to compete with other countries. In order not to be separated from the typical elements of Indonesia, the strengthening of Pancasila as an ideology is a must. Pancasila surrounding ethnic, religious, racial and sectarian (SARA less diversity reflected in Law No. 23 of 2006. The problems that arise, namely the loss of the typical elements of Indonesia namely traditional religious beliefs or because of their discrimination by emptying the religion column in Family Card (KK and Identity Card (KTP (Article 61 and Article 64 of Law No. 23-2006. This study aims to analyze the correlation on Law No. 23of 2016 with the existence of Pancasila and SARA in Indonesia. The method used is a normative legal research. The result of this study reveals that the Law No. 23 of 2006 not in line with the spirit of Pancasila that recognizes the diversity of SARA and incompatible with the principles of justice on Law No. 12 of 2011.

  6. The concentration principle applied to spaceborne solar arrays. AGORA mission: Studies synthesis

    Science.gov (United States)

    Laget, R.

    1986-01-01

    Studies that led to selection of the distributed 25 kW SARA LOUVRE concept for the solar cell generator to be flown on the AGORA asteroid mission, and the major characteristics of such a spaceborne solar array are summarized. In the SARA LOUVRE concept, a parabolic cross section reflector concentrates incident light over the rear face of the identical, preceding reflector dish. The whole set of reflectors is pivotally commanded, thus compensating the effects of depointing. Geometric concentration factor is 10. End of life power level at 2.5 AU is 4.5 kW.

  7. An Investigation into Rumen Fungal and Protozoal Diversity in Three Rumen Fractions, during High-Fiber or Grain-Induced Sub-Acute Ruminal Acidosis Conditions, with or without Active Dry Yeast Supplementation

    Directory of Open Access Journals (Sweden)

    Suzanne L. Ishaq

    2017-10-01

    Full Text Available Sub-acute ruminal acidosis (SARA is a gastrointestinal functional disorder in livestock characterized by low rumen pH, which reduces rumen function, microbial diversity, host performance, and host immune function. Dietary management is used to prevent SARA, often with yeast supplementation as a pH buffer. Almost nothing is known about the effect of SARA or yeast supplementation on ruminal protozoal and fungal diversity, despite their roles in fiber degradation. Dairy cows were switched from a high-fiber to high-grain diet abruptly to induce SARA, with and without active dry yeast (ADY, Saccharomyces cerevisiae supplementation, and sampled from the rumen fluid, solids, and epimural fractions to determine microbial diversity using the protozoal 18S rRNA and the fungal ITS1 genes via Illumina MiSeq sequencing. Diet-induced SARA dramatically increased the number and abundance of rare fungal taxa, even in fluid fractions where total reads were very low, and reduced protozoal diversity. SARA selected for more lactic-acid utilizing taxa, and fewer fiber-degrading taxa. ADY treatment increased fungal richness (OTUs but not diversity (Inverse Simpson, Shannon, but increased protozoal richness and diversity in some fractions. ADY treatment itself significantly (P < 0.05 affected the abundance of numerous fungal genera as seen in the high-fiber diet: Lewia, Neocallimastix, and Phoma were increased, while Alternaria, Candida Orpinomyces, and Piromyces spp. were decreased. Likewise, for protozoa, ADY itself increased Isotricha intestinalis but decreased Entodinium furca spp. Multivariate analyses showed diet type was most significant in driving diversity, followed by yeast treatment, for AMOVA, ANOSIM, and weighted UniFrac. Diet, ADY, and location were all significant factors for fungi (PERMANOVA, P = 0.0001, P = 0.0452, P = 0.0068, Monte Carlo correction, respectively, and location was a significant factor (P = 0.001, Monte Carlo correction for protozoa

  8. Management of Sub-acute Ruminal Acidosis in Dairy Cattle for Improved Production: A Review

    OpenAIRE

    Kafil Hussain; Amjad Ul Islam; Surinder Kumar Gupta

    2011-01-01

    Sub-acute ruminal acidosis (SARA) is a well-recognized digestive disorder that is an increasing health problem in most dairy herds. Feeding diets high in grain and other highly fermentable carbohydrates to dairy cows increases milk production, but also increases the risk of SARA. Sub-acute ruminal acidosis is defined as periods of moderately depressed ruminal pH, from about 5.5 to 5.0. Sub-acute ruminal acidosis may be associated with laminitis and other health problems resulting in decreased...

  9. Implementation of Comprehensive Environmental Response, Compensation, and Liability Act (CERCLA) Health Authority by the Agency for Toxic Substances and Disease Registry

    International Nuclear Information System (INIS)

    Siegel, M.R.

    1990-01-01

    The Superfund Amendments and Reauthorization Act (SARA) of 1986 greatly expanded the health authority of the Comprehensive Environmental Response, Compensation, and Liability Act. One of the federal agencies most affected by SARA is the Agency for Toxic Substances and Disease Registry (ATSDR) of the U.S. Public Health Service. Among other responsibilities, ATSDR was mandated to conduct health assessments within strict time frames for each site on or proposed for the U.S. Environmental Protection Agency's National Priorities List. The author will review ATSDR's efforts to address this new statutory mandate, especially for federal facilities, and will focus on different conceptual frameworks for implementing the health assessment program

  10. Avaliação do impacto da epizootia de Febre Amarela sobre as populações de primatas não humanos nas unidades de conservação do Rio Grande do Sul, Brasil

    Directory of Open Access Journals (Sweden)

    Marcos de Souza Fialho

    2012-05-01

    Full Text Available http://dx.doi.org/10.5007/2175-7925.2012v25n3p217   A Febre Amarela (FA é uma doença infecciosa aguda. No Brasil, a FA tem caráter sazonal, ocorrendo frequentemente entre os meses de janeiro a abril, quando fatores ambientais propiciam o aumento da abundância dos vetores. Há diversos relatos sobre a mortalidade de primatas devido à FA, em especial os do gênero Alouatta, mas há escassa informação disponível para verificar e quantificar os danos causados às populações de primatas por eventos desta natureza. O presente estudo busca avaliar o impacto do surto de FA ocorrido entre 2008 e 2009 sobre as populações de primatas nas unidades de conservação (UC do Estado do Rio Grande do Sul. A presença dos primatas e a ocorrência do surto foram registradas por meio de observações diretas e entrevistas. Foram visitadas 11 UC e realizadas 52 entrevistas. Constatou-se que destas UC, três não abrigam primatas, três abrigam populações de Alouatta caraya e quatro de Alouatta guariba. Cebus nigritus está presente em três UC. A única unidade de conservação severamente impactada pelo surto de FA foi o Parque Estadual do Espigão Alto, embora relatos de óbitos durante o surto tenham sido obtidos para a zona de amortecimento ou entorno próximo de outras cinco UC.

  11. Plasmodium simium/Plasmodium vivax infections in southern brown howler monkeys from the Atlantic Forest

    Directory of Open Access Journals (Sweden)

    Daniela Camargos Costa

    2014-08-01

    Full Text Available Blood infection by the simian parasite, Plasmodium simium, was identified in captive (n = 45, 4.4% and in wild Alouatta clamitans monkeys (n = 20, 35% from the Atlantic Forest of southern Brazil. A single malaria infection was symptomatic and the monkey presented clinical and haematological alterations. A high frequency of Plasmodium vivax-specific antibodies was detected among these monkeys, with 87% of the monkeys testing positive against P. vivax antigens. These findings highlight the possibility of malaria as a zoonosis in the remaining Atlantic Forest and its impact on the epidemiology of the disease.

  12. VICHADA: LA HOSPITALIDAD DEL ORINOCO. Pag. 150-157

    Directory of Open Access Journals (Sweden)

    Wilmer Velandia

    2013-03-01

    Full Text Available Donde el cielo y la sabana se unen en el infinito, se vislumbra una sola montaña en la lejanía, parece un gigante, antiguo y oscuro al final de la inmensidad un “Tepuye”, después de unas cuantas horas de camino se acerca este gran anciano que data del precámbrico, pero no está solo. Se observan algunos compañeros iguales a él, se podrían considerar como los guardianes del imponente y hermoso Orinoko, considerado en lengua Sikuani como la gran serpiente enroscada acompañada de una gran riqueza paisajística cultural y biodiversa; bosques de galería, diferentes tipos de sabana, esteros, lagunas, morichales, bosques inundables, las que recorren aguas blancas, negras y mixtas, rodeadas por diferentes etnias y grupos indígenas como Piaroas, Sikuanis – Guahibos, Cuibas y Amoruas, que viven en forma pacífica con llaneros y colonos, orgullosos de estas tierras, amables y hospitalarios que desde hace muchos años comparten este paraíso con: bagres, pirañas, anguilas, rayas, arawanas, anacondas, ranas, sapos, caimanes, babos, iguanas, tortugas, loros, búhos, guacamayas, azucareros, pavones, paujiles, águilas, zamuros, aulladores, armadillos, ocarros, chigüiros, osos hormigueros, ocelotes, jaguares, nutrias, murciélagos, cuerpo espines, zorros, venados y delfines, que pasan sus días entre; cedros, moriches, saladillos, caraños, yarumos, laureles, caimos, guaduas, guamos, alcornoques, chaparros, arepillos, palmiches y gualtes.

  13. Assessment Matters: Moving beyond Surveys

    Science.gov (United States)

    Wise, Vicki L.; Barham, Mary Ann

    2012-01-01

    The August 16, 2011, "Chronicle of Higher Education" article "Want Data? Ask Students. Again and Again" by Sara Lipka posits that in higher education there is a culture of oversurveying students and too often relying on surveys as the main, or only, way of assessing the impact of programs and services on student satisfaction and learning. Because…

  14. Some geological processes in the Macro-tidal regime of Gulf of Kachchh, Northwest coast of India

    Digital Repository Service at National Institute of Oceanography (India)

    Vora, K.H.; Chauhan, O.S.; Rao, B.R

    of about 150-350 m in the Kandla Creek The Sara, Sanu and Phang creeks exhibit uneven to rugged topography with about 4 to 12 m deep V-shaped channels The seismic profiles across these creeks show 10-15 m thick clays The channels are cutting across...

  15. 78 FR 47408 - Notice of Intent to Prepare an Environmental Impact Statement for Oil and Gas Leasing and...

    Science.gov (United States)

    2013-08-05

    ..., Sacramento, CA 95825 Documents pertinent to this proposal may be examined at the BLM California State Office, 2800 Cottage Way, Sacramento, CA 95825. FOR FURTHER INFORMATION CONTACT: Sara Acridge, Natural Resources Specialist, telephone 916-978-4557; address 2800 Cottage Way, Rm. W- 1623, Sacramento, CA 95825...

  16. The Workplace Literacy System Project (WLS). Final Performance Report.

    Science.gov (United States)

    Poulton, Bruce R.

    The Workplace Literacy System Project (WLS) prepared interactive CD-ROM discs containing about 50 hours of instruction and drill in basic skills presented within the context of the textile/apparel manufacturing industry. The project was conducted at a Sara Lee knit products plant in North Carolina. During the project, literacy task analyses were…

  17. 75 FR 59983 - National Priorities List, Final Rule-Newtown Creek

    Science.gov (United States)

    2010-09-29

    ...? H. May EPA delete portions of sites from the NPL as they are cleaned up? I. What is the Construction...), added by SARA. The revised HRS evaluates four pathways: Ground water, surface water, soil exposure, and... the site are typically not known at the time of listing. Although a CERCLA ``facility'' is broadly...

  18. 78 FR 31417 - National Priorities List, Final Rule No. 56

    Science.gov (United States)

    2013-05-24

    ... would be time-consuming or costly. In other cases, data for scoring some pathways are available, but... NPL as they are cleaned up? I. What is the Construction Completion List (CCL)? J. What is the sitewide... partly in response to CERCLA section 105(c), added by SARA. The revised HRS evaluates four pathways...

  19. 75 FR 9790 - National Priorities List, Final Rule-Gowanus Canal

    Science.gov (United States)

    2010-03-04

    ... of Sites From the NPL as They Are Cleaned Up? I. What Is the Construction Completion List (CCL)? J...), added by SARA. The revised HRS evaluates four pathways: ground water, surface water, soil exposure, and... the site are typically not known at the time of listing. Although a CERCLA ``facility'' is broadly...

  20. 78 FR 75534 - National Priorities List, Proposed Rule No. 59

    Science.gov (United States)

    2013-12-12

    ... portions of sites from the NPL as they are cleaned up? I. What is the Construction Completion List (CCL)? J... to CERCLA section 105(c), added by SARA. The revised HRS evaluates four pathways: ground water... precise nature and extent of the site are typically not known at the time of listing. Although a CERCLA...

  1. 76 FR 67209 - United States v. Grupo Bimbo S.A.B. de C.V., et al.; Proposed Final Judgment and Competitive...

    Science.gov (United States)

    2011-10-31

    ... substitute other bakery or food products for sliced bread for these and other uses. Therefore, a hypothetical... BBU and Sara Lee branded sliced-bread products as their first and second choices in sliced-bread... would be profitable after the acquisition. The same profit motive would apply to an increase in the...

  2. 1984-85 ISN progress report

    International Nuclear Information System (INIS)

    1985-01-01

    This progress report ISN 1984-1985 deals with the following subjects: nuclear physics theory, peripheral and intermediate energy physics, characteristics of reaction mechanisms in heavy ion collisions, nuclear structure, fundamental interactions, experimental methods and new instrumentation, some interdisciplinary research activities and technical activities, the SARA cyclotron and finally, technology transfer and valorisation [fr

  3. Modèles de gestion des ressources forestières du massif ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Expérimentation Participative et Adaptative de Modèles de Gestion des Ressources Forestières dans la Chaine Montagneuse de l'Atlas (Algérie, Maroc, Tunisie) : rapport final (17 mars 2009 au 18 septembre 2012). Download PDF. Reports. Unité de transformation de cire d'abeille (Commune de M'Sara). Download PDF ...

  4. ClassBeacons: designing distributed visualization of teachers’ physical proximity in the classroom.

    NARCIS (Netherlands)

    An, P.; Bakker, S.; Ordanovski, S.; Taconis, R.; Eggen, J.H.

    2018-01-01

    Pengcheng An, Saskia Bakker, Sara Ordanovski, Ruurd Taconis, Berry Eggen. 2018 (accepted at Oct 2017). ClassBeacons: designing distributed visualization of teachers’ physical proximity in the classroom. In Proceedings of Tangible and Embodied Interaction, TEI 2018, Mar 18-21, 2018,

  5. Journal of Earth System Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Low energy neutral atom imaging on the Moon with the SARA instrument ... that will be flown on the first Indian lunar mission Chandrayaan-1. ... Currently at NASA Goddard Space Flight Center, Mail Code 612.2, Greenbelt, MD 20771, USA.

  6. Early Support of Intracranial Perfusion

    Science.gov (United States)

    2009-10-01

    outcomes after traumatic brain injury: A multicenter analysis. Archives of Physical Medicine and Rehabilitation, 84(10), 1441- 1448. Cremer , O. L...Kolesnik Research Assistant 67.5 Sean Jordan Research Assistant 44.5 Sara Wade Research Assistant 90 David Prakash Research Assistant 63.6 Scott Berry

  7. To belong to the living

    DEFF Research Database (Denmark)

    Petersen, Michael Nebeling

    2013-01-01

    Med udgangspunkt i Lee Edelmans polemiske argumentation imod reproduktiv futurisme og Sara Ahmeds fokus på queer attachments analyserer og diskuterer artiklen queer slægtskab, som det fremstilles i den amerikanske spillefilm The Kids Are All Right. Der argumenteres for, at børnenes heteronormative...

  8. "Walking with a Ghost": Arts-Based Research, Music Videos, and the Re-Performing Body

    Science.gov (United States)

    Taylor, Pamela G.; Wilder, Shannon O.; Helms, Kathryn R.

    2007-01-01

    In folk-rock duo Tegan and Sara's 2004 music video "Walking with a Ghost," two women face one another, mirrored images in black and white. One is dressed in black--grunge shirt, pants and boots, while the other stands barefoot in a simple white dress. The black-clad figure removes three red paper hearts from her twin's chest, leaving crimson…

  9. Renewing Head Start's Promise: Invest in What Works for Disadvantaged Preschoolers

    Science.gov (United States)

    Mead, Sara

    2014-01-01

    Since Head Start's last reauthorization in 2007, the Department of Health and Human Services, which oversees Head Start, has implemented significant reforms that are improving the program. In "Renewing Head Start's Promise: Invest in What Works for Disadvantaged Preschoolers," Sara Mead offers several recommendations to enable…

  10. Sensorimotor Assessment and Rehabilitative Apparatus

    Science.gov (United States)

    2016-10-01

    become effective addressing health disparities. Title: Ethnic differences in endogenous pain regulation: PET imaging of opioid receptors Grant Number...campaigns, causing physical , sensory, cognitive, and behavioral/emotional changes. Therefore, a significant population of our wounded veterans suffer...collection. Training included medical screening for vestibular pathology, balance and gait assessments, and SARA testing. ii. Train Physical

  11. Associations between cardiovascular risk factors, hyper- and hypocoagulability

    NARCIS (Netherlands)

    Rafi, S.

    2011-01-01

    Sara Rafi beschrijft verbanden tussen risicofactoren voor hart- en vaatziekten (HVZ) en bloedstolling. Uit calciumneerslag op de aortaboog blijkt dat patiënten met veneuze trombose een verhoogde kans hebben op HVZ. Ook schildklieraandoeningen en het gebruik van ontstekingsremmers en

  12. Oil and gas property transfers: Analyzing the environmental risk through the environmental site assessment process

    International Nuclear Information System (INIS)

    Bratberg, D.; Hocker, S.

    1994-01-01

    The Superfund Act made anyone buying contaminated real estate liable for cleanup costs whether they know about the contamination or contributed to the contamination. In 1986, SARA amended the Superfund Act to include a provision known as the ''Innocent Landowner Defense.'' This provision created a defense for purchasers of contaminated property who did not contribute to the contamination and had no reason to believe that the property was contaminated at the time of the real estate transfer. SARA allows the purchasers and lenders to perform an environmental assessment using ''due diligence'' to identify contamination problems existing at a site. Since the passing of SARA, the environmental site assessment (ESA) process has become commonplace during the transfer of commercial real estate. Since the introduction of SARA, many professional associations, governmental agencies, and proposed federal legislation have struggled to produce a standard for conducting Phase 1 ESAs. Only recently has a standard been produced. Until recently, the domestic oil and gas industry has been relatively unconcerned about the Superfund liability issues. This approach was created by Congress's decision in 1980 to temporarily exempt the majority of oil and gas exploration and production wastes from federal hazardous waste rulings. However, new stringent rules governing oil and gas waste management practices are being considered by federal and state regulatory agencies. Based upon this knowledge and the awakening of public awareness, the use of ESAs for oil and gas transactions is increasing

  13. Near East/South Asia Report, No. 2778.

    Science.gov (United States)

    1983-07-08

    alternative had not been satis- factory. In that speech he also warned Europe about the U.S.A. Europe is the U.S.A’s sacrificial lamb , he claimed, and...to wait and let the Aguda members " stew in their own juices" until they would agree to the lowest price possible for voting in Sara Doron. The Price

  14. Workplace Stress Relief (A Cup of Health with CDC)

    Centers for Disease Control (CDC) Podcasts

    2014-07-31

    The stress of everyday life can lead to all kinds of health problems. It’s particularly a problem at work. In this podcast, Dr. Sara Luckhaupt discusses the health impact of work-related stress.  Created: 7/31/2014 by MMWR.   Date Released: 7/31/2014.

  15. 2015 Liquid Crystals Gordon Research Conference and Gordon Research Seminar

    Science.gov (United States)

    2015-10-20

    Faculdade de Ciências e Tecnologia , Universidade Nova de Lisboa, Portugal) "Joule-Heating Effect: A New Route to PDLCs Memory Removal" 9:55 am - 10...Madison Poster Presenter Registered Carvalho, Sara F UNINOVA, Faculdade de Ciências e Tecnologia , Universidade Nova de Lisboa Speaker Registered Cha

  16. Selecting, Evaluating and Creating Policies for Computer-Based Resources in the Behavioral Sciences and Education.

    Science.gov (United States)

    Richardson, Linda B., Comp.; And Others

    This collection includes four handouts: (1) "Selection Critria Considerations for Computer-Based Resources" (Linda B. Richardson); (2) "Software Collection Policies in Academic Libraries" (a 24-item bibliography, Jane W. Johnson); (3) "Circulation and Security of Software" (a 19-item bibliography, Sara Elizabeth Williams); and (4) "Bibliography of…

  17. Demonstration and Commercialization of the Sediment Ecosystem Assessment Protocol (SEAP)

    Science.gov (United States)

    2017-07-09

    31  6.1.1  Performance Objective #1: Water Quality Maintenance...green represents where a thin- layer sand cap was installed in April 2014. .................................................................12  Figure...device(s) PSNS Puget Sound Naval Shipyard QA/QC Quality Assurance/ Quality Control SARA Superfund Amendments and Reauthorization Act SCCWRP

  18. Ecology and Conservation of Acacia senegal in the Rangelands ...

    African Journals Online (AJOL)

    Ecology and Conservation of Acacia senegal in the Rangelands ofLuwero and Nakasongola Districts. Jacob Godfrey Agea, Joseph Obua, Sara Namirembe, Mukadasi Buyinza, Daniel Waiswa. Abstract. No Abstract. Full Text: EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL ...

  19. Agroforestry potential of Acacia senegal in the rangelands of luwero ...

    African Journals Online (AJOL)

    Agroforestry potential of Acacia senegal in the rangelands of luwero and Nakasongola districts. Jacob Godfrey Agea, Joseph Obua, Sara Namirembe, Mukadasi Buyinza, Daniel Waiswa. Abstract. No Abstract. Full Text: EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT.

  20. The Relationships among Writing Skills, Writing Anxiety and Metacognitive Awareness

    Science.gov (United States)

    Balta, Elif Emine

    2018-01-01

    The purpose of this study was to investigate the relationships among students' argumentative text writing skills, writing anxiety, and metacognitive awareness. The participants were composed of 375 8th graders in six middle schools in Sivas. Metacognitive Awareness Inventory (B Form) which was adapted in to Turkish by Karakelle & Saraç (2007)…

  1. Measuring the socio-economic impacts of agroforestry projects in the Philippines

    Science.gov (United States)

    Evan Mercer; Belita Vega; Hermie Francisco; Robin Maille

    1994-01-01

    Conventional wisdom suggests that agroforestry projects can provide both ecological and economic benefits. Most agroforestry project evaluations, however, have failed to adequately assess the soci0-economic impacts. For example, a review of 108 agroforestry project impact evaluations by Sara Scherr of IFPRJ reported that only 8% assessed economic costs or benefits, 5%...

  2. Disease: H01705 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available H01705 Bilateral sudden sensorineural hearing loss Bilateral sudden sensorineural ...hearing loss (SNHL) represents a rare disease entity, constituting less than 5 % of all sudden SNHL cases. U...nlike unilateral disease, bilateral sudden SNHL appears to be mostly related to serious systemic pathology, ...543 603629 601072 600965 PMID:24331736 ... AUTHORS ... Sara SA, Teh BM, Friedland P ... TITLE ... Bilateral sud

  3. Bulletin of Materials Science | News

    Indian Academy of Sciences (India)

    Enhanced antibacterial performance of Fe 3 O 4 –Ag and MnFe 2 O 4 –Ag ... Department of Chemistry, Fatih University, 34500 Buyukcekmece-Istanbul, Turkey ... Chemicals and Chemical Industry Trade Company, Saraçlar Industrial Zone, No.

  4. Numerical analysis of a one-dimensional multicomponent model of the in-situ combustion process

    DEFF Research Database (Denmark)

    Nesterov, Igor; Shapiro, Alexander; Stenby, Erling Halfdan

    2013-01-01

    , the model is based on SARA representation of a petroleum mixture (saturates–aromatics–resins–asphaltenes), which may react differently with oxygen and produce other components (for example, light oils and coke). In total, the model contains 14 components, which may undergo 15 chemical reactions. The set...

  5. African Journal of Biotechnology - Vol 15, No 33 (2016)

    African Journals Online (AJOL)

    Micropropagation of caçari under different nutritive culture media, antioxidants, and levels of agar and pH · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Maria Da Conceicao Da Rocha Araujo, Edvan Alves Chagas, Maria Isabel Ribeiro Garcia, Sara Thiele Sobral ...

  6. Browse Title Index

    African Journals Online (AJOL)

    ... hemorrhage mimicking a pneumopathy: a rare complication of dual antiplatelet therapy for ST elevation myocardial infarction, Abstract PDF. Sara Oualim, Charafeddine Ait Elharda, Dounia Benzeroual, Mustapha El Hattaoui. Vol 12, No 1 (2012), Pulmonary epidermoid carcinoma in a patient with acromegaly: a rare entity ...

  7. Our Immune System

    Science.gov (United States)

    Our Immune System A story for children with primary immunodeficiency diseases Written by Sara LeBien IMMUNE DEFICIENCY FOUNDATION A note ... who are immune deficient to better understand their immune system. What is a “ B-cell, ” a “ T-cell, ” ...

  8. Leveraging Existing Laboratory Capacity towards Universal Health ...

    African Journals Online (AJOL)

    Adequately equipped clinical laboratories should provide early warning signals of health risks. The Assessment categorized the laboratories at three levels relating to the type of facility, these being hospital, health center and health post. This study used results from the SARA to determine the ability to make timely diagnosis ...

  9. Banana nectar as a medium for testing pollen viability and ...

    African Journals Online (AJOL)

    Administrator

    2007-05-16

    May 16, 2007 ... The accession TMB2x 8075 - 7 showed no significant pollen germination in nectar and sucrose. Eleven genotypes (55%) showed significant increase in pollen ..... SAS (1999) SAS Institute Inc. Cary, USA. Sara CC, José OF, ...

  10. Human Aspects of Library Automation: Helping Staff and Patrons Cope. Papers presented at the Annual Clinic on Library Applications of Data Processing (22nd, Urbana, Illinois, April 14-16, 1985).

    Science.gov (United States)

    Shaw, Debora, Ed.

    This collection explores the human aspect of the automation and reautomation of library functions as both library staff and library users are expected to adapt to and use computers. A brief introduction by Debora Shaw sets the stage for the following papers: (1) "Terminal Paralysis, or Showdown at the Interface" (Sara Fine); (2)…

  11. Avgang 2017: Sommerkonsert i Aulaen

    OpenAIRE

    2017-01-01

    Avgangsstudenter fra MA2 opera og studenter fra MA1 holder konsert med sang fra operaer, lieder og fra operetter. MA2 sangere: Hanne Korsbrekke Askeland, Dagfinn Andersen, Sara Aasen. MA1 sangere: Eilert Egil Taugbøl Hasseldal, Marcela Randem, Nora Oleanne Sårheim, Tina Therese Tuven

  12. 77 FR 62562 - Self-Regulatory Organizations; ICE Clear Credit LLC; Notice of Filing and Immediate Effectiveness...

    Science.gov (United States)

    2012-10-15

    ... two single names (The Hillshire Brands Company and DE US, Inc.). II. Self-Regulatory Organization's... the Sara Lee Corporation's successor companies, The Hillshire Brands Company and DE US, Inc. This... things, that the rules of a clearing agency be designed to promote the prompt and accurate clearance and...

  13. Corporate social responsibility in the coffee sector: The dynamics of MNC responses and code development

    NARCIS (Netherlands)

    Kolk, A.

    2005-01-01

    Since the collapse of the international coffee agreement in 1989, attention has increasingly focused on the role of multinational corporations in this sector. As the main actors in the international coffee chain, companies such as Sara Lee/Douwe Egberts, Nestlé and Kraft have been pressurised to

  14. Student Pressure Subject of Debate

    Science.gov (United States)

    Gewertz, Catherine

    2006-01-01

    This article discusses student pressure as a subject of debate. The latest debate about schoolwork is being fueled by three recent books: "The Homework Myth" by Alfie Kohn, "The Case Against Homework" by Sara Bennett and Nancy Kalish, and "The Overachievers", by Alexandra Robbins, which depicts overextended high…

  15. Kanuti gildi saalis toimub kuni 24. XI festival "Continental Breakfast Tallinn"

    Index Scriptorium Estoniae

    2005-01-01

    Korraldajad: Anders Härm, Priit Raud. 4. XI Tellervo Kalleineni (Soome) performance "Lase mind/Let me". 5. XI Saralundeni (Sara Lunden, Rootsi) muusikaline performance "Sweet Beat Tour". 8. ja 9. XI esineb babaLAN (Vlado Gotvan Repnik, Sloveenia) multimeedia-performance'iga

  16. State Authorization Reciprocity Agreement: Participation and Access to Higher Education

    Science.gov (United States)

    Onwuameze, Nkechi

    2017-01-01

    The State Authorization Reciprocity Agreement initiative was launched in 2014 to provide a uniform standard for the regulation of distance education across states in the United States. The system established by the National Council for State Authorization Reciprocity Agreement (NC-SARA) allows willing post-secondary institutions to participate…

  17. Mapping the transcription start points of the Staphylococcus aureus eap, emp, and vwb promoters reveals a conserved octanucleotide sequence that is essential for expression of these genes.

