WorldWideScience

Sample records for atrioventricular av node

  1. Does the atrioventricular node conduct?

    NARCIS (Netherlands)

    Meijler, F.L.; Fisch, C.

    1989-01-01

    It is difficult to be certain wh en the term "conduction" was first applied to the transfer of atrial activation to the ventricles .' In 1894, Engelmann used the word "Leitung", which can be translated as "connection" or as "conduction" .2 In 1906, Tawara described the atrioventricular node,

  2. Mahaim Fiber Accelerated Automaticity and Clues to a Mahaim Fiber Being Morphologically an Ectopic or a Split AV Node

    Directory of Open Access Journals (Sweden)

    Shomu Bohora

    2010-01-01

    Full Text Available Mahaim Fiber tachycardia characteristically causes a wide QRS tachycardia with left bundle branch morphology and left axis deviation, especially in young patients, having no structural heart disease. Mahaim fiber automaticity further cements the proposition of Mahaim fiber, due to its Atrioventricular (AV node like property, being called as an ectopic AV node.

  3. An improved in vivo method for atrioventricular node ablation via thoracotomy

    Directory of Open Access Journals (Sweden)

    R.H. MacIver

    2010-02-01

    Full Text Available The atrioventricular (AV node is permanently damaged in approximately 3% of congenital heart surgery operations, requiring implantation of a permanent pacemaker. Improvements in pacemaker design and in alternative treatment modalities require an effective in vivo model of complete heart block (CHB before testing can be performed in humans. Such a model should enable accurate, reliable, and detectable induction of the surgical pathology. Through our laboratory’s efforts in developing a tissue engineering therapy for CHB, we describe here an improved in vivo model for inducing chronic AV block. The method employs a right thoracotomy in the adult rabbit, from which the right atrial appendage may be retracted to expose an access channel for the AV node. A novel injection device was designed, which both physically restricts needle depth and provides electrical information via electrocardiogram interface. This combination of features provides real-time guidance to the researcher for confirming contact with the AV node, and documents its ablation upon formalin injection. While all animals tested could be induced to acute AV block, those with ECG guidance were more likely to maintain chronic heart block >12 h. Our model enables the researcher to reproduce both CHB and the associated peripheral fibrosis that would be present in an open congenital heart surgery, and which would inevitably impact the design and utility of a tissue engineered AV node replacement.

  4. His electrogram alternans (Zhang's phenomenon) and a new model of dual pathway atrioventricular node conduction.

    Science.gov (United States)

    Zhang, Youhua

    2016-01-01

    In contrast to the current textbook model and the current clinical index of dual pathway atrioventricular (AV) nodal conduction, here we summarize the discovery and validation of Zhang's phenomenon (originally His electrogram alternans) as a new index of dual pathway conduction. We also describe the new findings of transverse-versus-longitudinal electrical propagation within the AV node as the electrophysiological basis underlining this new index. Thus, a new index and a new model of dual pathway AV conduction are being developed. We have reviewed current literature and provided evidence supporting a new index and a new model of dual pathway AV conduction. Recent data revealed that during fast pathway conduction, electrical excitation in the AV node propagates in a superior to inferior direction across AV conduction axis and fiber orientation to reach first the superior His bundle fibers. However, this transverse conduction can fail easily within the superior nodal domain at fast rates. The failing of transverse propagation permits electrical excitation formed at the posterior/inferior nodal region to propagate longitudinally along fiber orientation in a posterior to anterior direction through the inferior nodal domain to reach the inferior His bundle (slow pathway conduction). This transverse-versus-longitudinal electrical propagation within the AV node results in a functional dissociation in the distal node and formation of dual inputs into the His bundle, providing the electrophysiological basis for the formation of Zhang's phenomenon (His electrogram alternans). Based on strong experimental data, a new index and a new model of dual pathway AV nodal conduction are emerging, although they are still awaiting clinical validation.

  5. The sinus venosus myocardium contributes to the atrioventricular canal: potential role during atrioventricular node development?

    Science.gov (United States)

    Kelder, Tim P; Vicente-Steijn, Rebecca; Harryvan, Tom J; Kosmidis, Georgios; Gittenberger-de Groot, Adriana C; Poelmann, Rob E; Schalij, Martin J; DeRuiter, Marco C; Jongbloed, Monique R M

    2015-06-01

    The presence of distinct electrophysiological pathways within the atrioventricular node (AVN) is a prerequisite for atrioventricular nodal reentrant tachycardia to occur. In this study, the different cell contributions that may account for the anatomical and functional heterogeneity of the AVN were investigated. To study the temporal development of the AVN, the expression pattern of ISL1, expressed in cardiac progenitor cells, was studied in sequential stages performing co-staining with myocardial markers (TNNI2 and NKX2-5) and HCN4 (cardiac conduction system marker). An ISL1+/TNNI2+/HCN4+ continuity between the myocardium of the sinus venosus and atrioventricular canal was identified in the region of the putative AVN, which showed a pacemaker-like phenotype based on single cell patch-clamp experiments. Furthermore, qPCR analysis showed that even during early development, different cell populations can be identified in the region of the putative AVN. Fate mapping was performed by in ovo vital dye microinjection. Embryos were harvested and analysed 24 and 48 hrs post-injection. These experiments showed incorporation of sinus venosus myocardium in the posterior region of the atrioventricular canal. The myocardium of the sinus venosus contributes to the atrioventricular canal. It is postulated that the myocardium of the sinus venosus contributes to nodal extensions or transitional cells of the AVN since these cells are located in the posterior region of the AVN. This finding may help to understand the origin of atrioventricular nodal reentrant tachycardia. © 2015 The Authors. Journal of Cellular and Molecular Medicine published by John Wiley & Sons Ltd and Foundation for Cellular and Molecular Medicine.

  6. Comparison of power- and temperature-guided radiofrequency modification of the atrioventricular node. Polaris Investigator Group.

    Science.gov (United States)

    Kavesh, N G; Gosnell, M R; Shorofsky, S R; Gold, M R

    1997-12-01

    The purpose of this study was to compare the performance and clinical outcome of radiofrequency ablation of the substrate of atrioventricular (AV) nodal reentrant tachycardia (AVNRT) when guided by power output or temperature monitoring. Two sequential multicenter studies of power-controlled and open-loop, temperature-controlled radiofrequency ablation were analyzed in 171 patients undergoing AV node modification for the treatment of AVNRT. After successful ablation of AVNRT, complete elimination of slow AV node pathway function was accomplished more often with than without temperature monitoring (92% vs 69%, p = 0.005). Greater power was delivered to each patient with than without temperature monitoring (median 47 W, range 10 to 57, vs median 35 W, range 5 to 68, p = 0.001). Acute elimination of tachycardia (100% vs 96%), 3-month recurrence (6% vs 8%), procedural times (162 vs 170 minutes), fluoroscopy times (24.6 vs 29.5 minutes), complications (6% vs 3%), and catheter removals to check for coagulum (8% vs 6%) did not differ between patients treated with and without temperature monitoring, respectively. Power- and temperature-controlled radiofrequency techniques are highly successful with low complication rates for slow pathway ablation. Temperature monitoring may allow the safe delivery of more power, and the more complete elimination of slow AV node pathway function.

  7. Long-Term Outcome of Single-Chamber Atrial Pacing Compared with Dual-Chamber Pacing in Patients with Sinus-Node Dysfunction and Intact Atrioventricular Node Conduction

    OpenAIRE

    Kim, Won Ho; Joung, Boyoung; Shim, Jaemin; Park, Jong Sung; Hwang, Eui-Seock; Pak, Hui-Nam; Kim, Sungsoon; Lee, Moonhyoung

    2010-01-01

    Purpose The optimal pacing mode with either single chamber atrial pacemaker (AAI or AAIR) or dual chamber pacemaker (DDD or DDDR) is still not clear in sinus-node dysfunction (SND) and intact atrioventricular (AV) conduction. Materials and Methods Patients who were implanted with permanent pacemaker using AAI(R) (n = 73) or DDD(R) (n = 113) were compared. Results The baseline characteristics were comparable between the two groups, with a mean follow-up duration of 69 months. The incidence of ...

  8. Pacemaker-based analysis of atrioventricular conduction and atrial tachyarrhythmias in patients with primary sinus node dysfunction.

    Science.gov (United States)

    Stockburger, Martin; Trautmann, Frederike; Nitardy, Aischa; Just-Teetzmann, Martin; Schade, Stefan; Celebi, Oezlem; Krebs, Alice; Dietz, Rainer

    2009-05-01

    Most patients with symptomatic sinus node disease (SND) receive DDDR pacemakers (PM) in order to cover SND and atrioventricular (AV) block from the outset. But the concern about adverse effects of right ventricular pacing (RVP) is increasing. So far, data on the incidence of AV block in SND are based on clinical events. The study undertakes to assess and appraise AV block and atrial tachyarrhythmias (AT) from memory and electrograms of a dual-chamber PM set to an AAIR-DDDR switch mode (AAISafeR). A dual-chamber PM incorporating the AAISafeR mode was implanted in 58 patients (70 +/- 10 years, 28 males) with SND, but without AV block >I. AV block and AT episodes were retrieved from the PM memory and validated from electrograms. AV block episodes were classified potentially relevant while comprising AV block III or AV block I/II during exercise. The patients experienced a median of 90 (interquartile range 7-1,084) commutations. Possibly relevant AV block occurred in 32 patients (55%). Validation revealed high-quality PM-based categorization. The RVP prevalence was 0% (0-16%). The median AT prevalence was 0.03 (0-26) min/day. RVP was the only multivariate predictor of AT (P = 0.001). Potentially relevant AV block occurs frequently in patients with SND. Nonetheless, the RVP prevalence is kept low through the AAISafeR mode. The protection of SND patients with demand-actuated ventricular pacing appears reasonable. The AT prevalence is low in SND patients treated by the AAISafeR mode. Even low RVP proportions appear to favor AT. Prospective evaluation is needed.

  9. Time-dependent change in fast pathway refractoriness after slow pathway ablation in atrioventricular node reentrant tachycardia. Mansfield Polaris Investigators.

    Science.gov (United States)

    Krahn, A D; Klein, G J; Yee, R

    1997-06-01

    To determine the time course of change in fast pathway refractoriness after slow pathway ablation. Antegrade fast pathway refractoriness has been observed to shorten in patients undergoing slow pathway ablation for atrioventricular (AV) node reentrant tachycardia. The time course and mechanism of this observation have not been explained. Twenty-eight patients with AV node reentrant tachycardia and dual AV node pathways undergoing slow pathway ablation had the fast pathway effective refractory period (ERP) assessed immediately before, and at 0, 15, 30 and 45 mins after slow pathway ablation (Group 1). Twenty-five additional patients with AV node reentry and dual pathways involved in a multicentre protocol evaluating the Mansfield Polaris LE catheter underwent assessment of fast pathway refractoriness before and after slow pathway ablation, and at a routine three-month follow-up electrophysiology study (Group 2). In Group 1, antegrade fast pathway ERP fell from 394 ms before ablation to 334 ms immediately after slow pathway ablation, increased to 348 ms within 15 mins and was 353 ms at 45 mins (ANOVA P < 0.001). Retrograde fast pathway ERP fell from 325 ms before ablation to 294 ms at 45 mins (P = 0.02). In Group 2, antegrade fast pathway ERP fell from 390 ms before ablation to 337 ms after ablation, and rose to 362 ms at three months (P = 0.01). Retrograde fast pathway ERP also fell from 347 ms to 319 ms after ablation (P = 0.01), and remained unchanged at three months. Slow pathway ablation results in an immediate and sustained change in antegrade and retrograde first pathway refractoriness. There are immediate reversible and long term nonreversible components to this phenomenon. The latter finding may be related to loss of electrotonic inhibition of the fast pathway by the slow pathway.

  10. Long-term outcome of single-chamber atrial pacing compared with dual-chamber pacing in patients with sinus-node dysfunction and intact atrioventricular node conduction.

    Science.gov (United States)

    Kim, Won Ho; Joung, Boyoung; Shim, Jaemin; Park, Jong Sung; Hwang, Eui-Seock; Pak, Hui-Nam; Kim, Sungsoon; Lee, Moonhyoung

    2010-11-01

    The optimal pacing mode with either single chamber atrial pacemaker (AAI or AAIR) or dual chamber pacemaker (DDD or DDDR) is still not clear in sinus-node dysfunction (SND) and intact atrioventricular (AV) conduction. Patients who were implanted with permanent pacemaker using AAI(R) (n = 73) or DDD(R) (n = 113) were compared. The baseline characteristics were comparable between the two groups, with a mean follow-up duration of 69 months. The incidence of death did not show statistical difference. However, the incidence of hospitalization for congestive heart failure (CHF) was significantly lower in the AAI(R) group (0%) than the DDD(R) group (8.8%, p = 0.03). Also, atrial fibrillation (AF) was found in 2.8% in the AAI(R) group, which was statistically different from 15.2% of patients in the DDD(R) group (p = 0.01). Four patients (5.5%) with AAI(R) developed AV block, and subsequently switched to DDD(R) pacing. The risk of AF was lower in the patients implanted with AAI(R) than those with DDD(R) [hazard ratio (HR), 0.84; 95% confidence interval, 0.72 to 0.97, p = 0.02]. In patients with SND and intact AV conduction, AAI(R) pacing can achieve a better clinical outcome in terms of occurrence of CHF and AF than DDD(R) pacing. These findings support AAI(R) pacing as the preferred pacing mode in patients with SND and intact AV conduction.

  11. The ostium primum or partial atrioventricular septal defect

    OpenAIRE

    Radermecker, Marc; Fontaine, Raphael; Limet, Raymond

    2007-01-01

    Often assimilated to simple inter-atrial communication, the ostium primum, or partial atrio-ventricular septal defect, is an entity that is characterized by a different embryological mechanism and requires some specific surgical expertise. Basically, knowledge of the morphology of the common atrioventricular valve with 5 components, the topography of the A-V node and His bundle, and the ventricular consequences of the absence of atrio-ventricular septal structures must be taken into account. ...

  12. Differential ventricular entrainment: a maneuver to differentiate AV node reentrant tachycardia from orthodromic reciprocating tachycardia.

    Science.gov (United States)

    Segal, Oliver R; Gula, Lorne J; Skanes, Allan C; Krahn, Andrew D; Yee, Raymond; Klein, George J

    2009-04-01

    Distinguishing atrioventricular node reentry (AVNRT) from orthodromic reentrant tachycardia (ORT) utilizing an accessory pathway (AP) can sometimes be challenging. A pacing maneuver that reliably distinguishes between the two would be of value. This study sought to assess the utility of differential entrainment for the diagnosis of supraventricular tachycardia. Consecutive patients underwent prospective electrophysiological study of regular paroxysmal supraventricular tachycardia. Overdrive pacing with entrainment of tachycardia from each of the right ventricular apex and right ventricular base was performed. The post-pacing interval (PPI), PPI minus the tachycardia cycle length and corrected for AV node decrement (cPPI-TCL), and the ventriculoatrial (VA) interval (last RV pacing stimulus to last entrained high right atrial signal) were calculated at each site. Entrainment at both RV sites was achieved in 35 patients, 16 with typical AVNRT, 1 with atypical AVNRT, and 18 with ORT (13 left free wall, 3 right free wall, and 2 septal APs). The cPPI-TCL and VA intervals were significantly longer from base than apex in AVNRT (cPPI-TCL 61 ms longer, VA 38 ms longer, both P cPPI-TCL >30 ms or VA interval >20 ms identified patients with AVNRT with a positive predictive value, negative predictive value, sensitivity, and specificity of 100%. Differential ventricular entrainment is a useful tool for diagnosing between AVNRT and ORT. A differential cPPI-TCL >30 ms or VA interval of >20 ms reliably predicts AVNRT.

  13. The Tbx2(+) Primary Myocardium of the Atrioventricular Canal Forms the Atrioventricular Node and the Base of the Left Ventricle

    NARCIS (Netherlands)

    Aanhaanen, W.T.J.; Brons, J.F.; Domínguez, J.N.; Rana, M.S.; Norden, J.; Airik, R.; Wakker, V.; de Gier-de Vries, C.; Brown, N.A.; Kispert, A.; Moorman, A.F.M.; Christoffels, V.M.

    2009-01-01

    The primary myocardium of the embryonic heart, including the atrioventricular canal and outflow tract, is essential for septation and valve formation. In the chamber-forming heart, the expression of the T-box transcription factor Tbx2 is restricted to the primary myocardium. To gain insight into the

  14. Novel method of predicting the optimal atrioventricular delay in patients with complete AV block, normal left ventricular function and an implanted DDD pacemaker.

    Science.gov (United States)

    Miki, Yuko; Ishikawa, Toshiyuki; Matsushita, Kohei; Yamakawa, Youhei; Matsumoto, Katsumi; Sumita, Shinichi; Uchino, Kazuaki; Kimura, Kazuo; Umemura, Satoshi

    2009-04-01

    The optimal atrioventricular (AV) delay setting is important for achieving optimal AV synchrony in patients with an implanted DDD pacemaker. Using pulsed Doppler echocardiography is the most common method of predicting the optimal AV delay, but it is a complicated and time-consuming method. Therefore, an automatic optimizing function of the AV delay at different atrial rates is desirable for achieving a favorable hemodynamic state. This study aimed to predict the optimal AV delay using phonocardiography. The amplitude of the first heart sound (S1) recorded on the phonocardiogram was measured with different AV delays in 6 patents with complete AV block, normal left ventricular function and an implanted DDD pacemaker. The correlation between the amplitude of S1 and the length of the AV delay was a cubic curve (y=974.15x(3)-23.084x(2)-8.0074x+0.7495, R2=0.9511). The length of the AV delay at the inflection point of the curve showed a significant positive correlation with the optimal AV delay determined by pulsed Doppler echocardiography (R=0.9254, P<0.01). This study demonstrated a novel simple method of predicting the optimal AV delay using phono-cardiography.

  15. Three-dimensional computer model of the right atrium including the sinoatrial and atrioventricular nodes predicts classical nodal behaviours.

    Directory of Open Access Journals (Sweden)

    Jue Li

    Full Text Available The aim of the study was to develop a three-dimensional (3D anatomically-detailed model of the rabbit right atrium containing the sinoatrial and atrioventricular nodes to study the electrophysiology of the nodes. A model was generated based on 3D images of a rabbit heart (atria and part of ventricles, obtained using high-resolution magnetic resonance imaging. Segmentation was carried out semi-manually. A 3D right atrium array model (∼3.16 million elements, including eighteen objects, was constructed. For description of cellular electrophysiology, the Rogers-modified FitzHugh-Nagumo model was further modified to allow control of the major characteristics of the action potential with relatively low computational resource requirements. Model parameters were chosen to simulate the action potentials in the sinoatrial node, atrial muscle, inferior nodal extension and penetrating bundle. The block zone was simulated as passive tissue. The sinoatrial node, crista terminalis, main branch and roof bundle were considered as anisotropic. We have simulated normal and abnormal electrophysiology of the two nodes. In accordance with experimental findings: (i during sinus rhythm, conduction occurs down the interatrial septum and into the atrioventricular node via the fast pathway (conduction down the crista terminalis and into the atrioventricular node via the slow pathway is slower; (ii during atrial fibrillation, the sinoatrial node is protected from overdrive by its long refractory period; and (iii during atrial fibrillation, the atrioventricular node reduces the frequency of action potentials reaching the ventricles. The model is able to simulate ventricular echo beats. In summary, a 3D anatomical model of the right atrium containing the cardiac conduction system is able to simulate a wide range of classical nodal behaviours.

  16. A Simple Method to Differentiate Atrioventricular Node Reentrant Tachycardia from Orthodromic Reciprocating Tachycardia.

    Science.gov (United States)

    He, Quan; Lei, Sen; Jia, Feng-Peng; Gao, Ling-Yun; W X Zhu, Dennis

    2018-01-27

    Discrimination between atrioventricular node reentry tachycardia (AVNRT) and orthodromic reciprocating tachycardia (ORT) during an electrophysiological study is sometimes challenging. This study aimed to investigate if the difference in the local VA (ventricle-atrium) interval during ventricular entrainment pacing and during tachycardia (DVA, defined as the shortest local VA interval of coronary sinus [CS] during entrainment minus the shortest local VA interval of CS during tachycardia) was different in patients with AVNRT and patients with ORT.Diagnoses of AVNRT or ORT through a concealed accessory pathway (AP) were made according to conventional electrophysiological criteria and ablation results. Entrainment by right ventricular (RV) pacing was performed in each patient before ablation and patients with successful entrainment were included in the study. The DVA was compared between patients with AVNRT and patients with ORT. The DVA in patients with AVNRT was significantly longer than that in patients with ORT (120 ± 20 versus 5.7 ± 9; P DVA was more than 48 ms. In each patient with ORT using a left free wall accessory pathway (AP), right free wall AP, and septal AP, the DVA was less than 20 ms.DVA was found to be a rapid, useful test in distinguishing patients with AVNRT from those with ORT.

  17. Transverse versus longitudinal electrical propagation within the atrioventricular node during dual pathway conduction: basis of dual pathway electrophysiology and His electrogram alternans (Zhang's phenomenon).

    Science.gov (United States)

    Zhang, Youhua

    2014-02-01

    We have discovered and validated that AV node dual pathway conduction results in a new phenomenon termed His electrogram alternans (HEA), which indicates dual inputs rather than a final common pathway from the AV node into the His bundle. However, the electrophysiological basis for AV node dual pathway conduction and HEA has not been clarified. This study was designed to elucidate the electrophysiological basis for dual pathway conduction and HEA. By using HEA as an index of dual pathway electrophysiology, action potentials from multiple locations in the superior and inferior AV nodal domains were obtained to monitor electrical propagation during dual pathway conduction in 8 isolated rabbit hearts. Fibers inside the AV node were generally aligned along the AV conduction axis. During fast pathway (FP) conduction, electrical excitation in the AV node was propagated in a superior to inferior direction across the major fiber orientation. In contrast, slow pathway (SP) conduction occurred when the superior-inferior propagation failed within the superior nodal domain, permitting electrical propagation to proceed in the inferior nodal domain along the fiber orientation in a posterior to anterior direction. In effect, FP activated first the superior distal node, while SP activated first the inferior distal node. This functional dissociation of superior-fast and inferior-slow domains in distal node produced dual inputs into the His bundle. Transverse versus longitudinal electrical propagation within the AV node produces functional dissociation in the distal node, resulting in superior-fast and inferior-slow inputs into the His bundle and HEA during dual pathway conduction. Copyright © 2013 Elsevier Ireland Ltd. All rights reserved.

  18. In vivo recording of Zhang's phenomenon (His electrogram alternans): a novel index of atrioventricular node dual pathway conduction.

    Science.gov (United States)

    Zhang, Youhua

    2014-08-01

    Zhang's phenomenon (originally His electrogram alternans) is a new index of atrioventricular node dual pathway electrophysiology. This index has been described and validated in isolated hearts in vitro, but has not been recorded in vivo. This study explored the feasibility of in vivo recording of Zhang's phenomenon (His electrogram alternans) in six dogs with a custom-built bipolar electrode. The His electrogram recorded from superior His bundle domain (superior His electrogram) was high in amplitude at basic beats and long coupling intervals (i.e., fast pathway conduction) and low amplitude at short prematurities (i.e., slow pathway conduction). In contrast, His electrogram recorded from the inferior His bundle domain (inferior His electrogram) was always from low amplitude during fast pathway conduction to high amplitude during slow pathway conduction. The characteristic His electrogram alternans had been recorded in vivo in all six animals. This study provided the first data representing in vivo recording of Zhang's phenomenon (His electrogram alternans) in large animals. Clinical studies are needed before this novel index can be applied in patients.