    Science.gov (United States)

    Harraghy, Niamh; Homerova, Dagmar; Herrmann, Mathias; Kormanec, Jan

    2008-01-01

    Mapping the transcription start points of the eap, emp, and vwb promoters revealed a conserved octanucleotide sequence (COS). Deleting this sequence abolished the expression of eap, emp, and vwb. However, electrophoretic mobility shift assays gave no evidence that this sequence was a binding site for SarA or SaeR, known regulators of eap and emp.

  18. VES magas Riias

    Index Scriptorium Estoniae

    2002-01-01

    Valie Export Society (Kadi Estland, Killu Sukmit, Marko Laimre, Meelis Salujärv) osales 9.-11. V Riias toimunud rahvusvahelisel üritusel "6th element" remake-aktsiooniga. Performance'itega esinesid Sara Lunden Rootsist, Kate Pendry Norrast, Jenia Svetlova Venemaalt, Solomia Savtshuk ja Natalia Golibroda Ukrainast

  19. Spazio ASI, INFN e Nobel Ting a caccia di antimateria

    CERN Document Server

    Boz,

    2003-01-01

    "Una apparecchiatura per la ricerca dell' antimateria che nell'autunno del 2005 sara' installata sulla Stazione Spaziale e' al centro di un accordo di collaborazione tra l'Agenzia Spaziale Italiana e il Nobel Samuel Ting, del Mit e del Cern di Ginevra, firmato oggi a Roma (1 page).

  20. Mapping the Heart

    Science.gov (United States)

    Hulse, Grace

    2012-01-01

    In this article, the author describes how her fourth graders made ceramic heart maps. The impetus for this project came from reading "My Map Book" by Sara Fanelli. This book is a collection of quirky, hand-drawn and collaged maps that diagram a child's world. There are maps of her stomach, her day, her family, and her heart, among others. The…

  1. An electronic health record for infertility clinics | Coetsee | South ...

    African Journals Online (AJOL)

    Objective. To design a user-friendly electronic health record system for infertility clinics (EHRIC) to capture quality data that will allow advanced audit and practice analysis, and to use the captured data for the South African Register of Assisted Reproductive Techniques (SARA) database and as a clinical research function.

  2. Towards a sustainable coffee market: paradoxes faced by a multinational company

    NARCIS (Netherlands)

    Kolk, A.

    2012-01-01

    This paper examines the case of sustainable coffee as faced by Sara Lee's International Coffee and Tea Division (SL), asking which strategic direction the company should take considering its regulatory, competitive, and societal contexts. More than a decade after sustainable coffee became a

  3. "Who Wants to Be Sad Over and Over Again?": Emotion Ideologies in Contemporary German Education about the Holocaust

    Science.gov (United States)

    Krieg, Lisa Jenny

    2015-01-01

    Based on an ethnographic field study in Cologne, this article discusses the connection between memory practices and emotion ideologies in Holocaust education, using Sara Ahmed's concept of affective economies. Moral goals, political demands, and educators' care for their students lead to tensions in the education process. Two case studies…

  4. Record of Decision for the Ford Building Waste Unit (643-11G) Operable Unit; FINAL

    International Nuclear Information System (INIS)

    Fraley, S.

    2002-01-01

    This decision document presents the selected remedial for the Ford Building Waste Unit (FBWU), in Aiken, South Carolina, which was chosen in accordance with CERCLA, as amended by SARA, and, to the extent practical, the National Oil and Hazardous Substances Pollution Contingency Plan (NCP). This decision is based on the Administrative Record File for this specific RCRA/CERCLA site

  5. The Economic Costs of Childhood Disability

    Science.gov (United States)

    Stabile, Mark; Allin, Sara

    2012-01-01

    Childhood disabilities entail a range of immediate and long-term economic costs that have important implications for the well-being of the child, the family, and society but that are difficult to measure. In an extensive research review, Mark Stabile and Sara Allin examine evidence about three kinds of costs--direct, out-of-pocket costs incurred…

  6. 75 FR 78944 - Proposed Establishment of the Pine Mountain-Mayacmas Viticultural Area; Comment Period Reopening

    Science.gov (United States)

    2010-12-17

    ...://www.ttb.gov/wine/wine-rulemaking.shtml under Notice No. 105. You also may view copies of all published... Bureau (TTB) received a petition from Sara Schorske of Compliance Service of America, prepared and filed on her own behalf and on behalf of local wine industry members, to establish the 4,600-acre ``Pine...

  7. Temporal dynamics of in-situ fiber-adherent bacterial community under ruminal acidotic conditions determined by 16S rRNA gene profiling.

    Directory of Open Access Journals (Sweden)

    Renee M Petri

    Full Text Available Subacute rumen acidotic (SARA conditions are a consequence of high grain feeding. Recent work has shown that the pattern of grain feeding can significantly impact the rumen epimural microbiota. In a continuation of these works, the objective of this study was to determine the role of grain feeding patterns on the colonization and associated changes in predicted functional properties of the fiber-adherent microbial community over a 48 h period. Eight rumen-cannulated Holstein cows were randomly assigned to interrupted or continuous 60%-grain challenge model (n = 4 per model to induce SARA conditions. Cows in the continuous model were challenged for 4 weeks, whereas cows of interrupted model had a 1-wk break in between challenges. To determine dynamics of rumen fiber-adherent microbial community we incubated the same hay from the diet samples for 24 and 48 h in situ during the baseline (no grain fed, week 1 and 4 of the continuous grain feeding model as well as during the week 1 following the break in the interrupted model. Microbial DNA was extracted and 16SrRNA amplicon (V3-V5 region sequencing was done with the Illumina MiSeq platform. A significant decrease (P 0.1% relative abundance in the rumen, 18 of which were significantly impacted by the feeding challenge model. Correlation analysis of the significant OTUs to rumen pH as an indicator of SARA showed genus Succiniclasticum had a positive correlation to SARA conditions regardless of treatment. Predictive analysis of functional microbial properties suggested that the glyoxylate/dicarboxylate pathway was increased in response to SARA conditions, decreased between 24h to 48h of incubation, negatively correlated with propanoate metabolism and positively correlated to members of the Veillonellaceae family including Succiniclasticum spp. This may indicate an adaptive response in bacterial metabolism under SARA conditions. This research clearly indicates that changes to the colonizing fiber

  8. Atelinae phylogenetic relationships: the trichotomy revived?

    Science.gov (United States)

    Collins, A C

    2004-08-01

    This research examines phylogenetic relationships between members of the Atelinae subfamily (Alouatta, Ateles, Brachyteles, and Lagothrix), based on analysis of three genetic regions. Two loci, cytochrome c oxidase subunit II (COII) and the hypervariable I portion of the control region, are part of the mitochondrial genome. The other is a single-copy nuclear gene, Aldolase A Intron V. Analysis of these genetic regions provides support for tribe Alouattini containing the Alouatta species, while tribe Atelini contains the other three genera. However, these three genetic regions produce conflicting results for relationships among tribe Atelini members. Previous genetic studies supported grouping Brachyteles with Lagothrix, leaving Ateles in a separate subclade. The present data sets vary based on the genetic region analyzed and method of analysis suggesting all possible cladistic relationships. These results are more consistent with investigations of morphology and behavior among these primates. The primary cause of discrepancy between this study and previous genetic studies is postulated to reside in increased sampling in the present study of genetic variation among members of the Atelinae, specifically Ateles. The present study utilized samples of Ateles from all postulated species for this genetically variable primate, while previous studies used only one or two species of Ateles. This paper demonstrates that shifting relationships are produced when different species of Ateles are used to reconstruct phylogenies. This research concludes that a trichotomy should still be supported between members of tribe Atelini until further analyses, which include additional Atelinae haplotypes are conducted. Copyright 2003 Wiley-Liss, Inc.

  9. Altered TGF-β endocytic trafficking contributes to the increased signaling in Marfan syndrome.

    Science.gov (United States)

    Siegert, Anna-Maria; Serra-Peinado, Carla; Gutiérrez-Martínez, Enric; Rodríguez-Pascual, Fernando; Fabregat, Isabel; Egea, Gustavo

    2018-02-01

    The main cardiovascular alteration in Marfan syndrome (MFS) is the formation of aortic aneurysms in which augmented TGF-β signaling is reported. However, the primary role of TGF-β signaling as a molecular link between the genetic mutation of fibrillin-1 and disease onset is controversial. The compartmentalization of TGF-β endocytic trafficking has been shown to determine a signaling response in which clathrin-dependent internalization leads to TGF-β signal propagation, and caveolin-1 (CAV-1) associated internalization leads to signal abrogation. We here studied the contribution of endocytic trafficking compartmentalization to increased TGF-β signaling in vascular smooth muscle cells (VSMC) from MFS patients. We examined molecular components involved in clathrin- (SARA, SMAD2) and caveolin-1- (SMAD7, SMURF2) dependent endocytosis. Marfan VSMC showed higher recruitment of SARA and SMAD2 to membranes and their increased interaction with TGF-β receptor II, as well as higher colocalization of SARA with the early endosome marker EEA1. We assessed TGF-β internalization using a biotinylated ligand (b-TGF-β), which colocalized equally with either EEA1 or CAV-1 in VSMC from Marfan patients and controls. However, in Marfan cells, colocalization of b-TGF-β with SARA and EEA1 was increased and accompanied by decreased colocalization with CAV-1 at EEA1-positive endosomes. Moreover, Marfan VSMC showed higher transcriptional levels and membrane enrichment of RAB5. Our results indicate that increased RAB5-associated SARA localization to early endosomes facilitates its TGF-β receptor binding and phosphorylation of signaling mediator SMAD2 in Marfan VSMC. This is accompanied by a reduction of TGF-β sorting into multifunctional vesicles containing cargo from both internalization pathways. Copyright © 2017 Elsevier B.V. All rights reserved.

  10. Disparities in availability of essential medicines to treat non-communicable diseases in Uganda: A Poisson analysis using the Service Availability and Readiness Assessment.

    Science.gov (United States)

    Armstrong-Hough, Mari; Kishore, Sandeep P; Byakika, Sarah; Mutungi, Gerald; Nunez-Smith, Marcella; Schwartz, Jeremy I

    2018-01-01

    Although the WHO-developed Service Availability and Readiness Assessment (SARA) tool is a comprehensive and widely applied survey of health facility preparedness, SARA data have not previously been used to model predictors of readiness. We sought to demonstrate that SARA data can be used to model availability of essential medicines for treating non-communicable diseases (EM-NCD). We fit a Poisson regression model using 2013 SARA data from 196 Ugandan health facilities. The outcome was total number of different EM-NCD available. Basic amenities, equipment, region, health facility type, managing authority, NCD diagnostic capacity, and range of HIV services were tested as predictor variables. In multivariate models, we found significant associations between EM-NCD availability and region, managing authority, facility type, and range of HIV services. For-profit facilities' EM-NCD counts were 98% higher than public facilities (p < .001). General hospitals and referral health centers had 98% (p = .004) and 105% (p = .002) higher counts compared to primary health centers. Facilities in the North and East had significantly lower counts than those in the capital region (p = 0.015; p = 0.003). Offering HIV care was associated with 35% lower EM-NCD counts (p = 0.006). Offering HIV counseling and testing was associated with 57% higher counts (p = 0.048). We identified multiple within-country disparities in availability of EM-NCD in Uganda. Our findings can be used to identify gaps and guide distribution of limited resources. While the primary purpose of SARA is to assess and monitor health services readiness, we show that it can also be an important resource for answering complex research and policy questions requiring multivariate analysis.

  11. GC-MS analysis of the ruminal metabolome response to thiamine supplementation during high grain feeding in dairy cows.

    Science.gov (United States)

    Xue, Fuguang; Pan, Xiaohua; Jiang, Linshu; Guo, Yuming; Xiong, Benhai

    2018-01-01

    Thiamine is known to attenuate high-concentrate diet induced subacute ruminal acidosis (SARA) in dairy cows, however, the underlying mechanisms remain unclear. The major objective of this study was to investigate the metabolic mechanisms of thiamine supplementation on high-concentrate diet induced SARA. Six multiparous, rumen-fistulated Holstein cows were used in a replicated 3 × 3 Latin square design. The treatments included a control diet (CON; 20% starch, dry matter basis), a SARA-inducing diet (SAID; 33.2% starch, dry matter basis) and SARA-inducing diet supplemented with 180 mg of thiamine/kg of dry matter intake (SAID + T). On d21 of each period, ruminal fluid samples were collected at 3 h post feeding, and GC/MS was used to analyze rumen fluid samples. PCA and OPLS-DA analysis demonstrated that the ruminal metabolite profile were different in three treatments. Compared with CON treatment, SAID feeding significantly decreased rumen pH, acetate, succinic acid, increased propionate, pyruvate, lactate, glycine and biogenic amines including spermidine and putrescine. Thiamine supplementation significantly decreased rumen content of propionate, pyruvate, lactate, glycine and spermidine; increase rumen pH, acetate and some medium-chain fatty acids. The enrichment analysis of different metabolites indicated that thiamine supplementation mainly affected carbohydrates, amino acids, pyruvate and thiamine metabolism compared with SAID treatment. These findings revealed that thiamine supplementation could attenuate high-concentrate diet induced SARA by increasing pyruvate formate-lyase activity to promote pyruvate to generate acetyl-CoA and inhibit lactate generation. Besides, thiamine reduced biogenic amines to alleviate ruminal epithelial inflammatory response.

  12. Seismic Amplitude Ratio Analysis of the 2014-2015 Bár∂arbunga-Holuhraun Dike Propagation and Eruption

    Science.gov (United States)

    Caudron, Corentin; White, Robert S.; Green, Robert G.; Woods, Jennifer; Ágústsdóttir, Thorbjörg; Donaldson, Clare; Greenfield, Tim; Rivalta, Eleonora; Brandsdóttir, Bryndís.

    2018-01-01

    Magma is transported in brittle rock through dikes and sills. This movement may be accompanied by the release of seismic energy that can be tracked from the Earth's surface. Locating dikes and deciphering their dynamics is therefore of prime importance in understanding and potentially forecasting volcanic eruptions. The Seismic Amplitude Ratio Analysis (SARA) method aims to track melt propagation using the amplitudes recorded across a seismic network without picking the arrival times of individual earthquake phases. This study validates this methodology by comparing SARA locations (filtered between 2 and 16 Hz) with the earthquake locations (same frequency band) recorded during the 2014-2015 Bár∂arbunga-Holuhraun dike intrusion and eruption in Iceland. Integrating both approaches also provides the opportunity to investigate the spatiotemporal characteristics of magma migration during the dike intrusion and ensuing eruption. During the intrusion SARA locations correspond remarkably well to the locations of earthquakes. Several exceptions are, however, observed. (1) A low-frequency signal was possibly associated with a subglacial eruption on 23 August. (2) A systematic retreat of the seismicity was also observed to the back of each active segment during stalled phases and was associated with a larger spatial extent of the seismic energy source. This behavior may be controlled by the dike's shape and/or by dike inflation. (3) During the eruption SARA locations consistently focused at the eruptive site. (4) Tremor-rich signal close to ice cauldrons occurred on 3 September. This study demonstrates the power of the SARA methodology, provided robust site amplification; Quality Factors and seismic velocities are available.

  13. Systems analysis programs for hands-on integrated reliability evaluations (SAPHIRE) version 5.0

    International Nuclear Information System (INIS)

    Russell, K.D.; Kvarfordt, K.J.; Skinner, N.L.; Wood, S.T.

    1994-07-01

    The Systems Analysis Programs for Hands-on Integrated Reliability Evaluations (SAPHIRE) refers to a set of several microcomputer programs that were developed to create and analyze probabilistic risk assessments (PRAs), primarily for nuclear power plants. This volume is the reference manual for the Systems Analysis and Risk Assessment (SARA) System Version 5.0, a microcomputer-based system used to analyze the safety issues of a open-quotes familyclose quotes [i.e., a power plant, a manufacturing facility, any facility on which a probabilistic risk assessment (PRA) might be performed]. The SARA database contains PRA data primarily for the dominant accident sequences of a family and descriptive information about the family including event trees, fault trees, and system model diagrams. The number of facility databases that can be accessed is limited only by the amount of disk storage available. To simulate changes to family systems, SARA users change the failure rates of initiating and basic events and/or modify the structure of the cut sets that make up the event trees, fault trees, and systems. The user then evaluates the effects of these changes through the recalculation of the resultant accident sequence probabilities and importance measures. The results are displayed in tables and graphs that may be printed for reports. A preliminary version of the SARA program was completed in August 1985 and has undergone several updates in response to user suggestions and to maintain compatibility with the other SAPHIRE programs. Version 5.0 of SARA provides the same capability as earlier versions and adds the ability to process unlimited cut sets; display fire, flood, and seismic data; and perform more powerful cut set editing

  14. Risk management at hazardous waste sites

    International Nuclear Information System (INIS)

    Travis, C.C.; Doty, C.B.

    1990-01-01

    The Superfund Amendments and Reauthorization Act of 1986 (SARA) provided the Environmental Protection Agency (EPA) with additional resources and direction for the identification, evaluation, and remediation of hazardous waste sites in the United States. SARA established more stringent requirements for the Superfund program, both in terms of the pace of the program and the types of remedial alternatives selected. The central requirement is that remedial alternatives be ''protective of public health and the environment'' and ''significantly and permanently'' reduce the toxicity, mobility, or volume of contaminants. The mandate also requires that potential risk be considered in the decision-making process. This document discusses risk management at hazardous waste sites. Topics include selection of sites for placement on the National Priority List, risk assessment and the decision process, risk reduction and remedial alternative selection, and aquifer restoration. 10 refs., 2 figs

  15. Briefing paper -- Remedial Action Assessment System

    International Nuclear Information System (INIS)

    Buelt, J.L.

    1990-04-01

    Congress has mandated a more comprehensive management of hazardous wastes with the Resource Conservation and Recovery Act (RCRA), the Comprehensive Environmental Response, Compensation, and Liability Act (CERCLA or ''Superfund'') and the Superfund Amendment and Reauthorization Act (SARA). This mandate includes restoration of disposal sites contaminated through past disposal practices. This mandate applies to facilities operated for and by the Department of Energy (DOE), just as it does to industrial and other institutions. To help implement the CERCLA/SARA remedial investigation and feasibility study (RI/FS) process in a consistent, timely, and cost-effective manner, a methodology needs to be developed that will allow definition, sorting, and screening of remediation technologies for each operable unit (waste site). This need is stated specifically in Section 2.2.2.1 of the October 1989 Applied Research, Development, Demonstration, Testing, and Evaluation (RDDT ampersand E) Plan of the DOE. This Briefing Paper is prepared to respond to this need. 1 fig

  16. Soil treatment technologies combined

    International Nuclear Information System (INIS)

    Davis, K.J.; Russell, D.J.

    1993-01-01

    The Superfund Amendments and Reauthorization Act (SARA) presents a legislative mandate to select effective and long-term remediation options. SARA has spurred the development of innovative technologies and other remedial alternatives that can be applied to the diverse contaminated media at hazardous waste sites. Even though many treatment technologies have been investigated for use at hazardous waste sites, only a few have been used successfully. Soil vapor extraction and soil composting have achieved cleanup goals at sites with soils contaminated with solvents, aromatic hydrocarbons and petroleum derivatives. With the increased use of innovative on-site technologies, the integration of multiple technologies to remediate sites with complex contaminants becomes a viable and cost-effective remedial alternative. Soil vapor extraction and composting have been applied successfully as individual technologies at hazardous waste sites. An integration of these two technologies also has been used to remediate a complex contaminated site

  17. Time-To-Complete Prediction for Data Transfers

    CERN Document Server

    Toler, Wesley

    2016-01-01

    Currently, there is no prediction provided to users for the amount of time a particular data transfer from one site in the Worldwide LHC Computing Grid to another will take to complete. To develop a time-to-complete prediction, network performance data and per-file information is gathered from two separate databases and fused, and the resulting cleaned data is fitted using random forest regression. Results are shown for two separate links: the link from CERN Data Centre to Brookhaven National Laboratory’s ATLAS data center, and the link from CERN Data Centre to SARA-MATRIX in Amsterdam. A total RMS error of 25.93 minutes between predicted and test data is found for the CERN-PROD -> BNL-ATLAS link, while the CERN-PROD -> SARA-MATRIX link yields a total RMS error of 3.00 minutes.

  18. Pneumonia por varicela associada com síndrome da angústia respiratória aguda: relato de dois casos Varicella pneumonia complicated with acute respiratory distress syndrome: two cases report

    OpenAIRE

    Marcelo Moreno; Ricardo Castelão; Susana Orrico Peres; Suzana Margareth Lobo

    2007-01-01

    JUSTIFICATIVA E OBJETIVOS: A varicela é uma doença exantemática causada pela infecção primária do vírus varicela zoster (VVZ). A pneumonia pelo VVZ complicada com a síndrome da angústia respiratória aguda (SARA) é rara e associa-se a altas taxas de morbimortalidade. O objetivo deste estudo foi apresentar dois casos de pneumonia por varicela que evoluíram com SARA e outras disfunções orgânicas. RELATO DOS CASOS: Paciente de 15 anos, imunocomprometido com a síndrome da imunodeficiência adquirid...

  19. Application of the luminescence single-aliquot technique for dose estimation in the Marmara Sea

    International Nuclear Information System (INIS)

    Tanir, Guenes; Sencan, Emine; Boeluekdemir, M. Hicabi; Tuerkoez, M. Burak; Tel, Eyuep

    2005-01-01

    The aim of this study is to obtain the equivalent dose, which is the important quantity for all the studies related to the use of luminescence in dating sediments. Recent advances in luminescence dating have led to increasing application of the technique to sediment from the depositional environmental samples. The sample used in this study is the active main fault sample that was collected from the Sea of Marmara in NW Turkey. Equivalent dose was measured using both the multiple-aliquots and the single-aliquot techniques. In this study single aliquot regeneration on additive dose (SARA) procedure was also used. The result obtained was not in agreement with the results evaluated from the multiple-aliquots procedure. So a simple modification was suggested for SARA procedure. In our modified procedure the calculated dose (D) values were obtained by using the additive dose protocol instead of regeneration protocol

  20. Spectral characterization of crude oil using fluorescence (synchronous and time-resolved) and NIR (Near Infrared Spectroscopy); Caracterizacao espectral do petroleo utilizando fluorescencia (sincronizada e resolvida no tempo) e NIR (Near Infrared Spectroscopy)

    Energy Technology Data Exchange (ETDEWEB)

    Falla Sotelo, F.; Araujo Pantoja, P.; Lopez-Gejo, J.; Le Roux, G.A.C.; Nascimento, C.A.O. [Universidade de Sao Paulo (USP), SP (Brazil). Dept. de Engenharia Quimica. Lab. de Simulacao e Controle de Processos; Quina, F.H. [Universidade de Sao Paulo (USP), SP (Brazil). Inst. de Quimica. Centro de Capacitacao e Pesquisa em Meio Ambiente (CEPEMA)

    2008-07-01

    The objective of the present work is to evaluate the performance of two spectroscopic techniques employed in the crude oil characterization: NIR spectroscopy and fluorescence spectroscopy (Synchronous fluorescence - SF and Time Resolved Fluorescence - TRF) for the development of correlation models between spectral profiles of crude oil samples and both physical properties (viscosity and API density) and physico-chemical properties (SARA analysis: Saturated, Aromatic, Resins and Asphaltenes). The better results for viscosity and density were obtained using NIR whose prediction capacity was good (1.5 cP and 0.5 deg API, respectively). For SARA analysis, fluorescence spectroscopy revealed its potential in the model calibration showing good results (R2 coefficients greater than 0.85). TRF spectroscopy had better performance than SF spectroscopy. (author)

  1. Reseñas. Books Review

    Directory of Open Access Journals (Sweden)

    Díaz, Liliana

    2014-10-01

    Full Text Available TORRE, Claudia, El otro desierto de la nación argentina. Antología de narrativa expedicionaria, Bernal, Argentina, Editorial Universidad de Quilmes, 2011, 387 pp. MAURO, Diego y LICHTMAJER, Leandro (compiladores, Los costos de la política. Del Centenario al primer peronismo, Imago Mundi, Buenos Aires, 2014, 130 pp. DE MARCO; Miguel Ángel (h. Ciudad Puerto, Universidad y Desarrollo Regional, Rosario, 1919-1968. CEHDRE, Rosario, 2013, 542 pp. GUARDIA, Sara Beatriz. Primer Congreso Internacional. Las mujeres en los procesos de Independencia de América Latina. Lima, Perú. Sara Beatriz Guardia Edición, CEMHAL, UNESCO, USMP, 2014. 495 pp

  2. The technical status of the supersara project at its termination

    International Nuclear Information System (INIS)

    Markovina, A.; Randles, J.

    1987-01-01

    On March 10th 1983 the Council of Ministers of the European Community adopted the decision to abandon the SuperSARA project. In the frame of this decision, the Management of the SuperSARA project formulated the guidelines to close the project, which included the preparation of the present final report. This report presents the final status of the project, which means that it reflects the situation in March 1983, with a few updates introduced shortly afterwards in conformity with the safety requirements which were being revised at that time. The aim of this report is to give a general description of activities which were carried on to implement the experimental programme and to illustrate some important achievements reached in specific areas. In addition, it is also intended to provide the access key to the documentation which was produced in the past years, so as to make the most significant technical material easily available for any possible future use

  3. Systems Analysis Programs for Hands-on Integrated Reliability Evaluations (SAPHIRE), Version 5.0: Models and Results Database (MAR-D) reference manual. Volume 8

    International Nuclear Information System (INIS)

    Russell, K.D.; Skinner, N.L.

    1994-07-01

    The Systems Analysis Programs for Hands-on Integrated Reliability Evaluations (SAPHIRE) refers to a set of several microcomputer programs that were developed to create and analyze probabilistic risk assessments (PRAs), primarily for nuclear power plants. The primary function of MAR-D is to create a data repository for completed PRAs and Individual Plant Examinations (IPEs) by providing input, conversion, and output capabilities for data used by IRRAS, SARA, SETS, and FRANTIC software. As probabilistic risk assessments and individual plant examinations are submitted to the NRC for review, MAR-D can be used to convert the models and results from the study for use with IRRAS and SARA. Then, these data can be easily accessed by future studies and will be in a form that will enhance the analysis process. This reference manual provides an overview of the functions available within MAR-D and step-by-step operating instructions

  4. A survey of formal methods for determining functional joint axes.

    Science.gov (United States)

    Ehrig, Rainald M; Taylor, William R; Duda, Georg N; Heller, Markus O

    2007-01-01

    Axes of rotation e.g. at the knee, are often generated from clinical gait analysis data to be used in the assessment of kinematic abnormalities, the diagnosis of disease, or the ongoing monitoring of a patient's condition. They are additionally used in musculoskeletal models to aid in the description of joint and segment kinematics for patient specific analyses. Currently available methods to describe joint axes from segment marker positions share the problem that when one segment is transformed into the coordinate system of another, artefacts associated with motion of the markers relative to the bone can become magnified. In an attempt to address this problem, a symmetrical axis of rotation approach (SARA) is presented here to determine a unique axis of rotation that can consider the movement of two dynamic body segments simultaneously, and then compared its performance in a survey against a number of previously proposed techniques. Using a generated virtual joint, with superimposed marker error conditions to represent skin movement artefacts, fitting methods (geometric axis fit, cylinder axis fit, algebraic axis fit) and transformation techniques (axis transformation technique, mean helical axis, Schwartz approach) were classified and compared with the SARA. Nearly all approaches were able to estimate the axis of rotation to within an RMS error of 0.1cm at large ranges of motion (90 degrees ). Although the geometric axis fit produced the least RMS error of approximately 1.2 cm at lower ranges of motion (5 degrees ) with a stationary axis, the SARA and Axis Transformation Technique outperformed all other approaches under the most demanding marker artefact conditions for all ranges of motion. The cylinder and algebraic axis fit approaches were unable to compute competitive AoR estimates. Whilst these initial results using the SARA are promising and are fast enough to be determined "on-line", the technique must now be proven in a clinical environment.

  5. Subacute ruminal acidosis reduces sperm quality in beef bulls.

    Science.gov (United States)

    Callaghan, M J; McAuliffe, P; Rodgers, R J; Hernandez-Medrano, J; Perry, V E A

    2016-08-01

    Breeding bulls are commonly fed high-energy diets, which may induce subacute ruminal acidosis (SARA). In this experiment, 8 Santa Gertrudis bulls (age 20 ± 6 mo) were used to evaluate the extent and duration of effects of SARA on semen quality and the associated changes in circulating hormones and metabolites. The bulls were relocated and fed in yards with unrestricted access to hay and daily individual concentrate feeding for 125 d before SARA challenge. Semen was collected and assessed at 14-d intervals before the challenge to ensure acclimatization and the attainment of a stable spermiogram. The challenge treatments consisted of either a single oral dose of oligofructose (OFF; 6.5 g/kg BW) or an equivalent sham dose of water (Control). Locomotion, behavior, respiratory rate, and cardiovascular and gastrointestinal function were intensively monitored during the 24-h challenge period. Rumen fluid samples were retained for VFA, ammonia, and lactate analysis. After the challenge, semen was then collected every third day for a period of 7 wk and then once weekly until 12 wk, with associated blood collection for FSH, testosterone, inhibin, and cortisol assay. Percent normal sperm decreased in bulls dosed with OFF after the challenge period ( < 0.05) and continued to remain lower on completion of the study at 88 d after challenge. There was a corresponding increase in sperm defects commencing from 16 d after challenge. These included proximal cytoplasmic droplets ( < 0.001), distal reflex midpieces ( = 0.01), and vacuole and teratoid heads ( < 0.001). Changes in semen quality after challenge were associated with lower serum testosterone ( < 0.001) and FSH ( < 0.05). Serum cortisol in OFF bulls tended to be greater ( = 0.07) at 7 d after challenge. This study shows that SARA challenge causes a reduction in sperm quality sufficient to preclude bulls from sale as single sire breeding animals 3 mo after the event occurred.

  6. Pradinių klasių moksleivių mokymosi motyvacija, psichologinė savijauta ir mokyklinis nerimastingumas

    OpenAIRE

    Pileckaitė-Markovienė, Margarita

    2001-01-01

    This article deals with problem of learning motivation, school anxiety and well-being in middle childhood. The aim of investigation was to analyse inner consistency of Learning Motivation Scale, structure of learning motivation of primary school children and it's interrelations with school anxiety and well-being. Learning Motivation Scale (Zambacevičienė, Janulytė, 1998), Semantic Differential Type Scale for well-being in school (Beresnevičienė, 1995) and Test Anxiety Scale for children (Sara...

  7. Annual report 1979

    International Nuclear Information System (INIS)

    1980-01-01

    The research and development activities of the ISN for 1979 are reported. The main thrust is directed towards the SARA (Rhone-Alpes Accelerator System) project and the various technical and experimental aspects. Research work was carried out in the following areas: nuclear spectroscopy, giant resonances, reaction processes, experiments at ILL, intermediate energy physics and for the theoretical group: nuclear structure, nuclear reactions, three-body problem, thermal neutron capture and hypernuclear spectroscopy [fr

  8. Progress report of the Nuclear Physics Department (1.10.1983 - 30.9.1984)

    International Nuclear Information System (INIS)

    1985-01-01

    This progress report presents the experiments and the technological studies carried out at the Nuclear Physics Department of Saclay from October 1, 1983 to September 20, 1984. These studies concern the structure of nuclei and the nuclear reaction mechanisms. The experiments have been carried at the 9 MV tandem Van de Graaff, the 700 MeV electron linac, the synchrotron SATURNE, the heavy ion accelerator GANIL, the SARA facility at Grenoble, and the secondary beams at CERN [fr

  9. Use of Synthetic Peptides and Anti-Idiotypes for Controlling Human Immunodeficiency Virus Infections

    Science.gov (United States)

    1993-08-27

    example, studies by others have suggested that Iy-I. isolates which readily form syncytia in vitro may be associated with a more rapid rate of disease ...isolates which readily form syncytia in vitro may be associated with a more rapid rate of disease progression in vivo. Using fluorescent intracellular...will be useful reagents in testing sara for neutralizing activity in vitro. 0. Longitudinal analysis of the humoral inmune response to RIV-I gPi60

  10. Trading Nets for Guns: The Impact of Illegal Fishing on Piracy in Somalia

    Science.gov (United States)

    2010-09-01

    and World Order, Draft, Royal Irish Academy, National University of Ireland , Galway (Galway: Centr for Ocean Policy Studies, 2009), 26–27...Kismayo.75 Thus, piracy was transformed by warlord entrepreneurship , in its organization, targets, tactics, and potential profitability beginning in...World Order, Draft, Royal Irish Academy, National University of Ireland , Galway (Galway: Centr for Ocean Policy Studies, 2009), 26–27. Percy, Sara

  11. Progress report of the Nuclear Physics Department (1.10.1982 - 30.9.1983)

    International Nuclear Information System (INIS)

    1984-04-01

    This progress report presents the experiments and the technological studies carried out at the Nuclear Physics Department of Saclay from October 1, 1982 to September 30, 1983. These studies concern the structure of nuclei and hypernuclei and various reaction mechanisms. They have been performed with the 9 MV tandem Van de Graaff, with the 700 MeV electron linac, at the synchrotron SATURNE, the heavy ion accelerator GANIL, the SARA facility at Grenoble and the secondary beams at CERN [fr

  12. The role of synthetic fuels in natural gas global market; Il ruolo dei combustibili sintetici nello scenario mondiale del gas naturale

    Energy Technology Data Exchange (ETDEWEB)

    Urban, R. [Rome Univ. La Sapienza, Rome (Italy). Dipt. di Strategie delle politiche energetiche

    2001-09-01

    The paper examines the dilemma risen within the oil companies about the role the synthetic fuels will play in the context of the world energy scenery. [Italian] L'articolo e' basato sul dilemma che si e' proposto all'interno delle societa' petrolifere sul ruolo che sara' esercitato negli anni a venire dai combustibili sintetici all'interno del panorama energetico mondiale.

  13. DEVELOPMENT OF FINE MOTOR COORDINATION AND VISUAL-MOTOR INTEGRATION IN PRESCHOOL CHILDREN

    OpenAIRE

    MEMISEVIC Haris; HADZIC Selmir

    2015-01-01

    Fine motor skills are prerequisite for many everyday activities and they are a good predictor of a child's later academic outcome. The goal of the present study was to assess the effects of age on the development of fine motor coordination and visual-motor integration in preschool children. The sample for this study consisted of 276 preschool children from Canton Sara­jevo, Bosnia and Herzegovina. We assessed children's motor skills with Beery Visual Motor Integration Test and Lafayette Pegbo...

  14. A new approach to maternal mortality: the role of HIV in pregnancy

    OpenAIRE

    Gorman, Sara E

    2013-01-01

    Sara E GormanDepartment of Epidemiology, Harvard University, Boston, MA, USAAbstract: As 2015 quickly approaches, we have been made increasingly aware of our progress toward Millennium Development Goals (MDGs). However, one MDG has been particularly recalcitrant to progress: MDG 5, namely, improving maternal health. Few countries are on track to achieve the first part of MDG 5's goals, reducing maternal mortality by 75%. This article addresses the key priority issues of maternal healt...

  15. Supercritical solvent extraction of oil sand bitumen

    Science.gov (United States)

    Imanbayev, Ye. I.; Ongarbayev, Ye. K.; Tileuberdi, Ye.; Mansurov, Z. A.; Golovko, A. K.; Rudyk, S.

    2017-08-01

    The supercritical solvent extraction of bitumen from oil sand studied with organic solvents. The experiments were performed in autoclave reactor at temperature above 255 °C and pressure 29 atm with stirring for 6 h. The reaction resulted in the formation of coke products with mineral part of oil sands. The remaining products separated into SARA fractions. The properties of the obtained products were studied. The supercritical solvent extraction significantly upgraded extracted natural bitumen.

  16. Die räumliche Dimension von Herrschaftsverhältnissen

    Directory of Open Access Journals (Sweden)

    Ruben Marc Hackler

    2006-11-01

    Full Text Available Sara Mills stellt in klarer Sprache ein Konzept vor, sexistische, rassistische und klassenbezogene Herrschaftspraxen in den Kolonien des British Empire hinsichtlich ihrer räumlichen Dimension zu analysieren. Ihr Ansatz soll möglichst viele Formen von Herrschaft integrieren, offen bleibt aber die Frage, ob dabei das von ihr verwendete Habituskonzept Bourdieus die passende Erklärung hierzu liefert.

  17. Status Report on Speech Research. A Report on the Status and Progress of Studies on the Nature of Speech, Instrumentation for Its Investigation, and Practical Applications.

    Science.gov (United States)

    1985-10-01

    Kay Arlyne Russo Sara Basson Noriko Kobayashi Richard C. Schmidt "..’ Eric Bateson Rena A. Krakow John Scholz ... . Suzanne Boyce Deborah Kuglitsch...greater accuracy than isolated vowels ( Gottfried & Strange, 1980; Rakerd et al., 1984; Strange, Edman, & Jenkins, 1976; Strange, Verbrugge, Shankweiler...Perceptual structure of monophthongs and diphthongs in "" English. Language and Speech, 26, 21-59. Gottfried , T. L., & Strange, W. (1980

  18. Proceedings of the Canadian society of allergy and clinical immunology annual scientific meeting 2015

    OpenAIRE

    C?t?, Marie-?ve; Boulay, Marie-?ve; Plante, Sophie; Chakir, Jamila; Boulet, Louis-Philippe; Ahmed, Hanan; Ospina, Maria-Beatriz; Sideri, Kyriaki; Vliagoftis, Harissios; Johnson, Sara F.; Woodgate, Roberta L.; Cros, Guilhem; Teira, Pierre; Cellot, Sonia; Bittencourt, Henrique

    2016-01-01

    Table of contents A1 Role of fibrocytes in allergic rhinitis Marie-?ve C?t?, Marie-?ve Boulay, Sophie Plante, Jamila Chakir, Louis-Philippe Boulet A2 Patterns of aeroallergens sensitization in Northern Alberta Hanan Ahmed, Maria-Beatriz Ospina, Kyriaki Sideri, Harissios Vliagoftis A3 Addressing acceptable risk for adolescents with Food-Induced Anaphylaxis (FIA) Sara F. Johnson, Roberta L. Woodgate A4 Outcomes of matched related and unrelated bone marrow transplantation after reduced-toxicity ...

  19. Sigma Factor SigB Is Crucial to Mediate Staphylococcus aureus Adaptation during Chronic Infections.

    Directory of Open Access Journals (Sweden)

    Lorena Tuchscherr

    2015-04-01

    Full Text Available Staphylococcus aureus is a major human pathogen that causes a range of infections from acute invasive to chronic and difficult-to-treat. Infection strategies associated with persisting S. aureus infections are bacterial host cell invasion and the bacterial ability to dynamically change phenotypes from the aggressive wild-type to small colony variants (SCVs, which are adapted for intracellular long-term persistence. The underlying mechanisms of the bacterial switching and adaptation mechanisms appear to be very dynamic, but are largely unknown. Here, we analyzed the role and the crosstalk of the global S. aureus regulators agr, sarA and SigB by generating single, double and triple mutants, and testing them with proteome analysis and in different in vitro and in vivo infection models. We were able to demonstrate that SigB is the crucial factor for adaptation in chronic infections. During acute infection, the bacteria require the simultaneous action of the agr and sarA loci to defend against invading immune cells by causing inflammation and cytotoxicity and to escape from phagosomes in their host cells that enable them to settle an infection at high bacterial density. To persist intracellularly the bacteria subsequently need to silence agr and sarA. Indeed agr and sarA deletion mutants expressed a much lower number of virulence factors and could persist at high numbers intracellularly. SigB plays a crucial function to promote bacterial intracellular persistence. In fact, ΔsigB-mutants did not generate SCVs and were completely cleared by the host cells within a few days. In this study we identified SigB as an essential factor that enables the bacteria to switch from the highly aggressive phenotype that settles an acute infection to a silent SCV-phenotype that allows for long-term intracellular persistence. Consequently, the SigB-operon represents a possible target to develop preventive and therapeutic strategies against chronic and therapy

  20. Sigma Factor SigB Is Crucial to Mediate Staphylococcus aureus Adaptation during Chronic Infections.

    Science.gov (United States)

    Tuchscherr, Lorena; Bischoff, Markus; Lattar, Santiago M; Noto Llana, Mariangeles; Pförtner, Henrike; Niemann, Silke; Geraci, Jennifer; Van de Vyver, Hélène; Fraunholz, Martin J; Cheung, Ambrose L; Herrmann, Mathias; Völker, Uwe; Sordelli, Daniel O; Peters, Georg; Löffler, Bettina

    2015-04-01

    Staphylococcus aureus is a major human pathogen that causes a range of infections from acute invasive to chronic and difficult-to-treat. Infection strategies associated with persisting S. aureus infections are bacterial host cell invasion and the bacterial ability to dynamically change phenotypes from the aggressive wild-type to small colony variants (SCVs), which are adapted for intracellular long-term persistence. The underlying mechanisms of the bacterial switching and adaptation mechanisms appear to be very dynamic, but are largely unknown. Here, we analyzed the role and the crosstalk of the global S. aureus regulators agr, sarA and SigB by generating single, double and triple mutants, and testing them with proteome analysis and in different in vitro and in vivo infection models. We were able to demonstrate that SigB is the crucial factor for adaptation in chronic infections. During acute infection, the bacteria require the simultaneous action of the agr and sarA loci to defend against invading immune cells by causing inflammation and cytotoxicity and to escape from phagosomes in their host cells that enable them to settle an infection at high bacterial density. To persist intracellularly the bacteria subsequently need to silence agr and sarA. Indeed agr and sarA deletion mutants expressed a much lower number of virulence factors and could persist at high numbers intracellularly. SigB plays a crucial function to promote bacterial intracellular persistence. In fact, ΔsigB-mutants did not generate SCVs and were completely cleared by the host cells within a few days. In this study we identified SigB as an essential factor that enables the bacteria to switch from the highly aggressive phenotype that settles an acute infection to a silent SCV-phenotype that allows for long-term intracellular persistence. Consequently, the SigB-operon represents a possible target to develop preventive and therapeutic strategies against chronic and therapy-refractory infections.

  1. MAAGINEN SANASÄKKI : Toiminnallinen menetelmä esikouluikäisten lasten kielelliseen tukemiseen

    OpenAIRE

    George, Sara

    2017-01-01

    George, Sara. Maaginen sanasäkki. Toiminnallinen menetelmä esikouluikäisten lasten kielelliseen tukemiseen. Kevät 2017, 39s., 1 liite. Diakonia- ammattikorkeakoulu, Sosiaalialan koulutusohjelma, Sosiaali- ja kasvatusalan suuntautumisvaihtoehto, sosionomi (AMK) + lastentarhanopettajan kelpoisuus. Opinnäytetyön tarkoituksena oli juurruttaa suomi toisena kielenä -opetukseen uusi suomen kieltä tukeva Maaginen sanasäkki -menetelmä. Maaginen sanasäkki -menetelmä korostaa kielenoppimisessa aisti...

  2. Tselluloidi aura ja kaasaegne kunst / Hanno Soans

    Index Scriptorium Estoniae

    Soans, Hanno, 1974-

    2004-01-01

    Muutustest filmitegemises ja filmiesteetikas. Filmi sarnanemisest tehniliselt üha enam videoga. Kunstnike tegelemisest filmiga. 26. XI näeb kinos "Sõprus" "1+1=1" raames kaasaegsete kunstnike teoseid laiekraanil: Eija-Liisa Ahtila "If 6 was 9" (1995), "Today" (1996-97), "Consolation Service" (1999); Sara Lunden ja Henry Moore Selder (sünd. 1973, Stockholm) "Deadly Boring" (2001), "She is Dead" (2003)

  3. Jeter des ponts entre les agriculteurs et les supermarchés au ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    3 juil. 2014 ... Eric Smith. Que sont-ils devenus ? Sara Elder a reçu du financement qui lui a permis de poursuivre sur le terrain des travaux de recherche doctorale sur la façon dont les petits exploitants agricoles sont touchés par le fait qu'ils doivent vendre leurs produits à des supermarchés modernes plutôt qu'à des ...

  4. Til forsvar for surheden

    DEFF Research Database (Denmark)

    Monrad, Merete

    2012-01-01

    den australsk-britiske kulturkritiker Sara Ahmed i bogen The Promise of Happiness rammende beskriver, et så oplagt gode, at det kan være svært at problematisere glæde og kravet om at være glad. Vi bør være glade, for derved fremmer vi også andres glæde. Brok ødelægger den gode stemning, og ingen...

  5. Decay of new mass-separated neutron-deficient La and Ce isotopes

    International Nuclear Information System (INIS)

    Genevey, J.; Gizon, A.; Idrissi, N.; Weiss, B.; Beraud, R.; Charvet, A.; Duffait, R.; Emsallem, A.; Meyer, M.; Ollivier, T.; Redon, N.

    1987-01-01

    By use of a He jet system coupled to a Bernas-Nier ion-source, several new mass-separated A = 122 - 127 isotopes reached in heavy ion fusion reactions at SARA have been identified and studied. From experimental decay properties of La isotopes, systematics of low-lying energy levels have been extended for even-even and odd-A barium. New informations on Ce decay schemes are briefly reported

  6. Case report

    African Journals Online (AJOL)

    abp

    saraïque et le tronc porte (Figure 1). Une héparinothérapie associée à une antibiothérapie étaient démarrées. Une laparotomie médiane était réalisée en urgence, et l'exploration chirurgicale trouvait un appendice scléreux avec.

  7. Natsionalistlike meeleolude kaardistamine jätkub / Rael Artel

    Index Scriptorium Estoniae

    Artel, Rael, 1980-

    2008-01-01

    "Public Preparation Social Club. Natsionalismi sümptomid ja kriitika kaasaegses kunstis" 11. VII Pärnu Kunstnike Majas ja 12.-16. VII Pärnumaal. Korraldas ja modereeris Rael Artel, ettekannetega esinesid Kendra Ballingall (Winnipeg), Remco de Blaaij (Eindhoven), Övül Durmusoglu (Istanbul/Viin), Ronen Eidelman (Tel Aviv/Weimar), Claire Feeley (Dublin), Erden Kosova (Istanbul), Johannes Paul Raether (Berliin), Sara Stenczer (Budapest/Pariis) ja Tamara Zlobina (Kiiev)

  8. Annual report 1981

    International Nuclear Information System (INIS)

    1982-01-01

    This progress report reviews the research activities in the Institute of Nuclear Sciences for the year 1981; in experimental nuclear physics: nuclear spectroscopy, giant resonances, reaction processes, weak interactions, perinuclear research. In nuclear theory, studies were carried out on nuclear structure, nuclear reactions and the 3 quarks bound states problem. The setting-up of Sara facilities was going on the whole year through and the first beams are now accelerated [fr

  9. Loglines. May-June 2014

    Science.gov (United States)

    2014-06-01

    Kathleen T. Rhem Editor: Jacob Boyer Layout/Design: Paul Henry Crank Writers: Beth Reece Sara Moore Amanda Neumann Loglines is prepared...www.logisticsinformationservice.dla.mil dla.tng@dla.mil Jake Logan , a maintenance employee from the U.S. Army Corps of Engineers’ Greers Ferry Project...of their expertise. “The Joint Petroleum Seminar is designed to gather joint petroleum Defense, both incoming and incumbent, and expose them to

  10. VizieR Online Data Catalog: BVRI light curves of GR Boo (Wang+, 2017)

    Science.gov (United States)

    Wang, D.; Zhang, L.; Han, X. L.; Lu, H.

    2017-11-01

    We observed the eclipsing binary GR Boo on May 12, 22 and 24 in 2015 using the SARA 90-cm telescope located at Kitt Peak National Observatory, Arizona, USA. This telescope was equipped with an ARC CCD camera with a resolution of 2048x2048pixels but used at 2x2 binning, resulting in 1024x1024pixels. We used the Bessel BVRI filters. (1 data file).

  11. The importance of a culture of openness.

    Science.gov (United States)

    2016-06-15

    Revamping the counselling service at Birmingham Children's Hospital, as well as offering wa 24/7 telephone service and face-to-face counselling, led to reduced work-related stress - as stated in Nursing Management. Sara Brown, deputy chief officer for workforce at the hospital, says a culture of openness is essential for tackling the demands of nursing. She says nurses in management positions are responsible for supporting the daily demands of service delivery.

  12. punktum. Juni 2004

    OpenAIRE

    Aeschlimann, Heidi; Aeberli-Niquille, Christian Louis; Allemann, Rolf; Arnet, Esther; Burri Sharani, Barbara; Grünwald, Hugo Stephan; Gugger, Peter; Hürlimann, Fred W.; Meyer, Peter Michael; Meyer, Sara; Raeder, Sabine; Ruh, Hans; Schenker, Sybille; Wüthrich, Doris

    2004-01-01

    Meyer, Sara: Neue Lebensräume Arnet, Esther: Lebensraum Öffentlichkeit, Dürfen Politikerinnen Visionen haben? Burri Sharani, Barbara: Lebensraum Kosova, Die Frau des Bruders der Frau des ... Ruh, Hans (Prof.): Lebensraum Zeit, Höher weiter schneller länger? Meyer, Paul Michael: Lebensraum Schule, Warum ist hier möglich, was dort unmöglich scheint? Raeder Sabine (Dr.): Lebensraum Arbeit, Flexible Identitäten in flexibilisierten Arbeitsverhältnissen Gugger, Peter: Lebensraum...

  13. Proceedings of the 3rd Biennial Conference of the Society for Implementation Research Collaboration (SIRC) 2015: advancing efficient methodologies through community partnerships and team science

    OpenAIRE

    Lewis, Cara; Darnell, Doyanne; Kerns, Suzanne; Monroe-DeVita, Maria; Landes, Sara J.; Lyon, Aaron R.; Stanick, Cameo; Dorsey, Shannon; Locke, Jill; Marriott, Brigid; Puspitasari, Ajeng; Dorsey, Caitlin; Hendricks, Karin; Pierson, Andria; Fizur, Phil

    2016-01-01

    Table of contents Introduction to the 3rd Biennial Conference of the Society for Implementation Research Collaboration: advancing efficient methodologies through team science and community partnerships Cara Lewis, Doyanne Darnell, Suzanne Kerns, Maria Monroe-DeVita, Sara J. Landes, Aaron R. Lyon, Cameo Stanick, Shannon Dorsey, Jill Locke, Brigid Marriott, Ajeng Puspitasari, Caitlin Dorsey, Karin Hendricks, Andria Pierson, Phil Fizur, Katherine A. Comtois A1: A behavioral economic perspective ...

  14. Robot-assisted laparoscopic myomectomy: current status

    OpenAIRE

    Arian,Sara; Munoz,Jessian; Kim,Suejin; Falcone,Tommaso

    2017-01-01

    Sara E Arian, Jessian L Munoz, Suejin Kim, Tommaso Falcone Department of Obstetrics, Gynecology, and Women’s Health Institute, Cleveland Clinic, Cleveland, OH, USA Abstract: Robotic-assisted surgery has seen a rapid development and integration in the field of gynecology. Since the approval of the use of robot for gynecological surgery and considering its several advantages over conventional laparoscopy, it has been widely incorporated especially in the field of reproductive surgery....

  15. Interim action record of decision remedial alternative selection: TNX area groundwater operable unit

    International Nuclear Information System (INIS)

    Palmer, E.R.

    1994-10-01

    This document presents the selected interim remedial action for the TNX Area Groundwater Operable Unit at the Savannah River Site (SRS), which was developed in accordance with CERCLA of 1980, as amended by the Superfund Amendments and Reauthorization Act (SARA) of 1986, and to the extent practicable, the National Oil and Hazardous Substances Pollution contingency Plan (NCP). This decision is based on the Administrative Record File for this specific CERCLA unit

  16. Optical photometry of TX0506+056

    Science.gov (United States)

    Keel, William; Santander, Marcos

    2017-10-01

    The blazar TX0506+056 has attracted recent attention through its location in the error box of a high-energy Ice Cube neutrino detection (https://gcn.gsfc.nasa.gov/gcn3/21916.gcn3) and gamma-ray flaring (Atel #10791) We report recent photometry of TX0506+056 obtained in Johnson V and Cousins R passbands using the 1-meter Kapteyn telescope at La Palma, operated remotely by the SARA consortium.

  17. Detection of Ebola Virus RNA through Aerosol Sampling of Animal Biosafety Level 4 Rooms Housing Challenged Nonhuman Primates

    Science.gov (United States)

    2016-08-02

    Rooms Housing Challenged Nonhuman Primates 10 11 12 13 14 15 David E. Harbourt1*, Sara C. Johnston1, James Pettitt2, Travis K. Warren1 and...Sampling of ABSL-4 Rooms Housing Challenged Nonhuman 10 Primates for publication in an edition of The Journal of Infectious Disease. This 11 manuscript...embedded in the texts. This is the first report demonstrating detection of Ebola virus 17 RNA from animal rooms housing infected nonhuman primates and

  18. 1977 Annual report

    International Nuclear Information System (INIS)

    This report of the Nuclear Sciences Institute at Grenoble gives a general survey of the scientific and technical activities in 1977. The post-accelerator program SARA is described. In nuclear experimental physics, the research areas are heavy ion nuclear reactions, nuclear structure, nuclear spectroscopy; in collaboration with other laboratories pion scattering experiments and p invariance confirmation. In theoretical physics, reaction processes, three-body problem, nuclear structure and high energy pion collisions have been studied [fr

  19. Annual report 1983

    International Nuclear Information System (INIS)

    1984-01-01

    The research activities have in 1983 been centered in theoretical physics around particle models, symmetry groups and for intermediate energy physics around the π-N-N system and nuclear structure; in experimental physics, for high energy around experiments at CERN ISR and LEP, ALS and SATURNE and for nuclear physics in collaboration with SARA and GANIL. In the interdisciplinary studies: atomic collisions in solids, surfaces and interfaces, electronic structure, solids, amorphous [fr

  20. Brivaracetam: review of its pharmacology and potential use as adjunctive therapy in patients with partial onset seizures

    OpenAIRE

    Russo, Emilio; Mumoli,Laura; Palleria,Caterina; Gasparini,Sara; Citraro,Rita; Labate,Angelo; Ferlazzo,Edoardo; Gambardella,Antonio; De Sarro,Giovambattista

    2015-01-01

    Laura Mumoli,1 Caterina Palleria,2 Sara Gasparini,1 Rita Citraro,2 Angelo Labate,1 Edoardo Ferlazzo,1 Antonio Gambardella,1 Giovambattista De Sarro,2 Emilio Russo2 1Institute of Neurology, 2Institute of Pharmacology, University Magna Græcia, Catanzaro, Italy Abstract: Brivaracetam (BRV), a high-affinity synaptic vesicle protein 2A ligand, reported to be 10–30-fold more potent than levetiracetam (LEV), is highly effective in a wide range of experimental models of focal an...

  1. Properties of solar generators with reflectors and radiators

    Science.gov (United States)

    Ebeling, W. D.; Rex, D.; Bierfischer, U.

    1980-06-01

    Radiation cooled concentrator systems using silicon and GaAs cells were studied. The principle of radiation cooling by the reflector surfaces is discussed for cylindrical parabolic reflectors (SARA), truncated hexagonal pyramids, and a small trough configuration. Beam paths, collection properties for imperfect orientation, and thermal optimization parameters were analyzed. The three concentrating systems with radiation cooling offer advantages over the plane panel and over the large trough. With silicon solar cells they exhibit considerably lower solar cell consumption per Kw and also lower mass per kW. With GaAs cells the SARA system reduces the number of solar cells needed per kW to less than 10%. Also in all other cases SARA offers the best values for alpha and F sub sol, as long as narrow angular tolerances of the panel orientation can be met. Analysis of the energy collecting properties for imperfect orientation shows the superiority of the hexagonal concentrator. This device can produce power for even large angles between the sun and the panel normal.