  19. Dual atrioventricular nodal pathways physiology: a review of relevant anatomy, electrophysiology, and electrocardiographic manifestations.

    Science.gov (United States)

    Mani, Bhalaghuru Chokkalingam; Pavri, Behzad B

    2014-01-01

    More than half a century has passed since the concept of dual atrioventricular (AV) nodal pathways physiology was conceived. Dual AV nodal pathways have been shown to be responsible for many clinical arrhythmia syndromes, most notably AV nodal reentrant tachycardia. Although there has been a considerable amount of research on this topic, the subject of dual AV nodal pathways physiology remains heavily debated and discussed. Despite advances in understanding arrhythmia mechanisms and the widespread use of invasive electrophysiologic studies, there is still disagreement on the anatomy and physiology of the AV node that is the basis of discontinuous antegrade AV conduction. The purpose of this paper is to review the concept of dual AV nodal pathways physiology and its varied electrocardiographic manifestations.

  20. Dual Atrioventricular Nodal Pathways Physiology: A Review of Relevant Anatomy, Electrophysiology, and Electrocardiographic Manifestations

    Directory of Open Access Journals (Sweden)

    Bhalaghuru Chokkalingam Mani, MD

    2014-01-01

    Full Text Available More than half a century has passed since the concept of dual atrioventricular (AV nodal pathways physiology was conceived. Dual AV nodal pathways have been shown to be responsible for many clinical arrhythmia syndromes, most notably AV nodal reentrant tachycardia. Although there has been a considerable amount of research on this topic, the subject of dual AV nodal pathways physiology remains heavily debated and discussed. Despite advances in understanding arrhythmia mechanisms and the widespread use of invasive electrophysiologic studies, there is still disagreement on the anatomy and physiology of the AV node that is the basis of discontinuous antegrade AV conduction. The purpose of this paper is to review the concept of dual AV nodal pathways physiology and its varied electrocardiographic manifestations.

  1. Morfologia da junção atrioventricular em Iguana iguana (Reptilia-Iguanidae

    Directory of Open Access Journals (Sweden)

    Sonia Regina Jurado

    2006-06-01

    Full Text Available The atrioventricular junctional area (AVJA, including atrioventricular (AV node and bundle was investigated in seven hearts of common or green iguana (Iguana iguana using the light microscopy. Adult animals, both sexes, were captured in the Pantanal, Brazil. All hearts were fixed in buffered formaldehyde 10% (pH 7.2 for 24 hours, embedded in paraplast according to routine methods, and serially cut at 5 µm thickness. In the Iguana iguana, the AVJA consists of a mass of the fibers intermingled with variable amount of connective tissue and blood vessels surrounded by adjacent myocardium and the attachment of the right atrioventricular valve in the fibrous skeleton. By light microscopy, conducting cells of the AV node and bundle can be distinguished from working cells by their much smaller size, paler staining reaction and the presence of a sheath of connective tissue. The AV node and bundle and its branches were found to constitute a continuous tract. Histochemically, we found elastic fibers between cells of the conduction, mainly in the AV node. The PAS method reveals absence of glycogen in specialized cells. The fibrous skeleton, mainly the right trigone, showed a well-developed chondroid tissue, made by hyaline like cartilage (binucleated condrocytes included in the big lacunas and extracellular matrix with fibrillar collagen. In conclusion, the nodal and Purkinje cells in heart iguana presented poorly morphological differentiation comparing mammals and birds, however the skeleton fibrous has a different cartilage kind.

  2. Benefits of Permanent His Bundle Pacing Combined With Atrioventricular Node Ablation in Atrial Fibrillation Patients With Heart Failure With Both Preserved and Reduced Left Ventricular Ejection Fraction.

    Science.gov (United States)

    Huang, Weijian; Su, Lan; Wu, Shengjie; Xu, Lei; Xiao, Fangyi; Zhou, Xiaohong; Ellenbogen, Kenneth A

    2017-04-01

    Clinical benefits from His bundle pacing (HBP) in heart failure patients with preserved and reduced left ventricular ejection fraction are still inconclusive. This study evaluated clinical outcomes of permanent HBP in atrial fibrillation patients with narrow QRS who underwent atrioventricular node ablation for heart failure symptoms despite rate control by medication. The study enrolled 52 consecutive heart failure patients who underwent attempted atrioventricular node ablation and HBP for symptomatic atrial fibrillation. Echocardiographic left ventricular ejection fraction and left ventricular end-diastolic dimension, New York Heart Association classification and use of diuretics for heart failure were assessed during follow-up visits after permanent HBP. Of 52 patients, 42 patients (80.8%) received permanent HBP and atrioventricular node ablation with a median 20-month follow-up. There was no significant change between native and paced QRS duration (107.1±25.8 versus 105.3±23.9 milliseconds, P =0.07). Left ventricular end-diastolic dimension decreased from the baseline ( P heart failure with reduced ejection fraction patients (N=20) than in heart failure with preserved ejection fraction patients (N=22). New York Heart Association classification improved from a baseline 2.9±0.6 to 1.4±0.4 after HBP in heart failure with reduced ejection fraction patients and from a baseline 2.7±0.6 to 1.4±0.5 after HBP in heart failure with preserved ejection fraction patients. After 1 year of HBP, the numbers of patients who used diuretics for heart failure decreased significantly ( P Heart Association classification and reduced diuretics use for heart failure management in atrial fibrillation patients with narrow QRS who suffered from heart failure with preserved or reduced ejection fraction. © 2017 The Authors. Published on behalf of the American Heart Association, Inc., by Wiley Blackwell.

  3. Echocardiographic effects of changing atrioventricular delay in cardiac resynchronization therapy based on displacement

    DEFF Research Database (Denmark)

    Valeur, Nana; Fritz-Hansen, Thomas; Risum, Niels

    2010-01-01

    In studies showing benefits of cardiac resynchronization therapy (CRT), individual atrioventricular (AV) delays have been optimized using echocardiography. However, the method for AV delay optimization remains controversial.......In studies showing benefits of cardiac resynchronization therapy (CRT), individual atrioventricular (AV) delays have been optimized using echocardiography. However, the method for AV delay optimization remains controversial....

  4. Atrioventricular Dissociation after Electroconvulsive Therapy

    Directory of Open Access Journals (Sweden)

    Siegfried William Yu

    2011-01-01

    Full Text Available Electroconvulsive therapy (ECT is increasingly used as a treatment for psychiatric disorders. Cardiac effects are the principal cause of medical complications in these patients. We report a case of atrioventricular (AV dissociation that occurred after ECT that was treated with pacemaker implantation. The mechanisms contributing to the onset of AV dissociation in this patient, and the management and rationale for device therapy, in light of the most recent guidelines, are reviewed.

  5. Frequency-dependent electrophysiological remodeling of the AV node by hydroalcohol extract of Crocus sativus L. (saffron) during experimental atrial fibrillation: the role of endogenous nitric oxide.

    Science.gov (United States)

    Khori, Vahid; Alizadeh, Ali Mohammad; Yazdi, Hamidreza; Rakhshan, Elnaz; Mirabbasi, Abbas; Changizi, Shima; Mazandarani, Masumeh; Nayebpour, Mohsen

    2012-06-01

    The study assessed the hydroalcohol extract effects of Crocus sativus L. (saffron) on (i) the basic and rate-dependent electrophysiological properties of the AV node, (ii) remodeling of the AV node during experimental atrial fibrillation (AF) and (iii) the role of nitric oxide (NO) in the effects of saffron on the AV node. Stimulation protocols in isolated AV node were used to quantify AV nodal recovery, facilitation and fatigue in four groups of rabbits (n = 8-16 per group). In addition, the nodal response to AF was evaluated at multiple cycle lengths and during AF. Saffron had a depressant effect on AV nodal rate-dependent properties; further, it increased Wenckebach block cycle length, functional refractory period, facilitation and fatigue (p saffron on the AV node (p Saffron increased the zone of concealment in experimental AF (p saffron. Saffron increased the AV nodal refractoriness and zone of concealment. These depressant effects of saffron were mediated by endogenous NO. Copyright © 2011 John Wiley & Sons, Ltd.

  6. Integrity of the Ganglionated Plexi Is Essential to Parasympathetic Innervation of the Atrioventricular Node by the Right Vagus Nerve.

    Science.gov (United States)

    Xhaet, Olivier; DE Roy, Luc; Floria, Mariana; Deceuninck, Olivier; Blommaert, Dominique; Dormal, Fabien; Ballant, Elisabeth; LA Meir, Mark

    2017-04-01

    Radiofrequency isolation of pulmonary vein can be accompanied by transient sinus bradycardia or atrioventricular nodal (AVN) block, suggesting an influence on vagal cardiac innervation. However, the importance of the atrial fat pads in relation with the vagal innervation of AVN in humans remains largely unknown. The aim of this study was to evaluate the role of ganglionated plexi (GP) in the innervation of the AVN by the right vagus nerve. Direct epicardial high-frequency stimulation (HFS) of the GP (20 patients) and the right vagus nerve (10 patients) was performed before and after fat pad exclusion or destruction in 20 patients undergoing thoracoscopic epicardial ablation for the treatment of persistent AF. Asystole longer than 3 seconds or acute R-R prolongation over 25% was considered as a positive response to HFS. Prior to the ablation, positive responses to HFS were detected in 3 GPs in 7 patients (35%), 2 GPs in 5 patients (25%), and one GP in 8 patients (40%). After exclusion of the fat pads, all patients had a negative response to HFS. All the patients who exhibited a positive response to right vagus nerve stimulation (n = 10) demonstrated negative responses after the ablation. The integrity of the GP is essential for the right vagus nerve to exert physiological effects of on AVN in humans. © 2016 Wiley Periodicals, Inc.

  7. The retrograde P-wave theory: explaining ST segment depression in supraventricular tachycardia by retrograde AV node conduction.

    Science.gov (United States)

    Rivera, Santiago; De La Paz Ricapito, Maria; Conde, Diego; Verdu, Mariano Badra; Roux, Jean François; Paredes, Félix Ayala

    2014-09-01

    Pseudo ischemic ST segment changes during supraventricular tachycardia (SVT) are not yet fully understood. Our aim was to determine whether venticulo-atrial (VA) conduction during SVT may be a possible mechanism for ST depression (STd) in SVT. Patients undergoing SVT ablation (2010-2012) were analyzed (n = 72).Typical atrioventricular node reentrant tachycardia (AVNRT) and atrioventricular reentrant tachycardia (AVRT) were included. Those with STd were compared to those without STd. VA interval length, tachycardia cycle length (TCL), and retrograde P-wave activation during SVT were assessed. Retrograde P waves arriving simultaneously with the ST segment (PWST) during SVT were considered, whenever an atrial electrogram (measured from the high right atrium) was "on time" with the ST segment. Patients with STd during SVT presented longer VA intervals than those without STd (VA 100 ± 37 ms vs VA 69 ± 22 ms; P = 0.006). No differences in TCL were observed (TCL 333 ± 35 ms vs TCL 360 ± 22 ms; P = 0.1). PWST was observed in 38.5% of patients with AVNRT and STd versus 0% in those without STd. The TCL was similar in both groups (355 ± 25 ms vs 334 ± 18 ms; P = 0.1). In patients with AVRT and STd, PWST was present in 81% of cases versus 0% in those without STd. The TCL was also similar (330 ± 29 ms vs 346 ± 17 ms; P = 0.1). STd during SVT is observed at long VA intervals when the retrograde P wave matches the ST segment, without dependence on the TCL. This suggests that STd is not necessarily rate dependent but a result of a fusion between the ST segment and the P wave. ©2014 Wiley Periodicals, Inc.

  8. Congenital Complete Atrioventricular Block : Clinical and Experimental Studies

    NARCIS (Netherlands)

    Blank, A.C.

    2014-01-01

    Complete atrioventricular block (CAVB) is a cardiac conduction defect wherein the trans¬mission of the normal electrical impulse from the atria to the ventricle is interrupted due to structural or functional impairment of the atrioventricular (AV) conduction system. If CAVB is diagnosed in utero or

  9. Atrioventricular Canal Defect

    Science.gov (United States)

    ... tract infections. Atrioventricular canal defect can cause recurrent bouts of lung infections. Heart failure. Untreated, atrioventricular canal ... Leaky heart valves Narrowing of the heart valves Abnormal heart rhythm Breathing difficulties associated with lung damage ...

  10. Association of temporary complete AV block and junctional ectopic tachycardia after surgery for congenital heart disease.

    Science.gov (United States)

    Paech, Christian; Dähnert, Ingo; Kostelka, Martin; Mende, Meinhardt; Gebauer, Roman

    2015-01-01

    Junctional ectopic tachycardia (JET) is a postoperative complication with a mortality rate of up to 14% after surgery for congenital heart disease. This study evaluated the risk factors of JET and explored the association of postoperative temporary third degree atrioventricular (AV) block and the occurrence of JET. Data were collected retrospectively from 1158 patients who underwent surgery for congenital heart disease. The overall incidence of JET was 2.8%. Temporary third degree AV block occurred in 1.6% of cases. Permanent third degree AV block requiring pacemaker implantation occurred in 1% of cases. In all, 56% of patients with JET had temporary AV block (P < 0.001), whereas no case of postoperative JET was reported in patients with permanent AV block (P = 0.56). temporary third degree AV block did not suffer from JET. A correlation between temporary third degree AV block and postoperative JET could be observed. The risk factors identified for JET include younger age groups at the time of surgery, longer aortic cross clamping time and surgical procedures in proximity to the AV node.

  11. Association of temporary complete AV block and junctional ectopic tachycardia after surgery for congenital heart disease

    Directory of Open Access Journals (Sweden)

    Christian Paech

    2015-01-01

    Full Text Available Aim: Junctional ectopic tachycardia (JET is a postoperative complication with a mortality rate of up to 14% after surgery for congenital heart disease. This study evaluated the risk factors of JET and explored the association of postoperative temporary third degree atrioventricular (AV block and the occurrence of JET. Materials and Methods: Data were collected retrospectively from 1158 patients who underwent surgery for congenital heart disease. Results: The overall incidence of JET was 2.8%. Temporary third degree AV block occurred in 1.6% of cases. Permanent third degree AV block requiring pacemaker implantation occurred in 1% of cases. In all, 56% of patients with JET had temporary AV block (P < 0.001, whereas no case of postoperative JET was reported in patients with permanent AV block (P = 0.56. temporary third degree AV block did not suffer from JET. Conclusions: A correlation between temporary third degree AV block and postoperative JET could be observed. The risk factors identified for JET include younger age groups at the time of surgery, longer aortic cross clamping time and surgical procedures in proximity to the AV node.

  12. Optimal pacing for symptomatic AV block: a comparison of VDD and DDD pacing.

    Science.gov (United States)

    Huang, Max; Krahn, Andrew D; Yee, Raymond; Klein, George J; Skanes, Allan C

    2004-01-01

    VDD pacing provides the physiological benefits of atrioventricular synchronous pacing with the convenience of a single lead system, but is hampered by uncertainty regarding long term atrial sensing and potential development of sinus node disease. To examine the long-term reliability and complication rates of VDD pacing, we compared the outcome of 112 consecutive patients (age 70 +/- 13 years, 59% men) with symptomatic AV block who received a single pass bipolar VDD system, to 80 patients (age 63 +/- 16 years, 70% men) who received DDD pacing for the same indication. All patients were judged to have intact sinus node function based on submitted ECGs and monitoring results at the time of implant. Implant time was reduced in VDD patients compared to DDD patients (63 +/- 20 vs 97 +/- 36 minutes, P DDD patients compared to 3 (3%) VDD patients (P = 0.15). The implant P wave was lower with VDD pacing compared to DDD patients (2.91 +/- 1.48 vs 4.0 +/- 1.7 mv, P DDD patients. Physiological atrioventricular activation was maintained in 94%-99% of beats throughout the follow-up period in the VDD group. VDD pacing is an excellent strategy for treatment of patients with symptomatic AV block. The lower cost, high reliability, and abbreviated implantation time suggest that VDD pacing is a viable alternative to DDD pacing in patients with high degree AV block and normal sinus node function.

  13. Modeling the influence of the VV delay for CRT on the electrical activation patterns in absence of conduction through the AV node

    Science.gov (United States)

    Romero, D. A.; Sebastián, Rafael; Plank, Gernot; Vigmond, Edward J.; Frangi, Alejandro F.

    2008-03-01

    From epidemiological studies, it has been shown that 0.2% of men and 0.1% of women suffer from a degree of atrioventricular (AV) block. In recent years, the palliative treatment for third degree AV block has included Cardiac Resynchronization Therapy (CRT). It was found that patients show more clinical improvement in the long term with CRT compared with single chamber devices. Still, an important group of patients does not improve their hemodynamic function as much as could be expected. A better understanding of the basis for optimizing the devices settings (among which the VV delay) will help to increase the number of responders. In this work, a finite element model of the left and right ventricles was generated using an atlas-based approach for their segmentation, which includes fiber orientation. The electrical activity was simulated with the electrophysiological solver CARP, using the Ten Tusscher et al. ionic model for the myocardium, and the DiFrancesco-Noble for Purkinje fibers. The model is representative of a patient without dilated or ischemic cardiomyopathy. The simulation results were analyzed for total activation times and latest activated regions at different VV delays and pre-activations (RV pre-activated, LV pre-activated). To optimize the solution, simulations are compared against the His-Purkinje network activation (normal physiological conduction), and interventricular septum activation (as collision point for the two wave fronts). The results were analyzed using Pearson's coefficient of correlation for point to point comparisons between simulation cases. The results of this study contribute to gain insight on the VV delay and how its adjustment might influence response to CRT and how it can be used to optimize the treatment.

  14. Dual Atrioventricular Nodal Pathways Physiology: A Review of Relevant Anatomy, Electrophysiology, and Electrocardiographic Manifestations

    OpenAIRE

    Mani, Bhalaghuru Chokkalingam; Pavri, Behzad B.

    2014-01-01

    More than half a century has passed since the concept of dual atrioventricular (AV) nodal pathways physiology was conceived. Dual AV nodal pathways have been shown to be responsible for many clinical arrhythmia syndromes, most notably AV nodal reentrant tachycardia. Although there has been a considerable amount of research on this topic, the subject of dual AV nodal pathways physiology remains heavily debated and discussed. Despite advances in understanding arrhythmia mechanisms and the wides...

  15. Alk3 mediated Bmp signaling controls the contribution of epicardially derived cells to the tissues of the atrioventricular junction

    NARCIS (Netherlands)

    Lockhart, Marie M.; Boukens, Bastiaan J. D.; Phelps, Aimee L.; Brown, Christina-Lin M.; Toomer, Katelynn A.; Burns, Tara A.; Mukherjee, Rupak D.; Norris, Russell A.; Trusk, Thomas C.; van den Hoff, Maurice J. B.; Wessels, Andy

    2014-01-01

    Recent studies using mouse models for cell fate tracing of epicardial derived cells (EPDCs) have demonstrated that at the atrioventricular (AV) junction EPDCs contribute to the mesenchyme of the AV sulcus, the annulus fibrosus, and the parietal leaflets of the AV valves. There is little insight,

  16. Occult etiologies of complete atrioventricular block: Report of two cases

    Directory of Open Access Journals (Sweden)

    Neeta Bachani

    2016-09-01

    Full Text Available In patients presenting with complete atrioventricular (AV block, the common causes are degeneration of the conduction system, acute myocardial infarction, congenital and metabolic disorders (such as azotemia. However, at times, no cause can be ascribed and the label congenital or degenerative is applied depending on the patient's age and the QRS complex width. We present two cases of patients with complete AV block, who were subsequently found to have rare etiologies – sarcoidosis (with isolated feature of AV block and non-Hodgkin's lymphoma.

  17. Development of the cardiac conduction system in atrioventricular septal defect in human trisomy 21

    NARCIS (Netherlands)

    Blom, Nico A.; Ottenkamp, Jaap; Deruiter, Marco C.; Wenink, Arnold C. G.; Gittenberger-de Groot, Adriana C.

    2005-01-01

    In patients with atrioventricular septal defect (AVSD), the occurrence of nonsurgical AV block has been reported. We have looked for an explanation in the development of the AV conduction system. Human embryos with AVSD and trisomy 21 and normal embryos were examined (age 5-16 wk gestation).

  18. Non-physiological increase of AV conduction time in sinus disease patients programmed in AAIR-based pacing mode.

    Science.gov (United States)

    Mabo, Philippe; Cebron, Jean-Pierre; Solnon, Aude; Tassin, Aude; Graindorge, Laurence; Gras, Daniel

    2012-11-01

    The EVOCAV(DS) trial aimed to quantify the paradoxal atrioventricular (AV) conduction time lengthening in sinus node (SD) patients (pts) paced in AAIR-based pacing mode. SD pts, implanted with dual-chamber pacemaker programmed in AAIR-based pacing mode, were randomized in two arms for a 1-month period: the low atrial pacing (LAP; basic rate at 60 bpm, dual sensor with minimal slope) and the high atrial pacing (HAP; basic rate at 70 bpm, dual sensor with optimized slope, overdrive pacing) arm. At 1 month, crossover was performed for an additional 1-month period. AV conduction time, AV block occurrence and AV conduction time adaptation during exercise were ascertained from device memories at each follow-up. Seventy-nine pts participated to the analysis (75 ± 8 years; 32 male; PR = 184 ± 38 ms; bundle branch block n = 12; AF history n = 36; antiarrhythmic treatment n = 53; beta-blockers n = 27; class III/Ic n = 18; both n = 8). The mean AV conduction time was significantly greater during the HAP (275 ± 51 ms) vs. LAP (263 ± 49 ms) period (p AAIR-based pacing in SD pts may induce a significant lengthening of pts' AV conduction time, including frequent abnormal adaptation of AV conduction time during exercise.

  19. 59. Early and late results of routine leaflet augmentation for complete atrio-ventricular septal defect repair

    OpenAIRE

    A. Arifi; Najm, H; Khan, A.; Ahmad, M; Khan, M A; M. Elanany

    2016-01-01

    Complete AVSD (CAVSD) is characterized by the presence of a common atrio-ventricular (AV) orifice, an inter-atrial communication, and a ventricular septal defect (VSD). Results of surgical correction of atrio-ventricular septal defects (AVSDs) have improved over the last decades; however, the need for reoperation for left atrio-ventricular valve regurgitation, after primary AVSD repair remains a major concern. The aim of our study is to assess the outcome of the routine leaflet augmentation t...

  20. Effects of beta-blockade on atrial and atrioventricular nodal refractoriness, and atrial fibrillatory rate during atrial fibrillation in pigs

    NARCIS (Netherlands)

    van den Berg, MP; van de Ven, LLM; Witting, W; Crijns, JGM; Haaksma, J; Bel, KJ; de Langen, CDJ; Lie, KI

    1997-01-01

    Despite their widespread use in atrial fibrillation, the effects of beta-adrenoceptor blockers on atrial and atrioventricular (AV) nodal refractoriness, and atrial fibrillatory rate during atrial fibrillation have been incompletely characterised. In particular, it is unknown whether additional

  1. Assessment of atrioventricular conduction following cryoablation of atrioventricular nodal reentrant tachycardia in children.