  2. Phylogenetic inferences of Atelinae (Platyrrhini) based on multi-directional chromosome painting in Brachyteles arachnoides, Ateles paniscus paniscus and Ateles b. marginatus.

    Science.gov (United States)

    de Oliveira, E H C; Neusser, M; Pieczarka, J C; Nagamachi, C; Sbalqueiro, I J; Müller, S

    2005-01-01

    We performed multi-directional chromosome painting in a comparative cytogenetic study of the three Atelinae species Brachyteles arachnoides, Ateles paniscus paniscus and Ateles belzebuth marginatus, in order to reconstruct phylogenetic relationships within this Platyrrhini subfamily. Comparative chromosome maps between these species were established by multi-color fluorescence in situ hybridization (FISH) employing human, Saguinus oedipus and Lagothrix lagothricha chromosome-specific probes. The three species included in this study and four previously analyzed species from all four Atelinae genera were subjected to a phylogenetic analysis on the basis of a data matrix comprised of 82 discrete chromosome characters. The results confirmed that Atelinae represent a monophyletic clade with a putative ancestral karyotype of 2n = 62 chromosomes. Phylogenetic analysis revealed an evolutionary branching sequence [Alouatta [Brachyteles [Lagothrix and Ateles

  3. Foraging strategy of a Neotropical primate: how intrinsic and extrinsic factors influence destination and residence time

    DEFF Research Database (Denmark)

    Plante, Sabrina; Colchero, Fernando; Calmé, Sophie

    2014-01-01

    accounting for intrinsic and extrinsic factors, which are often overlooked when modelling foraging behaviour. 2.We identified the decision rules for foraging in black howler monkeys (Alouatta pigra), according to food preferences, locations of high quality patches and previously eaten trees, phenology...... of food resources and hunger state. We depicted foraging in two stages: 1) the choice of the immediate next tree and 2) the time spent on this tree. We used a recently developed model for inference of movement processes, incorporating resource selection functions into a Markov Chain framework. 3.We found...... that monkeys tend to move to preferred tree species at each step. However, we did not find conclusively that, at each step, monkeys direct their movements to reach high-quality patches. In fact, they were using these patches intensively, thus limiting the possibility to move toward other high quality patches...

  4. Habitat, density and group size of primates in a Brazilian tropical forest.

    Science.gov (United States)

    Pinto, L P; Costa, C M; Strier, K B; da Fonseca, G A

    1993-01-01

    Habitats, population densities and group sizes of 5 primate species (Callithrix flaviceps, Callicebus personatus personatus, Cebus apella nigritus, Alouatta fusca clamitans, and Brachyteles arachnoides) were estimated, using the method of repeated transect sampling, in an area of montane pluvial forest in eastern Brazil (Atlantic forest). A. fusca and C. apella had the highest densities in terms of groups and individuals per square kilometer, respectively, while B. arachnoides was least abundant. The highest primate densities were observed in areas of secondary vegetation. Both group sizes and population densities for the 5 species were generally lower at the Reserva Biologica Augusto Ruschi than those reported in other areas of Atlantic forest. Hunting pressure and the different carrying capacity of the habitat are suggested as possible causes for the low number of sightings registered for these species.

  5. Social organization and food resources availability in primates: a socio-bioenergetic analysis of diet and disease hypotheses.

    Science.gov (United States)

    Coelho, A M; Bramblett, C A; Quick, L B

    1977-03-01

    Data obtained during a field study of two species of nonhuman primates (Alouatta villosa and Ateles geoffroyi) living in the Tikal National Park in Guatemala are used to suggest an answer to the question: To what extent is the existence of a particular form of social organization (group size, structure, and composition) an indication of the amount of energy in the form of food resources available to animals in a particular habitat? Seven researchers working in teams spent 2,318 hours in the field, 1,145 hours of which were in contact with the monkeys. Comparisons of dietary data, estimated energy expenditures, and habitat productivity provide indications of the degree to which a habitat is capable of supporting the energy and other nutritional requirements of howler and spider monkeys living within the study area. These data suggest that much larger populations and different forms of social organizations can be supported by resources available within the habitat.

  6. Ticks (Acari: Ixodidae on wild animals from the Porto-Primavera Hydroelectric power station area, Brazil

    Directory of Open Access Journals (Sweden)

    Marcelo B Labruna

    2002-12-01

    Full Text Available From June 2000 to June 2001, a total of 741 ticks were collected from 51 free-living wild animals captured at the Porto-Primavera Hydroelectric power station area, located alongside an approximately 180 km course of the Paraná river, between the states of São Paulo and Mato Grosso do Sul, comprising 9 species of 3 genera: Ambly-omma (7 species, Boophilus (1 and Anocentor (1. A total of 421 immature Amblyomma ticks were reared in laboratory until the adult stage, allowing identification of the species. A. cajennense was the most frequent tick species (mostly immature stages collected on 9 host species: Myrmecophaga tridactyla, Tamandua tetradactyla,Cerdocyon thous, Puma concolor,Tayassu tajacu, Mazama gouazoubira,Hydrochaeris hydrochaeris,Alouatta caraya, Cebus apella. Other tick species were less common, generally restricted to certain host taxa.

  7. Ticks (Acari: Ixodidae) on wild animals from the Porto-Primavera Hydroelectric power station area, Brazil.

    Science.gov (United States)

    Labruna, Marcelo B; de Paula, Cátia D; Lima, Thiago F; Sana, Dênis A

    2002-12-01

    From June 2000 to June 2001, a total of 741 ticks were collected from 51 free-living wild animals captured at the Porto-Primavera Hydroelectric power station area, located alongside an approximately 180 km course of the Paran river, between the states of S o Paulo and Mato Grosso do Sul, comprising 9 species of 3 genera: Ambly-omma (7 species), Boophilus (1) and Anocentor (1). A total of 421 immature Amblyomma ticks were reared in laboratory until the adult stage, allowing identification of the species. A. cajennense was the most frequent tick species (mostly immature stages) collected on 9 host species: Myrmecophaga tridactyla, Tamandua tetradactyla,Cerdocyon thous, Puma concolor,Tayassu tajacu, Mazama gouazoubira,Hydrochaeris hydrochaeris,Alouatta caraya, Cebus apella. Other tick species were less common, generally restricted to certain host taxa.

  8. Diagnosis of Leishmania infantum infection by Polymerase Chain Reaction in wild mammals

    Directory of Open Access Journals (Sweden)

    Mayara C. Lombardi

    2014-12-01

    Full Text Available Visceral leishmaniasis is a chronic infectious disease caused by Leishmania infantum (synonym: Leishmania chagasi and transmitted by the sandfly Lutzomyia longipalpis in Brazil. It is an endemic zoonosis in several regions of the country, including Belo Horizonte (State of Minas Gerais. In urban areas, the domestic dog is susceptible and considered the most important animal reservoir. However, L. infantum has been previously diagnosed in other species, including captive primates and canids. This study aimed to evaluate the presence of the agent DNA in captive animals as well as some free ranging animals from the Zoo-Botanical Foundation of Belo Horizonte by Polymerase Chain Reaction. Eighty one blood samples from primates, carnivores, ruminants, edentates, marsupial, and a monogastric herbivore were analyzed. Three primates Alouatta guariba (brown howler monkey, and two canids Speothos venaticus (bush dog were positive, demonstrating the importance of leishmaniasis control in endemic areas for preservation of wildlife species in captivity.

  9. A new world monkey microsatellite (ap74) highly conserved in primates

    International Nuclear Information System (INIS)

    Oklander, Luciana Ines; Steinberg, Eliana Ruth; Dolores Mudry, Marta

    2012-01-01

    Given their great variability, microsatellites or STRS became the most commonly used genetic markers over the last 15 years. The analysis of these markers requires minimum quantities of DNA, allowing the use of noninvasive samples, such as feces or hair. We amplified the microsatellite ap74 in blood and hair samples in order to analyze the levels of genomic conservation among a wide range of primates including: lemur catta, alouatta caraya, ateles belzebuth, ateles chamek, pan troglodytes, papio sp., and Homo sapiens. in all cases we obtained amplification products that exhibited similar size both in monkeys and human (oscillating between 126 and 176 bp), except in the lemur where the detected fragment presented a size of approximately 1000 bp. the analysis of the nucleotide sequences permitted the evaluation of the molecular modifications experienced during the evolutionary process in primates.

  10. Effects of Habitat Structure and Fragmentation on Diversity and Abundance of Primates in Tropical Deciduous Forests in Bolivia.

    Science.gov (United States)

    Pyritz, Lennart W; Büntge, Anna B S; Herzog, Sebastian K; Kessler, Michael

    2010-10-01

    Habitat structure and anthropogenic disturbance are known to affect primate diversity and abundance. However, researchers have focused on lowland rain forests, whereas endangered deciduous forests have been neglected. We aimed to investigate the relationships between primate diversity and abundance and habitat parameters in 10 deciduous forest fragments southeast of Santa Cruz, Bolivia. We obtained primate data via line-transect surveys and visual and acoustic observations. In addition, we assessed the vegetation structure (canopy height, understory density), size, isolation time, and surrounding forest area of the fragments. We interpreted our results in the context of the historical distribution data for primates in the area before fragmentation and interviews with local people. We detected 5 of the 8 historically observed primate species: Alouatta caraya, Aotus azarae boliviensis, Callithrix melanura, Callicebus donacophilus, and Cebus libidinosus juruanus. Total species number and detection rates decreased with understory density. Detection rates also negatively correlated with forest areas in the surroundings of a fragment, which may be due to variables not assessed, i.e., fragment shape, distance to nearest town. Observations for Alouatta and Aotus were too few to conduct further statistics. Cebus and Callicebus were present in 90% and 70% of the sites, respectively, and their density did not correlate with any of the habitat variables assessed, signaling high ecological plasticity and adaptability to anthropogenic impact in these species. Detections of Callithrix were higher in areas with low forest strata. Our study provides baseline data for future fragmentation studies in Neotropical dry deciduous forests and sets a base for specific conservation measures.

  11. Wide distribution and ancient evolutionary history of simian foamy viruses in New World primates.

    Science.gov (United States)

    Ghersi, Bruno M; Jia, Hongwei; Aiewsakun, Pakorn; Katzourakis, Aris; Mendoza, Patricia; Bausch, Daniel G; Kasper, Matthew R; Montgomery, Joel M; Switzer, William M

    2015-10-29

    Although simian foamy viruses (SFV) are the only exogenous retroviruses to infect New World monkeys (NWMs), little is known about their evolutionary history and epidemiology. Previous reports show distinct SFVs among NWMs but were limited to small numbers of captive or wild monkeys from five (Cebus, Saimiri, Ateles, Alouatta, and Callithrix) of the 15 NWM genera. Other studies also used only PCR testing or serological assays with limited validation and may have missed infection in some species. We developed and validated new serological and PCR assays to determine the prevalence of SFV in blood specimens from a large number of captive NWMs in the US (n = 274) and in captive and wild-caught NWMs (n = 236) in Peruvian zoos, rescue centers, and illegal trade markets. Phylogenetic and co-speciation reconciliation analyses of new SFV polymerase (pol) and host mitochondrial cytochrome B sequences, were performed to infer SFV and host co-evolutionary histories. 124/274 (45.2 %) of NWMs captive in the US and 59/157 (37.5 %) of captive and wild-caught NWMs in Peru were SFV WB-positive representing 11 different genera (Alouatta, Aotus, Ateles, Cacajao, Callithrix, Cebus, Lagothrix, Leontopithecus, Pithecia, Saguinus and Saimiri). Seroprevalences were lower at rescue centers (10/53, 18.9 %) compared to zoos (46/97, 47.4 %) and illegal trade markets (3/7, 8/19, 42.9 %) in Peru. Analyses showed that the trees of NWM hosts and SFVs have remarkably similar topologies at the level of species and sub-populations suggestive of co-speciation. Phylogenetic reconciliation confirmed 12 co-speciation events (p history of SFV in NWMs at the species level. Additional studies are necessary to further explore the epidemiology and natural history of SFV infection of NWMs and to determine the zoonotic potential for persons exposed to infected monkeys in captivity and in the wild.

  12. Enamel microwear texture properties of IGF 11778 (Oreopithecus bambolii) from the late Miocene of Baccinello, Italy.

    Science.gov (United States)

    L' Engle Williams, Frank

    2013-01-01

    Late Miocene Oreopithecus bambolii has been posited as a folivore from its pronounced molar shearing crests. However, scanning electron microscopy yields conflicting results with one study of Oreopithecus showing folivory and another indicating a coarser diet was consumed. To address this debate, the dietary proclivities of the well-known IGF 11778 Oreopithecus bambolii specimen are reconstructed by comparing the enamel texture properties of this specimen to extant Alouatta palliata (n = 11), Cebus apella (n = 13), Gorilla gorilla (n = 9), Lophocebus albigena (n = 15), Pan troglodytes (n = 17) and Trachypithecus cristatus (n = 12). Dental microwear is captured by scanning facet 9, a Phase II facet on the hypoconid surface, using white-light confocal microscopy at 100x. The scanning was followed by scale-sensitive fractal analysis, yielding four texture characteristics. These were ranked before ANOVA with post-hoc tests of significance and multivariate analyses were conducted. Oreopithecus specimen IGF 11778 does not match any of the extant taxa consistently but in some analyses is associated with Lophocebus, and secondarily with Pan, Gorilla and Cebus outliers suggesting mixed-fruit and hard-object feeding characterized at least a portion of its diet. The partially open habitat of late Miocene Baccinello may have had resources with mechanically resistant foods, or foods found near ground level were consumed. Hard, brittle foods, insects, and or extraneous grit may have contributed to the greater use-wear complexity of the enamel surface observed in IGF 11778 compared to extant folivores. IGF 11778 does not exhibit the degree of anisotropy characterizing Trachypithecus and Alouatta. The partial resemblance of IGF 11778 to some great ape specimens may indicate intermittent extractive and or terrestrial foraging.

  13. Serological evidence for Saint Louis encephalitis virus in free-ranging New World monkeys and horses within the upper Paraná River basin region, Southern Brazil

    Directory of Open Access Journals (Sweden)

    Walfrido Kühl Svoboda

    2014-06-01

    Full Text Available Introduction Saint Louis encephalitis virus (SLEV primarily occurs in the Americas and produces disease predominantly in humans. This study investigated the serological presence of SLEV in nonhuman primates and horses from southern Brazil. Methods From June 2004 to December 2005, sera from 133 monkeys (Alouatta caraya, n=43; Sapajus nigritus, n=64; Sapajus cay, n=26 trap-captured at the Paraná River basin region and 23 blood samples from farm horses were obtained and used for the serological detection of a panel of 19 arboviruses. All samples were analyzed in a hemagglutination inhibition (HI assay; positive monkey samples were confirmed in a mouse neutralization test (MNT. Additionally, all blood samples were inoculated into C6/36 cell culture for viral isolation. Results Positive seroreactivity was only observed for SLEV. A prevalence of SLEV antibodies in sera was detected in Alouatta caraya (11.6%; 5/43, Sapajus nigritus (12.5%; 8/64, and S. cay (30.8%; 8/26 monkeys with the HI assay. Of the monkeys, 2.3% (1/42 of A. caraya, 6.3% 94/64 of S. nigritus, and 15.4% (4/26 of S. cay were positive for SLEV in the MNT. Additionally, SLEV antibodies were detected by HI in 39.1% (9/23 of the horses evaluated in this study. Arboviruses were not isolated from any blood sample. Conclusions These results confirmed the presence of SLEV in nonhuman primates and horses from southern Brazil. These findings most likely represent the first detection of this virus in nonhuman primates beyond the Amazon region. The detection of SLEV in animals within a geographical region distant from the Amazon basin suggests that there may be widespread and undiagnosed dissemination of this disease in Brazil.

  14. Primate community of the tropical rain forests of Saracá-Taqüera National Forest, Pará, Brazil

    Directory of Open Access Journals (Sweden)

    LC. Oliveira

    Full Text Available Brazil is the richest country in the world in terms of primate species and the Amazonian rain forest is one of the richest biomes containing 15 (ca. 90% of the Neotropical primate genera. Although considered key elements in conservation strategies, there is only anecdotal information on primates for several protected areas within the region. Here we present new data on the community composition of the primates in the Saracá-Taqüera National Forest (429,600 ha, an actively mined, bauxite rich area, in Pará, Brazil. We used information from the literature, technical reports, museum data, and interviews conducted with agents from the Brazilian Institute of the Environment and Natural Renewable Resources (Instituto Brasileiro do Meio Ambiente e dos Recursos Naturais Renováveis - IBAMA and members of the local "Quilombo" community. In addition, from July 2003 to June 2007, we carried out 19 field trips ranging from 10 to15 days each, amounting to a total effort of 1,230 hours and 1,420 km of censuses, resulting in 1,034 records of eight primate species (Saguinus martinsi, Saguinus midas, Saimiri sciureus, Cebus apella, Pithecia pithecia, Chiropotes sagulatus, Ateles paniscus, and Alouatta macconelli. Two other species (Cebus olivaceus and Aotus trivirgatus were recorded only indirectly, through interviews and literature data. In all, Alouatta macconelli was the most frequently recorded species (43% of all records; while Saguinus midas and P. pithecia were the least (ca. 0.4 and 0.6% of all records. Based on our results, we discuss group sizes as well as taxonomic problems concerning the genera Pithecia and Chiropotes, for which we registered individuals displaying phenotypic geographical variation and two different forms, respectively. Despite the deforestation inherent in bauxite mining, the Saracá-Taqüera National Forest still has a remarkable richness of primate species. Our study results place this National Forest amongst the richest

  15. Development of a biofilm inhibitor molecule against multidrug resistant Staphylococcus aureus associated with gestational urinary tract infections

    Directory of Open Access Journals (Sweden)

    Balamurugan eP

    2015-08-01

    Full Text Available Urinary Tract Infection (UTI is a globally widespread human infection caused by an infestation of uropathogens. Eventhough, Escherichia coli is often quoted as being the chief among them, Staphylococcus aureus involvement in UTI especially in gestational UTI is often understated. Staphylococcal accessory regulator A (SarA is a quorum regulator of S. aureus that controls the expression of various virulence and biofilm phenotypes. Since SarA had been a focussed target for antibiofilm agent development, the study aims to develop a potential drug molecule targeting the SarA of S. aureus to combat biofilm associated infections in which it is involved. In our previous studies, we have reported the antibiofilm activity of SarA based biofilm inhibitor, (SarABI with a 50% minimum biofilm inhibitory concentration (MBIC50 value of 200 µg/mL against S. aureus associated with vascular graft infections and also the antibiofilm activity of the root ethanolic extracts of Melia dubia against uropathogenic E. coli. In the present study, in silico design of a hybrid molecule composed of a molecule screened from M. dubia root ethanolic extracts and a modified SarA based inhibitor (SarABIM was undertaken. SarABIM is a modified form of SarABI where the fluorine groups are absent in SarABIM. Chemical synthesis of the hybrid molecule, 4-(Benzylaminocyclohexyl 2-hydroxycinnamate (henceforth referred to as UTI Quorum-Quencher, UTIQQ was then performed, followed by in vitro and in vivo validation. The MBIC¬50 and MBIC90 of UTIQQ were found to be 15 µg/mL and 65 µg/mL respectively. Confocal laser scanning microscopy (CLSM images witnessed biofilm reduction and bacterial killing in either UTIQQ or in combined use of antibiotic gentamicin and UTIQQ. Similar results were observed with in vivo studies of experimental UTI in rat model. So, we propose that the drug UTIQQ would be a promising candidate when used alone or, in combination with an antibiotic for staphylococcal

  16. Trends in extinction risk for imperiled species in Canada.

    Directory of Open Access Journals (Sweden)

    Brett Favaro

    Full Text Available Protecting and promoting recovery of species at risk of extinction is a critical component of biodiversity conservation. In Canada, the Committee on the Status of Endangered Wildlife in Canada (COSEWIC determines whether species are at risk of extinction or extirpation, and has conducted these assessments since 1977. We examined trends in COSEWIC assessments to identify whether at-risk species that have been assessed more than once tended to improve, remain constant, or deteriorate in status, as a way of assessing the effectiveness of biodiversity conservation in Canada. Of 369 species that met our criteria for examination, 115 deteriorated, 202 remained unchanged, and 52 improved in status. Only 20 species (5.4% improved to the point where they were 'not at risk', and five of those were due to increased sampling efforts rather than an increase in population size. Species outcomes were also dependent on the severity of their initial assessment; for example, 47% of species that were initially listed as special concern deteriorated between assessments. After receiving an at-risk assessment by COSEWIC, a species is considered for listing under the federal Species at Risk Act (SARA, which is the primary national tool that mandates protection for at-risk species. We examined whether SARA-listing was associated with improved COSEWIC assessment outcomes relative to unlisted species. Of 305 species that had multiple assessments and were SARA-listed, 221 were listed at a level that required identification and protection of critical habitat; however, critical habitat was fully identified for only 56 of these species. We suggest that the Canadian government should formally identify and protect critical habitat, as is required by existing legislation. In addition, our finding that at-risk species in Canada rarely recover leads us to recommend that every effort be made to actively prevent species from becoming at-risk in the first place.

  17. Structure of Rot, a global regulator of virulence genes in Staphylococcus aureus.

    Science.gov (United States)

    Zhu, Yuwei; Fan, Xiaojiao; Zhang, Xu; Jiang, Xuguang; Niu, Liwen; Teng, Maikun; Li, Xu

    2014-09-01

    Staphylococcus aureus is a highly versatile pathogen that can infect human tissue by producing a large arsenal of virulence factors that are tightly regulated by a complex regulatory network. Rot, which shares sequence similarity with SarA homologues, is a global regulator that regulates numerous virulence genes. However, the recognition model of Rot for the promoter region of target genes and the putative regulation mechanism remain elusive. In this study, the 1.77 Å resolution X-ray crystal structure of Rot is reported. The structure reveals that two Rot molecules form a compact homodimer, each of which contains a typical helix-turn-helix module and a β-hairpin motif connected by a flexible loop. Fluorescence polarization results indicate that Rot preferentially recognizes AT-rich dsDNA with ~30-base-pair nucleotides and that the conserved positively charged residues on the winged-helix motif are vital for binding to the AT-rich dsDNA. It is proposed that the DNA-recognition model of Rot may be similar to that of SarA, SarR and SarS, in which the helix-turn-helix motifs of each monomer interact with the major grooves of target dsDNA and the winged motifs contact the minor grooves. Interestingly, the structure shows that Rot adopts a novel dimerization model that differs from that of other SarA homologues. As expected, perturbation of the dimer interface abolishes the dsDNA-binding ability of Rot, suggesting that Rot functions as a dimer. In addition, the results have been further confirmed in vivo by measuring the transcriptional regulation of α-toxin, a major virulence factor produced by most S. aureus strains.

  18. Poly-N-acetylglucosamine production in Staphylococcus aureus is essential for virulence in murine models of systemic infection.

    Science.gov (United States)

    Kropec, Andrea; Maira-Litran, Tomas; Jefferson, Kimberly K; Grout, Martha; Cramton, Sarah E; Götz, Friedrich; Goldmann, Donald A; Pier, Gerald B

    2005-10-01

    The contribution of the Staphylococcus aureus surface polysaccharide poly-N-acetylglucosamine (PNAG) to virulence was evaluated in three mouse models of systemic infection: bacteremia, renal abscess formation, and lethality following high-dose intraperitoneal (i.p.) infection. Deletion of the intercellular adhesin (ica) locus that encodes the biosynthetic enzymes for PNAG production in S. aureus strains Mn8, Newman, and NCTC 10833 resulted in mutant strains with significantly reduced abilities to maintain bacterial levels in blood following intravenous or i.p. injection, to spread systemically to the kidneys following i.p. injection, or to induce a moribund/lethal state following i.p. infection. In the bacteremia model, neither growth phase nor growth medium used to prepare the S. aureus inoculum affected the conclusion that PNAG production was needed for full virulence. As the SarA regulatory protein has been shown to affect ica transcription, PNAG synthesis, and biofilm formation, we also evaluated S. aureus strains Mn8 and 10833 deleted for the sarA gene in the renal infection model. A decrease in PNAG production was seen in sarA mutants using immunoblots of cell surface extracts but was insufficient to reduce the virulence of sarA-deleted strains in this model. S. aureus strains deleted for the ica genes were much more susceptible to antibody-independent opsonic killing involving human peripheral blood leukocytes and rabbit complement. Thus, PNAG confers on S. aureus resistance to killing mediated by these innate host immune mediators. Overall, PNAG production by S. aureus appears to be a critical virulence factor as assessed in murine models of systemic infection.

  19. The Continuing Search for Variability Among Cool White Dwarfs

    Science.gov (United States)

    Schaefer, J. J.; Oswalt, T. D.; Johnston, K. B.; Rudkin, M.; Heinz, T.

    2002-12-01

    The Continuing Search for Variability Among Cool White Dwarfs Justin J. Schaefer University of Wyoming Department of Physics and Astronomy P.O. Box 3905 Laramie, Wyoming 82071 USA (schaefju@uwyo.edu) Terry D. Oswalt, Kyle Johnston, Merissa Rudkin, Tamalyn Heinz Florida Institute of Technology and the SARA Observatory Department of Physics & Space Sciences 150 West University Boulevard Melbourne, Florida 32901 USA (oswalt@luyten.astro.fit.edu, kyjohnst@fit.edu, mrudkin@astro.fit.edu, theinz@fit.edu) ABSTRACT We present BVRI photometry of eleven binaries with white dwarf (WD) components. The observations were obtained at the SARA 0.9-meter telescope on Kitt Peak during the summer of 2002. Standard system (B-V), (V-R) and (R-I) color indices of four white dwarfs were determined. This data will be used to estimate the WD cooling ages in wide WD+dM binaries, as part of our ongoing research program to determine the chromospheric activity-age relation for M dwarf stars. Time-series differential photometry was also collected for eight cool white dwarfs as part of a program to explore the variability in the low luminosity, low temperature regime of the WD cooling track. We failed to detect any variability greater than ~0.04 magnitudes in these stars. Several nights of differential photometry data were collected on the DAO WD + K dwarf short-period variable HS1136+6646. From the light variations we determined a likely orbital period of 0.825 +/-0.009 days. Strong evidence is presented for two other possible periods within this light curve, possibly indicative of rotational modulation by the WD component. We gratefully acknowledge support from the National Science Foundation, which funds the SARA Research Experiences for Undergraduates program via grant AST-0097616 to Florida Tech. One of us (TDO) also acknowledges partial support for this work from NASA (subcontract Y701296) and the NSF (AST 0206115).

  20. Histamine Induces Bovine Rumen Epithelial Cell Inflammatory Response via NF-κB Pathway

    Directory of Open Access Journals (Sweden)

    Xudong Sun

    2017-06-01

    Full Text Available Background/Aims: Subacute ruminal acidosis (SARA is a common disease in high-producing lactating cows. Rumenitis is the initial insult of SARA and is associated with the high concentrations of histamine produced in the rumen of dairy cows during SARA. However, the exact mechanism remains unclear. The objective of the current study is to investigate whether histamine induces inflammation of rumen epithelial cells and the underlying mechanism of this process. Methods: Bovine rumen epithelial cells were cultured and treated with different concentrations of histamine and pyrrolidine dithiocarbamate (PDTC, an NF-κB inhibitor cultured in different pH medium (pH 7.2 or 5.5. qRT-PCR, Western-blotting, ELISA and immunocytofluorescence were used to evaluate whether histamine activated the NF-κB pathway and inflammatory cytokines. Results: The results showed that histamine significantly increased the activity of IKK β and the phosphorylation levels of IκB α, as well as upregulated the mRNA and protein expression levels of NF-κB p65 in the rumen epithelial cells cultured in neutral (pH=7.2 and acidic (pH=5.5 medium. Furthermore, histamine treatment also significantly increased the transcriptional activity of NF-κB p65. High expression and transcriptional activity of NF-κB p65 significantly increased the mRNA expressions and concentrations of inflammatory cytokines, tumor necrosis factor alpha (TNF-α, interleukin 6 (IL-6 and interleukin 1 beta (IL-1β, thereby inducing the inflammatory response in bovine rumen epithelial cells. However, inhibition of NF-κB p65 by PDTC significantly decreased the expressions and concentrations of the inflammatory cytokines induced by histamine in the rumen epithelial cells cultured in the neutral and acidic medium. Conclusion: The present data indicate that histamine induces the inflammatory response of bovine rumen epithelial cells through the NF-κB pathway.