    Science.gov (United States)

    Kiplapinar, Neslihan; Ergul, Yakup; Akdeniz, Celal; Saygi, Murat; Ozyilmaz, Isa; Gul, Enes E; Tuzcu, Volkan

    2014-06-01

    Early-onset transient atrioventricular block (AVB) is a rare occurrence following cryoablation of atrioventricular nodal reentrant tachycardia (AVNRT), despite lack of any AVB at the end of the procedure. The purpose of this prospective study was to assess AVB shortly after successful cryoablation of AVNRT in children. A 6-mm-tip cryocatheter was used in 39 procedures. An 8-mm-tip catheter was used in 11 procedures. Twelve-lead electrocardiograms (ECGs) and 24-hour ambulatory ECGs were performed 24 hours prior to the procedure and immediately following the procedure. All procedures were done using the EnSite system (St. Jude Medical, St. Paul, MN, USA) without fluoroscopy. Although nine (18%) patients developed variable degrees of transient AVB during the procedure, all of them had normal atrioventricular (AV) conduction at the end of the procedure and did not require any intervention. Four of these patients had variable degrees of transient AVB following the procedure despite having normal AV conduction at the end of the procedure. One developed Mobitz type I AVB, which lasted for 11.5 hours, and the other three experienced 2:1 AVB, which lasted for 2, 8, and 24 hours, respectively. All patients had complete resolution of the AVB, which was also documented with the 24-hour ambulatory ECGs after the procedure. Early transient AVB can develop following AVNRT cryoablation even if AV conduction is normal at the end of the procedure. Despite the transient AVB in the initial 24 hours after the procedure in some cases, there is no evidence for ongoing AV nodal dysfunction. ©2014 Wiley Periodicals, Inc.

  2. Complete atrioventricular canal

    Directory of Open Access Journals (Sweden)

    Limongelli Giuseppe

    2006-04-01

    Full Text Available Abstract Complete atrioventricular canal (CAVC, also referred to as complete atrioventricular septal defect, is characterised by an ostium primum atrial septal defect, a common atrioventricular valve and a variable deficiency of the ventricular septum inflow. CAVC is an uncommon congenital heart disease, accounting for about 3% of cardiac malformations. Atrioventricular canal occurs in two out of every 10,000 live births. Both sexes are equally affected and a striking association with Down syndrome was found. Depending on the morphology of the superior leaflet of the common atrioventricular valve, 3 types of CAVC have been delineated (type A, B and C, according to Rastelli's classification. CAVC results in a significant interatrial and interventricular systemic-to-pulmonary shunt, thus inducing right ventricular pressure and volume overload and pulmonary hypertension. It becomes symptomatic in infancy due to congestive heart failure and failure to thrive. Diagnosis of CAVC might be suspected from electrocardiographic and chest X-ray findings. Echocardiography confirms it and gives anatomical details. Over time, pulmonary hypertension becomes irreversible, thus precluding the surgical therapy. This is the reason why cardiac catheterisation is not mandatory in infants (less than 6 months but is indicated in older patients if irreversible pulmonary hypertension is suspected. Medical treatment (digitalis, diuretics, vasodilators plays a role only as a bridge toward surgery, usually performed between the 3rd and 6th month of life.

  3. Rapidly Progressive Atrioventricular Block in a Patient with Sarcoidosis

    Directory of Open Access Journals (Sweden)

    Nagham Saeed Jafar

    2014-01-01

    Full Text Available Cardiac sarcoidosis is a major cause of death in patients with systemic sarcoidosis. Cardiac manifestations are seen in 2.3% of the patients. Atrioventricular (AV block is one of the common manifestations of cardiac sarcoidosis. Other presentations of cardiac involvement include congestive heart failure, ventricular arrhythmias, and sudden cardiac death. The presence of AV block in young patients should raise the suspicion of sarcoidosis. AV block may be the only manifestation and patients may not have clinical evidence of pulmonary involvement. Here we describe a young male presented with exercise induced AV block rapidly progressing to complete heart block with recurrent syncope needing urgent pacemaker implantation. Factors that suggested an infiltrative process included his young age, rapidly progressive conduction abnormalities in the ECG in the absence of coronary disease, and previous history of cutaneous sarcoidosis.

  4. Safety and efficiency of ventricular pacing prevention with an AAI-DDD changeover mode in patients with sinus node disease or atrioventricular block: impact on battery longevity-a sub-study of the ANSWER trial.

    Science.gov (United States)

    Stockburger, Martin; Defaye, Pascal; Boveda, Serge; Stancak, Branislav; Lazarus, Arnaud; Sipötz, Johann; Nardi, Stefano; Rolando, Mara; Moreno, Javier

    2016-05-01

    This ANSWER (EvaluAtioN of the SafeR mode in patients With a dual chambER pacemaker indication) sub-study assesses safety and effectiveness of SafeR™ and the impact of ventricular pacing (VP) prevention on anticipated device longevity and replacement rate. Patients implanted for atrioventricular block (AVB, n = 310) or sinus node dysfunction (SND, n = 336) were randomly assigned to SafeR (n = 314) or DDD (n = 318) and followed for 36 months. Safety, median VP, estimated device longevity (mean difference, 95% confidence interval [CI]), and anticipated replacement rates were analysed by pacing mode and implant indication. No difference in mortality, syncope, or mode intolerance was observed between randomization groups regardless of the indication. Ventricular pacing on SafeR vs. DDD was 11.5 vs. 93.6% in the overall population (P < 0.001), 89.2 vs. 83.8% in permanent AVB (P = 0.944), 53.5 vs. 98.2% in intermittent AVB (P < 0.001), and 2.2 vs. 84.7% in SND (P < 0.001). Anticipated median device longevity increased on SafeR by 14 [Q1 10; Q3 17] months [10; 17] (P < 0.001) in the overall population, 9 months [-5; 22] (P = 0.193) in permanent AVB, 14 months [8; 19] (P < 0.001) in intermittent AVB, and 14 months [9; 19] (P < 0.001) in SND. In intermittent AVB and SND, prolonged estimated battery longevity translated into the prevention of one anticipated replacement in at least 23% of patients. SafeR was effective in reducing VP in intermittent AVB and in SND. No effect was observed in permanent AVB. No safety issue was observed. Ventricular pacing reduction by SafeR translated into relevant estimated prolongation of device longevity and anticipated reduction of required replacements. Published on behalf of the European Society of Cardiology. All rights reserved. © The Author 2015. For permissions please email: journals.permissions@oup.com.

  5. Case of Wenckebach-type atrioventricular block caused by administration of indigo carmine.

    Science.gov (United States)

    Takeyama, Kazuhide; Sakamoto, Reinii; Yoshikawa, Masanobu; Suzuki, Toshiyasu

    2014-03-20

    We report a case of first-degree atrioventricular (A-V) block progressing to second-degree (Wenckebach-type) A-V block after administration of indigo carmine in a patient undergoing hysterectomy under general anesthesia. We believe that the onset of Wenckebach-type A-V block may have been induced by one or more of three factors: 1) preoperative first-degree A-V block, 2) the anesthetics used (propofol and remifentanil), and 3) administration of indigo carmine.

  6. Pathology of complete atrioventricular block in chronic chagas' myocarditis

    Directory of Open Access Journals (Sweden)

    Zilton A. Andrade

    1988-03-01

    Full Text Available Sclero-atrophy, fibrosis, vascular ectasia, phlebosclerosis and mild non-specific chronic inflammatory changes were observed in variable location and proportion involving the atrioventricular conducting tissue of the heart in five human cases of chronic Chagas' myocarditis associated with complete atrioventricular block. One case presented complete destruction of the A-V conduction system. In three cases the lesions were disseminated all along the conducting tissue but did not cause anywhere a complete disruption in the continuity of the system. The distal portion of the bundle branches were the most damaged sector of the system, exceptfor the fasciculi of the posterior division of the left bundle branch which were relatively preserved. One case exhibited bilateral sclero-atrophy of the bundle branches as the main change; and another showed early and mild fibrocalcific damage of the penetrating portion of the His bundle. The A-V node appeared as the least involved part of the conducting system in the cases studied. Demonstration of the lesions in this series of cases seems important because: a it reveals that complete atrioventriculr block in chronic Chagas' disease results from disseminated lesions and not from focal disruptive change as has been commonly observed in cases of other etiologies; b it shows that chronic inflammation can produce at the end variable and widespread vascular, degenerative andfibrotic alterations within the conducting tissue of the heart, which may lead to its total destruction.O estudo do sistema de condução atrioventricular através cortes seriados completos em cinco casos humanos de miocardite crônica chagásica e bloqueio A-V total revelou a presença de lesões de esclero-atrofia, fibrose, ectasia vascular, fleboesclerose e inflamação crônica inespeclfica envolvendo o sistema de maneira disseminada, mas com distribuição e intensidade variáveis de caso para caso. Em um caso, todo o sistema, do nódulo A-V

  7. Brucella Infection Associated with Complete Atrioventricular Block.

    Science.gov (United States)

    Bilici, Meki; Demir, Fikri; Yılmazer, Murat Muhtar; Bozkurt, Fatma; Tuzcu, Volkan

    2016-09-01

    The clinical spectrum of Brucella infection is quite diverse and characterized by multi-system involvement. Patients present with myocarditis, endocarditis, or pericarditis. Infective endocarditis is the most common cardiovascular complication in patients with brucellosis. Although conduction abnormalities are seen in cases with endocarditis, they are reported very rarely in the setting of cardiac Brucella infection. An eight and a half-year-old male patient was referred to our clinic due to inadequate response to cotrimaxazole plus streptomycin treatment at the 15th day of admission. Although local hospital records on the patient showed a heart rate of 80 bpm, we determined a heart rate of 46 bpm. The electrocardiogram showed complete atrioventricular (AV) block. The average heart rate was determined as 48 bpm with 24-hour Holter electrocardiogram (ECG) monitoring. The echocardiographic examination showed normal-sized heart chambers and the absence of valvular involvement. An agglutination test for brucellosis was found to be positive with a titer of 1/320. High fever, arthralgia, and splenomegaly regressed following doxycycline plus rifampicin therapy, but there was no improvement in the AV block. A permanent pacemaker was implanted because of the detection of an average heart rate of 48 bpm. Because cardiac failure and rhythm abnormalities are reported in the course of Brucella infection and may be associated with significant outcomes, cases with brucellosis should be evaluated carefully in terms of cardiac involvement. This report aims to draw attention to complete AV block as an extremely rare complication of Brucella infection.

  8. Selective slow pathway ablation does not alter enhancement of vagal tone on sinus and atrioventricular nodal function.

    Science.gov (United States)

    Olsovsky, M R; Belz, M K; Stambler, B S; Gilligan, D M; Wood, M A; Ellenbogen, K A

    1996-12-01

    We studied the effects of edrophonium on sinus cycle length, atrioventricular (AV) nodal fast pathway refractoriness, and AV nodal Wenckebach cycle length in 21 patients with AV nodal reentrant tachycardia (AVNRT) who received edrophonium, and 8 patients who received phenylephrine before and after selective slow pathway ablation. Changes in sinus cycle length, fast pathway conduction, and refractoriness were not altered by radiofrequency ablation of the slow pathway, suggesting that parasympathetic denervation does not occur after slow pathway ablation of AVNRT.

  9. Ion channel transcript expression at the rabbit atrioventricular conduction axis.

    Science.gov (United States)

    Greener, Ian D; Tellez, James O; Dobrzynski, Halina; Yamamoto, Mitsuru; Graham, Gillian M; Billeter, Rudi; Boyett, Mark R

    2009-06-01

    Little is known about the distribution of gap junctions and ion channels in the atrioventricular node, even though the physiology and pathology of the atrioventricular node is ultimately dependent on them. The abundance of 30 transcripts for markers, gap junctions, ion channels, and Ca(2+)-handling proteins in different regions of the rabbit atrioventricular node (nodal extension and proximal and distal penetrating bundle of His as well as atrial and ventricular muscle) was measured using a novel quantitative polymerase chain reaction technique and in situ hybridization. The expression profile of the nodal extension (slow pathway into penetrating bundle) was similar to that of the sinoatrial node. For example, in the nodal extension, in contrast to the atrial muscle and as expected for a slowly conducting tissue with pacemaker activity, there was no or reduced expression of Cx43, Na(v)1.5, Ca(v)1.2, K(v)1.4, KChIP2, and RYR3 and high expression of Ca(v)1.3 and HCN4. The expression profile of the penetrating bundle was less specialized. In situ hybridization revealed a transitional zone with reduced expression of Cx43, Na(v)1.5, and KChIP2 that may form the fast pathway into the penetrating bundle. At the atrioventricular node, the expression of gap junctions and ion channels in the nodal extension (slow pathway) and a transitional zone (putative fast pathway) as well as the penetrating bundle (output pathway) is specialized and heterogeneous and roughly matches the electrophysiology of the different regions.

  10. Reversing the direction of paced ventricular and atrial wavefronts reveals an oblique course in accessory AV pathways and improves localization for catheter ablation

    NARCIS (Netherlands)

    Otomo, K.; Gonzalez, M. D.; Beckman, K. J.; Nakagawa, H.; Becker, A. E.; Shah, N.; Matsudaira, K.; Wang, Z.; Lazzara, R.; Jackman, W. M.

    2001-01-01

    The purpose of this study was to determine how often accessory atrioventricular (AV) pathways (AP) cross the AV groove obliquely. With an oblique course, the local ventriculoatrial (VA) interval at the site of earliest atrial activation (local-VA) and the local-AV interval at the site of earliest

  11. Origem das artérias dos nós sinoatrial e atrioventricular em população do sul da Índia: um estudo angiográfico Origen de las arterias de los nódulos sinusal y atrioventricular en población del Sur de la India: un estudio angiográfico Origin of the sinoatrial and atrioventricular nodal arteries in South Indians: an angiographic study

    Directory of Open Access Journals (Sweden)

    Lakshmi Ramanathan

    2009-05-01

    the arterial dominance. RESULTS: The SA (sinoatrial node was supplied by the right coronary artery (RCA in 53% of the cases, by the circumflex (Cx branch of left coronary artery (LCA in 42.66%, and by both coronary arteries in 4.33% of cases. The AV (atrioventricular node was also more often supplied by the RCA (72.33% of cases than by the Cx branch of the LCA (27.66%, and surprisingly in none of the cases was this node supplied by both coronary arteries. CONCLUSION: The results of the present study may help cardiac surgeons, particularly in surgeries related to certain valvular disorders, due to the proximity of the nodal branches to the valve complex.

  12. LATE ONSET ATRIOVENTRICULAR NODAL TACHYCARDIA

    NARCIS (Netherlands)

    PENTINGA, ML; MEEDER, JG; CRIJNS, HJGM; DEMUINCK, ED; WIESFELD, ACP; LIE, KI

    AV nodal tachycardia may present at any age, but onset in late adulthood is considered uncommon. To evaluate whether onset of AV nodal tachycardias at older age is related to organic heart disease (possibly setting the stage for re-entry due to degenerative structural changes) 32 consecutive

  13. Atrioventricular valve abnormalities in infancy: two-dimensional echocardiographic and angiocardiographic comparison.

    Science.gov (United States)

    Gutgesell, H P; Cheatham, J; Latson, L A; Nihill, M R; Mullins, C E

    1983-09-01

    The results of two-dimensional echocardiography and biplane angiocardiography from 47 infants with congenital atrioventricular (AV) valve abnormalities were compared. Eleven patients had atresia of the right AV valve, 10 had atresia of the left AV valve, 4 had hypoplasia of the right AV valve and 5 had hypoplasia of the left AV valve. Twelve patients had endocardial cushion defect, three had single ventricle and two had straddling of the left AV valve. There was agreement between the two techniques as to the number of AV valves present in each patient. The echocardiographic estimate of valve anular diameter was below normal in seven of the eight patients thought to have a hypoplastic anulus by angiocardiography. In 10 of the 12 patients with endocardial cushion defect, there was agreement between the two techniques as to the presence or absence of atrial and ventricular septal defect. The chordal attachments of straddling valves were better visualized by echocardiography; flow patterns and effective orifice size were better demonstrated by angiocardiography. The subcostal four chamber echocardiographic views and cranially angulated oblique angiocardiographic views were comparable and provided the best images for determination of the size and number of AV valves and their relation to the atrial and ventricular septa.

  14. A case of advanced second-degree atrioventricular block in a ferret secondary to lymphoma

    OpenAIRE

    Menicagli, F.; Lanza, A; F. Sbrocca; Baldi, A.; Spugnini, E.P.

    2016-01-01

    A female ferret was referred as an emergency for severe respiratory distress symptoms. At presentation, the patient was listlessness, dyspnoeic, and hyper-responsive. The clinical examination evidenced dyspnea with cyanosis, altered cardiac rhythm, and hepatomegaly. Electrocardiography showed an advanced second-degree atrioventricular (AV) block. The liver aspirate was diagnostic for lymphoma. The patient did not respond to supportive therapy and rapidly died. Post-mortem exams confirmed the ...

  15. Reversible Atrioventricular Block and Junctional Ectopic Tachycardia in Coxsackievirus B3-Induced Fetal–Neonatal Myocarditis without Left Ventricular Dysfunction

    Directory of Open Access Journals (Sweden)

    Hironori Takahashi

    2011-09-01

    Full Text Available We present a case of fetal–neonatal acute myocarditis caused by coxsackievirus B3 infection in a term neonate. The condition manifested as high-grade atrioventricular (A-V block prenatally. After delivery, various arrhythmias such as high-grade A-V block, ventricular tachycardia, and junctional ectopic tachycardia appeared, and we had difficulty managing these arrhythmias. This is the first report describing a case of acute myocarditis due to coxsackievirus infection presenting with fetal A-V block. This case is also unique in that it is extremely rare that various arrhythmias occur serially in one patient without left ventricular dysfunction.

  16. Occurrence of atrioventricular block during supraventricular tachycardia: What is its possible mechanism?

    Directory of Open Access Journals (Sweden)

    Ho-Shun Cheng

    2014-02-01

    Full Text Available A female patient was admitted to our hospital for catheter ablation arising from paroxysmal supraventricular tachycardia (PSVT. In the laboratory, PSVT (the earliest retrograde atrial activation at the coronary sinus ostium with intermittent atrioventricular (AV block could be induced repeatedly. The tachycardia could be terminated during ventricular pacing without retrograde conduction to the atria. Therefore, orthodromic AV reciprocating tachycardia (AVRT and atrial tachycardia (AT could be ruled out and AV nodal re-entrant tachycardia (AVNRT was subsequently considered. Initial attempts using slow or intermediate AV nodal ablation failed to cure the tachycardia. We considered the possibility of orthodromic AV reciprocating tachycardia (AVRT with AV block occurring during the tachycardia. The tachycardia was successfully terminated during the ablation of the right posteroseptal pathway at the coronary sinus ostium. We hypothesized about the possible explanation that might help to clarify the phenomenon of AV block during SVT in order to provide some guidance to other clinicians confronted with similar patient challenges in the future.

  17. Anatomy of the human atrioventricular junctions revisited

    NARCIS (Netherlands)

    Anderson, R. H.; Ho, S. Y.; Becker, A. E.

    2000-01-01

    There have been suggestions made recently that our understanding of the atrioventricular junctions of the heart is less than adequate, with claims for several new findings concerning the arrangement of the ordinary working myocardium and the specialised pathways for atrioventricular conduction. In

  18. His-Bundle Pacing for Identifying Optimal Ablation Sites in Patients Undergoing Atrioventricular Junction Ablation: Teaching an Old Dog a New Trick.

    Science.gov (United States)

    Kulkarni, Nitin; Moore, Curtiss; Pandey, Ambarish; Castillo, Demetrio; Ayers, Colby; Joglar, Jose; Wu, Richard

    2017-03-01

    Atrioventricular (AV) junction (AVJ) ablation is conventionally performed by localizing the His-bundle electrogram (HBE). Identification of HBE in the presence of atrial fibrillation (AF) can be difficult, and can make this simple procedure challenging. In this study, we describe our experience with an alternative approach to localize optimal ablation sites using His-bundle pacing (HBP). Between 1/1/2014 and 12/31/2015, we performed 13 AVJ ablations using the standard electrogram-guided approach and 11 ablations using HBP. All cases utilized a long femoral guiding sheath and an 8-mm-tip electrode radiofrequency (RF) energy ablation catheter. Pacing was performed at high output (10 mA at 2 ms) to initially achieve right bundle branch capture. The catheter was withdrawn until a narrow QRS morphology and increased stim-to-QRS time were observed. HBP was confirmed when paced and native QRS were identical in morphology. RF energy was applied at the site of HBP capture until AV block was observed. Baseline characteristics of patients in each arm were not significantly different. Compared with the standard approach, HBP was associated with trends toward lower RF applications (3 vs. 2, P = 0.16) and shorter mean RF time (208 seconds vs. 128 seconds, P = 0.19). HBP is an effective technique to identify optimal ablation sites during AVJ ablation and may shorten procedure time. HBP can be used to identify the AV node during AF without recording the His potential. Future studies with larger sample size are needed to better characterize the utility of this technique. © 2017 Wiley Periodicals, Inc.

  19. Canonical Wnt Signaling Regulates Atrioventricular Junction Programming and Electrophysiological Properties

    Science.gov (United States)

    Gillers, Benjamin S; Chiplunkar, Aditi; Aly, Haytham; Valenta, Tomas; Basler, Konrad; Christoffels, Vincent M.; Efimov, Igor R; Boukens, Bastiaan J; Rentschler, Stacey

    2014-01-01

    Rationale Proper patterning of the atrioventricular canal (AVC) is essential for delay of electrical impulses between atria and ventricles, and defects in AVC maturation can result in congenital heart disease. Objective To determine the role of canonical Wnt signaling in the myocardium during AVC development. Methods and Results We utilized a novel allele of β-catenin that preserves β-catenin’s cell adhesive functions but disrupts canonical Wnt signaling, allowing us to probe the effects of Wnt loss of function independently. We show that loss of canonical Wnt signaling in the myocardium results in tricuspid atresia with hypoplastic right ventricle associated with loss of AVC myocardium. In contrast, ectopic activation of Wnt signaling was sufficient to induce formation of ectopic AV junction-like tissue as assessed by morphology, gene expression, and electrophysiologic criteria. Aberrant AVC development can lead to ventricular preexcitation, a characteristic feature of Wolff-Parkinson-White syndrome. We demonstrate that postnatal activation of Notch signaling downregulates canonical Wnt targets within the AV junction. Stabilization of β-catenin protein levels can rescue Notch-mediated ventricular preexcitation and dysregulated ion channel gene expression. Conclusions Our data demonstrate that myocardial canonical Wnt signaling is an important regulator of AVC maturation and electrical programming upstream of Tbx3. Our data further suggests that ventricular preexcitation may require both morphologic patterning defects, as well as myocardial lineage reprogramming, to allow robust conduction across accessory pathway tissue. PMID:25599332

  20. Bochdalek Hernia As A Cause Of Intermittent AV Block.

    Science.gov (United States)

    Etsadashvili, Kakhaber; Rashid, Haroon Mohammed; Jalabadze, Khatuna; Melia, Anzor

    2011-09-01

    Congenital diaphragmatic hernia is very rare cause of AV block. We report such a patient with sick sinus node syndrome and previous AAIR pacemaker implantation, in which intermittent AV block was diagnosed by 24-hours ECG monitoring and upgrade of pacing system to DDDR was suggested.

  1. A 2:1 AV rhythm: an adverse effect of a long AV delay during DDI pacing and its prevention by the ventricular intrinsic preference algorithm in DDD mode.

    Science.gov (United States)

    Minamiguchi, Hitoshi; Oginosawa, Yasushi; Kohno, Ritsuko; Tamura, Masahito; Takeuchi, Masaaki; Otsuji, Yutaka; Abe, Haruhiko

    2012-07-01

    A 91-year-old woman received a dual-chamber pacemaker for sick sinus syndrome and intermittently abnormal atrioventricular (AV) conduction. The pacemaker was set in DDI mode with a 350-ms AV delay to preserve intrinsic ventricular activity. She complained of palpitation during AV sequential pacing. The electrocardiogram showed a 2:1 AV rhythm from 1:1 ventriculoatrial (VA) conduction during ventricular pacing in DDI mode with a long AV interval. After reprogramming of the pacemaker in DDD mode with a 250-ms AV interval and additional 100-ms prolongation of the AV interval by the ventricular intrinsic preference function, VA conduction disappeared and the patient's symptom were alleviated without increasing unnecessary right ventricular pacing. ©2011, The Authors. Journal compilation ©2011 Wiley Periodicals, Inc.

  2. Atrioventricular Septal Defect with Common Atrioventricular Junction Guarded by a Common Valve Consisting of Left Atrioventricular Trifoliate Valve

    Science.gov (United States)

    Krasniqi, Xhevdet; Gashi, Masar; Berisha, Blerim; Pllana, Ejup; Bakalli, Aurora; Abazi, Flora; Koçinaj, Dardan

    2013-01-01

    Introduction: Atrioventricular septal defect with common atrioventricular junction is a rare adult congenital cardiac syndrome. This occurrence with prolonged survival is exceptionally rare. Case report: We present the case of a patient who presented with this defect with common atrioventricular junction who survived to the age of 32. We describe a 32-year-old man with atrioventricular septal defect with common atrioventricular junction guarded by a common valve. His history, clinical course, and anatomic findings are discussed along with the factors which may have contributed to his longevity, which is unique in the medical literature. His management reflected the state of medical knowledge at the time when he presented, and although alternate approaches may have been utilized if the patient presented today. We discuss the findings, frequency, classifi cation, and management of congenital defects. Development of embryonic structure is altered by interaction between genetics and environmental factors toward a rare associated of congenital cardiac defects-complex congenital heart disease. Conclusion: This case demonstrates that patients with very complex congenital cardiac disease may survive to adulthood, presenting challenges in both medical and surgical treatment. PMID:24554809

  3. Atrioventricular septal defect with common atrioventricular junction guarded by a common valve consisting of left atrioventricular trifoliate valve.

    Science.gov (United States)

    Krasniqi, Xhevdet; Gashi, Masar; Berisha, Blerim; Pllana, Ejup; Bakalli, Aurora; Abazi, Flora; Koçinaj, Dardan

    2013-12-01

    Atrioventricular septal defect with common atrioventricular junction is a rare adult congenital cardiac syndrome. This occurrence with prolonged survival is exceptionally rare. We present the case of a patient who presented with this defect with common atrioventricular junction who survived to the age of 32. We describe a 32-year-old man with atrioventricular septal defect with common atrioventricular junction guarded by a common valve. His history, clinical course, and anatomic findings are discussed along with the factors which may have contributed to his longevity, which is unique in the medical literature. His management reflected the state of medical knowledge at the time when he presented, and although alternate approaches may have been utilized if the patient presented today. We discuss the findings, frequency, classifi cation, and management of congenital defects. Development of embryonic structure is altered by interaction between genetics and environmental factors toward a rare associated of congenital cardiac defects-complex congenital heart disease. This case demonstrates that patients with very complex congenital cardiac disease may survive to adulthood, presenting challenges in both medical and surgical treatment.

  4. Reversibility of High-Grade Atrioventricular Block with Revascularization in Coronary Artery Disease without Infarction: A Literature Review

    Directory of Open Access Journals (Sweden)

    Rhanderson Cardoso

    2016-01-01

    Full Text Available Complete atrioventricular (AV block is known to be reversible in some cases of acute inferior wall myocardial infarction (MI. The reversibility of high-grade AV block in non-MI coronary artery disease (CAD, however, is rarely described in the literature. Herein we perform a literature review to assess what is known about the reversibility of high-grade AV block after right coronary artery revascularization in CAD patients who present without an acute MI. To illustrate this phenomenon we describe a case of 2 : 1 AV block associated with unstable angina, in which revascularization resulted in immediate and durable restoration of 1 : 1 AV conduction, thereby obviating the need for permanent pacemaker implantation. The literature review suggests two possible explanations: a vagally mediated response or a mechanism dependent on conduction system ischemia. Due to the limited understanding of AV block reversibility following revascularization in non-acute MI presentations, it remains difficult to reliably predict which patients presenting with high-grade AV block in the absence of MI may have the potential to avoid permanent pacemaker implantation via coronary revascularization. We thus offer this review as a potential starting point for the approach to such patients.

  5. Factors associated with moderate or severe left atrioventricular valve regurgitation within 30 days of repair of complete atrioventricular septal defect

    Directory of Open Access Journals (Sweden)

    Marcelo Felipe Kozak

    2015-09-01

    Full Text Available AbstractIntroduction:Left atrioventricular valve regurgitation is the most concerning residual lesion after surgical correction of atrioventricular septal defects.Objective:To determine factors associated with moderate or severe left atrioventricular valve regurgitation within 30 days of surgical repair of complete atrioventricular septal defect.Methods:We assessed the results of 53 consecutive patients 3 years-old and younger presenting with complete atrioventricular septal defect that were operated on at our practice between 2002 and 2010. The following variables were considered: age, weight, absence of Down syndrome, grade of preoperative atrioventricular valve regurgitation, abnormalities on the left atrioventricular valve and the use of annuloplasty. Median age was 6.7 months; median weight was 5.3 Kg; 86.8% had Down syndrome. At the time of preoperative evaluation, there were 26 cases with moderate or severe left atrioventricular valve regurgitation (49.1%. Abnormalities on the left atrioventricular valve were found in 11.3%; annuloplasty was performed in 34% of the patients.Results:At the time of postoperative evaluation, there were 21 cases with moderate or severe left atrioventricular valve regurgitation (39.6%. After performing a multivariate analysis, the only significant factor associated with moderate or severe left atrioventricular valve regurgitation was the absence of Down syndrome (P=0.03.Conclusion:Absence of Down syndrome was associated with moderate or severe postoperative left atrioventricular valve regurgitation after surgical repair of complete atrioventricular septal defect at our practice.

  6. [Reversible first-degree atrioventricular block due to hyperthyroidism].

    Science.gov (United States)

    Çelebi, Aksüyek Savaş; Amasyalı, Basri

    2017-04-01

    Hyperthyroidism often causes tachyarrhythmia. Reversible atrioventricular block caused by hyperthyroidism is rare occurrence. Presently described is a case of atrioventricular block due to hyperthyroidism and recovery after antithyroid treatment.

  7. 59. Early and late results of routine leaflet augmentation for complete atrio-ventricular septal defect repair

    Directory of Open Access Journals (Sweden)

    A. Arifi

    2016-07-01

    Full Text Available Complete AVSD (CAVSD is characterized by the presence of a common atrio-ventricular (AV orifice, an inter-atrial communication, and a ventricular septal defect (VSD. Results of surgical correction of atrio-ventricular septal defects (AVSDs have improved over the last decades; however, the need for reoperation for left atrio-ventricular valve regurgitation, after primary AVSD repair remains a major concern. The aim of our study is to assess the outcome of the routine leaflet augmentation technique in CAVSD repair. A retrospective database and chart review analysis of all patients who underwent AV canal repair at king Abdul-Aziz Cardiac Center during period from 1999 to September 2014 was conducted. Demographic data, associated anomalies, operative data, ICU and hospital course were reviewed. Early outcomes were reviewed for postoperative complications (Chylothorax, complete AV block, Arrhythmias, early mortality and late outcomes were reviewed for Left AV valve regurgitation requiring for re-intervention and late mortality. Two hundred and sixty patients underwent leaflet augmentation technique to repair complete AVSD, between January 1999 and September 2014. The mean age was (131.5 months, and mean weight (6.06 kg. A variety of concomitant procedures were performed at the time of repair of the CAVSD, including a total of 49 patients (18.8% who underwent PDA ligation. Repair of TV (Right AV valve was performed in 11 patients (4.2%, 9 patients (3.46% required RVOTO resection, in 5 patients (1.92%, PA plasty was done and 2 patients (0.76% required ECMO after CAVSD repair. Regarding reoperations, a total of 17 patients (of 260 required reoperation after initial CAVSD repair. The most common indication for reoperation was left AV valve regurgitation in 16 patients (6% in the follow up period up to 15 years. One patient (0.38% required diaphragmatic plication. The overall mortality was 3 patients (1.1%. Leaflet augmentation for the repair of the

  8. Anatomical-embryological correlates in atrioventricular septal defect.

    OpenAIRE

    Allwork, S P

    1982-01-01

    Recent embryological studies have supported the consideration that the ventricular septum is multifocal in origin. These data have also provided excellent correlation of the morphology of malformed hearts with their embryology. In particular, atrioventricular septal defect correlates accurately with these observations on ventricular septation. Many of the names given to atrioventricular septal defect (for example ostium primum, persistent atrioventricular canal, endocardial cushion defect) in...

  9. Incidence and predictors of late atrioventricular conduction recovery among patients requiring permanent pacemaker for complete heart block after cardiac surgery.

    Science.gov (United States)

    Kiehl, Erich L; Makki, Tarek; Matar, Ralph M; Johnston, Douglas R; Rickard, John W; Tarakji, Khaldoun G; Kanj, Mohamed; Wazni, Oussama M; Saliba, Walid I; Varma, Niraj; Wilkoff, Bruce L; Cantillon, Daniel J

    2017-12-01

    New-onset complete heart block (CHB) commonly complicates cardiac surgery, for which some patients require a permanent pacemaker (PPM). Little is known regarding late atrioventricular (AV) conduction recovery. The purpose of this study was to characterize the incidence and predictors of late AV conduction recovery among patients requiring PPM after cardiac surgery. Consecutive patients receiving PPM for CHB after cardiac surgery at a high-volume U.S. center from 2000 to 2014 were evaluated. The primary outcome was late AV conduction recovery, defined as a reduction in ventricular pacing requirement to conduction recovery was 12% (n = 37), for whom the median ventricular pacing requirement decreased from 96% at implant to conduction abnormalities were present, including no recovery among patients with preoperative PR >200 ms and QRS >120 ms (n = 42). Multivariable analysis identified only female sex and transient AV conduction postoperatively as independent predictors of recovery (odds ratio 3.5; P conduction recovery is not uncommon after cardiac surgery, occurring in 1 of 8 patients within 6 months postoperatively. Preoperative AV conduction abnormalities were associated with decreased recovery, whereas female sex and transient postoperative AV conduction were associated with increased recovery. Copyright © 2017 Heart Rhythm Society. Published by Elsevier Inc. All rights reserved.

  10. Factors associated with moderate or severe left atrioventricular valve regurgitation within 30 days of repair of incomplete atrioventricular septal defect

    Directory of Open Access Journals (Sweden)

    Marcelo Felipe Kozak

    2015-04-01

    Full Text Available AbstractIntroduction:Left atrioventricular valve regurgitation is the most concerning residual lesion after surgical correction of atrioventricular septal defect.Objective:To determine factors associated with moderate or greater left atrioventricular valve regurgitation within 30 days of surgical repair of incomplete atrioventricular septal defect.Methods:We assessed the results of 51 consecutive patients 14 years-old and younger presenting with incomplete atrioventricular septal defect that were operated on at our practice between 2002 and 2010. The following variables were considered: age, weight, absence of Down syndrome, grade of preoperative left atrioventricular valve regurgitation, abnormalities on the left atrioventricular valve and the use of annuloplasty. The median age was 4.1 years; the median weight was 13.4 Kg; 37.2% had Down syndrome. At the time of preoperative evaluation, there were 23 cases with moderate or greater left atrioventricular valve regurgitation (45.1%. Abnormalities on the left atrioventricular valve were found in 17.6%; annuloplasty was performed in 21.6%.Results:At the time of postoperative evaluation, there were 12 cases with moderate or greater left atrioventricular valve regurgitation (23.5%. The variation between pre- and postoperative grades of left atrioventricular valve regurgitation of patients with atrioventricular valve malformation did not reach significance (P=0.26, unlike patients without such abnormalities (P=0.016. During univariate analysis, only absence of Down syndrome was statistically significant (P=0.02. However, after a multivariate analysis, none of the factors reached significance.Conclusion:None of the factors studied was determinant of a moderate or greater left atrioventricular valve regurgitation within the first 30 days of repair of incomplete atrioventricular septal defect in the sample. Patients without abnormalities on the left atrioventricular valve benefit more of the operation.

  11. Effective Management of Atrioventricular Interval for Paroxysmal Atrial Fibrillation That Developed After DDDR Pacemaker Implantation in a Sick Sinus Syndrome Patient.

    Science.gov (United States)

    Tasaki, Hirofumi; Ashizawa, Naoto; Nagao, Shoichi; Fukushima, Kiyoyasu; Furukawa, Ryuji; Fukae, Satoki; Maemura, Koji

    2015-01-01

    A 68-year-old man with sick sinus syndrome (SSS) was referred to our department for pacemaker implantation. After implantation of a pacemaker with rate-responsive dual chamber (DDDR) mode and minimized ventricular pacing (MVP) functions, paroxysmal atrial fibrillation (PAF) repeatedly developed. Pacemaker memory showed that the intrinsic atrioventricular (AV) (atrial pacing-ventricular sensing [Ap-Vs]) interval was paradoxically prolonged during rate-responsive atrial single-chamber (AAIR) mode rapid pacing because of MVP. Accordingly, to eliminate the paradoxical prolongation of the AV interval during rapid atrial pacing, we changed MVP to medium AV hysteresis and conducted DDDR mode pacing with rate-dependent AV delay. PAF then sharply decreased without antiarrhythmic drugs.

  12. Do All Children with Congenital Complete Atrioventricular Block Require Permanent Pacing ?

    Directory of Open Access Journals (Sweden)

    Christian Balmer

    2003-07-01

    Full Text Available With an incidence of 1 in 20’000 live born infants1, congenital complete atrioventricular block (CCAVB is a rare disease. The aetiology is not completely understood. However, CCAVB may be isolated or combined with congenital heart diseases in up to 53% of affected individuals2. Isolated CCAVB is in up to 98% of the children associated with positive autoimmune antibodies in the maternal serum (anti-Ro/SS-A and anti-LA/SS-B3,4. Interestingly, these antibodies are not specifically directed against the conduction system but also against normal myocardial cells and may cause myocarditis5,6. Affection of the conduction system can occur at different levels7. Histologically, the atrioventricular node tissue may be replaced by fibrous fatty tissue with variable involvement of the distal conduction system8.

  13. Verdivurdering av Prosafe

    OpenAIRE

    Sanne, Tom

    2006-01-01

    Prosafe ASA er et offshore selskap som eier og driver verdens største flåte av halvtnedsenkbare bolig- og service rigger. I tillegg er de en ledende eier og operatør av flytende produksjons- og lagringsfartøyer. Selskapet har uttrykt følgende visjon: ”Prosafe har som visjon å være en ledende og innovativ leverandør av produkter og tjenester til utvalgte nisjer i den globale olje- og gassindustrien.”(Prosafe.no) Prosafe har mesteparten av sine inntekter, kostnader og gjeldsfo...

  14. Determination of the optimal atrioventricular interval in sick sinus syndrome during DDD pacing.

    Science.gov (United States)

    Kato, Masaya; Dote, Keigo; Sasaki, Shota; Goto, Kenji; Takemoto, Hiroaki; Habara, Seiji; Hasegawa, Daiji; Matsuda, Osamu

    2005-09-01

    Although the AAI pacing mode has been shown to be electromechanically superior to the DDD pacing mode in sick sinus syndrome (SSS), there is evidence suggesting that during AAI pacing the presence of natural ventricular activation pattern is not enough for hemodynamic benefit to occur. Myocardial performance index (MPI) is a simply measurable Doppler-derived index of combined systolic and diastolic myocardial performance. The aim of this study was to investigate whether AAI pacing mode is electromechanically superior to the DDD mode in patients with SSS by using Doppler-derived MPI. Thirty-nine SSS patients with dual-chamber pacing devices were evaluated by using Doppler echocardiography in AAI mode and DDD mode. The optimal atrioventricular (AV) interval in DDD mode was determined and atrial stimulus-R interval was measured in AAI mode. The ratio of the atrial stimulus-R interval to the optimal AV interval was defined as relative AV interval (rAVI) and the ratio of MPI in AAI mode to that in DDD mode was defined as relative MPI (rMPI). The rMPI was significantly correlated with atrial stimulus-R interval and rAVI (r = 0.57, P = 0.0002, and r = 0.67, P 1 based on the receiver operator curves. Even though the intrinsic AV conduction is moderately prolonged, some SSS patients with dual-chamber pacing devices benefit from the ventricular pacing with optimal AV interval. MPI is useful to determine the optimal pacing mode in acute experiment.

  15. Atrial tachycardia mimicking atrioventricular nodal reentry tachycardia.

    Science.gov (United States)

    Eilbert, Wesley P; Patel, Neal

    2013-07-01

    The term supraventricular tachycardia (SVT) is used to describe tachydysrhythmias that require atrial or atrioventricular nodal tissue for their initiation and maintenance. SVT can be used to describe atrioventricular nodal reentry tachycardia, atrioventricular reentry tachycardia, and atrial tachycardia (AT). AT is the least common of these SVT subtypes, accounting for only 10% of cases. Although the suggested initial management of each SVT subtype is different, they all can present with similar symptoms and electrocardiographic findings. Discuss the pathophysiology, diagnosis, and treatment of AT as compared with other types of SVT. We report a 56-year-old woman with symptoms and electrocardiographic findings consistent with SVT. Although standard treatment with intravenous adenosine failed to convert the SVT, it revealed AT as the cause of the tachydysrhythmia. The AT was successfully terminated with beta-blockade and the patient eventually underwent successful radioablation of three separate AT foci. AT frequently mimics other more common forms of SVT. AT might be recognized only when standard treatment of SVT has failed. Identification of AT in this setting is crucial to allow for more definitive therapy. Copyright © 2013 Elsevier Inc. All rights reserved.

  16. A Rare Association of Takotsubo Cardiomyopathy with High-Degree Atrioventricular Block

    Directory of Open Access Journals (Sweden)

    Eder Hans Cativo

    2017-01-01

    Full Text Available Here we present a case of a patient who got trapped in an elevator; on initial evaluation patient was found with bradycardia; on further evaluation electrocardiogram (EKG showed new onset 2nd-degree Mobitz type 2 AV block. On admission patient developed ischemic changes on EKG and troponin elevation. Transthoracic echocardiogram showed reduced ejection fraction as well as apical inferior, anterior, lateral, and septal hypokinesia. Coronary angiography showed nonobstructive coronary artery disease and ventriculogram demonstrated anterolateral and apical hypokinesia suggesting takotsubo cardiomyopathy (TCM. Atrioventricular block (AV is rarely seen as initial presentation of TCM and has a prevalence of about 2.9%. AV block during early presentation of TCM poses a therapeutic dilemma with regard to the timing and the need to place a temporary or permanent pacemaker. The decision to place a permanent pacemaker may be on a case-by-case basis and more research is needed on formulating standardized recommendations in patients with TCM and conduction tissue abnormalities.

  17. Effects of AV-delay optimization on hemodynamic parameters in patients with VDD pacemakers.

    Science.gov (United States)

    Krychtiuk, Konstantin A; Nürnberg, Michael; Volker, Romana; Pachinger, Linda; Jarai, Rudolf; Freynhofer, Matthias K; Wojta, Johann; Huber, Kurt; Weiss, Thomas W

    2014-05-01

    Atrioventricular (AV) delay optimization improves hemodynamics and clinical parameters in patients treated with cardiac resynchronization therapy and dual-chamber-pacemakers (PM). However, data on optimizing AV delay in patients treated with VDD-PMs are scarce. We, therefore, investigated the acute and chronic effects of AV delay optimization on hemodynamics in patients treated with VDD-PMs due to AV-conduction disturbances. In this prospective, single-center interventional trial, we included 64 patients (38 men, 26 women, median age: 77 (70-82) years) with implanted VDD-PM. AV-delay optimization was performed using a formula based on the surface electrocardiogram (ECG). Hemodynamic parameters (stroke volume (SV), cardiac output (CO), heart rate (HR), and blood pressure (BP)) were measured at baseline and follow-up after 3 months using impedance cardiography. Using an ECG formula for AV-delay optimization, the AV interval was decreased from 180 (180-180) to 75 (75-100) ms. At baseline, AV-delay optimization led to a significant increase of both SV (71.3 ± 15.8 vs. 55.3 ± 12.7 ml, p < 0.001, for optimized AV delay vs. nominal AV interval, respectively) and CO (5.1 ± 1.4 vs. 3.9 ± 1.0 l/min, p < 0.001), while HR and BP remained unchanged. At follow-up, the improvement in CO remained stable (4.9 ± 1.3 l/min, p = 0.09), while SV slightly, but significantly, decreased (to 65.1 ± 17.6, p < 0.01). AV-delay optimization in patients treated with VDD-PMs exhibits immediate beneficial effects on hemodynamic parameters that are sustained for 3 months.

  18. Robust AVS Audio Watermarking

    Science.gov (United States)

    Wang, Yong; Huang, Jiwu

    Part III of AVS(China Audio and Video Coding Standard) is the first standard for Hi-Fi audio proposed in China and is becoming more popular in some IT industries. For MP3 audio, some efforts have been made to solve the problems such as copyright pirating and malicious modifications by the way of watermarking. But till now little efforts have been made to solve the same problems for AVS audio. In this paper, we present a novel robust watermarking algorithm which can protect the AVS audio from the above problems. The watermark is embedded into the AVS compressed bit stream. At the extracting end, the watermark bits can be extracted from the compressed bit stream directly without any computation. This algorithm achieves robustness to decoding/recoding attacks, and low complexity of both embedding and extracting while preserves the quality of the audio signals.