  1. Bovine rumen epithelium undergoes rapid structural adaptations during grain-induced subacute ruminal acidosis.

    Science.gov (United States)

    Steele, Michael A; Croom, Jim; Kahler, Melissa; AlZahal, Ousama; Hook, Sarah E; Plaizier, Kees; McBride, Brian W

    2011-06-01

    Alterations in rumen epithelial structure and function during grain-induced subacute ruminal acidosis (SARA) are largely undescribed. In this study, four mature nonlactating dairy cattle were transitioned from a high-forage diet (HF; 0% grain) to a high-grain diet (HG; 65% grain). After feeding the HG diet for 3 wk, the cattle were transitioned back to the original HF diet, which was fed for an additional 3 wk. Continuous ruminal pH was measured on a weekly basis, and rumen papillae were biopsied during the baseline and at the first and final week of each diet. The mean, minimum, and maximum daily ruminal pH were depressed (P < 0.01) in the HG period compared with the HF period. During the HG period, SARA was diagnosed only during week 1, indicating ruminal adaptation to the HG diet. Microscopic examination of the papillae revealed a reduction (P < 0.01) in the stratum basale, spinosum, and granulosum layers, as well as total depth of the epithelium during the HG period. The highest (P < 0.05) papillae lesion scores were noted during week 1 when SARA occurred. Biopsied papillae exhibited a decline in cellular junctions, extensive sloughing of the stratum corneum, and the appearance of undifferentiated cells near the stratum corneum. Differential mRNA expression of candidate genes, including desmoglein 1 and IGF binding proteins 3, 5, and 6, was detected between diets using qRT-PCR. These results suggest that the structural integrity of the rumen epithelium is compromised during grain feeding and is associated with the differential expression of genes involved in epithelial growth and structure.

  2. PENANGANAN ORAL HIDRASI DAN KEJADIAN DEHIDRASI ANAK DIARE

    Directory of Open Access Journals (Sweden)

    Fera Dwi Purwanti

    2013-08-01

    Full Text Available Background: Many deaths due to diarrheal dehydration. While the primary treatment of diarrhea itself is overcome the dehydration. Rehydration therapy is highly effective for reducing mortality due to diarrheal dehydration. One factors that may affect the status of the child's diarrhea is rehidration of the parents in the treatment of oral hydration. There are 4 old men in rehydration in children with diarrhea is to provide a liquid, but with the amount, frequency and type of fluid that is not in accordance with the fluids the body needs. Research Objectives: To determine the relationship behavior parents in handling with oral hydration with events dehydration in children with diarrhea in RSUD Saras Husada Purworejo. Research Methods: This research uses method descriptive analytical using design cross sectional. Engineering samples are used by non-probability sampling using technique Accidental Sampling. Data collection by questionnaire. The number of samples is 24 parents of children with diarrhea. Analysis of test data used was the Kendall Tau. Results: The behavior of parents in the treatment of oral hydration of children suffering from diarrhea for lack of a majority of as many as 58,3%. Dehydration status of child diarrhea with dehydration diarrhea mostly mild / moderate as many as 45,8%. Results analysis Kendall Tau of -0,443 with level a significance of 0,020. The results showed a p-value less than 0,05 (0,020 < 0,05 which means there is a relationship between behavior parents' in the treatment of oral hydration with the incidence of dehydration in children with diarrhea in RSUD Saras Husada Purworejo. Conclusion: There is a relationship between behavior parents' in the treatment of oral hydration with the incidence of dehydration in children with diarrhea in RSUD Saras Husada Purworejo.

  3. A Surfactant-Induced Functional Modulation of a Global Virulence Regulator from Staphylococcus aureus.

    Directory of Open Access Journals (Sweden)

    Sukhendu Mandal

    Full Text Available Triton X-100 (TX-100, a useful non-ionic surfactant, reduced the methicillin resistance in Staphylococcus aureus significantly. Many S. aureus proteins were expressed in the presence of TX-100. SarA, one of the TX-100-induced proteins, acts as a global virulence regulator in S. aureus. To understand the effects of TX-100 on the structure, and function of SarA, a recombinant S. aureus SarA (rSarA and its derivative (C9W have been investigated in the presence of varying concentrations of this surfactant using various probes. Our data have revealed that both rSarA and C9W bind to the cognate DNA with nearly similar affinity in the absence of TX-100. Interestingly, their DNA binding activities have been significantly increased in the presence of pre-micellar concentration of TX-100. The increase of TX-100 concentrations to micellar or post-micellar concentration did not greatly enhance their activities further. TX-100 molecules have altered the secondary and tertiary structures of both proteins to some extents. Size of the rSarA-TX-100 complex appears to be intermediate to those of rSarA and TX-100. Additional analyses show a relatively moderate interaction between C9W and TX-100. Binding of TX-100 to C9W has, however, occurred by a cooperative pathway particularly at micellar and higher concentrations of this surfactant. Taken together, TX-100-induced structural alteration of rSarA and C9W might be responsible for their increased DNA binding activity. As TX-100 has stabilized the somewhat weaker SarA-DNA complex effectively, it could be used to study its structure in the future.

  4. Progress report of the Nuclear Physics Department

    International Nuclear Information System (INIS)

    1983-01-01

    The experiments and the technological studies carried out at the Nuclear Physics Department of Saclay from October 1, 1981 to September 30, 1982 are presented. These studies concern the structure of nuclei and hypernuclei and various reaction mechanisms. They have been performed with the 8.5 MV tandem Van de Graaff, with the 600 MeV electron linac, at the synchrotron SATURNE and with different accelerators belonging to other laboratories, in particular the SARA facility at Grenoble, the boosted tandem at Heidelberg and the secondary beams at CERN [fr

  5. Os desenhos animados e as crianças : um estudo multicaso sobre as preferências de desenhos animados por crianças do 1º ciclo do ensino básico

    OpenAIRE

    Morais, Sandra Araújo Martins

    2008-01-01

    Dissertação de mestrado em Estudos da Criança (área de especialização em Tecnologias de Informação e Comunicação) Em diversos estudos efectuados, nomeadamente no de Bredorode Santos (1991), Sara Pereira (2002) e Ana Maria Magalhães e Isabel Alçada (1993), as crianças indicam os desenhos animados como a programação específica na qual costumam despender mais tempo de visionamento, quer durante a semana, quer ao fim-de-semana. Todavia, a partir da revisão da literatura, verifi...

  6. Ear Acupuncture versus  local anaestethic for pain relief during perineal repair - a randomised controlled trial

    DEFF Research Database (Denmark)

    Kindberg, Sara

    2007-01-01

    ACUPUNCTURE OR LOCAL ANAESTETICS FOR PAIN RELIEF DURING PERINEAL REPAIR AFTER VAGINAL DELIVERY: A RANDOMISED CONTROLLED TRIAL.   By:  Sara Kindberg. Midwife and PhD student, Sønderborg Hospital, Denmark. Objective: To evaluate acupuncture as a new method of pain relief for postpartum perineal...... as photos of the acupuncture points. Perspectives:  Basic midwifery services such as providing sufficient pain relief during perineal repair still need improvement. Clinical practice should be improved continuously and thus produce reliable evidence on different pain relief methods. Website:        http...

  7. Proposed plan for the United Nuclear Corporation Disposal Site at the Oak Ridge Y-12 Plant, Oak Ridge, Tennessee

    International Nuclear Information System (INIS)

    1991-03-01

    The US Department of Energy (DOE) in compliance with Section 117(a) of the Comprehensive Environmental Response, Compensation, and Liability Act (CERCLA) of 1980, as amended by the Superfund Amendments and Reauthorization Act (SARA) of 1986, is releasing the proposed plan for remedial action at the United Nuclear Corporation (UNC) Disposal Site located at the DOE Oak Ridge Operations (ORO) Y-12 Plant, Oak Ridge, Tennessee. The purpose of this document is to present and solicit for comment to the public and all interested parties the ''preferred plan'' to remediate the UNC Disposal Site. However, comments on all alternatives are invited

  8. Annual report 1982

    International Nuclear Information System (INIS)

    This annual report describes the work during 1982 of the Nuclear Physics Institute of Lyon. The achievement of SARA postaccelerator in Grenoble, realized in collaboration with the Nuclear Science Institute, permits to pursue new lines of research in heavy ion physics. A new isotope separator was realized by the nuclear spectroscopy group and the high energy experimental group cooperates with the LAPP to build in international collaboration the L3 detector for LEP. The topics covered include theoretical physics, high energy and intermediate energy physics, nuclear physics and interdisciplinary physics, such as solid state physics and neutronics [fr

  9. Neutrons and light nuclei detectors realization for the 4π multidetector amphora

    International Nuclear Information System (INIS)

    Pastor, C.

    1987-01-01

    Detection of light charged particles emitted in reactions induced by heavy ions has been studied. Several types of detectors are presented as phoswiches of scintillators, single scintillators or combinations of scintillators having different functions (either detection of charged particles only or detection of charged particles and neutrons). The AMPHORA 4 π detection array has been designed and built as a set of 140 of these cells. Il covers a solid angle of 82 % out of 4 π around a target bombarded by ion beams delivered by the SARA facility in Grenoble [fr

  10. Validating the Patient Experience with Treatment and Self-Management (PETS), a patient-reported measure of treatment burden, in people with diabetes

    OpenAIRE

    Rogers,Elizabeth; Yost,Kathleen; Rosedahl,Jordan; Linzer,Mark; Boehm,Deborah; Thakur,Azra; Poplau,Sara; Anderson,Roger; Eton,David

    2017-01-01

    Elizabeth A Rogers,1,2 Kathleen J Yost,3 Jordan K Rosedahl,3 Mark Linzer,4 Deborah H Boehm,5 Azra Thakur,5 Sara Poplau,5 Roger T Anderson,6 David T Eton3 1Department of Medicine, University of Minnesota Medical School, Minneapolis, MN, USA; 2Department of Pediatrics, University of Minnesota Medical School, Minneapolis, MN, USA; 3Department of Health Services Research, Mayo Clinic, Rochester, MN, USA; 4Department of Medicine, Hennepin County Medical Center, Minneapolis, MN, USA; 5Minneapolis M...

  11. New Editors Appointed for Sections of Journal of Geophysical Research

    Science.gov (United States)

    2009-04-01

    New editors have been appointed for the Atmospheres, Biogeosciences, and Oceans sections of the Journal of Geophysical Research (JGR). Joost de Gouw (NOAA, Boulder, Colo.) and Renyi Zhang (Texas A&M, College Station) are filling the vacancies of retiring Atmospheres section editors John Austin and Jose Fuentes. De Gouw and Zhang join the continuing editors Steven Ghan and Yinon Rudich. Sara Pryor (Indiana University, Bloomington) is joining the Atmospheres section editorial board as an associate editor now; she will transition to editor in January 2010.

  12. Der er en særlig plads i Helvede for dovne børn

    DEFF Research Database (Denmark)

    Eriksen, Camilla Bruun

    2015-01-01

    in the process. Inspired also by Sara Ahmed and her claim that emotions are cultural practices that hold affective power and organize our modes of life, this article is interested in the ways the ‘healthy’ body is understood as tied to life and therefore gets to count as life. The article concludes that health...... are made (im)possible through the game’s strong narrative about Hell, death and health. The article will show how this narrative helps create ’healthy’ and ’liveable’ subject positions (for some) while understandings (of what health is or could be) that differ from the game’s view are stigmatized...

  13. KOULUIKÄISEN LAPSEN PELON HELPOTTAMINEN LEI-KIN KEINOIN SAIRAALASSA : Kuvaileva kirjallisuuskatsaus

    OpenAIRE

    Hietanen, Sara

    2017-01-01

    Hietanen, Sara. Kuvaileva kirjallisuuskatsaus kouluikäisen lapsen pelon helpottamisesta leikin keinoin sairaalassa. Kirjallisuuskatsaus. 27 sivua, 2 liitettä. Hel-sinki, kevät 2017. Diakonia-ammattikorkeakoulu, Hoitotyön koulutusohjelma, sai-raanhoitaja (AMK). Opinnäytetyön tarkoituksena oli kuvata leikin keinoja, joiden avulla voidaan hel-pottaa lasten pelkoja ja ahdistusta sairaalassa. Tavoitteena oli kartoittaa muualla maailmalla käytettäviä leikkiin liittyviä työmuotoja ja -menetelmiä...

  14. Archivos y bibliotecas en la antigüedad

    OpenAIRE

    Calderón Rondón, Homero A.

    2005-01-01

    SUMARIO Presentación Olmos Reverón, Sara M. Artículos Primera Parte Archivos y bibliotecas en la antigüedad Archives and libraries in ancient times Calderón Rondón, Homero A. Algunos aspectos sobre los libros y las bibliotecas en la Edad Media Some considerations on Medieval books and libraries Pérez Medina, Guillermo Amado Pérez Medina, Simón Vladimir La Farmacia del Alma. Primera Biblioteca de la Universidad de Los Andes The soul p...

  15. Pneumonia por varicela associada com síndrome da angústia respiratória aguda: relato de dois casos Varicella pneumonia complicated with acute respiratory distress syndrome: two cases report

    Directory of Open Access Journals (Sweden)

    Marcelo Moreno

    2007-03-01

    Full Text Available JUSTIFICATIVA E OBJETIVOS: A varicela é uma doença exantemática causada pela infecção primária do vírus varicela zoster (VVZ. A pneumonia pelo VVZ complicada com a síndrome da angústia respiratória aguda (SARA é rara e associa-se a altas taxas de morbimortalidade. O objetivo deste estudo foi apresentar dois casos de pneumonia por varicela que evoluíram com SARA e outras disfunções orgânicas. RELATO DOS CASOS: Paciente de 15 anos, imunocomprometido com a síndrome da imunodeficiência adquirida (SIDA e uma paciente do sexo feminino imunocompetente, foram admitidos na UTI com quadro clínico de varicela, SARA, trombocitopenia e acidose graves. Além disso, disfunção cardiovascular e falência renal ocorreram no primeiro e segundo casos, respectivamente. Foram tratados com aciclovir além de ventilação mecânica protetora. CONCLUSÕES: Os dois casos de pneumonia por varicela, que apresentaram SARA e disfunções de múltiplos órgãos, obtiveram boa evolução clínica.BACKGROUNG AND OBJECTIVES: Varicella is an exantematic disease caused by varicella-zoster virus. Varicella pneumonia complicated with acute respiratory distress syndrome (ARDS is very rare in adults and is associated with high morbimortality. We report two cases of ARDS secondary to varicella-zoster virus pneumonia. CASES REPORT: We report two cases of ARDS and multiple organ dysfunction syndrome (MODS secondary to varicella-zoster virus pneumonia. A 15-year-old man with human immunodeficiency virus (HIV infection and a 29-year-old immunocompetent female were admitted in the ICU with primary varicella infection and pneumonia. Both cases progressed towards ARDS, severe thrombocytopenia and acidosis. In addition cardiovascular and renal failure occurred in the first and second patients, respectively. Treatment consisted of immediate administration of intravenous acyclovir and a lung-protective ventilation strategy. CONCLUSIONS: Both cases of varicella

  16. Epidemiology of cerebral palsy in Southern Denmark

    DEFF Research Database (Denmark)

    Frøslev-Friis, Christina; Dunkhase-Heinl, Ulrike; Andersen, Johnny Dohn Holmgren

    2015-01-01

    INTRODUCTION: The aim of this study was to describe the prevalence, subtypes, severity and neuroimaging findings of cerebral palsy (CP) in a cohort of children born in Southern Denmark. Risk factors were analysed and aetiology considered. METHODS: A population-based cohort study covering 17...... prevention of CP is possible if the numbers of preterm births and multiple pregnancies can be reduced. FUNDING: The Danish Cerebral Palsy Follow-up Programme is supported by the foundation "Ludvig og Sara Elsass Fond". TRIAL REGISTRATION: 2008-58-0034....

  17. The Mysidacea of the Andaman Sea

    Digital Repository Service at National Institute of Oceanography (India)

    Panampunnayil, S.U.

    Press 2002 The Mysidacea of the Andaman Sea S. U. PANAMPUNNAYIL NATIONAL INSTITUTE OF OCEANOGRAPHY, REGIONAL CENTRE, COCHIN ., INDIA E-MAIL: sara@niokochi.org Fifteen species belonging to eight genera were collected from the shallow waters (0–150 m... the distal border of the telson (Figures 2C,D) the middle is longer while in female the apex is slightly expanded and the outer two pairs are longer and subequal (Figures 2E,F). In Hansen’s and Pillai’s speci- mens the middle pair of spines is the longest...

  18. Symposium on Molecular Spectroscopy (40th) Held at Columbus, Ohio on 17-21 June 1985.

    Science.gov (United States)

    1985-06-21

    INFRARED-MICROWAVE SIDEBAND LASER SPECTROSCOPY OF THE v, AND 2v,*v, BANDS OF 1𔃽CHF’ SANG LEE, R. H. SCHWENDEMAN, AND GOTTFRIED MAGERL Approximately...University, Mississippi State, Mississippi 39762 FA6. (9:4 FORCE CONSTANTS FOR THE CYCLOPROPENYL CATION NORMAN C. CRAIG, JULIANTO PRANATA, SARA JAMIE...WHJO RA14 MAESSEN, B.--RFl4, RF15 HEAVEN, M. C. --MG7, MG8, MG9, KENNY,’ J. E.--MF9, M[FlO, M_7l1 MAGERL, GOTTFRIED --RF5 Presiding over Session MG

  19. The unattainable attempt to avoid the casus irreducibilis for cubic equations Gerolamo Cardano's De Regula Aliza

    CERN Document Server

    Confalonieri, Sara

    2015-01-01

    Sara Confalonieri presents an overview of Cardano's mathematical treatises and, in particular, discusses the writings that deal with cubic equations. The author gives an insight into the latest of Cardano's algebraic works, the De Regula Aliza (1570), which displays the attempts to overcome the difficulties entailed by the casus irreducibilis. Notably some of Cardano's strategies in this treatise are thoroughly analyzed. Far from offering an ultimate account of De Regula Aliza, by one of the most outstanding scholars of the 16th century, the present work is a first step towards a better understanding.

  20. International Migration, US Immigration Law and Civil Society: From the Pre-Colonial Era to the 113th Congress (Edited by Leonir Mario Chiarello and Donald Kerwin, Scalabrini International Migration Network, 2014

    Directory of Open Access Journals (Sweden)

    Breana George

    2014-09-01

    Full Text Available International Migration, US Immigration Law and Civil Society: From the Pre-Colonial Era to the 113th Congress, published by the Scalabrini International Migration Network in collaboration with the Center for Migration Studies of New York, offers an overview of immigration law and policy that contextualizes the present challenges in reaching policy consensus in the immigration debate. This book review highlights the debate on executive action in relation to a chapter on the evolution of US immigration laws by Charles Wheeler and a chapter on the role of civil society in immigration policymaking by Sara Campos. 

  1. Location-based games

    DEFF Research Database (Denmark)

    Ejsing-Duun, Stine

    In this dissertation, it is explored which prerequisites are necessary in location-based games (LBGs) to make meaningful the meeting between players and spatiality with an emphasis on physical locations. Throughout the dissertation, it has been shown that LBGs affect players’ perception of and be...... possible. The practical contribution is my creation of the LBG Visions of Sara. People continue to play this game in Odense more than two years after its launch, and DJEEO uses it as a showcase, enabling the company to sell similar LBGs....

  2. Shameful Separations and Embarrassing Proximities

    DEFF Research Database (Denmark)

    Frederiksen, Maja Bissenbakker

    2012-01-01

    state of the subject or a mere social construct, this thinking enables an understanding of shame as performative acts that constitute the very positions that a subject may occupy and experience. Using examples from the on-going Danish debate on prostitution, the article suggests an analysis of “what...... structures, and when does it stigmatize the sex workers whom the speakers purport to protect? Inspired by Sara Ahmed’s work on affect, the article concludes that shame can play interestingly together with activist strategies when its ability to “stick” certain subject positions and subject matters together...

  3. Love Without Borders?

    DEFF Research Database (Denmark)

    Bissenbakker, Mons; Myong, Lene

    2016-01-01

    the idealized version of love promoted by LWB happened to take the form of romantic intimacy predominantly consisting of straight, young and white-brown couples oriented towards reproduction. Our main argument is that despite its good intentions of supporting migration the activist campaign ‘Love without...... and to the political system in ways that sustain white hegemony. Building mainly on Sara Ahmed's and Laurent Berlant's reflections on love as cultural politics the article analyzes posters, viral videos and newspaper debates in its discussion of the promises and pitfalls of love as an affective political tool....

  4. El Sistema inspirerede projekter

    DEFF Research Database (Denmark)

    Holst, Finn; Chemi, Tatiana

    Rapporten er resultat af pilotprojektet ”Forundersøgelse El Sistema DK” gennemført af Ph.D. Finn Holst (DPU, Aarhus Universitet) og Ph.D. Tatiana Chemi (Aalborg Universitet) i 2015. I rapporten indgår desuden bidrag fra Sofie Holm, Sara Fink Søndergaard og Stine Møgelbjerg Johansen. Pilotprojektet...... er gennemført for DMKLs El Sistema-udvalg med støtte fra Statens Kunstfond, Projektstøtteudvalget for Musik....

  5. Strange culinary cncounters:

    DEFF Research Database (Denmark)

    Leer, Jonatan; Kjær, Katrine Meldgaard

    Strange Culinary Encounters: Stranger Fetishism in Cooking Shows In this paper, we will examine the ways in which the encountering of 'other' food cultures is played out in the two travelogue cooking shows Gordon's Great Escape and Jamie's Italian Escape, arguing that despite their ‘noble......’ intentions and ‘enlightened’ cosmopolitan approach to meeting the other (culinary culture), ultimately, Jamie and Gordon's respective culinary adventures work to create a social hierarchy in their own favor. Inspired by Sara Ahmed’s work on stranger fetishism, we will investigate how the two protagonist...

  6. Progress report of the nuclear physics department

    International Nuclear Information System (INIS)

    1987-01-01

    This progress report presents the experiments and the technological studies carried out at the Nuclear Physics Department of Saclay from October 1, 1985 to September 30, 1986. These studies concern the structure of nuclei, the nuclear reaction mechanisms and, more and more, mesic processes in nuclear dynamics. The experiments have been carried at the 700 MeV electron linac, the synchrotron SATURNE, the heavy ion accelerator GANIL, the SARA facility at Grenoble. An important technical activity has been devoted to the construction of the supraconducting booster of the 9 MV tandem [fr

  7. Talking about Life

    Science.gov (United States)

    Impey, Chris

    2010-08-01

    Preface; Part I. Introduction Timothy Ferris, Iris Fry, Steven Dick, Ann Druyan, Pinky Nelson, Neil Tyson, Steve Benner and William Bains; Part II. Earth Roger Buick, Lynn Rothschild, John Baross, Joe Kirschvink, Andrew Knoll, Simon Conway Morris, Roger Hanlon and Lori Marino; Part III. Solar System Chris McKay, David Grinspoon, Jonathan Lunine, Carolyn Porco, Laurie Leshin, Guy Consolmagno and Peter Smith; Part IV. Exoplanets Alan Boss, Geoff Marcy, Debra Fischer, Sara Seager, David Charbonneau and Vikki Meadows; Part V. Frontiers Jill Tarter, Seth Shostak, Ray Kurzweil, Nick Bostrom, Paul Davies, Martin Rees, Ben Bova and Jennifer Michael Hecht; Reading list; Glossary; Index.

  8. Automated accountability of hazardous materials at AlliedSignal Inc., Kansas City Division

    International Nuclear Information System (INIS)

    Depew, P.L.

    1993-12-01

    The Department of Energy's (DOE) Kansas City Plant (KCP), currently operated by AlliedSignal Inc. has developed a comprehensive Hazardous Material Information System (HMIS). The purpose of this system is to provide a practical and automated method to collect, analyze and distribute hazardous material information to DOE, KCP associates, and regulatory agencies. The drivers of the HMIS are compliance with OSHA Hazard Communications, SARA reporting, pollution prevention, waste minimization, control and tracking of hazards, and emergency response. This report provides a discussion of this system

  9. Oculomotor and Vestibular Findings in Gaucher Disease Type 3 and Their Correlation with Neurological Findings

    Directory of Open Access Journals (Sweden)

    Tatiana Bremova-Ertl

    2018-01-01

    Full Text Available ObjectivesTo evaluate the function of the oculomotor and vestibular systems and to correlate these findings with the clinical status of patients with Gaucher disease type 3 (GD3. The goal of this cross-sectional and longitudinal study was to find oculomotor biomarkers for future clinical trials.MethodsTwenty-six patients with GD3 were assessed for eligibility and 21 were able to perform at least one task. Horizontal and vertical reflexive saccades, smooth pursuit, gaze-holding, optokinetic nystagmus, and horizontal vestibulo-ocular reflex (VOR were examined by video-oculography/video-head impulse test and compared concurrently with 33 healthy controls. The Scale for the Assessment and Rating of Ataxia (SARA, the modified Severity Scoring Tool (mSST, and Grooved Pegboard Test (GPT were administered to assess overall neurological function. Eleven patients were also re-assessed after 1 year.ResultsNine out of 17 patients exhibited gaze-holding deficits. One patient had upbeat nystagmus. Three patients presented with bilateral abducens palsy in combination with central oculomotor disorders, suggesting a bilateral involvement of the abducens nucleus. Horizontal angular VOR gain was reduced in all patients (0.66 ± 0.37 compared with controls (1.1 ± 0.11, p < 0.001. Most strongly correlated with clinical rating scales were peak velocity of downward saccades (SARA: ρ = −0.752, p < 0.0005; mSST: ρ = −0.611, p = 0.003; GPT: ρ = −0.649, p = 0.005 and duration of vertical saccades (SARA: ρ = 0.806, p < 0.001; mSST: ρ = 0.700, p < 0.0005; GPT: ρ = 0.558, p = 0.02 together with the VOR gain (SARA: ρ = −0.63, p = 0.016; mSST: ρ = −0.725, p = 0.003; GPT: ρ = −0.666, p = 0.004. Vertical smooth pursuit gain decreased significantly at follow-up.InterpretationThis study shows neuronal degeneration of the brainstem and cerebellum with combined involvement of

  10. Research Implementation and Quality Assurance Project Plan: An Evaluation of Hyperspectral Remote Sensing Technologies for the Detection of Fugitive Contamination at Selected Superfund Hazardous Waste Sites

    Science.gov (United States)

    Slonecker, E. Terrence; Fisher, Gary B.

    2009-01-01

    This project is a research collaboration between the U.S. Environmental Protection Agency (EPA) Office of Inspector General (OIG) and the U.S. Geological Survey (USGS) Eastern Geographic Science Center (EGSC), for the purpose of evaluating the utility of hyperspectral remote sensing technology for post-closure monitoring of residual contamination at delisted and closed hazardous waste sites as defined under the Comprehensive Environmental Response Compensation and Liability Act [CERCLA (also known as 'Superfund')] of 1980 and the Superfund Amendments and Reauthorization Act (SARA) of 1986.

  11. Avgang 2017: Don Giovanni i Operaen

    OpenAIRE

    2017-01-01

    Opera av W.A. Mozart, med våre MA-studenter og gjester. Medvirkende: Dagfinn Andersen (MA2), Emil Havold Næshagen (MA1), Hanne Korsbrekke Askeland (MA2), Nora Oleanne Sårheim (MA2?), Sara Aasen (MA2), Marcela Randem (MA1), Eilert Hasseldal (MA1). Gjester: Eirik Grøtvedt, Per Lindström, Pavels Trofimiks. Kostymer: Fredrik Straum Floen. Dessuten medvirker kor (NMH), strykere (Ensemble Allegri) og blåsere (Stabsmusikken i Oslo)

  12. Reviews of recent publications

    Directory of Open Access Journals (Sweden)

    1994-06-01

    Full Text Available Bjornson, Richard. The African Quest for Freedom and Identity: Cameroonian Writing and the National Experience by Thomas A. Hale Cixous, Hélène. 'Coming to Wrting' and Other Essays by Randi Brox Birn Derwin, Susan. The Ambivalence of Form: Lukacs, Freud, and the Novel by Eva L. Corredor Kaminsky, Amy K. Reading the Body Politic: Feminist Criticism and Latin American Women Writers by Naomi Lindstrom Nägele, Rainer. Theater, Theory, Speculation: Walter Benjamin and the Scenes of Modernity by Alice A. Kuzniar Tomlinson, John. Cultural Imperialism by Michael Filcher Weisberg, Richard. Poethics and Other Strategies of Law and Literature by Sara B. Blair

  13. Representasi Budaya Popular dalam Video Parodi Jokowi-Ahok di Youtube Selama Pemilukada DKI Jakarta 2012

    OpenAIRE

    Wulansari, Amalia Ayu; Lukmantoro, Triyono; Hasfi, Nurul

    2013-01-01

    Representation of Popular Culture in Jokowi-Ahok's Video Parodyson Youtube During Pemilukada DKI Jakarta 2012AbstractPemilukada DKI Jakarta 2012 was marked by the rise of videos that related toGovernor and Vice Governor candidates of DKI Jakarta 2012 on internet mediaYoutube, such as videos which is purposely made for campaign, or videos withSARA (etnic, religion, race and inter-group) issue, that attack one of the pair'scabdidates. The interesting point is videos made by partisipants and vol...

  14. GOLD and the fixed ratio

    Directory of Open Access Journals (Sweden)

    Vestbo J

    2012-09-01

    Full Text Available Jørgen VestboUniversity of Manchester, Manchester, UKI read with interest the paper entitled "Diagnosis of airway obstruction in the elderly: contribution of the SARA study" by Sorino et al in a recent issue of this journal.1 Being involved in the Global Initiative for Obstructive Lung Diseases (GOLD, it is nice to see the interest sparked by the GOLD strategy document. However, in the paper by Sorino et al, there are a few misunderstandings around GOLD and the fixed ratio (forced expiratory volume in 1 second/forced volume vital capacity < 0.70 that need clarification.View original paper by Sorino and colleagues.

  15. The prevalence and causes of decreased visual acuity – a study based on vision screening conducted at Enukweni and Mzuzu Foundation Primary Schools, Malawi

    OpenAIRE

    Thom L; Jogessar S; McGowan SL; Lawless F

    2016-01-01

    Leaveson Thom,1 Sanchia Jogessar,1,2 Sara L McGowan,1 Fiona Lawless,1,2 1Department of Optometry, Mzuzu University, Mzuzu, Malawi; 2Brienholden Vision Institute, Durban, South Africa Aim: To determine the prevalence and causes of decreased visual acuity (VA) among pupils recruited in two primary schools in Mzimba district, northern region of Malawi.Materials and methods: The study was based on the vision screening which was conducted by optometrists at Enukweni and Mzuzu Foundation Primary Sc...

  16. The prevalence and causes of decreased visual acuity – a study based on vision screening conducted at Enukweni and Mzuzu Foundation Primary Schools, Malawi

    OpenAIRE

    Thom,Leaveson; Jogessar,Sanchia; McGowan,Sara L; Lawless,Fiona

    2016-01-01

    Leaveson Thom,1 Sanchia Jogessar,1,2 Sara L McGowan,1 Fiona Lawless,1,2 1Department of Optometry, Mzuzu University, Mzuzu, Malawi; 2Brienholden Vision Institute, Durban, South Africa Aim: To determine the prevalence and causes of decreased visual acuity (VA) among pupils recruited in two primary schools in Mzimba district, northern region of Malawi.Materials and methods: The study was based on the vision screening which was conducted by optometrists at Enukweni and Mzuzu Foundation Primary Sc...

  17. Development, characterization, and skin delivery studies of related ultradeformable vesicles: transfersomes, ethosomes, and transethosomes

    OpenAIRE

    Ascenso, Andreia; Raposo, Sara; Batista, Cátia; Cardoso, Pedro; Mendes, Tiago; Praça, Fabíola Garcia; Bentley, Maria Vitória Lopes Badra; Simões, Sandra

    2015-01-01

    Andreia Ascenso,1 Sara Raposo,1 Cátia Batista,2 Pedro Cardoso,2 Tiago Mendes,2 Fabíola Garcia Praça,3 Maria Vitória Lopes Badra Bentley,3 Sandra Simões1 1Instituto de Investigação do Medicamento (iMed.ULisboa), 2Faculdade de Farmácia, Universidade de Lisboa, Lisboa, Portugal; 3Faculdade de Ciências Farmacêuticas de Ribeirão Preto, Universidade de São Paulo, Monte ...

  18. Progress report of the nuclear physics department

    International Nuclear Information System (INIS)

    1986-01-01

    This progress report presents the experiments and the technological studies carried out at the Nuclear Physics Department of Saclay from October 1, 1984 to September 30, 1985. These studies concern the structure of nuclei, the nuclear reaction mechanisms and, more and more, mesic processes in nuclear dynamics. The experiments have been carried at the 700 MeV electron linac, the synchrotron SATURNE, the heavy ion accelerator GANIL, the SARA facility at Grenoble, and the antiproton beams at CERN. An important technical activity has been devoted to the construction of the supraconducting booster of the 9 MV tandem [fr

  19. Nova Talenta: 2014-2015

    OpenAIRE

    Aguilera Velandia, Mónica Natalia; Álvarez Rodríguez, María Isabel; Báez Millán, Christian Danilo; Cuestas Díaz, Andrea Patricia; Escobar Campos, Lina Marcela; Galindo Londoño, Ana María; García Sierra, María Camila; García, Lina María; Jaramillo Barrios, María Paola; Mesa Torres, Karen Eliana; Mora Barrero, Daniel; Morales Morales, Ángela Beatriz; Moreno, Ana María; Naranjo Pinilla, Juan Sebastian; Ochoa Rodríguez, Ángela Marcela

    2015-01-01

    Contenido Introducción 1. Inteligencia emocional, liderazgo transformacional y género: factores que influencian el desempeño organizacional / Ana María Galindo Londoño, Sara Urrego Mayorga; Director: Juan Carlos Espinosa Méndez. 2. El rol de la mujer en el liderazgo / Andrea Patricia Cuestas Díaz; Directora: Francoise Venezia Contreras Torres. 3. Liderazgo transformacional, clima organizacional, satisfacción laboral y desempeño. Una revisión de la literatura / Juliana Restrepo O...

  20. Early Life Processes, Endocrine Mediators, and Number of Susceptible Cells in Relation to Breast Cancer Risk

    Science.gov (United States)

    2011-04-01

    maternal and fetal adrenal glands are enzymatically converted in the placenta to androstene- dione and testosterone, which are then aromatized to...androgens). The attenu- ation in the group differences for estriol with androstene- dione in the model could also result if androstenedione was...Jianjun Liu2, Rulla M Tamimi3,4, Sara Lindström5, David J Hunter3, Celine M Vachon6, Fergus J Couch7, Christopher G Scott6, Pagona Lagiou4,8, Per Hall1

  1. Lección clínica ortopédica

    OpenAIRE

    Leiva Pereira, Lisandro

    2011-01-01

    Historia Clínica N° 14247Servicio de Ortopedia y Cirugía de Urgencia.Sala de Mujeres.Lección clínica dictada por el Profesor L. Leyva Pereira el 23 dejunio de 1.939. (Version taquigráfica de la señorita Sara Elvia Calderón, mecano-tuquígrafa de dicha Clínica)."Nombre de la enferma : Leonor Peña.Edad: 60 afios.Estado civil: Viuda.Entró al servicio el 28 de diciembre de 1938.Antecedentes personales y hereditarios : Sin importancia.

  2. A new method for the automatic calculation of prosody

    International Nuclear Information System (INIS)

    GUIDINI, Annie

    1981-01-01

    An algorithm is presented for the calculation of the prosodic parameters for speech synthesis. It uses the melodic patterns, composed of rising and falling slopes, suggested by G. CAELEN, and rests on: 1. An analysis into units of meaning to determine a melodic pattern 2. the calculation of the numeric values for the prosodic variations of each syllable; 3. The use of a table of vocalic values for the three parameters for each vowel according to the consonantal environment and of a table of standard duration for consonants. This method was applied in the 'SARA' program of synthesis with satisfactory results. (author) [fr

  3. Environmental compliance at U.S. Department of Energy FUSRAP (Formerly Utilized Sites Remedial Action Program) sites

    International Nuclear Information System (INIS)

    Liedle, S.D.; Clemens, B.W.

    1988-01-01

    With the promulgation of the Superfund Amendments and Reauthorization Act (SARA), federal facilities were required to comply with the Comprehensive Environmental Response Compensation and Liability Act (CERCLA) in the same manner as any non-government entity. This presented challenges for the Department of Energy (DOE) and other federal agencies involved in remedial action work because there are many requirements under SARA that overlap other laws requiring DOE compliance, e.g., the National Environmental Policy Act (NEPA). This paper outlines the options developed to comply with CERCLA and NEPA as part of active, multi-site remedial action program. The program, the Formerly Utilized Sites Remedial Action Program (FUSRAP), was developed to identify, clean up, or control sites containing residual radioactive or chemical contamination as a result of the nation's early development of nuclear power. During the Manhattan Project, uranium was extracted from ores and resulted in mill concentrates, purified metals, and waste products that were transported for use or disposal at other locations. Figure 1 shows the steps for producing uranium metal during the Manhattan Project. As a result of these activities materials, equipment, buildings, and land became contaminated, primarily with naturally occurring radionuclides. Currently, FUSRAP includes 29 sites; three are on the Environmental Protection Agency's (EPA's) National Priorities List (NPL) of hazardous waste sites

  4. Defining the Core Genome of Salmonella enterica Serovar Typhimurium for Genomic Surveillance and Epidemiological Typing

    Science.gov (United States)

    Fu, Songzhe; Octavia, Sophie; Tanaka, Mark M.; Sintchenko, Vitali

    2015-01-01

    Salmonella enterica serovar Typhimurium is the most common Salmonella serovar causing foodborne infections in Australia and many other countries. Twenty-one S. Typhimurium strains from Salmonella reference collection A (SARA) were analyzed using Illumina high-throughput genome sequencing. Single nucleotide polymorphisms (SNPs) in 21 SARA strains ranged from 46 to 11,916 SNPs, with an average of 1,577 SNPs per strain. Together with 47 strains selected from publicly available S. Typhimurium genomes, the S. Typhimurium core genes (STCG) were determined. The STCG consist of 3,846 genes, a set that is much larger than that of the 2,882 Salmonella core genes (SCG) found previously. The STCG together with 1,576 core intergenic regions (IGRs) were defined as the S. Typhimurium core genome. Using 93 S. Typhimurium genomes from 13 epidemiologically confirmed community outbreaks, we demonstrated that typing based on the S. Typhimurium core genome (STCG plus core IGRs) provides superior resolution and higher discriminatory power than that based on SCG for outbreak investigation and molecular epidemiology of S. Typhimurium. STCG and STCG plus core IGR typing achieved 100% separation of all outbreaks compared to that of SCG typing, which failed to separate isolates from two outbreaks from background isolates. Defining the S. Typhimurium core genome allows standardization of genes/regions to be used for high-resolution epidemiological typing and genomic surveillance of S. Typhimurium. PMID:26019201

  5. Individualized exergame training improves postural control in advanced degenerative spinocerebellar ataxia: A rater-blinded, intra-individually controlled trial.

    Science.gov (United States)

    Schatton, Cornelia; Synofzik, Matthis; Fleszar, Zofia; Giese, Martin A; Schöls, Ludger; Ilg, Winfried

    2017-06-01

    Treatment options are rare in degenerative ataxias, especially in advanced, multisystemic disease. Exergame training might offer a novel treatment strategy, but its effectiveness has not been investigated in advanced stages. We examined the effectiveness of a 12-week home-based training with body-controlled videogames in 10 young subjects with advanced degenerative ataxia unable or barely able to stand. Training was structured in two 6-weeks phases, allowing to adapt the training according to individual training progress. Rater-blinded clinical assessment (Scale for the Assessment and Rating of Ataxia; SARA), individual goal-attainment scoring (GAS), and quantitative movement analysis were performed two weeks before training, immediately prior to training, and after training phases 1 and 2 (intra-individual control design). This study is registered with ClinicalTrials.gov, NCT02874911). After intervention, ataxia symptoms were reduced (SARA -2.5 points, p training (p = 0.04). Goal attainment during daily living was higher than expected (GAS: 0.45). Movement analysis revealed reduced body sway while sitting (p training-induced improvements in posture control mechanisms. This study provides first evidence that, even in advanced stages, subjects with degenerative ataxia may benefit from individualized training, with effects translating into daily living and improving underlying control mechanisms. The proposed training strategy can be performed at home, is motivating and facilitates patient self-empowerment. Copyright © 2017 Elsevier Ltd. All rights reserved.

  6. ТHE TREASURE OF MACEDONIA THE ETHNO - SOCIAL AND CULTURAL – HISTORICAL TOURISTIC MOTIVES IN THE SHAR – POLOG REGION

    Directory of Open Access Journals (Sweden)

    Jagoda Jankovska

    2013-07-01

    Full Text Available Macedonia is a country rich in natural and cultural heritage, which makes it extremely interesting as a tourist destination. There is almost no place that is not marked by cultural characteristics and natural beauty. All this makes Macedonia a unique touristic place. In the abundance of cultural diversity, Sara-Polog region offers an amazing mix of ethno-social, cultural and historical motifs that are not sufficiently studied, but can very easily contribute to greater tourism development in Macedonia. The main aim of this Paper is to identify and describe the cultural, historical andethno-social values of Sara-Polog Region, as a precondition for tourismdevelopment not only in the region, but in Macedonia as well. The research was done using the precise scientific methodology, especially: analysis and synthesis, and the genetic-evolutionary, the historical and the comparative method. The research done led to the conclusion that this attractivemulti-ethnicarea is extremely rich withdifferent ethno dresses, songs, art, traditional music instruments and dances, customs, religious buildings and houses, are enriching the touristic offer in Macedonia.

  7. Bioremediation of soils contaminated by hydrocarbons at the coastal zone of “Punta Majagua”.

    Directory of Open Access Journals (Sweden)

    Jelvys Bermúdez Acosta

    2012-03-01

    Full Text Available The purpose of this research was to describe and assess the main results in the process of bioremediation of 479 m3 of petroleum residuals spilled on the soil and restrained into four deposits of fuel on the coastal zone of “Punta Majagua”, Cienfuegos. The volume of hydrocarbons spilled and contained into the tanks was determined by means of their previous mixture with fertile ground in a ratio of 3/1. The hydrocarbons were disposed in a bioremediation area of 115 m X 75m built in situ. In turn 54, 5 m3 of BIOIL - FC were applied, which were fermented in an industrial bioreactor of 12000 L. An initial sampling was carried out registering values of total hydrocarbons (HTP higher than 41880 mg/kg, with high concentrations of Saturated hydrocarbons, aromatics, resins, asphaltens (SARA. Three subsequent samples were taken with a sampling interval of 0, 45, 90 and 120 days of the application. An average concentration of 1884.57 mg/kg of total hydrocarbons was obtained at 120 days with an average removal rate of 94.8%, moreover values of 94.6%, 90.78%, 86.99% y 79.9% of SARA were respectively reported.

  8. Preliminary data report of investigations conducted at the Salmon Site, Lamar County, Mississippi

    International Nuclear Information System (INIS)

    1994-04-01

    The US Department of Energy (DOE) conducted ecological studies at the Salmon Site (SS), Lamar County, Mississippi, from the middle of June 1992 to the end of April 1993. The studies are part of the Remedial Investigation and Feasibility Study (RI/FS) being conducted by the DOE. The RI/FS is the methodology under the Comprehensive Environmental Response, Compensation, and Liability Act of 1980, as amended by the Superfund Amendments and Reauthorization Act of 1986 (CERCLA/SARA) for evaluating hazardous waste sites on the National Priorities List (NPL). The Salmon Site is not listed on the NPL but DOE has voluntarily elected to conduct the evaluation of the SS in accordance with CERCLA/SARA. As part of the remedial investigation, baseline human health and ecological risk assessments will be conducted. These baseline risk assessments will evaluate the potential impact on human health and the environment if remedial actions are not conducted, identify locations where additional information needs to be collected, help determine whether remedial actions are necessary, and provide justification for performing remedial actions. This report describes the sampling activities conducted between February and April 1993 to aid in evaluating the possible environmental impacts at the SS tailored to the specific circumstances and conditions found there. The initial investigations included identification of the flora and fauna in and around the SS, with particular emphasis on identifying sensitive environments, endangered species and their habitats, and those species consumed by humans or found in human food chains

  9. KEKUASAAN SIMBOLIK DALAM WACANA POLITIK DI MEDIA CETAK

    Directory of Open Access Journals (Sweden)

    Lilik Wahyuni

    2008-12-01

    Full Text Available As a social practice, language is used to persuade, influence, argue, refuse, maintain, and to response one’s reaction. Using language, one may practically pro- duce and reproduce authority. This article deals with the symbolic fight and the mechanism of symbolic force within politics discourse in written media. The analy- sis technique used is critical discourse analysis, especially in the interaction be- tween language and social structure. The result shows that the symbolic fight in the written media represents the practice of continuing the doxa by the orthodoxa group and of attacking it by the heterodoxa group. The strategies of fighting the doxa are by showing the orthodoxa group’s weaknesses, arousing the enmity within the group, comparing the orthodoxa group to others, and by using SARA and com- munity issues. The mechanism of the symbolic force used by the ortodoxa is the use of euphemism and censor.   Key words: kekuasaan simbolik, doxa, orthodoxa, SARA, dan wacana politik.

  10. Food as a linking device among the Guidar of North Cameroon La nourriture comme lien entre Guidar du nord-Cameroun

    Directory of Open Access Journals (Sweden)

    Forka Leypey Mathew Fomine

    2009-07-01

    Full Text Available This article elucidates and illuminates food as a powerful device that established and strengthened cultural and commercial relationships among the Guidar of North Cameroon and between the Guidar and their neighbouring ethnic groups. During cultural ceremonies such as traditional wedding, death celebration, funeral entertainment, naming ceremony and group circumcision, the Guidar collectively consumed diverse food items that established and cemented cultural relationships among them. Food also aided in establishing commercial relationships between the Guidar and Moundang, Massa, Tupuri, Bamileke from Cameroon and the Sara from the Republic of Chad.Cet article montre le pouvoir instrumental alimentaire qui établit et renforce les relations culturelles et commerciales parmi les peuples Guidar du nord-Cameroun et différentes entités ethniques voisines. Durant les cérémonies traditionnelles telles que les mariages, les funérailles, les circoncisions en groupes, les peuples Guidar collectivement consomment un large éventail de produits alimentaires qui établissent et renforcent les relations culturelles. La nourriture également favorise l’établissement de relations commerciales entre les peuples Guidar, Moundang, Massa, Toupouri, Bamileke et les peuples Sara de la République du Tchad.

  11. Persepsi mahasiswa terhadap kemunculan berita bohong di media sosial

    Directory of Open Access Journals (Sweden)

    Totok Suyanto

    2018-06-01

    Full Text Available Di era demokratisasi saat ini yang bercirikan adanya kebebasan berpendapat setiap warga baik secara lisan ataupun tertulis, maka fenomena hoax menjadi satu hal yang harus menjadi perhatian bersama. Desain penelitian yang digunakan adalah penelitian survey. Proses penyebaran berita dalam media sosial banyak melibatkan kaum perempuan. Hanya sebagian kecil saja yang mengakui sering mendapatkan berita-berita hoax tentang suku, agama, ras, dan antar golongan (SARA. Dengan demikian, maraknya penyebaran berita hoax di media sosial merupakan satu bentuk pembodohan masyarakat dan  respons terhadap kemunculan berita hoax dengan cara melakukan tindakan perlawanan. ----------------------------------------------------------------------------------------------------------------------------- In this democratization era characterized by the freedom of speech belongs to every citizen both written and spoken, the hoax should be considered seriously. It was a survey research. The spread of news through social media was conducted mostly by women. It was only small numbers who reported that they had received hoax relating SARA. Therefore, the spreading of hoax through social media is a kind of fooling and their response is through counter-narrative.

  12. A perspective of PC-based probabilistic risk assessment

    International Nuclear Information System (INIS)

    Sattison, M.B.; Rasmuson, D.M.; Robinson, R.C.; Russell, K.D.; Van Siclen, V.S.

    1987-01-01

    Probabilistic risk assessment (PRA) information has been under-utilized in the past due to the large effort required to input the PRA data and the large expense of the computers needed to run PRA codes. The microcomputer-based Integrated Reliability and Risk Analysis System (IRRAS) and the System Analysis and Risk Assessment (SARA) System, under development at the Idaho National Engineering Laboratory, have greatly enhanced the ability of managers to use PRA techniques in their decision-making. IRRAS is a tool that allows an analyst to create, modify, update, and reanalyze a plant PRA to keep the risk assessment current with the plant's configuration and operation. The SARA system is used to perform sensitivity studies on the results of a PRA. This type of analysis can be used to evaluate proposed changes to a plant or its operation. The success of these two software projects demonstrate that risk information can be made readily available to those that need it. This is the first step in the development of a true risk management capability

  13. Stakeholder views of superfund sites

    International Nuclear Information System (INIS)

    English, M.R.

    1992-01-01

    Nearly ten years have passed since the enactment of the federal Comprehensive Response, Compensation, and Liability Act (CERCLA), usually referred to as open-quotes Superfundclose quotes. Nearly four years have passed since CERCLA's major overhaul through the Superfund Amendments and Reauthorization Act (SARA). Although much still remains to be done under Superfund, there is now enough experience to assess how effectively it is working. A study being undertaken by the University of Tennessee's Waste Management Research and Education Institute will supply a portion of that assessment. The study was completed in the fall of 1990. Our study examines two related issues: the resources that will be needed in the coming years to fulfill the mandate of Superfund and other hazardous waste remediation programs, and the site-level experience to date in implementing CERCLA and SARA. This chapter discusses only the open-quotes site-level experienceclose quotes effort, and only its methodological approach. The purpose of the open-quotes site-level experienceclose quotes effort is to explore what counts as a open-quotes successfulclose quotes site in the eyes of different stakeholders in a Superfund cleanup - e.g., the affected community, the potentially responsible parties (PRPs), state and local officials, and the US Environmental Protection Agency (EPA)

  14. FUSRAP adapts to the amendments of Superfund

    International Nuclear Information System (INIS)

    Atkin, R.G.; Liedle, S.D.; Clemens, B.W.

    1988-01-01

    With the promulgation of the Superfund Amendments and Reauthorization Act (SARA) federal facilities were required to comply with the Comprehensive Environmental Response Compensation and Liability Act (CERCLA) in the same manner as any non-government entity. This situation presented challenges for the Department of Energy (DOE) and other federal agencies involved in remedial action work because of the requirements under SARA that overlap other laws requiring DOE compliance, e.g., the National Environmental Policy Act (NEPA). This paper outlines options developed to comply with CERCLA and NEPA as part of an active, multi-site remedial action program. The program, the Formerly Utilized Sites Remedial Action Program (FUSRAP), was developed to identify, clean up, or control sites containing residual radioactive contamination resulting from the nation's early development of nuclear power. During the Manhattan Project, uranium was extracted from domestic and foreign ores and resulted in mill concentrates, purified metals, and waste products that were transported for use or disposal at other locations. Figure 1 shows the steps for producing uranium metal during the Manhattan Project. As a result of these activities materials equipment, buildings, and land became contaminated, primarily with naturally occurring radionuclides. Currently, FUSRAP includes 29 sites; three are on the Environmental Protection Agency's (EPA's) National Priorities List (NPL) of hazardous waste sites

  15. Behaviour of 14C-sulfadiazine and 14C-difloxacin during manure storage

    International Nuclear Information System (INIS)

    Lamshoeft, Marc; Sukul, Premasis; Zuehlke, Sebastian; Spiteller, Michael

    2010-01-01

    The persistence of sulfadiazine, difloxacin, and their metabolites has been investigated in stored manure. The manure collected from sulfadiazine ( 14 C-SDZ) and difloxacin ( 14 C-DIF) treated pigs contained N-acetylsulfadiazine (Ac-SDZ), 4-hydroxy-SDZ (4-OH-SDZ), and sarafloxacin (SARA) as the main metabolites, respectively along with their parent compounds. Manures were stored separately at 10 o C and 20 o C at various moisture levels. About 96-99% of the radioactivity remained in extractable parent compounds and their metabolites after 150 d of storage. The formation of non-extractable residue and the rate of mineralization were both negligible in manure containing SDZ and DIF. During storage SDZ concentration increased as a result of the deacetylation of Ac-SDZ, whose concentration decreased proportionally. Hence the environmental effects may be underestimated if the parent compound alone is considered for environmental risk assessment. About 11% and 14% of 4-OH-SDZ were lost after 20 and 40 d of storage; thereafter its concentration increased relatively, highlighting hydroxylation of SDZ. DIF degraded very slowly (7% loss after 150 d) during the storage of manure; in contrast the concentration of SARA decreased rapidly (72-90% loss after 150 d). Dilution of manure and storage at higher temperatures for a reasonable period of time enhanced the rate of reactions of SDZ, DIF and their related metabolites.

  16. Chemical structure investigation on SFEF fractions of Dagang vacuum residue

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Z.; Yan, G.; Zhao, S.; Guo, S. [China Univ. of Petroleum, Beijing (China). State Key Laboratory of Heavy Oil Processing; Zhang, Z. [Beijing Aeronautical Technology Research Center, Beijing (China)

    2006-07-01

    One of the most important problems in petroleum chemistry is the molecular structure and composition of heavy oil fractions and its importance in applications pertaining to the recovery, refining, and upgrading of petroleum. This paper presented an investigation into the chemical structure on supercritical fluid extraction and fraction (SFEF) factions of Dagang vacuum residue. Dagang vacuum residue was cut into sixteen fractions and a tailing with SFEF instrument. Then, using a chromatography, all SFEF fractions were further separated into four group compositions, notably saturated hydrocarbons, aromatic hydrocarbons, resins and asphaltenes (SARA). Last, the chemical structure was explored through a thorough analysis of the products from the ruthenium ions-catalyzed oxidation (RICO) reaction of those aromatics, resins and asphaltenes. The paper discussed the experiment in terms of samples and chemicals; supercritical fluid extraction and fraction; SARA separation; and RICO. The results and discussions focused on alkyl side chains attached to aromatic carbon; polymethylene bridges connecting two aromatic units; benzenecarboxylic acids an aromatic units; and others. The study has brought to light useful characterization on covalent molecular structure of two typical SFEF fractions, notably the tenth and fifteen fraction. 17 refs., 6 tabs., 16 figs., 1 appendix.

  17. The current status of the New World monkey phylogeny

    Directory of Open Access Journals (Sweden)

    SCHNEIDER HORACIO

    2000-01-01

    Full Text Available Four DNA datasets were combined in tandem (6700 bp and Maximum parsimony and Neighbor-Joining analyses were performed. The results suggest three groups emerging almost at the same time: Atelidae, Pitheciidae and Cebidae. The total analysis strongly supports the monophyly of the Cebidae family, grouping Aotus, Cebus and Saimiri with the small callitrichines. In the callitrichines, the data link Cebuela to Callithrix, place Callimico as a sister group of Callithrix/Cebuella, and show Saguinus to be the earliest offshoot of the callitrichines. In the family Pithecidae, Callicebus is the basal genus. Finally, combined molecular data showed congruent branching in the atelid clade, setting up Alouatta as the basal lineage and Brachyteles-Lagothrix as a sister group and the most derived branch. Two major points remain to be clarified in the platyrrhine phylogeny: (i what is the exact branching pattern of Aotus, Cebus, Saimiri and the small callitrichines, and (ii, which two of these three lineages, pitheciines, atelines or cebids, are more closely related?

  18. Divergent evolution and purifying selection of the H (FUT1 gene in New World monkeys (Primates, Platyrrhini

    Directory of Open Access Journals (Sweden)

    Bárbara do Nascimento Borges

    2004-01-01

    Full Text Available In the present study, the coding region of the H gene was sequenced and analyzed in fourteen genera of New World primates (Alouatta, Aotus, Ateles, Brachyteles, Cacajao, Callicebus, Callithrix, Cebus, Chiropotes, Lagothrix, Leontopithecus, Pithecia, Saguinus, and Saimiri, in order to investigate the evolution of the gene. The analyses revealed that this coding region contains 1,101 nucleotides, with the exception of Brachyteles, the callitrichines (Callithrix, Leontopithecus, and Saguinus and one species of Callicebus (moloch, in which one codon was deleted. In the primates studied, the high GC content (63%, the nonrandom distribution of codons and the low evolution rate of the gene (0.513 substitutions/site/MA in the order Primates suggest the action of a purifying type of selective pressure, confirmed by the Z-test. Our analyses did not identify mutations equivalent to those responsible for the H-deficient phenotypes found in humans, nor any other alteration that might explain the lack of expression of the gene in the erythrocytes of Neotropical monkeys. The phylogenetic trees obtained for the H gene and the distance matrix data suggest the occurrence of divergent evolution in the primates.