  19. A case of advanced second-degree atrioventricular block in a ferret secondary to lymphoma

    Directory of Open Access Journals (Sweden)

    F. Menicagli

    2016-04-01

    Full Text Available A female ferret was referred as an emergency for severe respiratory distress symptoms. At presentation, the patient was listlessness, dyspnoeic, and hyper-responsive. The clinical examination evidenced dyspnea with cyanosis, altered cardiac rhythm, and hepatomegaly. Electrocardiography showed an advanced second-degree atrioventricular (AV block. The liver aspirate was diagnostic for lymphoma. The patient did not respond to supportive therapy and rapidly died. Post-mortem exams confirmed the presence of lymphoma with hepatic involvement. Moreover, a pericardial lymphocytic infiltration and a widespread myocardial nodular localization of lymphoma were evidenced as well. This condition was probably the cause of the cardiac arrhythmia. To the best of our knowledge, ours is the first report of cardiac lymphoma causing heart block in ferrets.

  20. A case of advanced second-degree atrioventricular block in a ferret secondary to lymphoma.

    Science.gov (United States)

    Menicagli, F; Lanza, A; Sbrocca, F; Baldi, A; Spugnini, E P

    2016-01-01

    A female ferret was referred as an emergency for severe respiratory distress symptoms. At presentation, the patient was listlessness, dyspnoeic, and hyper-responsive. The clinical examination evidenced dyspnea with cyanosis, altered cardiac rhythm, and hepatomegaly. Electrocardiography showed an advanced second-degree atrioventricular (AV) block. The liver aspirate was diagnostic for lymphoma. The patient did not respond to supportive therapy and rapidly died. Post-mortem exams confirmed the presence of lymphoma with hepatic involvement. Moreover, a pericardial lymphocytic infiltration and a widespread myocardial nodular localization of lymphoma were evidenced as well. This condition was probably the cause of the cardiac arrhythmia. To the best of our knowledge, ours is the first report of cardiac lymphoma causing heart block in ferrets.

  1. [Complete atrioventricular block during galantamine therapy].

    Science.gov (United States)

    Leentjens, A F G; Kragten, J A

    2006-03-11

    A 77-year-old man who for 5 months had been being treated with galantamine for early Alzheimer's disease, suddenly became unwell. He was bradycardic and his ECG showed a complete atrioventricular block. This was treated by implantation of a pacemaker. Treatment with galantamine was continued. A month later he had no cardiac symptoms and his dementia score on a cognitive scale had improved. Cholinesterase inhibitors may have adverse effects on the heart. Patients starting treatment with cholinesterase inhibitors should be screened for an increased risk of cardiac arrhythmias by investigating their potassium concentrations and running an ECG.

  2. Embryonic Ethanol Exposure Dysregulates BMP and Notch Signaling, Leading to Persistent Atrio-Ventricular Valve Defects in Zebrafish.

    Directory of Open Access Journals (Sweden)

    Swapnalee Sarmah

    Full Text Available Fetal alcohol spectrum disorder (FASD, birth defects associated with ethanol exposure in utero, includes a wide spectrum of congenital heart defects (CHDs, the most prevalent of which are septal and conotruncal defects. Zebrafish FASD model was used to dissect the mechanisms underlying FASD-associated CHDs. Embryonic ethanol exposure (3-24 hours post fertilization led to defects in atrio-ventricular (AV valvulogenesis beginning around 37 hpf, a morphogenetic event that arises long after ethanol withdrawal. Valve leaflets of the control embryos comprised two layers of cells confined at the compact atrio-ventricular canal (AVC. Ethanol treated embryos had extended AVC and valve forming cells were found either as rows of cells spanning the AVC or as unorganized clusters near the AV boundary. Ethanol exposure reduced valve precursors at the AVC, but some ventricular cells in ethanol treated embryos exhibited few characteristics of valve precursors. Late staged larvae and juvenile fish exposed to ethanol during embryonic development had faulty AV valves. Examination of AVC morphogenesis regulatory networks revealed that early ethanol exposure disrupted the Bmp signaling gradient in the heart during valve formation. Bmp signaling was prominent at the AVC in controls, but ethanol-exposed embryos displayed active Bmp signaling throughout the ventricle. Ethanol exposure also led to mislocalization of Notch signaling cells in endocardium during AV valve formation. Normally, highly active Notch signaling cells were organized at the AVC. In ethanol-exposed embryos, highly active Notch signaling cells were dispersed throughout the ventricle. At later stages, ethanol-exposed embryos exhibited reduced Wnt/β-catenin activity at the AVC. We conclude that early embryonic ethanol exposure alters Bmp, Notch and other signaling activities during AVC differentiation leading to faulty valve morphogenesis and valve defects persist in juvenile fish.

  3. Prognostic importance of complete atrioventricular block complicating acute myocardial infarction

    DEFF Research Database (Denmark)

    Aplin, Mark; Engstrøm, Thomas; Vejlstrup, Niels G

    2003-01-01

    Third-degree atrioventricular block after acute myocardial infarction is considered to have prognostic importance. However, its importance in conjunction with thrombolytic therapy and its relation to left ventricular function remains uncertain. This report also outlines an important distinction...... between atrioventricular block in the setting of anterior and inferior wall acute myocardial infarction, with profound clinical and prognostic implications....

  4. [Acute atrio-ventricular block in sickle cell anemia].

    Science.gov (United States)

    Gacon, P-H; Jourdain, P; Heba, N; Amara, W

    2014-11-01

    Even though sickle cell disease has a high prevalence amongst the black race and despite its well known potential of micro infarction, there have been only a few reports regarding the acute myocardial damage during vaso-occlusive crisis. The risk of atrio ventricular block during these crises has never been described in a large survey. Ten patients (six men and four women, mean age 39 years old) were hospitalized for an acute atrio ventricular block. The patients were all African or Caribbean natives. Three patients were found with a heterozygous phenotype for hemoglobin S (sickle trait) and seven were found with a homozygous phenotype. The most common symptoms were asthenia (10 cases), shortness of breath (8 cases) and acute coronary syndrome (1 case) (syncope was not reported). Four patients had a second degree atrio ventricular block and six patients had third degree block. The treatment involved bed rest, intravenous hydration, and pain relief with opiates. All the cases of atrio ventricular block were only transitory and none of the patients underwent a pacemaker implantation. This report is the largest survey regarding transitory acute atrio ventricular block in patients with sickle cell disease. A local ischemic event affecting the AV node and Hiss bundle area can explain the conduction abnormalities. Sickle cell disease must be ruled out in black patients with an AV block. Copyright © 2014 Elsevier Masson SAS. All rights reserved.

  5. Serotonin Potentiates Transforming Growth Factor-beta3 Induced Biomechanical Remodeling in Avian Embryonic Atrioventricular Valves

    Science.gov (United States)

    Buskohl, Philip R.; Sun, Michelle L.; Thompson, Robert P.; Butcher, Jonathan T.

    2012-01-01

    Embryonic heart valve primordia (cushions) maintain unidirectional blood flow during development despite an increasingly demanding mechanical environment. Recent studies demonstrate that atrioventricular (AV) cushions stiffen over gestation, but the molecular mechanisms of this process are unknown. Transforming growth factor-beta (TGFβ) and serotonin (5-HT) signaling modulate tissue biomechanics of postnatal valves, but less is known of their role in the biomechanical remodeling of embryonic valves. In this study, we demonstrate that exogenous TGFβ3 increases AV cushion biomechanical stiffness and residual stress, but paradoxically reduces matrix compaction. We then show that TGFβ3 induces contractile gene expression (RhoA, aSMA) and extracellular matrix expression (col1α2) in cushion mesenchyme, while simultaneously stimulating a two-fold increase in proliferation. Local compaction increased due to an elevated contractile phenotype, but global compaction appeared reduced due to proliferation and ECM synthesis. Blockade of TGFβ type I receptors via SB431542 inhibited the TGFβ3 effects. We next showed that exogenous 5-HT does not influence cushion stiffness by itself, but synergistically increases cushion stiffness with TGFβ3 co-treatment. 5-HT increased TGFβ3 gene expression and also potentiated TGFβ3 induced gene expression in a dose-dependent manner. Blockade of the 5HT2b receptor, but not 5-HT2a receptor or serotonin transporter (SERT), resulted in complete cessation of TGFβ3 induced mechanical strengthening. Finally, systemic 5-HT administration in ovo induced cushion remodeling related defects, including thinned/atretic AV valves, ventricular septal defects, and outflow rotation defects. Elevated 5-HT in ovo resulted in elevated remodeling gene expression and increased TGFβ signaling activity, supporting our ex-vivo findings. Collectively, these results highlight TGFβ/5-HT signaling as a potent mechanism for control of biomechanical remodeling of

  6. Serotonin potentiates transforming growth factor-beta3 induced biomechanical remodeling in avian embryonic atrioventricular valves.

    Directory of Open Access Journals (Sweden)

    Philip R Buskohl

    Full Text Available Embryonic heart valve primordia (cushions maintain unidirectional blood flow during development despite an increasingly demanding mechanical environment. Recent studies demonstrate that atrioventricular (AV cushions stiffen over gestation, but the molecular mechanisms of this process are unknown. Transforming growth factor-beta (TGFβ and serotonin (5-HT signaling modulate tissue biomechanics of postnatal valves, but less is known of their role in the biomechanical remodeling of embryonic valves. In this study, we demonstrate that exogenous TGFβ3 increases AV cushion biomechanical stiffness and residual stress, but paradoxically reduces matrix compaction. We then show that TGFβ3 induces contractile gene expression (RhoA, aSMA and extracellular matrix expression (col1α2 in cushion mesenchyme, while simultaneously stimulating a two-fold increase in proliferation. Local compaction increased due to an elevated contractile phenotype, but global compaction appeared reduced due to proliferation and ECM synthesis. Blockade of TGFβ type I receptors via SB431542 inhibited the TGFβ3 effects. We next showed that exogenous 5-HT does not influence cushion stiffness by itself, but synergistically increases cushion stiffness with TGFβ3 co-treatment. 5-HT increased TGFβ3 gene expression and also potentiated TGFβ3 induced gene expression in a dose-dependent manner. Blockade of the 5HT2b receptor, but not 5-HT2a receptor or serotonin transporter (SERT, resulted in complete cessation of TGFβ3 induced mechanical strengthening. Finally, systemic 5-HT administration in ovo induced cushion remodeling related defects, including thinned/atretic AV valves, ventricular septal defects, and outflow rotation defects. Elevated 5-HT in ovo resulted in elevated remodeling gene expression and increased TGFβ signaling activity, supporting our ex-vivo findings. Collectively, these results highlight TGFβ/5-HT signaling as a potent mechanism for control of biomechanical

  7. Cardiac resynchronization therapy and AV optimization increase myocardial oxygen consumption, but increase cardiac function more than proportionally.

    Science.gov (United States)

    Kyriacou, Andreas; Pabari, Punam A; Mayet, Jamil; Peters, Nicholas S; Davies, D Wyn; Lim, P Boon; Lefroy, David; Hughes, Alun D; Kanagaratnam, Prapa; Francis, Darrel P; Whinnett, Zachary I

    2014-02-01

    The mechanoenergetic effects of atrioventricular delay optimization during biventricular pacing ("cardiac resynchronization therapy", CRT) are unknown. Eleven patients with heart failure and left bundle branch block (LBBB) underwent invasive measurements of left ventricular (LV) developed pressure, aortic flow velocity-time-integral (VTI) and myocardial oxygen consumption (MVO2) at 4 pacing states: biventricular pacing (with VV 0 ms) at AVD 40 ms (AV-40), AVD 120 ms (AV-120, a common nominal AV delay), at their pre-identified individualised haemodynamic optimum (AV-Opt); and intrinsic conduction (LBBB). AV-120, relative to LBBB, increased LV developed pressure by a mean of 11(SEM 2)%, p=0.001, and aortic VTI by 11(SEM 3)%, p=0.002, but also increased MVO2 by 11(SEM 5)%, p=0.04. AV-Opt further increased LV developed pressure by a mean of 2(SEM 1)%, p=0.035 and aortic VTI by 4(SEM 1)%, p=0.017. MVO2 trended further up by 7(SEM 5)%, p=0.22. Mechanoenergetics at AV-40 were no different from LBBB. The 4 states lay on a straight line for Δexternal work (ΔLV developed pressure × Δaortic VTI) against ΔMVO2, with slope 1.80, significantly >1 (p=0.02). Biventricular pacing and atrioventricular delay optimization increased external cardiac work done but also myocardial oxygen consumption. Nevertheless, the increase in cardiac work was ~80% greater than the increase in oxygen consumption, signifying an improvement in cardiac mechanoenergetics. Finally, the incremental effect of optimization on external work was approximately one-third beyond that of nominal AV pacing, along the same favourable efficiency trajectory, suggesting that AV delay dominates the biventricular pacing effect - which may therefore not be mainly "resynchronization". © 2013. Published by Elsevier Ireland Ltd. All rights reserved.

  8. Paroxysmal atrioventricular block: Electrophysiological mechanism of phase 4 conduction block in the His-Purkinje system: A comparison with phase 3 block.

    Science.gov (United States)

    Shenasa, Mohammad; Josephson, Mark E; Wit, Andrew L

    2017-11-01

    Paroxysmal atrioventricular (A-V) block is relatively rare, and due to its transient nature, it is often under recognized. It is often triggered by atrial, junctional, or ventricular premature beats, and occurs in the presence of a diseased His-Purkinje system (HPS). Here, we present a 45-year-old white male who was admitted for observation due to recurrent syncope and near-syncope, who had paroxysmal A-V block. The likely cellular electrophysiological mechanisms(s) of paroxysmal A-V block and its differential diagnosis and management are discussed. Continuous electrocardiographic monitoring was done while the patient was in the cardiac unit. Multiple episodes of paroxysmal A-V block were documented in this case. All episodes were initiated and terminated with atrial/junctional premature beats. The patient underwent permanent pacemaker implantation and has remained asymptomatic since then. Paroxysmal A-V block is rare and often causes syncope or near-syncope. Permanent pacemaker implantation is indicated according to the current guidelines. Paroxysmal A-V block occurs in the setting of diseased HPS and is bradycardia-dependent. The detailed electrophysiological mechanisms, which involve phase 4 diastolic depolarization, and differential diagnosis are discussed. © 2017 Wiley Periodicals, Inc.

  9. Kampklubb : en kommentert oversettelse av Fight club av Chuck Palahniuk

    OpenAIRE

    Gottschalk, Morten Peter

    2006-01-01

    Oppgaven er en kommentert oversettelse av romanen Fight Club av Chuck Palahniuk. Den inneholder en oversettelse av de sju første kapitlene i romanen. Kommentardelen tar for seg oversetterproblemer, og diskuterer disse i detalj. Det dreier seg om stil, syntaks, oversettelse av navn med betydning og problemer der kulturelle forskjeller mellom USA og Norge skaper oversetterproblemer. Som bakgrunnsmateriale brukes Gideon Tourys begreper om adekvate og akseptable oversettelser, og hvordan kildekul...

  10. Restaurangernas val av livsmedel

    OpenAIRE

    Korpihalkola, Janica

    2009-01-01

    Syftet med detta lärdomsprov är att ta reda på vilka livsmedel restaurangerna i Vasa har valt att använda samt varifrån de skaffar sina råvaror och livsmedel. Avsikten var även att undersöka om valet av livsmedel skiljer sig vid lunch och a la carté -mat och om det finns skillnader mellan privata och kedjerestauranger med tanke på val av livsmedel. I teoridelen beskriver jag om hur restaurangerna och deras användning av råvaror har utvecklats på 1900-talet och om olika valmöjligheter som ...

  11. Nykonstruktion av trippelsaxlyftbord

    OpenAIRE

    Gisselman, Niklas

    2010-01-01

    SammanfattningDenna rapport behandlar konstruktion av ett trippelsaxlyftbord. Lyftbord är ett bord som harmöjlighet att lyfta eller sänka en bordsskiva till en höjd som underlättar arbete. Dessa lyftbordutgår från en av SIS standardiserat arbetsgång för att uppfylla CE-märkning. En förändring idenna standard har öppnat en marknad för lyftbord som lågfartshissar upp till 3 våningsplansom Edmolift avser att täcka. Av denna anledning vill Edmolift konstruera etttrippelsaxlyftbord med en kapacite...

  12. Skyggedom av enkepensjonsdommen

    DEFF Research Database (Denmark)

    Rognlien, Ida Gundersby

    2014-01-01

    Masteroppgaven undersøker om bortfall av ektefellepensjon ved lovendring med tilbakevirkende kraft er i strid med retten til eiendom etter EMK TP 1 art 1. Skyggedommetoden/ Feminist Judgments -metoden brukes for å gjenskrive enkepensjonsdommen Rt.2006.262 i et feministisk perspektiv. Da mannen døde.......1975.220. I spørsmålet om inngrepet er proporsjonalt ble vektlagt at det ikke foreligger en transparent avveining av de relevante interessene. Videre er hensynene bak og behovene for den opprinnelige ektefellepensjonen fortsatt tilstede, og de er ikke tilstrekkelig avveid mot formålene med inngrepet...

  13. BMP-2 induces versican and hyaluronan that contribute to post-EMT AV cushion cell migration.

    Directory of Open Access Journals (Sweden)

    Kei Inai

    Full Text Available Distal outgrowth and maturation of mesenchymalized endocardial cushions are critical morphogenetic events during post-EMT atrioventricular (AV valvuloseptal morphogenesis. We explored the role of BMP-2 in the regulation of valvulogenic extracellular matrix (ECM components, versican and hyaluronan (HA, and cell migration during post-EMT AV cushion distal outgrowth/expansion. We observed intense staining of versican and HA in AV cushion mesenchyme from the early cushion expansion stage, Hamburger and Hamilton (HH stage-17 to the cushion maturation stage, HH stage-29 in the chick. Based on this expression pattern we examined the role of BMP-2 in regulating versican and HA using 3D AV cushion mesenchymal cell (CMC aggregate cultures on hydrated collagen gels. BMP-2 induced versican expression and HA deposition as well as mRNA expression of versican and Has2 by CMCs in a dose dependent manner. Noggin, an antagonist of BMP, abolished BMP-2-induced versican and HA as well as mRNA expression of versican and Has2. We further examined whether BMP-2-promoted cell migration was associated with expression of versican and HA. BMP-2- promoted cell migration was significantly impaired by treatments with versican siRNA and HA oligomer. In conclusion, we provide evidence that BMP-2 induces expression of versican and HA by AV CMCs and that these ECM components contribute to BMP-2-induced CMC migration, indicating critical roles for BMP-2 in distal outgrowth/expansion of mesenchymalized AV cushions.

  14. O efeito da morfina na inibição vagal do coração: demonstração da dupla via do nodo atrioventricular - DOI: 10.4025/actascihealthsci.v28i2.1102 The effect of morphine on vagal inhibition of the heart: demonstration of dual atrioventricular nodal pathways - DOI: 10.4025/actascihealthsci.v28i2.1102

    Directory of Open Access Journals (Sweden)

    José Geraldo Pereira da Cruz

    2006-03-01

    Full Text Available A estimulação elétrica do nervo vago diminui a freqüência cardíaca e aumenta o intervalo PQ no eletrocardiograma, podendo ativar a via anterógrada do nodo atrioventricular. Neste experimento é investigada a interação da morfina sobre o controle nervoso parassimpático cardíaco em relação à dupla condução do nodo atrioventricular. A estimulação do nervo vago induz uma significativa bradicardia e um bloqueio atrioventricular de terceiro grau, com a onda P aparecendo negativa na derivação II. Devido aos efeitos moduladores da anestesia sobre o coração, administração de injeções de morfina induz o aparecimento de onda P positiva através de uma ação inibitória sobre a reentrância do nodo atrioventricular. Tudo sugere a presença de duas vias atrioventriculares, anatômica e funcionalmente distintasThat electrical stimulation of the vagus decreased heart rate and increased the PQ interval in electrocardiogram, consistent with anterograde dual atriventricular conduction. The present experiments were investigating the interaction of the morphine with cardiac parasympathetic nervous control in dual atrioventricular node. Electrical stimulation of the vagus nerve induced significant bradycardia and of third degree atrioventricular block and the P wave appearance was negative in leads II. Because background anesthesia modulates the heart, administered morphine injection the P waves appearance was positive through one inhibitory action on atrioventricular nodal reentry. All suggest the presence of two functionally and anatomically distinct atrioventricular pathways

  15. Forenkling av tekniske systemer

    DEFF Research Database (Denmark)

    Førland-Larsen, Arne; Bramslev, Katharina; Halderaker, Ingrid

    2017-01-01

    De fleste moderne kontorbygg har omfattende tekniske installasjoner. Mange byggeiere opplever at dagens kompliserte tekniske anlegg ikke fungerer som de skal. De ender med å få reklamasjoner, høyt energiforbruk og klager på inneklima. Kan en kraftig forenkling av ventilasjons-, oppvarmings- og...

  16. En av gutta

    DEFF Research Database (Denmark)

    Neumann, Cecilie Basberg; Rysst, Mari; Bjerck, Mari

    2012-01-01

    Hvilken betydning har kjønn og klær for kvinner som arbeider i mannsdominerte arbeiderklasseyrker? Forfatterne av denne artikkelen finner at kvinnene må nedtone sitt kjønn og sin seksualitet gjennom å dekke til kroppen, i klær laget for menn, for å signalisere at de er på jobb for å arbeide...

  17. Forenkling av tekniske systemer

    DEFF Research Database (Denmark)

    Førland-Larsen, Arne; Bramslev, Katharina; Halderaker, Ingrid

    De fleste moderne kontorbygg har omfattende tekniske installasjoner. Mange byggeiere opplever at dagens kompliserte tekniske anlegg ikke fungerer som de skal. De ender med å få reklamasjoner, høyt energiforbruk og klager på inneklima. Kan en kraftig forenkling av ventilasjons-, oppvarmings- og...

  18. Radiofrequency Catheter Ablation of Atrioventricular Nodal Reentrant Tachycardia: Success Rates and Complications during 14 Years of Experience

    Directory of Open Access Journals (Sweden)

    Mansour Moghaddam

    2010-05-01

    Full Text Available Background: Radiofrequency catheter ablation (RFCA has been introduced as the treatment of choice for supraventricular tachycardia. The aim of this study was to evaluate the success rate as well as procedural and in-hospital complications of RFCA for the treatment of atrioventricular nodal reentrant tachycardia (AVNRT.Methods: Between March 1995 and February 2009, 544 patients (75.9% female, age: 48.89 ± 13.19 years underwent 548 RFCAs for AVNRT in two large university hospitals. Echocardiography was performed for all the patients before and after the procedure. Electrocardiograms were recorded on digital multichannel systems (EP-Med or Bard EP system. Anticoagulation was initiated during the procedure.Results: From the 548 patients, 36 had associated arrhythmias, atrial flutter (4%, atrial fibrillation (0.7%, concurrent atrial fibrillation and atrial flutter (0.7%, and concealed atrioventricular pathway (0.4%. The overall success rate was 99.6%. There were 21 (3.9% transient III-degree AV blocks (up to a few seconds and 4 (0.7% prolonged II- or III-degree AV blocks, 2 (0.25% of which required permanent pacemaker insertion, 3(0.5% deep vein thrombosis, and one (0.2% arteriovenous fistula following the procedure. No difference was observed in the echocardiography parameters before and after the ablation.Conclusion: RFCA had a high success rate. The complication rate was generally low and in the above-mentioned centers it was similar to those in other large centers worldwide. Echocardiography showed no difference before and after the ablation. The results from this study showed that the risk of permanent II or III-degree AV block in patients undergoing RFCA was low and deep vein thrombosis was the second important complication. There was no risk of life-threatening complications.

  19. Fluorinated steroids do not improve outcome of isolated atrioventricular block

    NARCIS (Netherlands)

    Van den Berg, N. W. E.; Slieker, M. G.; van Beynum, I. M.; Bilardo, C. M.; de Bruijn, D.; Clur, S. A.; Cornette, J. M. J.; Frohn-Mulder, I. M. E.; Haak, M. C.; van Loo-Maurus, K. E. H.; Manten, G. T. R.; Rackowitz, A. B. M. H.; Rammeloo, L. A. J.; Reimer, A.; Rijlaarsdam, M. E. B.; Freund, M. W.

    2016-01-01

    Introduction: Congenital atrioventricular block (CAVB) is a rare disorder with a significant morbidity and mortality. Consensus regarding the prescription and efficacy of prenatal corticosteroids is lacking. This nationwide study was initiated to evaluate the effects of prenatal treatment with

  20. Swallow syncope caused by third-degree atrioventricular block

    DEFF Research Database (Denmark)

    Roust Aaberg, Anne Marie; Eriksson, Anna Elin; Madsen, Per Lav

    2015-01-01

    We report a case of a patient with more than 30 years of repeated syncopes, always following food intake. The patient was diagnosed with a swallow-related third-degree atrioventricular block and successfully treated with an artificial pacemaker.......We report a case of a patient with more than 30 years of repeated syncopes, always following food intake. The patient was diagnosed with a swallow-related third-degree atrioventricular block and successfully treated with an artificial pacemaker....

  1. Projektering av robotcell

    OpenAIRE

    Carnbo, Linda; Suonperä, Nadja

    2012-01-01

    Syftet med examensarbetet var att projektera en fysisk robotcell till Haldex i Landskrona, tillverkare av bromshävarmar, då det finns ett behov hos dem att effektivisera sin produktion för att kunna bibehålla konkurrenskraften och tillverkningen i Sverige. Bromshävarmen är en mogen produkt vilket medför att det inte skulle bli lönsamt att omforma den utan istället fokusera på tillverkningen. Därför vore lösningen att automatisera den del av monteringslinan som inte tillför något värde till sl...

  2. Isorhythmic atrioventricular dissociation in Labrador Retrievers.

    Science.gov (United States)

    Perego, M; Ramera, L; Santilli, R A

    2012-01-01

    Isorhythmic atrioventricular dissociation (IAVD) is a rhythm disturbance in which atria and ventricles are driven by independent pacemakers at equal or nearly equal rates. To describe electrocardiographic and electrophysiologic features of IAVD in a group of 11 Labrador Retrievers and its possible correlation with focal junctional tachycardia (FJT). Between December 2004 and October 2010, medical records of 11 Labrador Retrievers with surface electrocardiographic findings compatible with IAVD were retrospectively analyzed. Twelve-lead surface electrocardiograms, thoracic radiographs, and echocardiographic findings of each dog and electrophysiologic mapping results of 3 dogs were retrospectively analyzed. In 10 of 11 dogs, the ECG pattern revealed the presence of IAVD with type I synchronization. In 5 of 10 dogs, IAVD with type I synchronization was interrupted by periods of junctional tachycardia with 1 : 1 ventriculo-atrial conduction. One of 11 dogs presented IAVD with type II synchronization. The ECG diagnosis of IAVD with type I and type II synchronization, and junctional rhythm with 1 : 1 ventriculo-atrial conduction was confirmed in 3 of 11 dogs with endocardial mapping in which the diagnosis of focal junctional tachycardia was made. IAVD with type I synchronization is more common than IAVD with type II synchronization in Labrador Retrievers, and a correlation between IAVD and FJT can be hypothesized. Copyright © 2012 by the American College of Veterinary Internal Medicine.

  3. Follow-up of a modified catheter ablation of the atrioventricular junction in patients with atrial tachyarrhythmias.

    Science.gov (United States)

    Hsia, C P; Chen, S A; Tsang, W P; Wang, D C; Ting, C T; Wang, S P; Kong, C W; Chiang, B N; Chang, M S

    1992-11-01

    In order to reduce cumulative energy, minimize barotrauma and infranodal injury, a modified catheter ablation technique was performed on seventeen patients. These patients had drug refractory atrial tachyarrhythmias (AT) consisting of thirteen with paroxysmal atrial fibrillation (PAf), three with sick sinus syndrome (SSS) with PAf, and one having SSS with rapid left atrial tachycardia. This technique, using the femoral approach, consisted of delivering a direct-current (DC) shock using a dual electrode configuration, to the ablation site adjacent the atrioventricular (AV) junction just before the disappearance of His deflection on the His bundle electrogram. After delivering 1-4 DV shock (mean 2.8) (cumulative energy 556 +/- 260 joules), 9 pts had first degree AV block (1st AVB) and 8 pts had complete AV block (CAVB). Only two pts had a right bundle branch block after ablation. During the clinical follow-up (15.4 +/- 2.7 months), sixteen pts were asymptomatic and were free of antiarrhythmic drugs. One pt was asymptomatic with quinidine which was ineffective before ablation. Pacemaker implantation was performed in 10 pts as a back-up for symptomatic SSS and CAVB. The results show this modified technique is relatively safe and effective.

  4. Node security

    CERN Document Server

    Barnes, Dominic

    2013-01-01

    A practical and fast-paced guide that will give you all the information you need to secure your Node applications.If you are a developer who wishes to secure your Node applications, whether you are already using Node Security in production, or are considering using it for your next project, then this book will enable you to ensure security of your applications. An understanding of JavaScript is a prerequisite, and some experience with Node is recommended, though not required.

  5. Konkurranseutsetting av pleie- og omsorgstjenester : en studie av Oslo kommune

    OpenAIRE

    Seim, Karianne

    2006-01-01

    Sammendrag Siden konkurranseutsetting av pleie- og omsorgstjenester har vært, og er, et omstridt tema, synes jeg at det er spennende å studere hvorfor noen kommuner likevel bestemmer seg for å ta i bruk denne formen for produksjon av sine tjenester, og hvordan de går frem for å gjennomføre dette. For å kunne dekke alle sider ved konkurranseutsetting, valgte jeg derfor å konsentrere meg om å se på innføringen av konkurranseutsetting av pleie- og omsorgstjenester i Oslo kommune. Jeg har...

  6. Node cookbook

    CERN Document Server

    Clements, David Mark

    2014-01-01

    In Node Cookbook Second Edition, each chapter focuses on a different aspect of working with Node. Following a Cookbook structure, the recipes are written in an easy-to-understand language. Readers will find it easier to grasp even the complex recipes which are backed by lots of illustrations, tips, and hints.If you have some knowledge of JavaScript and want to build fast, efficient, scalable client-server solutions, then Node Cookbook Second Edition is for you. Knowledge of Node will be an advantage but is not required. Experienced users of Node will be able to improve their skills.

  7. Morphological aspects of atrioventricular valves in the ostrich (Struthio camelus

    Directory of Open Access Journals (Sweden)

    Marco A. Pereira-Sampaio

    2013-11-01

    Full Text Available Heart anatomy in the ostrich has been reported, but there are few information on the histological features of the atrioventricular valves. Hearts of young ostriches were fixed in 10% formaldehyde for 24 h and dissected to characterize their macroscopic anatomy. Samples of valves were harvested and stained with Mallory’s trichrome, Gomori’s trichrome, and Picro-Sirius red, for later analysis. The right atrioventricular valve consists of a muscle flap with two fixations. The left atrioventricular valve consists of two layers of endocardium with a layer of connective tissue between them. The free border of the tricuspid valve supports a varying number of chordae tendineae. One of the cusps is attached to the septum, while the other two cusps are attached to the opposite wall. The aortic valve, as well as the pulmonary trunk valve, consists of three cusps. The right atrioventricular valve showed up only as a muscle flap of myocardium coated with a thin layer of dense connective tissue, with two fixations. In the connective tissue, we find a predominance of type I collagen fibers and a lesser amount of type III, with a small presence of elastic fibers. The presence of Purkinje fibers were also usual in the valvular subendocardium, suggesting that they directly participate in the transmission of nervous stimulation to the muscle fibers within the valves. The left atrioventricular valve consisted of 3 cusps, a dorsal, a left, and a right.

  8. Utveckling av ett snabblyftblock

    OpenAIRE

    Svensk, Johanna; Schönning, Lisa

    2014-01-01

    Detta examensarbete har genomförts i samarbete med Svero Lifting. Företaget säljer och utvecklar lyftanordningar. Svero Lifting arbetar idag med att reducera vikten på företagets komponenter genom ett materialbyte och har påbörjat utveckling av en ny lyftanordning, en blockvagn och ett snabblyftblock. Svero Lifting vill fortsätta utveckla företagets lyftanordning så att komponenterna i lyftanordningen passar varandra och utmärker sig på marknaden. Idag har Svero Lifting inga CAD-modeller elle...

  9. Pregabalin-induced first degree atrioventricular block in a young patient treated for pain from extrapulmonary tuberculosis.

    Science.gov (United States)

    Schiavo, Alessandra; Stagnaro, Francesca M; Salzano, Andrea; Marra, Alberto M; Bobbio, Emanuele; Valente, Pietro; Grassi, Simona; Miniero, Martina; Arcopinto, Michele; Matarazzo, Margherita; Napoli, Raffaele; Cittadini, Antonio

    2017-09-28

    Pregabalin, widely used in the treatment of several pain disorders, is usually well tolerated. Uncommonly, the drug may induce cardiac side effects, rarely prolongation of the PR interval. The latter has never been described in patients with healthy heart or normal renal function. We characterize a unique case of a young man with extrapulmonary tuberculosis and no detectable or known cardiac or kidney diseases, treated with pregabalin to control the severe pain due to the involvement of the spinal cord by the tuberculosis, showing an atrioventricular (AV) block due to pregabalin administration. The reported case emphasizes the need of monitoring PR interval during treatment with pregabalin, even in patients without background of cardiac or renal diseases.

  10. Ultralydfremstilling av fostervekst

    Directory of Open Access Journals (Sweden)

    Synnøve Lian Johnsen

    2009-09-01

    Full Text Available Ultralyd billeddanning er i dag den beste undersøkelsesmetoden vi har til å overvåke fosterets utvikling og vekst. Ultralydmåling av fosterets størrelse og biometriske referansetabeller for svangerskapet brukes til å fastsette svangerskapets alder, beregne termin og vurdere fosterets vekst. Optimal studiedesign er ulik for hvert av disse formålene. Det er stor variasjon i fysiologisk vekst og en utfordring å identifisere fostre som har dårlig tilvekst. En enkeltmåling av fosteret kan fortelle oss om det er lite eller stort i forhold til andre fostre, men ikke om størrelsen er passelig i forhold til forventet fysiologisk vekst for dette fosteret. Tilpassede referansemodeller ("customised" justerer forventet størrelse i relasjon til føtale og maternelle faktorer og har vist seg å bedre identifisere sanne veksthemmede fostre enn bare å klassifisere i henhold til 2,5, 5 eller 10 persentilen. Men et foster som i utgangspunktet er stort for alderen, men etter hvert vokser langsomt vil ikke nødvendigvis bli fanget opp ved en slik enkeltmåling. Serielle målinger vil hjelpe, men en slik longitudinell metode blir ikke fullt ut utnyttet før det appliseres betinget ("conditional" vekstberegning. Betingelsesleddene for variasjon i vekst og målemetode kalkuleres ut fra longitudinelle data og kan så anvendes for det enkelte foster. En første måling brukes til å beregne forventet vekst og variasjon for en neste måling. Denne metoden forventes å skjerpe diagnostikken for vekst-avvik i alle vektklasser og kan sammen med tilpasningen av andre faktorer bedre overvåkningen av risikosvangerskapUltrasonographic imaging is today the best method for assessing fetal size and monitoring fetal growth. Ultrasound measurements of fetal size are used for age, size and growth assessment, but the statistical design and analysis are different for each of these purposes. Physiological ranges for fetal growth are wide and the identification of fetal

  11. Læring av erfaring?

    DEFF Research Database (Denmark)

    Ramvi, Ellen

    Hva skal til for å lære av erfaring? Denne avhandlingen er en empirisk baseret undersøkelse av ungdosmskolelæreres muligheter og betingelser for å "lære av erfaring" i den særlige betydning av begrepet  W. Bion gir i sin psykoanalytiske teori. Undersøgelsen baserer seg på et feltarbeid som strekker...... seg over ett skoleår. Datamaterialet ble samlet inn via observerasjoner og mer eller mindre strukturerte samtaler med lærere ved to forskellige norske ungdsomsskoler. Analysen av materialet foregår i to trinn: først en fenomenologisk analyse, tett på lærernes egne beskrivelser og refleksjoner av...... lærerarbeidet, dets udfordringer og vanskeligheter, og deretter en psykoanalytisk perspektivering av de fenomenologiske analyseresultatene. Analysen viser en almindelig lærerhverdag og en skoleorganisation, hvor lærernes "læring av erfaring" i stor utstrekning blokkeres i et vekselspill mellem lærernes flukt...

  12. Teratogene effekter av antiepileptika

    Directory of Open Access Journals (Sweden)

    Bernt A. Engelsen

    2009-10-01

    Full Text Available  SAMMENDRAGCa. 1 av 200 gravide har epilepsi. Gravide med epilepsi har økt risiko for visse obstetriske komplikasjonerog for å føde barn med medfødte misdannelser. Risikoen for misdannelser synes koblet til bruk avantiepileptika under svangerskapet, og ikke til selve epilepsien. Alle typer misdannelser er økt, men leppeganespalteog nevralrørsdefekter utgjør særlig viktige misdannelser. Årsakene til misdannelsene er multifaktorielle.Bruk av antiepileptika i monoterapi kan sies å gi en individuell risiko for større misdannelser påca. 4-6%. Karbamazepin og natriumvalproat gir hhv. 0,5-1% og 2-3% risiko for nevralrørsdefekt. Samletrisiko for større og mindre anomalier inkludert dysmorfe ansiktstrekk synes ikke å overstige 10%. ENGLISH SUMMARYEngelsen BA. Teratogenic effects of antiepileptic drugs. Nor J Epidemiol 1997; 7 (1: 23-28.Approximately 1 in 200 pregnant women have epilepsy, and 1 in 250 births are to children of mothers whouse antiepleptic drugs (AED. Pregnant women with epilepsy have increased risk for certain obstetricalcomplications, and for giving birth to children with congenital malformations. The increased risk forcongenital malformations seems connected to the use of AED, not to the epileptic syndromes. The etiologyof congenital malformations are multifactorial. Use of AED in monotherapy is associated with anindividual risk of giving birth to a child with a major malformation of 4-6%. The specific risk of spinabifida is 0,5 to 1% for carbamazepine and 2-3% for sodium valproate.

  13. Helseeffekter av byluftpartikler

    Directory of Open Access Journals (Sweden)

    Magne Refsnes

    2009-10-01

    Full Text Available Svevestøv i byluft består av forbrenningspartikler og mineralpartikler med svært forskjellige størrelser og kjemiske egenskaper. Svevestøvet kan deles inn i størrelsesfraksjoner som PMAmbient particulate matter (PM comprises particles from different combustion processes and a variety of mineral particles. The particles vary widely in size distribution and chemical/physical characteristics. PM is often divided into size fractions with different aerodynamic diameters: PM10 (PM ! 10 mm, PM2.5 (PM ! 2.5 mm and PM0.1 (PM ! 0.1 mm. Recent population studies have found an association between an increase in mortality and morbidity due to lung and/or cardiovascular disease and short-term increases in PM. The relative risk (RR was approximately 1.005 for an increase in 10 mg/m3 PM10, without an observed threshold even at concentrations below 10 mg/m3. Chronic exposure has been investigated to a lesser extent, but longterm exposure to PM2.5 has been found to be associated with an approximately 10-fold greater increase in RR than short-term exposures. Experimental studies with volunteers in chamber and field studies show mild lung or cardiovascular responses at concentrations of ambient particles (PM2.5/PM10: 100-200 mg/m3 that may occur during episodes of air pollution. Animal studies at higher concentrations have shown stronger responses. The experimental studies support the epidemiological evidence for an adverse health effect of PM. Both population- and experimental studies indicate the existence of vulnerable individuals. At low to average ambient concentrations there seems to exist a discrepancy between the results of population- and experimental studies that might be due to the absence of the most vulnerable individuals in the experimental studies. Together with cell culture experiments, human and animal studies indicate the importance of physical and chemical properties of the particles (size, content of metals, organics, endotoxins, etc. for

  14. A Mobitz type II atrioventricular block in multicentric ischemic stroke ...

    African Journals Online (AJOL)

    A Mobitz type II atrioventricular block in multicentric ischemic stroke. Utku Murat Kalafat, Canan Akman, Turker Karaboga, Tarik Ocak. Abstract. Cardiac and cerebrovascular illnesses are major causes of mortality and morbidity. Thromboembolisms, which are the result of cardiac arrhythmia, are important causes of ischemic ...

  15. A Mobitz type II atrioventricular block in multicentric ischemic stroke

    Science.gov (United States)

    Kalafat, Utku Murat; Akman, Canan; Karaboga, Turker; Ocak, Tarik

    2016-01-01

    Cardiac and cerebrovascular illnesses are major causes of mortality and morbidity. Thromboembolisms, which are the result of cardiac arrhythmia, are important causes of ischemic stroke. In this study, we present a rare case of multicentric ischemic stroke induced by Mobitz type II atrioventricular block. PMID:28154620

  16. Atrioventricular conduction after alcohol septal ablation for obstructive hypertrophic cardiomyopathy

    DEFF Research Database (Denmark)

    Axelsson, Anna; Weibring, Kristina; Havndrup, Ole

    2014-01-01

    .1-9.4) after ASA. Patients with high-grade atrioventricular block at follow-up had longer PR intervals at baseline [205 ms (200-230)] than the rest of the cohort [180 ms (140-200), P = 0.004] and a higher incidence of acute complete heart block (63 vs. 15%; P = 0.007) during ASA. A PR interval of at least 200...... ms at baseline was associated with higher prevalence of high-grade atrioventricular block at follow-up (30 vs. 2%; P = 0.0013). The incidence of late-onset complete heart block was 1.5% per year after ASA. CONCLUSION: We found normalized atrioventricular conduction at long-term follow-up, suggesting...... recovery in 6 of 14 patients with a pacemaker implanted in relation to ASA. Permanent atrioventricular conduction abnormalities were associated with baseline PR intervals of at least 200 ms and acute persistent complete heart block during ASA....

  17. Age changes in the structure of human Atrioventricular annuli | El ...

    African Journals Online (AJOL)

    Atrioventricular annuli are important in hemodynamic stability and support to tricuspid and mitral valves. Anatomical features of the annuli such as circumference, organization of connective tissue fibers, myocardium and cellularity may predispose to annular insufficiency and valvular incompetence. These pathologies ...

  18. Swallow syncope caused by third-degree atrioventricular block.

    Science.gov (United States)

    Aaberg, Anne Marie Roust; Eriksson, Anna Elin; Madsen, Per Lav; Dixen, Ulrik

    2015-10-27

    We report a case of a patient with more than 30 years of repeated syncopes, always following food intake. The patient was diagnosed with a swallow-related third-degree atrioventricular block and successfully treated with an artificial pacemaker. 2015 BMJ Publishing Group Ltd.

  19. [Fetal atrioventricular septal defect associated with Patau and Edwards syndromes, as well as trisomy 22].

    Science.gov (United States)

    Cesko, I; Hajdú, J; Marton, T; Tóth-Pál, E; Papp, C; Papp, Z

    1998-05-03

    The atrioventricular septal defect is usually associated with trisomy 21 and it may be observed in the heterotaxia syndromes. Atrioventricular septal defect may be associated with 8p deletion. There are reported cases of familial atrioventricular septal defect. Atrioventicular septal defect is rarely associated with other chromosomal abnormalities. We are reporting three unusual cases of atrioventricular septal defect that were associated with trisomy 13, 18 and 22. This association may be due to effect of genetic loci on the 13, 18 and 22 chromosome which could play the role in the development and fusion of endocardial cushion and atrioventricular septal defect.

  20. Atrioventricular junctional tissue. Discrepancy between histological and electrophysiological characteristics

    NARCIS (Netherlands)

    McGuire, M. A.; de Bakker, J. M.; Vermeulen, J. T.; Moorman, A. F.; Loh, P.; Thibault, B.; Vermeulen, J. L.; Becker, A. E.; Janse, M. J.

    1996-01-01

    BACKGROUND: Previous work has demonstrated that cells with AV nodal-type action potentials are not confined to Koch's triangle but may extend along the AV orifices. The aim of this study was to examine the histological and electrophysiological characteristics of this tissue. METHODS AND RESULTS:

  1. Lokalisering av arbeidsplasser og boliger

    DEFF Research Database (Denmark)

    Næss, Petter

    2011-01-01

    En miljømessig effektiv lokalisering av arbeidsplasser og boliger sikter mot å begrense - og helst redusere - biltrafikk og miljøproblemer knyttet til bytransport, sammenliknet med alternative lokaliseringer. En effektiv transportmessig lokalisering kan også bidra til å redusere tap av verdifulle...... arealer (f eks jordbruksareal eller natur- og friluftsområder) utenfor dagens tettstedsgrense. Tiltaket må samtidig utformes slik at en kan bevare viktige bomiljøkvaliteter og så mye som mulig av de grønne arealene innenfor tettbebyggelsen....

  2. The left atrioventricular valve in partial atrioventricular septal defect: management strategy and surgical outcome.

    Science.gov (United States)

    Al-Hay, Amira A A; Lincoln, Christopher R; Shore, Darryl F; Shinebourne, Elliot A

    2004-10-01

    To test the hypothesis that in patients with a partial atrioventricular septal defect (PAVSD) and a competent left atrioventricular valve (LAVV), sutures should be placed across the line of apposition of the superior and inferior bridging leaflets, septal commissure (SC), to prevent the development of regurgitation. Outcome of surgery and risk factors for the need for LAVV reoperation of patients with mild or no LAVV regurgitation (LAVVR) were evaluated. Controversy over management of the LAVV in PAVSD. One hundred and forty seven children with PAVSD underwent surgical repair at the Royal Brompton Hospital between January 1983 and December 1999. Of this group, 21 (16.7%) had LAVVR of sufficient severity to require surgical intervention and were therefore excluded from analysis. The median age and weight at repair of those with mild or no LAVVR was 4.1 years and 15.4 kg. One hundred and eight had normal chromosomes, 13 Down syndrome and five other syndromes. The interatrial communication was closed using a pericardial patch in 62.7% and with synthetic material in the remainder. Intraoperative testing of LAVV competence was undertaken using saline injection into the left ventricle. In 80.9%, sutures were placed across the line of apposition of the left sided superior and inferior bridging leaflets partially to close the SC (sometimes incorrectly named the mitral valve cleft). The overall hospital mortality was 3.2% (95% confidence interval (CI) 1, 8.4%), which did not differ statistically in the last 20 years. No specific risk factors for early death were identified. Eleven patients (8.7%, 95% CI 4.7, 15.4%) required reoperation, 10 for LAVV repair and 1 resection of subaortic stenosis. Univariate analysis of risk factors for LAVV reoperation were low weight, relatively small size LAVV, the presence of a small preoperative interventricular interchordal communication and duration of ventilation. Ten (9.8%) of 102 patients in whom SC was sutured required LAVV

  3. Morphological aspects of atrioventricular valves in the ostrich (Struthio camelus

    Directory of Open Access Journals (Sweden)

    Marcelo Abidu-Figueiredo

    2013-08-01

    Full Text Available http://dx.doi.org/10.5007/2175-7925.2013v26n4p203 Heart anatomy in the ostrich has been reported, but there are few information on the histological features of the atrioventricular valves. Hearts of young ostriches were fixed in 10% formaldehyde for 24 h and dissected to characterize their macroscopic anatomy. Samples of valves were harvested and stained with Mallory’s trichrome, Gomori’s trichrome, and Picro-Sirius red, for later analysis. The right atrioventricular valve consists of a muscle flap with two fixations. The left atrioventricular valve consists of two layers of endocardium with a layer of connective tissue between them. The free border of the tricuspid valve supports a varying number of chordae tendineae. One of the cusps is attached to the septum, while the other two cusps are attached to the opposite wall. The aortic valve, as well as the pulmonary trunk valve, consists of three cusps. The right atrioventricular valve showed up only as a muscle flap of myocardium coated with a thin layer of dense connective tissue, with two fixations. In the connective tissue, we find a predominance of type I collagen fibers and a lesser amount of type III, with a small presence of elastic fibers. The presence of Purkinje fibers were also usual in the valvular subendocardium, suggesting that they directly participate in the transmission of nervous stimulation to the muscle fibers within the valves. The left atrioventricular valve consisted of 3 cusps, a dorsal, a left, and a right.