  19. The prion protein and New World primate phylogeny

    Directory of Open Access Journals (Sweden)

    Igor Schneider

    2004-01-01

    Full Text Available The PrP C prion protein contains 250 amino acids with some variation among species and is expressed in several cell types. PrP C is converted to PrP Sc by a post-translational process in which it acquires amino acid sequences of three-dimensional conformation of beta-sheets. Variations in the prion protein gene were observed among 16 genera of New World primates (Platyrrhini, and resulted in amino acid substitutions when compared with the human sequence. Seven substitutions not yet described in the literature were found: W -> R at position 31 in Cebuella, T -> A at position 95 in Cacajao and Chiropotes, N-> S at position 100 in Brachyteles, L -> Q at position 130 in Leontopithecus (in the sequence responsible for generating the beta-sheet 1, D -> E at position 144 in Lagothrix (in the sequence responsible for the alpha-helix 1, D-> G at position 147 in Saguinus (also located in the alpha-helix 1 region, and M -> I at position 232 in Alouatta. The phylogenetic trees generated by parsimony, neighbor-joining and Bayesian analyses strongly support the monophyletic status of the platyrrhines, but did not resolve relationships among families. However, the results do corroborate previous findings, which indicate that the three platyrrhine families radiated rapidly from an ancient split.

  20. Fate of a redundant gamma-globin gene in the atelid clade of New World monkeys: implications concerning fetal globin gene expression.

    Science.gov (United States)

    Meireles, C M; Schneider, M P; Sampaio, M I; Schneider, H; Slightom, J L; Chiu, C H; Neiswanger, K; Gumucio, D L; Czelusniak, J; Goodman, M

    1995-01-01

    Conclusive evidence was provided that gamma 1, the upstream of the two linked simian gamma-globin loci (5'-gamma 1-gamma 2-3'), is a pseudogene in a major group of New World monkeys. Sequence analysis of PCR-amplified genomic fragments of predicted sizes revealed that all extant genera of the platyrrhine family Atelidae [Lagothrix (woolly monkeys), Brachyteles (woolly spider monkeys), Ateles (spider monkeys), and Alouatta (howler monkeys)] share a large deletion that removed most of exon 2, all of intron 2 and exon 3, and much of the 3' flanking sequence of gamma 1. The fact that two functional gamma-globin genes were not present in early ancestors of the Atelidae (and that gamma 1 was the dispensible gene) suggests that for much or even all of their evolution, platyrrhines have had gamma 2 as the primary fetally expressed gamma-globin gene, in contrast to catarrhines (e.g., humans and chimpanzees) that have gamma 1 as the primary fetally expressed gamma-globin gene. Results from promoter sequences further suggest that all three platyrrhine families (Atelidae, Cebidae, and Pitheciidae) have gamma 2 rather than gamma 1 as their primary fetally expressed gamma-globin gene. The implications of this suggestion were explored in terms of how gene redundancy, regulatory mutations, and distance of each gamma-globin gene from the locus control region were possibly involved in the acquisition and maintenance of fetal, rather than embryonic, expression. Images Fig. 2 PMID:7535927

  1. Genome analysis of yellow fever virus of the ongoing outbreak in Brazil reveals polymorphisms

    Directory of Open Access Journals (Sweden)

    Myrna C Bonaldo

    Full Text Available The current yellow fever outbreak in Brazil is the most severe one in the country in recent times. It has rapidly spread to areas where YF virus (YFV activity has not been observed for more than 70 years and vaccine coverage is almost null. Here, we sequenced the whole YFV genome of two naturally infected howler-monkeys (Alouatta clamitans obtained from the Municipality of Domingos Martins, state of Espírito Santo, Brazil. These two ongoing-outbreak genome sequences are identical. They clustered in the 1E sub-clade (South America genotype I along with the Brazilian and Venezuelan strains recently characterised from infections in humans and non-human primates that have been described in the last 20 years. However, we detected eight unique amino acid changes in the viral proteins, including the structural capsid protein (one change, and the components of the viral replicase complex, the NS3 (two changes and NS5 (five changes proteins, that could impact the capacity of viral infection in vertebrate and/or invertebrate hosts and spreading of the ongoing outbreak.

  2. Geophagy in brown spider monkeys (Ateles hybridus) in a lowland tropical rainforest in Colombia.

    Science.gov (United States)

    Link, Andres; de Luna, Ana Gabriela; Arango, Ricardo; Diaz, Maria Clara

    2011-01-01

    Spider monkeys and howler monkeys are the only Neotropical primates that eat soil from mineral licks. Not all species within these genera visit mineral licks, and geophagy has been restricted to populations of Ateles belzebuth belzebuth,Ateles belzebuth chamek and Alouatta seniculus in western Amazonian rainforests. With the aid of a camera trap we studied the visitation patterns of a group of brown spider monkeys (Ateles hybridus) to a mineral lick at Serrania de Las Quinchas, in Colombia. Spider monkeys visited the lick frequently throughout the year, with a monthly average of 21.7 ± 7.2 visits per 100 days of camera trapping (n = 14 months). Spider monkeys visited the mineral lick almost always on days with no rain, or very little (<3 mm) rain, suggesting that proximate environmental variables might determine spider monkeys' decisions to come to the ground at the licks. This study expands the geographical occurrence of mineral lick use by spider monkeys providing additional data for future assessments on the biogeographical correlates of mineral lick use by platyrrhines. Copyright © 2011 S. Karger AG, Basel.

  3. Isolation of yellow fever virus (YFV from naturally infectied Haemagogus (Conopostegus leucocelaenus (diptera, cukicudae in São Paulo State, Brazil, 2009

    Directory of Open Access Journals (Sweden)

    Renato Pereira de Souza

    2011-06-01

    Full Text Available After detecting the death of Howlers monkeys (genus Alouatta and isolation of yellow fever virus (YFV in Buri county, São Paulo, Brazil, an entomological research study in the field was started. A YFV strain was isolated from newborn Swiss mice and cultured cells of Aedes albopictus - C6/36, from a pool of six Haemagogus (Conopostegus leucocelaenus (Hg. leucocelaenus mosquitoes (Dyar & Shannon collected at the study site. Virus RNA fragment was amplified by RT-PCR and sequenced. The MCC Tree generated showed that the isolated strain is related to the South American I genotype, in a monophyletic clade containing isolates from recent 2008-2010 epidemics and epizootics in Brazil. Statistical analysis commonly used were calculated to characterize the sample in relation to diversity and dominance and indicated a pattern of dominance of one or a few species. Hg. leucocelaenus was found infected in Rio Grande do Sul State as well. In São Paulo State, this is the first detection of YFV in Hg. leucocelaenus.

  4. Circulation of antibodies against yellow fever virus in a simian population in the area of Porto Primavera Hydroelectric Plant, São Paulo, Brazil.

    Science.gov (United States)

    Lima, Maura Antonia; Romano-Lieber, Nicolina Silvana; Duarte, Ana Maria Ribeiro de Castro

    2010-01-01

    Yellow fever (YF) is an acute viral infectious disease transmitted by mosquitoes which occurs in two distinct epidemiological cycles: sylvatic and urban. In the sylvatic cycle, the virus is maintained by monkey's infection and transovarian transmission in vectors. Surveillance of non-human primates is required for the detection of viral circulation during epizootics, and for the identification of unaffected or transition areas. An ELISA (enzyme-linked immunosorbent assay) was standardized for estimation of the prevalence of IgG antibodies against yellow fever virus in monkey sera (Alouatta caraya) from the reservoir area of Porto Primavera Hydroelectric Plant, in the state of São Paulo, Brazil. A total of 570 monkey sera samples were tested and none was reactive to antibodies against yellow fever virus. The results corroborate the epidemiology of yellow fever in the area. Even though it is considered a transition area, there were no reports to date of epizootics or yellow fever outbreaks in humans. Also, entomological investigations did not detect the presence of vectors of this arbovirus infection. ELISA proved to be fast, sensitive, an adequate assay, and an instrument for active search in the epidemiological surveillance of yellow fever allowing the implementation of prevention actions, even before the occurrence of epizootics.

  5. Medium- and large-sized mammals in a steppic savanna area of the Brazilian Pampa: survey and conservation issues of a poorly known fauna.

    Science.gov (United States)

    Espinosa, C C; Galiano, D; Kubiak, B B; Marinho, J R

    2016-02-01

    The wildlife of the Brazilian Pampa is threatened by large-scale habitat loss, due in particular to the expansion of soybean cultivation and the conversion of grasslands areas into extensive areas of silviculture. It is essential to study how the mammal fauna copes with the highly fragmented, human-influenced, non-protected landscape. Our study presents the results of a survey of the large- and medium-sized mammals of a typical human-influenced steppic savanna area of the Pampa biome. The survey was conducted exclusively with the use of camera traps over a period of 16 months. The relative frequencies of species in the area were evaluated. We recorded 18 species, some of them locally threatened (Tamandua tetradactyla, Alouatta caraya, Leopardus colocolo, Leopardus geoffroyi, Leopardus wiedii, Puma yagouaroundi, Mazama gouazoubira and Cuniculus paca). Several species were found to thrive in the area; however, many species were considered rare, and undoubtedly new species could be recorded if we continued the sampling. Our results contribute to the knowledge of faunal diversity in the Pampa biome and associated habitats, warn about threats and provide support for conservation measures.

  6. Medium- and large-sized mammals in a steppic savanna area of the Brazilian Pampa: survey and conservation issues of a poorly known fauna

    Directory of Open Access Journals (Sweden)

    C. C. Espinosa

    Full Text Available Abstract The wildlife of the Brazilian Pampa is threatened by large-scale habitat loss, due in particular to the expansion of soybean cultivation and the conversion of grasslands areas into extensive areas of silviculture. It is essential to study how the mammal fauna copes with the highly fragmented, human-influenced, non-protected landscape. Our study presents the results of a survey of the large- and medium-sized mammals of a typical human-influenced steppic savanna area of the Pampa biome. The survey was conducted exclusively with the use of camera traps over a period of 16 months. The relative frequencies of species in the area were evaluated. We recorded 18 species, some of them locally threatened (Tamandua tetradactyla, Alouatta caraya, Leopardus colocolo, Leopardus geoffroyi, Leopardus wiedii, Puma yagouaroundi, Mazama gouazoubira and Cuniculus paca. Several species were found to thrive in the area; however, many species were considered rare, and undoubtedly new species could be recorded if we continued the sampling. Our results contribute to the knowledge of faunal diversity in the Pampa biome and associated habitats, warn about threats and provide support for conservation measures.

  7. Comprehensive characterization of evolutionary conserved breakpoints in four New World Monkey karyotypes compared to Chlorocebus aethiops and Homo sapiens.

    Science.gov (United States)

    Fan, Xiaobo; Supiwong, Weerayuth; Weise, Anja; Mrasek, Kristin; Kosyakova, Nadezda; Tanomtong, Alongkoad; Pinthong, Krit; Trifonov, Vladimir A; Cioffi, Marcelo de Bello; Grothmann, Pierre; Liehr, Thomas; Oliveira, Edivaldo H C de

    2015-11-01

    Comparative cytogenetic analysis in New World Monkeys (NWMs) using human multicolor banding (MCB) probe sets were not previously done. Here we report on an MCB based FISH-banding study complemented with selected locus-specific and heterochromatin specific probes in four NWMs and one Old World Monkey (OWM) species, i.e. in Alouatta caraya (ACA), Callithrix jacchus (CJA), Cebus apella (CAP), Saimiri sciureus (SSC), and Chlorocebus aethiops (CAE), respectively. 107 individual evolutionary conserved breakpoints (ECBs) among those species were identified and compared with those of other species in previous reports. Especially for chromosomal regions being syntenic to human chromosomes 6, 8, 9, 10, 11, 12 and 16 previously cryptic rearrangements could be observed. 50.4% (54/107) NWM-ECBs were colocalized with those of OWMs, 62.6% (62/99) NWM-ECBs were related with those of Hylobates lar (HLA) and 66.3% (71/107) NWM-ECBs corresponded with those known from other mammalians. Furthermore, human fragile sites were aligned with the ECBs found in the five studied species and interestingly 66.3% ECBs colocalized with those fragile sites (FS). Overall, this study presents detailed chromosomal maps of one OWM and four NWM species. This data will be helpful to further investigation on chromosome evolution in NWM and hominoids in general and is prerequisite for correct interpretation of future sequencing based genomic studies in those species.

  8. Dental microwear texture analysis of late Pliocene Procynocephalus subhimalayanus (Primates: Cercopithecidae) of the Upper Siwaliks, India

    Science.gov (United States)

    Williams, Frank L'Engle; Holmes, Noelle A.

    2012-09-01

    Late Pliocene Procynocephalus subhimalayanus from the Upper Siwaliks, India is known from only three specimens. The dietary proclivities of this taxon have implications for reconstructing the paleoecology of the Upper Siwaliks. The dental microwear texture properties of Procynocephalus are compared to those from extant tropical forest primates including Alouatta palliata (n = 11), Cebus apella (n = 13), Gorilla gorilla (n = 9), Lophocebus albigena (n = 15) and Trachypithecus cristatus (n = 12). Dental microwear textures are generated by scanning the surface enamel of Facet 9 using white-light confocal microscopy at 100x. Four variables were extracted from scale-sensitive fractal analysis, and the data were ranked before ANOVA with post-hoc tests of significance and multivariate analyses were performed. Procynocephalus clusters closest to Lophocebus, Cebus and some Gorilla specimens suggesting hard-object feeding characterized a portion of its diet. The dental microwear texture of Procynocephalus supports interpretations of widespread grasslands of the Late Pliocene Kansal Formation (Pinjor zone). The extreme enamel complexity characterizing Procynocephalus may derive from consumption of underground storage organs, or other foods with high grit loads. Foods consumed near ground level carry a heavy load of abrasive minerals possibly contributing to greater enamel surface complexity and textural fill volume.

  9. Evolutionary modifications of human milk composition: evidence from long-chain polyunsaturated fatty acid composition of anthropoid milks.

    Science.gov (United States)

    Milligan, Lauren A; Bazinet, Richard P

    2008-12-01

    Brain growth in mammals is associated with increased accretion of long-chain polyunsaturated fatty acids (LCPUFA) in brain phospholipids. The period of maximum accumulation is during the brain growth spurt. Humans have a perinatal brain growth spurt, selectively accumulating docosahexaenoic acid (DHA) and other LCPUFA from the third trimester through the second year of life. The emphasis on rapid postnatal brain growth and LCPUFA transfer during lactation has led to the suggestion that human milk LCPUFA composition may be unique. Our study tests this hypothesis by determining fatty acid composition for 11 species of captive anthropoids (n=53; Callithrix jacchus, Cebus apella, Gorilla gorilla, Hylobates lar, Leontopithecus rosalia, Macaca mulatta, Pan troglodytes, Pan paniscus, Pongo pygmaeus, Saimiri boliviensis, and Symphalangus syndactylus). Results are compared to previously published data on five species of wild anthropoids (n=28; Alouatta paliatta, Callithrix jacchus, Gorilla beringei, Leontopithecus rosalia, and Macaca sinica) and human milk fatty acid profiles. Milk LCPUFA profiles of captive anthropoids (consuming diets with a preformed source of DHA) are similar to milk from women on a Western diet, and those of wild anthropoids are similar to milk from vegan women. Collectively, the range of DHA percent composition values from nonhuman anthropoid milks (0.03-1.1) is nearly identical to that from a cross-cultural analysis of human milk (0.06-1.4). Humans do not appear to be unique in their ability to secrete LCPUFA in milk but may be unique in their access to dietary LCPUFA.

  10. Dietary proclivities of Paranthropus robustus from Swartkrans, South Africa

    Directory of Open Access Journals (Sweden)

    L’Engle Williams Frank

    2015-03-01

    Full Text Available Pleistocene Paranthropus robustus fossils from Swartkrans have yielded stable isotope values suggesting some foraging on C4 plants possibly including underground storage organs. Dental microwear texture analysis on P. robustus (SK 6, SK 34 and SK 47 from Swartkrans Member 1 is performed to examine whether tooth surface damage from mastication agrees with prior dietary inferences from carbon isotopes. There is considerable variation in textural characteristics among the P. robustus specimens. Specifically, adult SK 34 stands apart from the two subadult specimens, SK 6 and SK 47, suggesting life history could be reflected in patterns of dental microwear texture characteristics, although seasonality and availability of fallback foods may also explain the variation observed in P. robustus. The fossils all exhibit elevated surface texture complexity, resembling the values for Lophocebus albigena and Cebus apella, and to a lesser extent, Pan troglodytes. Paranthropus robustus is dissimilar to primary folivores, such as Trachypithecus cristatus or folivore- frugivores such as Alouatta palliata suggesting leaves comprised very little of its diet. The textural fill volume of P. robustus differs from that observed in extant primates from tropical forests indicating extreme durophagy, perhaps a function of differences in habitat. Ingestion of extraneous grit on the underground parts of plants and from terrestrial resources, perhaps as fallback foods or as dietary staples, may account for these enamel textural properties and may help explain the mixed C3/C4 isotopic signal in P. robustus.

  11. Diversity and abundance of primates and their threats in the interfluvium of the Napo and Putumayo rivers, Peruvian Amazonia

    Directory of Open Access Journals (Sweden)

    Rolando Aquino

    2016-12-01

    Full Text Available Within the northeastern Peruvian Amazonia remain areas with scarce information on primates, one of them being the interfluvium between the Napo and Putumayo rivers. This lack of information motivated us to conduct a study to determine the diversity and abundance of primates within the area, as well as to identify the threats, which inhibit these primate species populations. For this purpose, we conducted transect censuses in three sampling sites in October 2007, September 2013 and November 2014. In 1040 km of transect walks we observed 308 groups of nine primate species, the most common being Leontocebus nigricollis (109 groups and the rarest being Alouatta seniculus (16 groups. Smaller groups of Lagothrix lagothricha lagothricha (8-11 individuals and A. seniculus (3-5 individuals were observed in Tamboryacu, a majorly disturbed sampling site. Likewise, the lowest population densities estimated for L. l. lagothricha and A. seniculus corresponded to this same sampling site with 3.8 indiv. /km2 and 1.6 indiv. /km2, respectively, while for the remaining species there were no major differences among the sampling sites. Among the activities, hunting and logging are the predominant threats responsible for the scarce populations of A. seniculus and l. l. lagothricha, mainly in the Napo River Basin.

  12. Comprehensive characterization of evolutionary conserved breakpoints in four New World Monkey karyotypes compared to Chlorocebus aethiops and Homo sapiens

    Directory of Open Access Journals (Sweden)

    Xiaobo Fan

    2015-11-01

    Full Text Available Comparative cytogenetic analysis in New World Monkeys (NWMs using human multicolor banding (MCB probe sets were not previously done. Here we report on an MCB based FISH-banding study complemented with selected locus-specific and heterochromatin specific probes in four NWMs and one Old World Monkey (OWM species, i.e. in Alouatta caraya (ACA, Callithrix jacchus (CJA, Cebus apella (CAP, Saimiri sciureus (SSC, and Chlorocebus aethiops (CAE, respectively. 107 individual evolutionary conserved breakpoints (ECBs among those species were identified and compared with those of other species in previous reports. Especially for chromosomal regions being syntenic to human chromosomes 6, 8, 9, 10, 11, 12 and 16 previously cryptic rearrangements could be observed. 50.4% (54/107 NWM-ECBs were colocalized with those of OWMs, 62.6% (62/99 NWM-ECBs were related with those of Hylobates lar (HLA and 66.3% (71/107 NWM-ECBs corresponded with those known from other mammalians. Furthermore, human fragile sites were aligned with the ECBs found in the five studied species and interestingly 66.3% ECBs colocalized with those fragile sites (FS. Overall, this study presents detailed chromosomal maps of one OWM and four NWM species. This data will be helpful to further investigation on chromosome evolution in NWM and hominoids in general and is prerequisite for correct interpretation of future sequencing based genomic studies in those species.

  13. High consumption of primates by pumas and ocelots in a remnant of the Brazilian Atlantic Forest

    Directory of Open Access Journals (Sweden)

    JL Santos

    Full Text Available We studied the diet of the ocelot and puma during the years 2007 and 2008 at the Feliciano Miguel Abdala Reserve, in Minas Gerais, south-eastern Brazil. We collected 49 faecal samples (scats from cats, and identified the species of cat from 23 of them by the analysis of the microstructure patterns of hairs found in their faeces: 17 scats of the puma (Puma concolor and six of the ocelot (Leopardus pardalis. In the puma scats, we identified three species of primates (Brachyteles hypoxanthus, Alouatta guariba and Sapajus nigritus, the remains of which were found in eight of 17 collected (47.1%, representing 26.7% of items consumed. For the ocelot, we detected capuchin monkey (S. nigritus remains in three of the six scats (50%, accounting for 18.7% of items consumed by ocelot. We were unable to identify the cat species in the remaining 26 faecal samples, but we were able to analyse the food items present. Primates were found in five of these 26 faeces (19.2% and represented 10.2% of the items found. Although the sample size is limited, our results indicate a relatively high consumption of primates by felines. We believe that this high predation may be the result of the high local density of primates as well as the greater exposure to the risks of predation in fragmented landscapes, which tends to increase the incidence of the primates using the ground.

  14. Response of frugivorous primates to changes in fruit supply in a northern Amazonian forest.

    Science.gov (United States)

    Mourthé, I

    2014-08-01

    Few attempts have been made to understand how spatiotemporal changes in fruit supply influence frugivores in tropical forests. The marked spatiotemporal variation in fruit supply can affect frugivore abundance and distribution, but studies addressing the effects of this variation on primates are scarce. The present study aimed to investigate how the spatiotemporal distribution of fruits influences the local distribution of three frugivorous primates in the eastern part of the Maracá Ecological Station, a highly seasonal Amazonian rainforest. Specifically, it was hypothesised that primate distribution will track changes in fruit supply, resulting that sites with high fruit availability should be heavily used by primates. During a 1-year study, fruit supply (ground fruit surveys) and primate density (line-transects) were monitored in twelve 2 km-long transects at monthly intervals. Fruit supply varied seasonally, being low during the dry season. The density of Ateles belzebuth was positively related to fruit supply during fruit shortage, but Cebus olivaceus and Alouatta macconnelli did not follow the same pattern. The supply of Sapotaceae fruit was an important component determining local distribution of A. belzebuth during the overall fruit shortage. Highly frugivorous primates such as A. belzebuth respond to seasonal decline in fruit supply by congregating at places with high fruit supply in this forest, particularly, those with many individuals of species of Sapotaceae. This study underscores the importance of small-scale spatiotemporal changes of fruit supply as a key component of frugivorous primate ecology in highly seasonal environments.

  15. Molecular Detection of Plasmodium malariae/Plasmodium brasilianum in Non-Human Primates in Captivity in Costa Rica.

    Science.gov (United States)

    Fuentes-Ramírez, Alicia; Jiménez-Soto, Mauricio; Castro, Ruth; Romero-Zuñiga, Juan José; Dolz, Gaby

    2017-01-01

    One hundred and fifty-two blood samples of non-human primates of thirteen rescue centers in Costa Rica were analyzed to determine the presence of species of Plasmodium using thick blood smears, semi-nested multiplex polymerase chain reaction (SnM-PCR) for species differentiation, cloning and sequencing for confirmation. Using thick blood smears, two samples were determined to contain the Plasmodium malariae parasite, with SnM-PCR, a total of five (3.3%) samples were positive to P. malariae, cloning and sequencing confirmed both smear samples as P. malariae. One sample amplified a larger and conserved region of 18S rDNA for the genus Plasmodium and sequencing confirmed the results obtained microscopically and through SnM-PCR tests. Sequencing and construction of a phylogenetic tree of this sample revealed that the P. malariae/P. brasilianum parasite (GenBank KU999995) found in a howler monkey (Alouatta palliata) is identical to that recently reported in humans in Costa Rica. The SnM-PCR detected P. malariae/P. brasilianum parasite in different non-human primate species in captivity and in various regions of the southern Atlantic and Pacific coast of Costa Rica. The similarity of the sequences of parasites found in humans and a monkey suggests that monkeys may be acting as reservoirs of P.malariae/P. brasilianum, for which reason it is important, to include them in control and eradication programs.

  16. Constraining Cosmic Dawn and Cosmological Reionization via the global redshifted 21-cm signal

    Science.gov (United States)

    Singh, Saurabh

    2018-01-01

    The formation of first stars and consequent thermal evolution in baryons during Cosmic Dawn and the Epoch of Reionization (EoR) is poorly constrained. The 21-cm line transition of neutral hydrogen is one of the richest probes of the astrophysics during this era. The signal has the potential to reveal the nature and timing of the emergence of first stars, first light, and the consequent evolution in thermal and ionization state of the baryons.The detection of the global redshifted 21-cm signal, which represents the mean thermal history of the gas, is challenging since it is extremely faint and seen through orders of magnitude stronger contributions from Galactic and extragalactic foregrounds. Man-made terrestrial Radio Frequency Interference (RFI) and the exacting tolerances required on instrument systematics make the detection even more daunting.The design considerations for a precision spectral radiometer are first listed, and a comparison is made of different radiometer configurations, including short and zero baseline interferometers along with methods to enhance the response. We discuss the relative merits of different methods.We then describe SARAS 2, a spectral radiometer custom-designed for precision measurement of the global 21-cm signal. SARAS 2 has been designed to have a system transfer function and internal systematics – both multiplicative and additive – to be spectrally smooth so as to allow a separation of foregrounds and systematics from plausible and predicted global cosmological 21-cm signals. The algorithms for calibration and RFI mitigation are carefully developed so that they do not introduce spectral features that may confuse the detection of the 21-cm signal.We present the outcomes for cosmology from analysis of 60 hr observing with the radiometer deployed at the Timbaktu Collective in Southern India. The detailed analysis of the data reveals an RMS noise level of 11 mK, without being limited by systematic structures. The likelihood

  17. New insights into the effects of styrene-butadiene-styrene polymer modifier on the structure, properties, and performance of asphalt binder: The case of AP-5 asphalt and solvent deasphalting pitch

    Energy Technology Data Exchange (ETDEWEB)

    Nciri, Nader, E-mail: nader.nciri@koreatech.ac.kr [Department of Energy, Materials, and Chemical Engineering, Korea University of Technology and Education, 1600 Chungjeol-ro, Byeongcheon-myeon, Dongnam-gu, Cheonan-City, Chungnam-Province 330-708 (Korea, Republic of); Kim, Namho [Department of Architectural Engineering, Korea University of Technology and Education, 1600 Chungjeol-ro, Byeongcheon-myeon, Dongnam-gu, Cheonan-City, Chungnam-Province 330-708 (Korea, Republic of); Cho, Namjun, E-mail: njuncho@koreatech.ac.kr [Department of Energy, Materials, and Chemical Engineering, Korea University of Technology and Education, 1600 Chungjeol-ro, Byeongcheon-myeon, Dongnam-gu, Cheonan-City, Chungnam-Province 330-708 (Korea, Republic of)

    2017-06-01

    This paper deals with the poorly understood effects of styrene-butadiene-styrene (SBS) copolymer on the bitumen performance. It focuses on determining the impact of various concentrations (e.g., 0, 4, 8, and 12 wt. %) of SBS on the attributes of two types of asphalt namely AP-5 asphalt and solvent deasphalting (SDA) pitch. The unmodified and modified binders were investigated in terms of their chemical compositions, microstructures, thermo-analytical behaviors, and physical properties. The intricate chemical compositions were evaluated by elemental analysis and thin layer chromatography-ionization detection (TLC-FID). Fourier transform infrared (FT-IR) and nuclear magnetic resonance (NMR) spectroscopies, scanning electron microscopy (SEM), and X-ray diffraction (XRD) were utilized to examine the microstructures. Whereas, thermal characteristics were evaluated by thermogravimetric analysis (TGA/DTGA) and differential scanning calorimetry (DSC). The physical behaviors were monitored through the softening point, penetration, viscosity, and ductility tests. The findings showed that the blending of asphalt with different amounts of SBS resulted into different rheological behaviors. This was reflected from the difference in the SARA (i.e., saturates, aromatics, resins, and asphaltenes) compositions and colloidal instability indexes of the modified asphalts. SEM exhibited a continuous asphalt phase with distributed SBS particles, a continuous polymer phase with distributed asphalt globules, or two interconnected continuous phases. FT-IR, {sup 1}H {sup 13}C NMR, and XRD data revealed that the AP-5 asphalt and SDA pitch experienced a number of distinct structural changes. TGA/DSC studies determined the occurrence of diverse events during thermal treatment. It is concluded that the degree of SBS modification depends strongly on SARA composition and polymer content. If the polymers are molded at higher concentrations along with aromatics-rich SDA pitches, then the mixtures

  18. Role of the two-component regulatory system arlRS in ica operon and aap positive but non-biofilm-forming Staphylococcus epidermidis isolates from hospitalized patients.