  4. O nódulo atrioventricular e o feixe de his no homem

    Directory of Open Access Journals (Sweden)

    C. Magarinos Torres

    1961-09-01

    Full Text Available A demonstração do nódulo atrioventricular e do feixe de His, no coração humano, não oferece dificuldade especial, uma vez que seja seguida a técnica consagrada. A negação da sua existência, feita há cêrca de 20 anos atraz, é atribuível à não observância dêsse cuidado. A documentação apresentada refere-se a um paciente do sexo feminino, de côr branca, com 36 anos de idade, não infectado pelo Schizotrypanum cruzi, cujo coração pesava 310 g, sendo considerado macro e microscòpicamente, normal. Destina-se ela a servir de têrmo de comparação para a que será publicada, oportunamente, sôbre a cardiopatia crônica na doença de Chagas. Confirmamos o que dizem muitos autores quando assinalam a ausência completa de células ganglionares e de nervos, no nódulo atrioventricular, no tronco comum do feixe His e em seus dois ramos, quando observados no homem. Contrasta isso, fortemente, com o que existe, nas mesmas estruturas, no coração dos ungulados. Verificamos, não raramente, continuidade entre fibras musculares do tecido específico, no ramo esquerdo do feixe de His e fibras musculares ventriculares, sendo o ramo esquerdo constituído, em certa proporção, por fibras com caracters intermediários entre fibras musculares ordinárias e fibras de Purkinje (fibras de transição. Algumas vêzes fibras com características das de Purkinie aparecem em grupos musculares do septo ventricular imediatamente adjacentes ao ramo esquerdo, dificultando a demarcação exata daquele ramo. Reproduzimos, textualmente, pontos de mior interêsse, na literatura consultada, quando receavamos que a tradução não pudesse traduzir o pensamento exato do autor ou pudesse dar tal impressão.No particular difficulty was met in the demonstration of the atrioventricular node and bundel of His in the human heart when standard methods such as that described by RÉNON and GÉRAUDEL (posteriorly referred as MAHAIM's method was followed. The figures

  5. Entrainment to distinguish orthodromic reciprocating tachycardia from atrioventricular nodal reentry tachycardia in children.

    Science.gov (United States)

    Kannankeril, Prince J; Bonney, William J; Dzurik, Matthew V; Fish, Frank A

    2010-04-01

    Studies in adults suggest that after entrainment from the right ventricle, a post-pacing interval (PPI) minus tachycardia cycle length (TCL), when corrected for atrioventricular node delay (cPPI-TCL), is useful to distinguish atrioventricular nodal reentry tachycardia (AVNRT) from orthodromic reciprocating tachycardia (ORT), but this has not been evaluated in children. In 100 children undergoing catheter ablation, entrainment of ORT or AVNRT was performed from the right ventricular apex. The atrial-His (AH) interval was measured on the return cycle (post-AH) and during tachycardia just prior to pacing (pre-AH). The cPPI-TCL was calculated as (PPI-TCL) - (post-AH - pre-AH). In the first 50 children, the best cutoff was identified and then validated in the next 50 children. In the first 50 children, cPPI-TCL was longer in AVNRT compared with ORT (122 +/- 19 ms vs 63 +/- 23 ms, P cPPI-TCL exceeded 95 ms in all AVNRT patients, but was less than cPPI-TCL cPPI-TCL > 95 ms was 95% specific for AVNRT. There was even greater separation of cPPI-TCL values comparing AVNRT with ORT utilizing a septal accessory pathway. The cPPI-TCL is a useful technique to distinguish AVNRT from ORT in children. Our data suggest that in children a cPPI-TCL 95 ms is rarely observed in ORT. This technique is particularly useful to distinguish AVNRT from ORT utilizing a septal accessory pathway. (PACE 2010; 469-474).

  6. Prevalence of E/A wave fusion and A wave truncation in DDD pacemaker patients with complete AV block under nominal AV intervals.

    Science.gov (United States)

    Poller, Wolfram C; Dreger, Henryk; Schwerg, Marius; Melzer, Christoph

    2015-01-01

    Optimization of the AV-interval (AVI) in DDD pacemakers improves cardiac hemodynamics and reduces pacemaker syndromes. Manual optimization is typically not performed in clinical routine. In the present study we analyze the prevalence of E/A wave fusion and A wave truncation under resting conditions in 160 patients with complete AV block (AVB) under the pre-programmed AVI. We manually optimized sub-optimal AVI. We analyzed 160 pacemaker patients with complete AVB, both in sinus rhythm (AV-sense; n = 129) and under atrial pacing (AV-pace; n = 31). Using Doppler analyses of the transmitral inflow we classified the nominal AVI as: a) normal, b) too long (E/A wave fusion) or c) too short (A wave truncation). In patients with a sub-optimal AVI, we performed manual optimization according to the recommendations of the American Society of Echocardiography. All AVB patients with atrial pacing exhibited a normal transmitral inflow under the nominal AV-pace intervals (100%). In contrast, 25 AVB patients in sinus rhythm showed E/A wave fusion under the pre-programmed AV-sense intervals (19.4%; 95% confidence interval (CI): 12.6-26.2%). A wave truncations were not observed in any patient. All patients with a complete E/A wave fusion achieved a normal transmitral inflow after AV-sense interval reduction (mean optimized AVI: 79.4 ± 13.6 ms). Given the rate of 19.4% (CI 12.6-26.2%) of patients with a too long nominal AV-sense interval, automatic algorithms may prove useful in improving cardiac hemodynamics, especially in the subgroup of atrially triggered pacemaker patients with AV node diseases.

  7. Prevalence of E/A wave fusion and A wave truncation in DDD pacemaker patients with complete AV block under nominal AV intervals.

    Directory of Open Access Journals (Sweden)

    Wolfram C Poller

    Full Text Available Optimization of the AV-interval (AVI in DDD pacemakers improves cardiac hemodynamics and reduces pacemaker syndromes. Manual optimization is typically not performed in clinical routine. In the present study we analyze the prevalence of E/A wave fusion and A wave truncation under resting conditions in 160 patients with complete AV block (AVB under the pre-programmed AVI. We manually optimized sub-optimal AVI.We analyzed 160 pacemaker patients with complete AVB, both in sinus rhythm (AV-sense; n = 129 and under atrial pacing (AV-pace; n = 31. Using Doppler analyses of the transmitral inflow we classified the nominal AVI as: a normal, b too long (E/A wave fusion or c too short (A wave truncation. In patients with a sub-optimal AVI, we performed manual optimization according to the recommendations of the American Society of Echocardiography.All AVB patients with atrial pacing exhibited a normal transmitral inflow under the nominal AV-pace intervals (100%. In contrast, 25 AVB patients in sinus rhythm showed E/A wave fusion under the pre-programmed AV-sense intervals (19.4%; 95% confidence interval (CI: 12.6-26.2%. A wave truncations were not observed in any patient. All patients with a complete E/A wave fusion achieved a normal transmitral inflow after AV-sense interval reduction (mean optimized AVI: 79.4 ± 13.6 ms.Given the rate of 19.4% (CI 12.6-26.2% of patients with a too long nominal AV-sense interval, automatic algorithms may prove useful in improving cardiac hemodynamics, especially in the subgroup of atrially triggered pacemaker patients with AV node diseases.

  8. Marked First Degree Atrioventricular Block: an extremely prolonged PR interval associated with Atrioventricular Dissociation in a young Nigerian man with Pseudo-Pacemaker Syndrome: a case report.

    Science.gov (United States)

    Ogunlade, Oluwadare; Akintomide, Anthony O; Ajayi, Olufemi E; Eluwole, Omotayo A

    2014-11-04

    The diagnosis of Marked First Degree Atrioventricular Block is made with electrocardiogram when PR interval ≥0.30 s. A PR interval of up to 0.48 s had been reported in literature. Data is sparse on an extremely prolonged PR interval associated with Atrioventricular Dissociation and Pseudo-Pacemaker Syndrome. Electrocardiogram with this type of uncommon features poses diagnostic and management challenges in clinical practice. We report a case of a 22 year old Nigerian male from Igbo ethnic group who presented himself for medical screening with a history of exercise intolerance, occasional palpitation and fainting spells. He has no history of cough, orthopnoea, paroxysmal nocturnal dyspnoea nor body swelling. A physical examination revealed that the patient has a pulse rate of 64 beats per minute, blood pressure of 110/70 mmHg and soft heart sounds. Standard 12-lead electrocardiogram showed an uncommon Marked First Degree Atrioventricular Block with an extremely prolonged PR interval of 0.56 s. Long rhythm strips of the electrocardiogram showed extremely prolonged PR interval associated with Atrioventricular Dissociation and variable degrees of Atrioventricular Block (Mobitz type I and II). An extremely prolonged PR interval may occur in First Degree Atrioventricular Block and it may be associated with Atrioventricular Dissociation and Pseudo-Pacemaker Syndrome which may pose diagnostic and management challenges. This suggests that not all cases of First Degree Atrioventricular Block are benign and so should be sub-classified based on degree of PR interval prolongation and associated electrical abnormalities.

  9. Effects of enhanced parasympathetic tone on atrioventricular nodal conduction during atrioventricular nodal reentrant tachycardia.

    Science.gov (United States)

    Belz, M K; Stambler, B S; Wood, M A; Pherson, C; Ellenbogen, K A

    1997-10-01

    The effects of various physiologic and pharmacologic stimuli on the anterograde slow pathway in patients with atrioventricular nodal reentrant tachycardia are well characterized. We sought to further characterize the nature of anterograde and retrograde conduction during tachycardia and to define the differential input of the parasympathetic nervous system to these pathways. A custom-made neck suction collar was placed to stimulate the carotid body baroreceptors during supraventricular tachycardia. Neck suction at -60 mm Hg was applied and changes in tachycardia cycle length, AH, and ventriculoatrial intervals were measured in 20 patients. These measurements were repeated after intravenous administration of 10 mg of edrophonium to enhance vagal tone. We observed a 15 +/- 6 ms increase in tachycardia cycle length from baseline (p <0.0001) and a 14 +/- 6 ms increase in AH interval (p <0.0001), but no change in the VA interval with neck suction alone. The tachycardia cycle length prolonged 26 +/- 55 ms (p <0.0001) with edrophonium and an additional 12 +/- 43 ms (p <0.001) with neck suction after edrophonium. There was no change in the VA interval before or after edrophonium during neck suction. There were 10 tachycardia terminations in 8 patients during anterograde slow pathway block during neck suction, with tachycardia cycle length prolongation and mean AH prolongation before termination of 45 +/- 37 ms (vs 15 +/- 7 ms increase in AH interval without tachycardia termination, p = 0.10). There were 12 tachycardia terminations in 4 patients with retrograde block during neck suction, only after edrophonium, without any preceding change in tachycardia cycle length during 11 episodes. We conclude that anterograde slow pathway demonstrates gradual conduction slowing with parasympathetic enhancement, whereas retrograde fast pathway responds with abrupt block.

  10. Complete Atrioventricular Block in an Adolescent With Rheumatic Fever

    OpenAIRE

    Yoo, Gyeong-Hee

    2009-01-01

    Rheumatic fever is an acute inflammatory sequela following a group A, ?-hemolytic streptococcal infection. Rheumatic fever is characterized by polyarthritis, carditis, chorea, subcutaneous nodules, and erythema marginatum as the major diagnostic criteria. Rarely, advanced heart block may also occur. A 13-year-old boy was admitted to the Pediatric Department for evaluation and management of complete atrioventricular block. The patient had exertional dyspnea for 1 month. Based on the findings o...

  11. Complete atrioventricular block in an adolescent with rheumatic Fever.

    Science.gov (United States)

    Yoo, Gyeong-Hee

    2009-03-01

    Rheumatic fever is an acute inflammatory sequela following a group A, beta-hemolytic streptococcal infection. Rheumatic fever is characterized by polyarthritis, carditis, chorea, subcutaneous nodules, and erythema marginatum as the major diagnostic criteria. Rarely, advanced heart block may also occur. A 13-year-old boy was admitted to the Pediatric Department for evaluation and management of complete atrioventricular block. The patient had exertional dyspnea for 1 month. Based on the findings of mitral regurgitation, fever, elevated acute phase reactants, and a high antistreptolysin O titer, the patient was diagnosed with rheumatic fever. A benzathine penicillin injection was administered, as well as salicylate therapy. On the 5(th) day of hospitalization, the electrocardiogram revealed a normal sinus rhythm with a 1(st) degree atrioventricular block. After discharge, the electrocardiogram normalized with the monthly penicillin injections. Herein we report a case of complete atrioventricular block associated with rheumatic fever. The heart block resolved without specific cardiac treatment, other than a non-steroidal anti-inflammatory medication.

  12. Efeitos da mudança de modo de estimulação ventricular para atrioventricular sobre a qualidade de vida em pacientes com cardiopatia chagásica e bloqueio atrioventricular na troca eletiva do gerador de pulsos Health-related quality of life in patients with Chagas' cardiomiopathy and complete atrioventricular block at elective pulse generator replacement: effects of pacing mode upgraded from VVI to DDD

    Directory of Open Access Journals (Sweden)

    Luiz Antonio Castilho Teno

    2005-03-01

    ção da Faculdade de Medicina da Universidade de São Paulo and Hospital de Beneficência Portuguesa de Ribeirão Preto, a total of 27 patients with chronic Chagas' cardiopathy, complete atrioventricular block and implanted ventricular pacemaker were upgraded to a dual-chamber pacing mode. At the beginning of the study and after 90-days periods under each pacing modes, the patients' quality of life was evaluated. Statistical analysis was made at basal, VVI and DDD conditions using the analysis of repetitive measures. RESULTS: No significant differences in the health-related quality of life, across the three studied variables (physical function, vitality and general health, were detected after the change of pacing mode from VVI to DDD. There were three cases of complications related to pacing mode upgrade: two cases of atrial tachycardia triggered to ventricles through DDD pacemaker and one atrial lead displacement. CONCLUSIONS: No benefits no quality of life were detected after the change of pacing mode VVI to DDD during elective replacement of pulse generator, in patients with Chagas' cardiomyopathy and complete AV block

  13. Opplevelsen av god helse på tross av KOLS

    OpenAIRE

    Blakseth, Margrethe

    2017-01-01

    Master i folkehelsevitenskap med vekt på endringer av livsstilsvaner, 2017 Bakgrunn: Verdens helseorganisasjon (WHO) kom i 1978 med utsagnet og et ambisiøst mål kalt «Helse for alle i år 2000». I 2013 i Almaty ble det på nytt diskutert de globale utfordringene. Her ble det fokusert på to hovedtemaer, ulikheter i helse og den økte byrden av kroniske sykdommer. Hovedvekten ble lagt på samarbeid mellom helsevesenet og brukerne for å imøtekomme disse problemene. I Stortingsmelding 26 snakkes d...

  14. Development of the right ventricular inflow tract and moderator band: a possible morphological and functional explanation for Mahaim tachycardia

    NARCIS (Netherlands)

    Jongbloed, M. R. M.; Wijffels, M. C. E. F.; Schalij, M. J.; Blom, N. A.; Poelmann, R. E.; van der Laarse, A.; Mentink, M. M. T.; Wang, Z.; Fishman, G. I.; Gittenberger-de Groot, A. C.

    2005-01-01

    Atriofascicular accessory bundles with AV-node like conduction properties can sustain atrioventricular (AV) re-entrant tachycardia (Mahaim tachycardia). During early embryogenesis, the AV canal is situated above the primitive left ventricle (LV), and a right AV connection has not been achieved yet.

  15. A Heart too Drunk to Drive; AV Block following Acute Alcohol Intoxication.

    Science.gov (United States)

    van Stigt, Arthur H; Overduin, Ruben J; Staats, Liza C; Loen, Vera; van der Heyden, Marcel A G

    2016-02-29

    Acute excessive alcohol consumption is associated with heart rhythm disorders like atrial fibrillation but also premature ventricular contractions, collectively known as the "holiday heart syndrome". More rarely but clinically significant are reports of atrioventricular (AV) conduction disturbances in binge drinkers with no underlying heart disease or chronic alcohol consumption. To obtain better insights into common denominators and the potential underlying mechanisms we collected and compared individual case reports of AV block following acute alcohol intoxication in otherwise healthy people. By screening PubMed, Google Scholar, Scopus and JSTOR, fifteen cases were found of which eight were sufficiently documented for full analysis. Blood alcohol levels ranged from 90 to 958 mg/dl (19 to 205 mM). Second and third degree AV block was observed most (6/8) albeit that in two of these patients a vagal stimulus led to deterioration from first into higher order AV block. In all cases, patients reverted to normal sinus rhythm upon becoming sober again. Mildly lowered body temperature (35.9 ± 0.5°C) was observed but can be excluded as a major cause of conduction blockade. We hypothesize that ethanol induced partial inhibition of calcium and potentially also sodium currents in conductive tissue structures may be one of the mechanisms of conduction slowing and block that may become exaggerated upon increased vagal tone. An impairment of gap junction function cannot be excluded as a contributing factor. In conclusion, cases of documented alcohol induced AV block are very rare but events can occur at relatively low serum alcohol levels which should prompt to awareness of this phenomenon in alcohol intoxicated patients.

  16. [Use of non-fluoroscopic mapping in recurrent atrioventricular nodal reentrant tachycardia in a patient with corrected transposition of the great arteries].

    Science.gov (United States)

    Aristizábal, Julián; Uribe, William; Duque, Mauricio; Marín, Jorge; Medina, Eduardo; Velásquez, Jorge; Femenía, Francisco; Baranchuk, Adrían

    2013-01-01

    The anatomy in congenital corrected transposition of the great arteries is complex and the conduction system may experience large degrees of variation. Invasive procedures should be done with the use of the highest possible technological sources to warrant success. We describe here, a patient with recurrent atrioventricular node reentry tachycardia where non-fluoroscopic navigation system helped in a complex ablation. Copyright © 2011 Instituto Nacional de Cardiología Ignacio Chávez. Published by Masson Doyma México S.A. All rights reserved.

  17. Atrioventricular nodal reentrant tachycardia ablation and inferior vena cava agenesis.

    Science.gov (United States)

    Galand, Vincent; Pavin, Dominique; Behar, Nathalie; Mabo, Philippe; Martins, Raphaël P

    2016-10-01

    Congenital anomalies of the inferior vena cava (IVC) are rare and very often diagnosed in asymptomatic patients during computed tomography performed for other purposes. These anomalies can have significant clinical implications, for example if electrophysiology procedures are needed. Diagnostic and ablation procedures are difficult since catheter manipulation and positioning are more complex. We present here a case of successful atrioventricular nodal reentrant tachycardia ablation in a patient with unexpected IVC agenesis, using an azygos route. Copyright © 2016 Sociedade Portuguesa de Cardiologia. Publicado por Elsevier España, S.L.U. All rights reserved.

  18. Coronary sinus and atrioventricular groove avulsion after motor vehicle crash

    Directory of Open Access Journals (Sweden)

    Bradley M Dennis

    2014-01-01

    Full Text Available Simultaneous cardiac and pericardial rupture from blunt chest trauma is a highly lethal combination with rarely reported survival. We report of a case of young patient with a right atrioventricular groove injury, pericardial rupture and a unique description of a coronary sinus avulsion following blunt chest trauma. Rapid recognition of this injury is crucial to patient survival, but traditional diagnostic adjuncts such as ultrasound, echocardiography and computed tomography are often unhelpful. Successful repair of these injuries requires high suspicion of injury, early cardiac surgery involvement of and possible even placement of the patient on cardiopulmonary bypass.

  19. Ny versjon av standarden ISO 15489

    OpenAIRE

    Herbjørn Andresen

    2016-01-01

    Standarden NS-ISO 15489-1:2016 er gjeldende norsk standard fra 1. juli 2016. Dette er andre versjon av ISO 15489, den første versjonen fra 2001 er ikke lenger gyldig. 2001-utgaven av ISO 15489 besto av to deler. Del 2, SN-ISO/TR 15489-2:2001 er trukket, slik at den nye ISO 15489 kun består av del 1. ISO 15489 var den første internasjonale Records Management-standarden, og har en funksjon som overordnet referansestandard for en voksende portefølje av senere standarder på tilgrensende områder. ...

  20. En analyse av Yoga-kundalini-upanisad

    OpenAIRE

    Martinsen, Fred

    2006-01-01

    Avhandlingen En analyse av Yoga-kundalini-upanisad bygger på den indiske asketen Narayanaswamy Aiyers engelske oversettelse av Yoga-kundalini-upanisad, utgitt i Thirty Minor Upanisad-s, Including the Yoga Upanisad-s (Oklahoma, Santarasa Publications, 1980). Denne hinduistiske teksten er omtalt som en av de 21 yoga-upanishadene, den åttisjette av de 108 klassiske upanishadene, og utgjør en del av tekstkorpuset Krsna-Yajurveda. Teksten fungerer som en manual i øvelser fra disiplinene hathayoga,...

  1. Development of the myocardium of the atrioventricular canal and the vestibular spine in the human heart

    NARCIS (Netherlands)

    Kim, J. S.; Virágh, S.; Moorman, A. F.; Anderson, R. H.; Lamers, W. H.

    2001-01-01

    To establish the morphogenetic mechanisms underlying formation and separation of the atrioventricular connections, we studied the remodeling of the myocardium of the atrioventricular canal and the extracardiac mesenchymal tissue of the vestibular spine in human embryonic hearts from 4.5 to 10 weeks

  2. Lymph node biopsy

    Science.gov (United States)

    Biopsy - lymph nodes; Open lymph node biopsy; Fine needle aspiration biopsy; Sentinel lymph node biopsy ... A lymph node biopsy is done in an operating room in a hospital. Or, it is done at an outpatient surgical center. The ...