    Science.gov (United States)

    Wu, Yang; Liu, Jingran; Jiang, Juan; Hu, Jian; Xu, Tao; Wang, Jiaxue; Qu, Di

    2014-11-01

    The ica operon and aap gene are important factors for Staphylococcus epidermidis biofilm formation. However, we found 15 out of 101 S. epidermidis strains isolated from patients had both the ica operon and the aap gene in the genome but could not form biofilms (ica(+)aap(+)/BF(-) isolates). Compared with standard strain RP62A, the 15 ica(+)aap(+)/BF(-) isolates had similar growth curves and initial attachment abilities, but had much lower apparent transcription levels of the icaA gene and significantly less production of polysaccharide intercellular adhesion (PIA). Furthermore, the expression of accumulation-associated protein in ica(+)aap(+)/BF(-) isolates was much weaker than in RP62A. The mRNA levels of icaADBC transcription-related regulatory genes, including icaR, sarA, rsbU, srrA, arlRS and luxS, were measured in the 15 ica(+)aap(+)/BF(-) clinical isolates. The mRNA levels of arlR and rsbU in all of the ica(+)aap(+)/BF(-) isolates were lower than in RP62A at 4 h. At 10 h, 14/15 of the isolates showed lower mRNA levels of arlR and rsbU than shown by RP62A. However, expression of sarA, luxS, srrA and icaR varied in different ica(+)aap(+)/BF(-) isolates. To further investigate the role of arlRS in biofilm formation, we analyzed icaA, sarA and rsbU transcription, PIA synthesis, Aap expression and biofilm formation in an arlRS deletion mutant of S. epidermidis strain 1457 and all were much less than in the wild type strain. This is consistent with the hypothesis that ArlRS may play an important role in regulating biofilm formation by the ica(+)aap(+)/BF(-)S. epidermidis clinical isolates and operate via both ica-dependent and Aap-dependent pathways. Copyright © 2014 Elsevier Ltd. All rights reserved.

  19. Histamine Induces Bovine Rumen Epithelial Cell Inflammatory Response via NF-κB Pathway.

    Science.gov (United States)

    Sun, Xudong; Yuan, Xue; Chen, Liang; Wang, Tingting; Wang, Zhe; Sun, Guoquan; Li, Xiaobing; Li, Xinwei; Liu, Guowen

    2017-01-01

    Subacute ruminal acidosis (SARA) is a common disease in high-producing lactating cows. Rumenitis is the initial insult of SARA and is associated with the high concentrations of histamine produced in the rumen of dairy cows during SARA. However, the exact mechanism remains unclear. The objective of the current study is to investigate whether histamine induces inflammation of rumen epithelial cells and the underlying mechanism of this process. Bovine rumen epithelial cells were cultured and treated with different concentrations of histamine and pyrrolidine dithiocarbamate (PDTC, an NF-κB inhibitor) cultured in different pH medium (pH 7.2 or 5.5). qRT-PCR, Western-blotting, ELISA and immunocytofluorescence were used to evaluate whether histamine activated the NF-κB pathway and inflammatory cytokines. The results showed that histamine significantly increased the activity of IKK β and the phosphorylation levels of IκB α, as well as upregulated the mRNA and protein expression levels of NF-κB p65 in the rumen epithelial cells cultured in neutral (pH=7.2) and acidic (pH=5.5) medium. Furthermore, histamine treatment also significantly increased the transcriptional activity of NF-κB p65. High expression and transcriptional activity of NF-κB p65 significantly increased the mRNA expressions and concentrations of inflammatory cytokines, tumor necrosis factor alpha (TNF-α), interleukin 6 (IL-6) and interleukin 1 beta (IL-1β), thereby inducing the inflammatory response in bovine rumen epithelial cells. However, inhibition of NF-κB p65 by PDTC significantly decreased the expressions and concentrations of the inflammatory cytokines induced by histamine in the rumen epithelial cells cultured in the neutral and acidic medium. The present data indicate that histamine induces the inflammatory response of bovine rumen epithelial cells through the NF-κB pathway. © 2017 The Author(s). Published by S. Karger AG, Basel.

  20. U.S. EPA Superfund Program's Policy for Community Involvement at Radioactively Contaminated Sites

    International Nuclear Information System (INIS)

    Carey, Pat; Walker, Stuart

    2008-01-01

    This paper describes the Superfund program's statutory requirements for community involvement. It also discusses the efforts the Superfund program has made that go beyond these statutory requirements to involve communities. The Environmental Protection Agency (EPA) implements the Superfund program under the authority of the Comprehensive Environmental Response, Compensation, and Liability Act of 1980 (CERCLA), as amended by the Superfund Amendments and Reauthorization Act of 1986 (SARA). From the beginning of the Superfund program, Congress envisioned a role for communities. This role has evolved and expanded during the implementation of the Superfund program. Initially, the CERCLA statute had community involvement requirements designed to inform surrounding communities of the work being done at a site. CERCLA's provisions required 1) development of a community relations plan for each site, 2) establishment of information repositories near each site where all publicly available materials related to the site would be accessible for public inspection, 3) opportunities for the public to comment on the proposed remedy for each site and 4) development of a responsiveness summary responding to all significant comments received on the proposed remedy. In recognition of the need for people living near Superfund sites to be well-informed and involved with decisions concerning sites in their communities, SARA expanded Superfund's community involvement activities in 1986. SARA provided the authority to award Technical Assistance Grants (TAGs) to local communities enabling them to hire independent technical advisors to assist them in understanding technical issues and data about the site. The Superfund Community Involvement Program has sought to effectively implement the statutory community involvement requirements, and to go beyond those requirements to find meaningful ways to involve citizens in the cleanup of sites in their communities. We've structured our program around

  1. An Update on the NASA Planetary Science Division Research and Analysis Program

    Science.gov (United States)

    Richey, Christina; Bernstein, Max; Rall, Jonathan

    2015-01-01

    Introduction: NASA's Planetary Science Division (PSD) solicits its Research and Analysis (R&A) programs each year in Research Opportunities in Space and Earth Sciences (ROSES). Beginning with the 2014 ROSES solicitation, PSD will be changing the structure of the program elements under which the majority of planetary science R&A is done. Major changes include the creation of five core research program elements aligned with PSD's strategic science questions, the introduction of several new R&A opportunities, new submission requirements, and a new timeline for proposal submissionROSES and NSPIRES: ROSES contains the research announcements for all of SMD. Submission of ROSES proposals is done electronically via NSPIRES: http://nspires.nasaprs.com. We will present further details on the proposal submission process to help guide younger scientists. Statistical trends, including the average award size within the PSD programs, selections rates, and lessons learned, will be presented. Information on new programs will also be presented, if available.Review Process and Volunteering: The SARA website (http://sara.nasa.gov) contains information on all ROSES solicitations. There is an email address (SARA@nasa.gov) for inquiries and an area for volunteer reviewers to sign up. The peer review process is based on Scientific/Technical Merit, Relevance, and Level of Effort, and will be detailed within this presentation.ROSES 2014 submission changes: All PSD programs will use a two-step proposal submission process. A Step-1 proposal is required and must be submitted electronically by the Step-1 due date. The Step-1 proposal should include a description of the science goals and objectives to be addressed by the proposal, a brief description of the methodology to be used to address the science goals and objectives, and the relevance of the proposed research to the call submitted to.Additional Information: Additional details will be provided on the Cassini Data Analysis Program, the

  2. Invited review: Practical feeding management recommendations to mitigate the risk of subacute ruminal acidosis in dairy cattle.

    Science.gov (United States)

    Humer, E; Petri, R M; Aschenbach, J R; Bradford, B J; Penner, G B; Tafaj, M; Südekum, K-H; Zebeli, Q

    2018-02-01

    Rumen health is of vital importance in ensuring healthy and efficient dairy cattle production. Current feeding programs for cattle recommend concentrate-rich diets to meet the high nutritional needs of cows during lactation and enhance cost-efficiency. These diets, however, can impair rumen health. The term "subacute ruminal acidosis" (SARA) is often used as a synonym for poor rumen health. In this review, we first describe the physiological demands of cattle for dietary physically effective fiber. We also provide background information on the importance of enhancing salivary secretions and short-chain fatty acid absorption across the stratified squamous epithelium of the rumen; thus, preventing the disruption of the ruminal acid-base balance, a process that paves the way for acidification of the rumen. On-farm evaluation of dietary fiber adequacy is challenging for both nutritionists and veterinarians; therefore, this review provides practical recommendations on how to evaluate the physical effectiveness of the diet based on differences in particle size distribution, fiber content, and the type of concentrate fed, both when the latter is part of total mixed ration and when it is supplemented in partial mixed rations. Besides considering the absolute amount of physically effective fiber and starch types in the diet, we highlight the role of several feeding management factors that affect rumen health and should be considered to control and mitigate SARA. Most importantly, transitional feeding to ensure gradual adaptation of the ruminal epithelium and microbiota; monitoring and careful management of particle size distribution; controlling feed sorting, meal size, and meal frequency; and paying special attention to primiparous cows are some of the feeding management tools that can help in sustaining rumen health in high-producing dairy herds. Supplementation of feed additives including yeast products, phytogenic compounds, and buffers may help attenuate SARA

  3. Modeling the adequacy of dietary fiber in dairy cows based on the responses of ruminal pH and milk fat production to composition of the diet.

    Science.gov (United States)

    Zebeli, Q; Dijkstra, J; Tafaj, M; Steingass, H; Ametaj, B N; Drochner, W

    2008-05-01

    The main objective of this study was to develop practical models to assess and predict the adequacy of dietary fiber in high-yielding dairy cows. We used quantitative methods to analyze relevant research data and critically evaluate and determine the responses of ruminal pH and production performance to different variables including physical, chemical, and starch-degrading characteristics of the diet. Further, extensive data were used to model the magnitude of ruminal pH fluctuations and determine the threshold for the development of subacute ruminal acidosis (SARA). Results of this study showed that to minimize the risk of SARA, the following events should be avoided: 1) a daily mean ruminal pH lower than 6.16, and 2) a time period in which ruminal pH is content of physically effective neutral detergent fiber (peNDF) or the ratio between peNDF and rumen-degradable starch from grains in the diet increased up to 31.2 +/- 1.6% [dry matter (DM) basis] or 1.45 +/- 0.22, respectively, so did the daily mean ruminal pH, for which a asymptotic plateau was reached at a pH of 6.20 to 6.27. This study also showed that digestibility of fiber in the total tract depends on ruminal pH and outflow rate of digesta from reticulorumen; thereby both variables explained 62% of the variation of fiber digestibility. Feeding diets with peNDF content up to 31.9 +/- 1.97% (DM basis) slightly decreased DM intake and actual milk yield; however, 3.5% fat-corrected milk and milk fat yield were increased, resulting in greater milk energy efficiency. In conclusion, a level of about 30 to 33% peNDF in the diet may be considered generally optimal for minimizing the risk of SARA without impairing important production responses in high-yielding dairy cows. In terms of improvement of the accuracy to assessing dietary fiber adequacy, it is suggested that the content of peNDF required to stabilize ruminal pH and maintain milk fat content without compromising milk energy efficiency can be arranged based

  4. Incorporating ecological risk assessment into remedial investigation/feasibility study work plans

    International Nuclear Information System (INIS)

    1994-06-01

    This guidance document (1) provides instructions on preparing the components of an ecological work plan to complement the overall site remedial investigation/feasibility study (RI/FS) work plan and (2) directs the user on how to implement ecological tasks identified in the plan. Under the Comprehensive Environmental Response, Compensation, and Liability Act of 1980 (CERCLA), as amended by the Superfund Amendments and Reauthorization Act of 1986 (SARA), and RI/FS work plan will have to be developed as part of the site-remediation scoping process. Specific guidance on the RI/FS process and the preparation of work plans has been developed by the US Environmental Protection Agency (EPA 1988a). This document provides guidance to US Department of Energy (DOE) staff and contractor personnel for incorporation of ecological information into environmental remediation planning and decision making at CERCLA sites

  5. Optimizing compliance training for the waste management worker

    International Nuclear Information System (INIS)

    Copenhaver, E.D.

    1988-01-01

    Waste management workers are required to participate in special training mandated by a variety of Federal laws and DOE Orders; these include the Resource Conservation and Recovery Act (RCRA), Superfund Amendments Reauthorization Act (SARA) as implemented by OSHA in CFR 1920.120, in addition to requirements for Hazard Communication, Radiation Workers, Respiratory Protection, Transportation, and Waste Generator training. The Technical Resources and Training program is examining the course contents and mandated requirements to determine how to best meld these requirements into a training program that will still fulfill all requirements but eliminate the potential for duplication of some elements in successive courses. This approach may not eliminate all duplication between courses, but it should result in significant savings in manhours demanded in a training environment which requires similar information to meet a host of regulatory requirements. The training matrix planned for Oak Ridge National Laboratory (ORNL) will be presented and discussed. 22 refs., 3 tabs

  6. Special offer

    CERN Multimedia

    Staff Association

    2010-01-01

    Entrez en Harmony et découvrez… Un espace bien-être avec piscine, jacuzzi, hammam, sauna. Une offre de 65 cours collectifs dispensés par des professeurs diplômés, et de multiples possibilités de s’entraîner individuellement ou avec un coach. Un personnel expérimenté à votre écoute. Des locaux spacieux, lumineux, situés au centre de La Praille. Une garderie, des places de parking et 50 commerces, et une grande diversité de collations et jus de fruits frais. Prix corporate « spécial 10 ans » Plus de 20 % de rabais en 2010 Sur présentation de votre carte membre Votre contact: Sara Forestier 079 290 66 18

  7. The revival of Phage Therapy to fight Antimicrobial Resistance – Part II: What about patent protection and alternative incentives?

    DEFF Research Database (Denmark)

    Minssen, Timo

    2014-01-01

    Three days ago I commented on a couple of legal issues raised in the recent Nature report “Phage therapy gets revitalized” by Sara Reardon. One challenge concerns the reluctance of pharma companies to broadly invest in the development of phage therapies. As pointed out in the report, this does....... Like in Europe, the first door to patentability that phage-related technology would need to pass concerns patent eligibility. In the last years the US Supreme Court has rendered an astonishing number of fundamental patent-decisions, including not less than four (!) landmark judgments on patent...... occurring viruses, such as phages, and the processes in which these are used. Myriad and Prometheus could thus have a fundamental impact on many patent portfolios relating to phage therapy and thus business involvement. In that context, it is important to realize that an important component of proper use...

  8. Arvustused / Mart Kalvet

    Index Scriptorium Estoniae

    Kalvet, Mart, 1975-

    2007-01-01

    Heliplaatidest:Type O Negative "Dead Again", Luv Machine "Turns You On", Loits "Leegion laval", Chrome Hoof "Beyond Zade", Neoandertals "Neoanderthals Were Master Butchers", Deathbound "To Cure The Sane With Insanity", Guardians Of Mankind/Merging Flare "Beyond the Blackhole/Under the Fire", Funeral "From These Wounds", Black Bile "Cloacal Meditation", Furze (Woe J. Reaper) "UTD", Embrace "The Last Embrace", Blut Aus Nord "MoRT", Diskreet "Infernal Rise", Sepia Dreamer "The Sublime", SaraLee "Darkness Between", Urt "Saatanhark", Onslaught "Killing Peace", Paganize "Evolution Hour", Kroda "Fimbulwinter", Scent Of Flesh "Deform In Torture", Zatokrev "Bury the Ashes", Misery Signals "Mirrors", Sarpanitum "Despoilment Of Origin", Umbra Nihil "Gnoia", Saattue "Ikiuneen", Sanctimony "Hell in Stereo", Twilight Ophera "Descension", Year Of Desolation "Year Of Desolation", "Resistance"

  9. The changing Arena: New DOE waste management orders

    International Nuclear Information System (INIS)

    Albenesius, E.L.; Kluk, A.F.

    1988-01-01

    There are five orders that address waste management within the Department of Energy (DOE); three of these orders are being revised, which emphasize the rapidly changing arena in which the department is contending in this field. The need to change the Comprehensive Environmental Response, Compensation and Liability Act (CERCLA) Order arose from the Superfund amendments of 1986 (SARA) with its hammer provisions in Section 120 for compliance at Federal facilities. The need to change the Hazardous and Mixed Waste Management Order was accelerated by the promulgation by DOE of the new mixed waste rule on May 1, 1987, (1) and cancellation of the obsolete existing order on October 5, 1987. The new rule requires coregulation of all DOE mixed waste with the Environmental Protection Agency (EPA) and the respective authorized states. 5 refs

  10. Note e Recensioni

    Directory of Open Access Journals (Sweden)

    a cura di Mariagrazia Portera

    2013-12-01

    Full Text Available Volumi Winfried Menninghaus, La promessa della bellezza, [Fabrizio Desideri, p. 272] • David Rothenberg, Survival of the Beautiful. Art, Science and Evolution [Danae Crocchiola, p. 274] • Lev Manovich, Software Takes Command [Angela Maiello, p. 277]. Note Method in Aesthetics: Philosophy, Evolution and the Cognitive Sciences [Aaron Meskin, Matthew Kieran, Gregory Currie, p. 280] • L’Abitare possibile. Estetica, Architettura e New Media, Ravello, Auditorium Oscar Niemeyer, 28-30 maggio 2013 [Sara Matetich, p. 282] • Copenhagen Summer School in Phenomenology and Philosophy of Mind, University of Copenhagen, 12-16 Agosto 2013 [Raoul Frauenfelder, p. 289] • Ciò che è vivo e ciò che è morto nell’estetica di Archibald Ali- son. Nota a margine del convegno: Neoestetica ed emozione. Archibald Alison e l’estetica con- temporanea, Palermo, 4-5 ottobre 2013 [Giuseppe Pucci, p. 294

  11. Feminist Praxis, Critical Theory and Informal Hierarchies

    Directory of Open Access Journals (Sweden)

    Eva Giraud

    2015-05-01

    Full Text Available This article draws on my experiences teaching across two undergraduate media modules in a UK research-intensive institution to explore tactics for combatting both institutional and informal hierarchies within university teaching contexts. Building on Sara Motta’s (2012 exploration of implementing critical pedagogic principles at postgraduate level in an elite university context, I discuss additional tactics for combatting these hierarchies in undergraduate settings, which were developed by transferring insights derived from informal workshops led by the University of Nottingham’s Feminism and Teaching network into the classroom. This discussion is framed in relation to the concepts of “cyborg pedagogies” and “political semiotics of articulation,” derived from the work of Donna Haraway, in order to theorize how these tactics can engender productive relationships between radical pedagogies and critical theory.

  12. Implementation of environmental compliance for operating radioactive liquid waste systems at the Oak Ridge National Laboratory

    International Nuclear Information System (INIS)

    Hooyman, J.H.; Robinson, S.M.

    1992-01-01

    This paper addresses methods being implemented at the Oak Ridge National Laboratory (ORNL) to continue operating while achieving compliance with new standards for liquid low level waste (LLLW) underground storage tank systems. The Superfund Amendment and Reauthorization Act (SARA) of the Comprehensive Environmental Response, Compensation, and Liability Act (CERCLA) required that the Department of Energy (DOE) execute a Federal Facility Agreement (FFA) with the Environmental Protection Agency (EPA) within 6 months of listing of the ORNL on the National Priorities List. An FFA for ORNL became effective January 1, 1992 among the EPA, DOE, and the Tennessee Department of Environment and Conservation (TDEC). The agreement ensures that environmental impacts resulting from operations at the Oak Ridge Reservation are investigated and remediated to protect the public health, welfare, and environment

  13. Solvent substitutes

    International Nuclear Information System (INIS)

    Evanoff, S.P.

    1995-01-01

    The environmental and industrial hygiene regulations promulgated since 1980, most notably the Superfund Amendments and Reauthorization Act (SARA), the Hazardous and Solid Waste Amendments to the Resources Conservation and Recovery Act (RCRA), and the Clean Air Act Amendments of 1990, have brought about an increased emphasis on user exposure, hazardous waste generation, and air emissions. As a result, industry is performing a fundamental reassessment of cleaning solvents, processes, and procedures. The more progressive organizations have made their goal the elimination of solvents that may pose significant potential human health and environmental hazards. This chapter discusses solvent cleaning in metal-finishing, metal-manufacturing, and industrial maintenance applications; precision cleaning; and electronics manufacturing. Nonmetallic cleaning, adhesives, coatings, inks, and aerosols also will be addressed, but in a more cursory manner

  14. Fifteen years of seismic monitoring at the Las Tres Virgenes, BCS, geothermal field; Quince anos de monitoreo sismico en el campo geotermico de Las Tres Virgenes, BCS

    Energy Technology Data Exchange (ETDEWEB)

    Ortiz Prieto, Irais; Lorenzo Pulido, Cecilia [Comision Federal de Electricidad, Gerencia de Proyectos Geotermoelectricos, Morelia, Michoacan (Mexico)]. E-mail: cecilia.lorenzo@cfe.gob.mx

    2009-07-15

    Seismic monitoring at the Las Tres Virgenes, BCS, geothermal field started in 1992 with an analog station of vertical components detecting a large number of earthquakes of varying magnitudes. In February 1993, a seismic network was installed, composed of six digital stations DR-2000-with S-6000 and S-5000 sensors and three registration channels (N-S, E-W and vertical). This was the basis for the development of a program to correct arrival-time data for P and S waves due to instrument drift. From January to April 1994 and May to August 1995, based on the 170 seismic events recorded, a velocity model was proposed. From December 1995 to July 1996, seismic data were processed and interpreted, and zones of occurrence were determined for events according to magnitude and the predominant noise in the field. From September 2003 to December 2004, 10 seismic stations (permanent and temporary) were installed and monitored and it was concluded the most active fault system was El Volcan. From September to December 2004, production wells LV-4 and LV-13 were acid-stimulated and seismic monitoring during this period allowed for the definition of two important seismic zones, both related to the El Volcan fault system and to injection well LV-8. After reopening these production wells, it was concluded an increase in seismic activity had occurred. From May to August 2006, information was compiled from the seismic network and it was concluded El Partido had became the most active fault system. Presently the seismic network in this field is composed of one SARA station and four K2 units. The SARA station is telemetrically connected to the base station. [Spanish] En el campo geotermico de Las Tres Virgenes, BCS, el monitoreo sismico empezo a partir de 1992 con una sola estacion analogica de registro vertical, la cual detecto una gran cantidad de temblores de distintas magnitudes. En febrero de 1993 se instalo una red sismica con seis estaciones digitales DR-2000 con sensores S-6000 y S

  15. Energy policy and foreign policy in Italy; Politica energetica e politica estera in Italia

    Energy Technology Data Exchange (ETDEWEB)

    Venanzi, F. (comp.)

    2001-06-01

    Energy policy in Italy is principally a matter of foreign policy. As a result, extensive programmes for the exploration, development, transport and marketing of oil and natural gas have to be planned and carried out together with the producing countries. In this effort, the country shall need the support of its national energy companies. That is why ENI's controlling interest as well as its mission had better be on Italian hands. [Italian] Per l'Italia la politica energetica deve essere principalmente politica estera. Occorre pertanto realizzare vasti programmi di esplorazione mineraria, coltivazione, trasporto e commercializzazione di petrolio e gas naturale con i Paesi produttori. Ci sara' quindi bisogno di contare sulle imprese energetiche nazionali: per questa ragione, si auspica che il controllo e la missione dell'ENI restino italiani.

  16. Methodology of modeling and measuring computer architectures for plasma simulations

    Science.gov (United States)

    Wang, L. P. T.

    1977-01-01

    A brief introduction to plasma simulation using computers and the difficulties on currently available computers is given. Through the use of an analyzing and measuring methodology - SARA, the control flow and data flow of a particle simulation model REM2-1/2D are exemplified. After recursive refinements the total execution time may be greatly shortened and a fully parallel data flow can be obtained. From this data flow, a matched computer architecture or organization could be configured to achieve the computation bound of an application problem. A sequential type simulation model, an array/pipeline type simulation model, and a fully parallel simulation model of a code REM2-1/2D are proposed and analyzed. This methodology can be applied to other application problems which have implicitly parallel nature.

  17. Optimizing compliance training for the waste management worker

    International Nuclear Information System (INIS)

    Copenhaver, E.D.

    1988-01-01

    Waste management workers are required to participate in special training mandated by a variety of Federal laws and DOE (Department of Energy) Orders; these include the Resource Conservation and Recovery Act (RCRA), Superfund Amendments Reauthorization Act (SARA) as implemented by OSHA (Occupational Safety and Health Administration) in CFR 1910.120, in addition to requirements for Hazard Communication, Radiation Workers, Respiratory Protection, Transportation, and Waste Generator training. The Technical Resources and Training Program is examining the course contents and mandated requirements to determine how to best meld these requirements into a training program that will still fulfill all requirements but eliminate the potential for duplication of some elements in successive courses. This approach may not eliminate all duplication between courses, but it should result in significant savings in man-hours demanded in a training environment which requires similar information to meet a host of regulatory requirements. The training matrix planned for Oak Ridge National Laboratory (ORNL) will be presented and discussed

  18. Full spectrum analysis in environmental monitoring

    International Nuclear Information System (INIS)

    Reinhardt, Sascha; Hartmann, Soeren; Pimpl, Richard

    2015-01-01

    In the environmental monitoring spectroscopic gamma detectors are frequently used. The motivation to use spectroscopic gamma detectors is the higher sensitivity and specific spectral information. For the analysis often the photo peaks of the gamma spectrum are used to identify the nuclide. These methods are very reliable, robust and well developed but using only the photo peak means also to use only a fraction of the available information. Doing a full spectrum analysis based on principle components obtained from NASVD for description of the radiation background and adjustment calculations are a possible analysis method which may provide advantages compared to a peak based analysis when used for a continuous environmental monitoring. An analysis example is shown and discussed with a measured time series of gamma spectra obtained from a spectroscopic gamma detector SARA IGS710 with a NaI(Tl) scintillator as it is used in the environmental monitoring.

  19. Comprehensive Environmental Response, Compensation, and Liability Act, as amended by the Superfund Amendments and Reauthorization Act Section 120(e)(5)

    International Nuclear Information System (INIS)

    1992-05-01

    The US Department of Energy (DOE) is committed to conducting its operations. In a safe and environmentally sound manner. High priorities for the Department are identifying and correcting environmental problems at DOE facilities that resulted from past operations, and preventing environmental problems from occurring during present and future operations. In this regard, the Department is committed to the 30-year goal of cleanup of all facilities by the year 2019. DOE has issued an Order and guidance establishing policy and procedures for activities conducted under the Comprehensive Environmental Response, Compensation, and Liability Act (CERCLA), as amended by the Superfund Amendments and Reauthorization Act (SARA), and has developed a Five-Year Plan, updated annually, that integrates planing for corrective activities, environmental restoration, and waste management operations at its facilities. During Calendar Year 1991 and early 1992, DOE made significant progress in reaching agreements with regulatory entities, undertaking cleanup actions, and initiating preventive measures designed to eliminate future environmental problems. These accomplishments are described

  20. Transfer of 137Cs from soil to plants in different types of soils

    International Nuclear Information System (INIS)

    Todorovic, D.; Radenkovic, M.; Popovic, D.; Djuric, G.

    1998-01-01

    The investigations were carried out in two mountainous regions in the West and South region of the country). Three main types of soils were examined: shale, limestone and the mixed type, and several plants: grass, meadow flora, pinewood, blueberries, an endemic species of Mt. Sara and the bioindicators: moss and lichen. The transfer factors lay in the range of 0.1 - 2.0 in dependence on the type of soil and plant (3.0 - 10.0 for the bioindicator plants). The vertical distribution of 13' 7Cs in the first 15 cm layer of the soil indicates a slow migration of Chernobyl cesium through soil, except on riversides where the wash-out effect plays a role. Generally, the concentration of 137 Cs in soils strongly depends on the configuration of the ground