  3. [Candida albicans endocarditis after treatment of complete atrioventricular canal].

    Science.gov (United States)

    El Alami, S; Handor, N; Moutaki Allah, Y; Bouchrik, M; El Mellouki, W; Boulahya, A; Lmimouni, B

    2013-09-01

    Infective endocarditis is rare in children, it is rarer after a surgical treatment of atrioventricular canal, and it is exceptional that Candida albicans is the etiologic agent. This is a serious infection found in congenital heart disease with or without surgery. It is potentially lethal, despite diagnostic and therapeutic advances. We report a case of infective endocarditis due to C. albicans after the treatment of a congenital systemic atrioventricular canal in a child with trisomy 21. The diagnosis was suspected on clinical manifestations and cardiac auscultation. Confirmation was provided by positive blood cultures and echocardiography. The large size of the vegetation in the patient was in favor of a fungal etiology, blood cultures allowed to identify the fungus. This observation illustrates a poorly understood disease, with very poor prognosis and which is a potential complication of heart surgery. The improved prognosis should be achieved by shortening the time to diagnosis and optimizing the therapeutic support. Copyright © 2013 Elsevier Masson SAS. All rights reserved.

  4. Evaluering av inflammatoriske mediatorer i diagnostikk av alvorlige neonatale infeksjoner

    Directory of Open Access Journals (Sweden)

    Henrik Døllner

    2009-10-01

    Full Text Available  Formål: SAMMENDRAGStudie design: Resultater: IL-6 predikerte uavhengig infeksjon (bidrag til infeksjonsdiagnosen. En kombinert parameter bestående av CRP≥ 10 mg/l og/eller IL-6 > 50 pg/mlga en sensitivitet på 96% (95% CI: 88–100%, en spesifisitet på 74% (95% CI: 65–83%, en negativ prediktivverdi på 99% (95% CI: 96–100% og en positiv prediktiv verdi på 49% (95% CI: 35–63%.Konklusjon: diagnosis of severe neonatal infections  ObjectiveENGLISH SUMMARY Study design Results: of IL-6 yielded independent contributions to the diagnosis of infection ( mediator made any further contribution to the diagnosis. A combined parameter of CRP≥ 10 mg/l and/or IL-6 >50 pg/ml yielded a sensitivity of 96% (95% CI: 88–100%, a specificity of 74% (95% CI: 65–83%, a negativepredictive value of 99% (95% CI: 96–100% and a positive predictive value of 49% (95% CI: 35–63%.Conclusion: severe neonatal infections.IL-6 in combination with CRP may constitute a valuable parameter in the early diagnosis ofp p p = 0.03. No other Twentyfour neonates with sepsis, clinical sepsis and pneumonia had significantly raised serumlevels of all six mediators compared to noninfected neonates (all : Blood samples were collected at admittance from 165 neonates who were suspected to have asevere bacterial infection and serum concentrations of the six inflammatory mediators were determined. Weanalysed the mediators, either isolated or in combination, as diagnostic parameters by multiple logisticregression, receiver-operator characteristic plots and predictive value theory (sensitivity and specificity.: To study C-reactive protein (CRP, interleukin-6 (IL-6, soluble tumor necrosis factor receptors(TNFR p55 and p75 and the adhesion molecules ICAM-1 and E-selectin in the early diagnosis of neonatalsepsis.The value of inflammatory mediators in the . Nor J Epidemiol 1997; 7 (1: 73-78.IL-6 i kombinasjon med CRP synes å være en verdifull parameter ved utredning

  5. Análise dos fatores de risco na correção cirúrgica do defeito septal atrioventricular de forma total Risk factors analysis in the surgical repair of complete atrioventricular septal defect

    Directory of Open Access Journals (Sweden)

    Eduardo Keller Saadi

    1993-06-01

    Full Text Available Pacientes com defeito septal atrioventricular de forma total (DSAVT freqüentemente apresentam insuficiência cardíaca intratável e hipertensão arterial pulmonar nos primeiros meses de vida, e apenas uma minoria sobrevive sem tratamento cirúrgico precoce. Por essa razão, indica-se a correção definitiva para alterar favoravelmente a história natural da doença. Entretanto, vários fatores são responsáveis pela alta mortalidade cirúrgica. O presente trabalho estuda a experiência na correção cirúrgica do DSAVT com o objetivo de identificar alguns fatores de risco estatisticamente significativos para a ocorrência de morte operatória. Analisaram-se, retrospectivamente, 52 pacientes submetidos, entre janeiro de 1974 e dezembro de 1990, a cirurgia definitiva para correção de DSAVT no Royal Brompton and National Heart and Lung Institute, sendo estudadas as seguintes variáveis: idade, peso, sexo, ano da operação, presença de síndrome de Down, grau de regurgitação da valva AV, bandagem prévia do tronco pulmonar, presença de anomalias associadas, pressão sistólica pulmonar, duplo orifício mitral, classificação do defeito segundo Rastelli, emprego de parada circulatória e técnica de correção (1 x 2 retalhos. Todos os fatores foram avaliados isoladamente, mediante a análise univariada. Para determinar quais os fatores que, independentemente da ação de outros, contribuíram significativamente para maior mortalidade cirúrgica, foi utilizada a análise multivariada com regressão logística. A análise multivariada demonstrou que o baixo peso na época da operação e a técnica de correção com um retalho aumentam significativamente a mortalidade cirúrgica.Patients with complete atrioventricular septal defects (CAVSD frequently present with severe heart failure which cannot be controllable medically and pulmonary hypertension in infancy. Just a small number survives without early surgical treatment. For this reason

  6. A Simple Dissection Method for the Conduction System of the Human Heart

    Science.gov (United States)

    Yanagawa, Nariaki; Nakajima, Yuji

    2009-01-01

    A simple dissection guide for the conduction system of the human heart is shown. The atrioventricular (AV) node, AV bundle, and right bundle branch were identified in a formaldehyde-fixed human heart. The sinu-atrial (SA) node could not be found, but the region in which SA node was contained was identified using the SA nodal artery. Gross…

  7. Analysis of Onset Mechanisms of a Sphingosine 1-Phosphate Receptor Modulator Fingolimod-Induced Atrioventricular Conduction Block and QT-Interval Prolongation

    Energy Technology Data Exchange (ETDEWEB)

    Yagi, Yukihiro [Department of Pharmacology, Faculty of Medicine, Toho University, 5-21-16 Omori-nishi, Ota-ku, Tokyo 143–8540 (Japan); Pharmaceutical Research Center, Meiji Seika Pharma Co., Ltd., 760 Morooka-cho, Kohoku-ku, Yokohama, Kanagawa 222–8567 (Japan); Nakamura, Yuji [Department of Pharmacology, Faculty of Medicine, Toho University, 5-21-16 Omori-nishi, Ota-ku, Tokyo 143–8540 (Japan); Kitahara, Ken [Department of Pharmacology, Faculty of Medicine, Toho University, 5-21-16 Omori-nishi, Ota-ku, Tokyo 143–8540 (Japan); Division of Cardiovascular Medicine, Department of Internal Medicine, Faculty of Medicine, Toho University, 6-11-1 Omori-nishi, Ota-ku, Tokyo 143–8541 (Japan); Harada, Takuma [Department of Pharmacology, Faculty of Medicine, Toho University, 5-21-16 Omori-nishi, Ota-ku, Tokyo 143–8540 (Japan); Kato, Kazuhiko; Ninomiya, Tomohisa [Pharmaceutical Research Center, Meiji Seika Pharma Co., Ltd., 760 Morooka-cho, Kohoku-ku, Yokohama, Kanagawa 222–8567 (Japan); Cao, Xin [Department of Pharmacology, Faculty of Medicine, Toho University, 5-21-16 Omori-nishi, Ota-ku, Tokyo 143–8540 (Japan); Ohara, Hiroshi [Department of Pharmacology, Faculty of Medicine, Toho University, 5-21-16 Omori-nishi, Ota-ku, Tokyo 143–8540 (Japan); Division of Cardiovascular Medicine, Department of Internal Medicine, Faculty of Medicine, Toho University, 6-11-1 Omori-nishi, Ota-ku, Tokyo 143–8541 (Japan); Izumi-Nakaseko, Hiroko [Department of Pharmacology, Faculty of Medicine, Toho University, 5-21-16 Omori-nishi, Ota-ku, Tokyo 143–8540 (Japan); Suzuki, Kokichi [Pharmaceutical Research Center, Meiji Seika Pharma Co., Ltd., 760 Morooka-cho, Kohoku-ku, Yokohama, Kanagawa 222–8567 (Japan); Ando, Kentaro [Department of Pharmacology, Faculty of Medicine, Toho University, 5-21-16 Omori-nishi, Ota-ku, Tokyo 143–8540 (Japan); and others

    2014-11-15

    Fingolimod, a sphingosine 1-phosphate (S1P) receptor subtype 1, 3, 4 and 5 modulator, has been used for the treatment of patients with relapsing forms of multiple sclerosis, but atrioventricular conduction block and/or QT-interval prolongation have been reported in some patients after the first dose. In this study, we directly compared the electropharmacological profiles of fingolimod with those of siponimod, a modulator of sphingosine 1-phosphate receptor subtype 1 and 5, using in vivo guinea-pig model and in vitro human ether-a-go-go-related gene (hERG) assay to better understand the onset mechanisms of the clinically observed adverse events. Fingolimod (0.01 and 0.1 mg/kg) or siponimod (0.001 and 0.01 mg/kg) was intravenously infused over 10 min to the halothane-anaesthetized guinea pigs (n = 4), whereas the effects of fingolimod (1 μmol/L) and siponimod (1 μmol/L) on hERG current were examined (n = 3). The high doses of fingolimod and siponimod induced atrioventricular conduction block, whereas the low dose of siponimod prolonged PR interval, which was not observed by that of fingolimod. The high dose of fingolimod prolonged QT interval, which was not observed by either dose of siponimod. Meanwhile, fingolimod significantly inhibited hERG current, which was not observed by siponimod. These results suggest that S1P receptor subtype 1 in the heart could be one of the candidates for fingolimod- and siponimod-induced atrioventricular conduction block since S1P receptor subtype 5 is localized at the brain, and that direct I{sub Kr} inhibition may play a key role in fingolimod-induced QT-interval prolongation. - Highlights: • Fingolimod and siponimod are S1P{sub 1,3,4,5} and S1P{sub 1,5} receptor modulators, respectively. • Fingolimod and siponimod induced AV block in the halothane-anesthetized guinea pigs. • S1P{sub 1} in the hearts may be the target of fingolimod- and siponimod-induced AV block. • Fingolimod directly inhibited hERG current, which was not

  8. Activitrax AAIR pacing for sinus node dysfunction after orthotopic heart transplantation: an initial report.

    Science.gov (United States)

    Loria, K; Salinger, M; McDonough, T; Frohlich, T; Arentzen, C

    1988-01-01

    Donor sinus node dysfunction is an uncommon event after orthotopic heart transplantation. In the past treatment of persistent symptomatic bradycardia in the setting of orthotopic heart transplantation has been accomplished by implantation of a single transvenous lead system with loss of atrioventricular synchrony and rate responsiveness or by implantation of a multiple transvenous lead system in which the multiple leads present a mechanical limitation to endomyocardial biopsy. To preserve atrioventricular synchrony, avoid the mechanical limitations of a ventricular lead at the time of routine biopsies, and maintain some degree of rate responsiveness during exercise, we elected to implant an activity-detecting pacing system with a single bipolar transvenous atrial lead in two of our orthotopic heart transplant recipients with persistent symptomatic donor sinus node dysfunction. This article details the techniques used and the results obtained in what we believe to be the first two implantations of this unique pacing system in orthotopic heart transplant recipients.

  9. Ny versjon av standarden ISO 15489

    Directory of Open Access Journals (Sweden)

    Herbjørn Andresen

    2016-09-01

    Full Text Available Standarden NS-ISO 15489-1:2016 er gjeldende norsk standard fra 1. juli 2016. Dette er andre versjon av ISO 15489, den første versjonen fra 2001 er ikke lenger gyldig. 2001-utgaven av ISO 15489 besto av to deler. Del 2, SN-ISO/TR 15489-2:2001 er trukket, slik at den nye ISO 15489 kun består av del 1. ISO 15489 var den første internasjonale Records Management-standarden, og har en funksjon som overordnet referansestandard for en voksende portefølje av senere standarder på tilgrensende områder. Denne artikkelen gjennomgår endringene i hovedtrekk, både i standarden ISO 15489 som sådan og i noen av de standardene som bygger videre på den.

  10. Atrial enlargement in symptomatic heart block patients with preserved left ventricular function: possibly related to atrioventricular dyssynchrony.

    Science.gov (United States)

    Lin, Yu-Sheng; Guo, G Bih-Fang; Chen, Yung-Lung; Tsai, Tzu-Hsien; Pan, Kuo-Li; Liu, Wen-Hao; Chen, Mien-Cheng

    2011-05-05

    Right ventricular apical pacing may possibly induce atrial dilatation as a consequence of atrioventricular dyssynchrony. However, atrial enlargement associated with atrioventricular dyssynchrony due to atrioventricular block has never been studied. This case-control survey involved 90 patients with symptomatic atrioventricular block [29 patients with Mobitz type 2 atrioventricular block, 22 patients with high degree of atrioventricular block and 39 patients with complete atrioventricular block]. The control group comprised 54 age- and sex-matched patients with sick sinus syndrome and intact intrinsic atrioventricular conduction. The M-mode measurements were obtained before implant and the left and right atrial areas were measured by planimetry. The peri-implant right atrial area (17.4±3.7 vs. 15.3±3.4 cm2, p=0.002), left atrial area (24.9±4.2 vs. 21.0±3.7 cm2, pblock patients than in sick sinus syndrome patients. The two groups had similar left ventricular ejection fraction. The right atrial area (p=0.01) and left atrial area (p=0.006) remained significantly greater in atrioventricular block patients than in sick sinus syndrome patients after adjustments for age, gender, body surface area, left ventricular dimension and left ventricular ejection fraction in multiple logistic regression analysis. Atrial enlargement occurs in patients with symptomatic atrioventricular block. This phenomenon is possibly related to atrioventricular dyssynchrony. Copyright © 2009 Elsevier Ireland Ltd. All rights reserved.

  11. Effects of energy delivery via a His bundle catheter during closed chest ablation of the atrioventricular conduction system.

    Science.gov (United States)

    Trantham, J L; Gallagher, J J; German, L D; Broughton, A; Guarnieri, T; Kasell, J

    1983-11-01

    In this paper we summarize our experience and report the characteristics of energy delivery in 23 patients who have undergone closed chest ablation of the normal atrioventricular (AV) conduction system for the treatment of refractory supraventricular arrhythmias. The induction of AV block was achieved by the synchronous delivery of electrical energy with a damped sinusoidal waveform utilizing a standard direct current defibrillator and a standard tripolar His bundle catheter. The procedure was well tolerated, though one patient experienced ventricular fibrillation, which was uneventfully converted with external paddles. Complete AV block was achieved in 20 of 23 patients and all were rendered arrhythmia free, though two still required antiarrhythmic drugs. A stable escape rhythm was seen in all patients with a cycle length of 1,294 +/- 243 ms. Creatine phosphokinase-MB was positive at low levels in 19 of 23 patients and cleared within 24 h. 99mTc pyrophosphate scans were faintly positive in only 2 of 22 patients. Left ventricular wall motion and ejection fractions were unchanged in 19 of 19 patients, two-dimensional echocardiography with microcavitation technique was unchanged in 12 of 12 patients, and a slight increase in pulmonary artery wedge pressure was seen in only 1 of 11 patients. Current, voltage, and their product (power) waveforms were recorded in 12 patients (12 recordings at a defibrillator setting of 200 J and 5 recordings at a defibrillator setting of 300 J) and revealed a complex voltage-current relationship due to changes occurring at the catheter electrode-tissue interface. At 200 J the peak values were 42.2 +/- 3.3 A, 2.16 +/- 0.11 kV, and 87.9 +/- 4.7 kW, while at 300 J the peak values were 58.2 +/- 2.8 A, 2.40 +/- 0.10 kV, and 134.4 +/- 6.7 kW, respectively. No instance of catheter disruption was seen, though "pitting" of the distal electrode (through which current passed) occurred in all but one catheter.

  12. Multivariat analyse av 18F-FDG PET av tre brystkreft-xenografter i mus

    OpenAIRE

    Skappel, Ingvild

    2015-01-01

    Denne masteroppgaven tar utgangspunkt i et studie hvor man har analysert bilder innhentet fra dynamisk PET (Positron Emission Tomography) av mus med implanterte menneskelige brystkreft-xenografter, utført ved Oslo Universitetssykehus i mars 2014. 2-deoksy-2-[18F]fluoro-D-glukose (FDG), en glukoseanalog merket med radioaktivt fluor (18F), er benyttet som tracer. Ved dynamisk FDG PET avbildes aktiviteten av 18F i kroppsvevet av interesse ved flere tidspunkt etter injeksjon av tracer. I denne op...

  13. Effect of atrioventricular conduction on heart rate variability

    KAUST Repository

    Ahmad, Talha Jamal

    2011-08-01

    This paper discusses the effect of atrioventricular conduction time (AVCT) on the short-term Heart Rate Variability (HRV) by computing HRV parameters using intervals between the onsets of successive P waves (PP time series) for three groups: normal, arrhythmia and sudden cardiac death (SCD) patients. A very precise wavelet transform based ECG delineator was developed to detect PP, PR and RR time series. Mean PR variation in arrhythmia and SCD group was found to be significantly high as compared to the normal group. It was observed that when PR variations in arrhythmia and SCD cases crossed a certain threshold, RR variability no longer provided a very accurate estimate of HRV. In such cases, PP variability was able to provide a better assessment of HRV. © 2011 IEEE.

  14. Reconfigureable network node

    Science.gov (United States)

    Vanderveen, Keith B [Tracy, CA; Talbot, Edward B [Livermore, CA; Mayer, Laurence E [Davis, CA

    2008-04-08

    Nodes in a network having a plurality of nodes establish communication links with other nodes using available transmission media, as the ability to establish such links becomes available and desirable. The nodes predict when existing communications links will fail, become overloaded or otherwise degrade network effectiveness and act to establish substitute or additional links before the node's ability to communicate with the other nodes on the network is adversely affected. A node stores network topology information and programmed link establishment rules and criteria. The node evaluates characteristics that predict existing links with other nodes becoming unavailable or degraded. The node then determines whether it can form a communication link with a substitute node, in order to maintain connectivity with the network. When changing its communication links, a node broadcasts that information to the network. Other nodes update their stored topology information and consider the updated topology when establishing new communications links for themselves.

  15. Down Syndrome with Complete Atrioventricular Septal Defect, Hypertrophic Cardiomyopathy, and Pulmonary Vein Stenosis.

    Science.gov (United States)

    Mahadevaiah, Guruprasad; Gupta, Manoj; Ashwath, Ravi

    2015-10-01

    The prevalence of congenital heart disease in infants with Down syndrome is 40%, compared with 0.3% in children who have normal chromosomes. Atrioventricular and ventricular septal defects are often associated with chromosomal aberrations, such as in trisomy 21, whereas hypertrophic cardiomyopathy is chiefly thought to be secondary to specific gene mutations. We found only one reported case of congenital hypertrophic cardiomyopathy and atrioventricular septal defect in an infant with Down syndrome. Here, we report atrioventricular septal defect, hypertrophic cardiomyopathy, and pulmonary vein stenosis in a neonate with Down syndrome-an apparently unique combination. In addition, we discuss the relevant medical literature.

  16. Vidareutveckling av PROFIBUS-modul

    OpenAIRE

    Forsberg, Andreas; Larsson, Christoffer

    2010-01-01

    Denna rapport beskriver ett examensarbete som gjordes på företaget Motion Control i Västerås AB. Rapporten följer projektets utvecklingssteg och beskriver hur arbetet med att ta fram elektronik och inbyggd programvara för en kommunikationsmodul har framskridit. Kommunikationsmodulen ska fungera som en länk mellan en styrenhet och en I/O-enhet.   De inledande delarna av rapporten tar upp undersökningar på kommunikationsprotokollen PROFIBUS och PROFINET som är vanliga kommunikationsmetoder inom...

  17. Permanent pacemaker implantation for late atrioventricular block in patients receiving catheter ablation for atrioventricular nodal reentrant tachycardia.

    Science.gov (United States)

    Liao, Jo-Nan; Hu, Yu-Feng; Wu, Tsu-Juey; Fong, Ann-Ning; Lin, Wei-Shiang; Lin, Yenn-Jiang; Chang, Shih-Lin; Lo, Li-Wei; Tuan, Ta-Chuan; Chang, Hung-Yu; Li, Cheng-Hung; Chao, Tze-Fan; Chung, Fa-Po; Hanafy, Dicky Armein; Lin, Wen-Yu; Huang, Jin-Long; Huang, Chin-Chou; Leu, Hsin-Bang; Lee, Pi-Chang; Chiang, Chern-En; Chen, Shih-Ann

    2013-02-15

    The present study investigated the incidence and predictors of permanent pacemaker (PPM) implantation for late atrioventricular block (AVB) in patients with atrioventricular nodal reentrant tachycardia (AVNRT) who received ablation. The data from 3,442 patients with AVNRT who received ablation were analyzed. Those who developed late AVB (>1 month after ablation) and received a PPM were identified. The incidence of PPM implantation in 1,148 matched patients with Wolff-Parkinson-White syndrome and in the whole population of Taiwan were compared. Of the patients with AVNRT receiving ablation (mean follow-up duration 128.3 ± 62.5 months), 15 (0.4%) received PPM implantation for late AVB (mean interval after catheter ablation 95.4 ± 55.0 months). Only age (odds ratio 1.05, p = 0.02) and transient AVB (odds ratio 8.55, p = 0.01) during the procedure were independently associated with PPM implantation for late AVB. The patients with AVNRT had a greater incidence of PPM implantation due to late AVB compared to the matched patients with Wolff-Parkinson-White syndrome. The annual incidence of PPM implantation for AVB was also greater in the patients with AVNRT than in the general population. In conclusion, the incidence of PPM implantation for late AVB in patients with AVNRT who received catheter ablation was low but still greater than that in patients with Wolff-Parkinson-White syndrome and the general population in Taiwan. Copyright © 2013 Elsevier Inc. All rights reserved.

  18. PREPARATION FOR RETIREMENT - AVS SEMINAR

    CERN Multimedia

    Social Service

    2001-01-01

    The 500 or so participants in the fifth Preparation for Retirement seminar held at the end of March were unfortunately deprived of the planned session on the AVS due to the unavailability of the Director of the Caisse Cantonale Genevoise de Compensation (CCGC). We have since had formal confirmation that because of an extra workload due to important changes in the Swiss tax and social legislation and the implementation this summer of the maternity insurance in Geneva, the CCGC has suspended its participation in preparation for retirement seminars in the international organisations for the time being. Conscious of the necessity of offering a session dedicated to the AVS, it is with pleasure that we can inform you that one of our legal advisers, Mr Lorenz Stampfli, has accepted to lead this session. In order to allow for adequate preparation we have reserved the following date: Wednesday 26 September from 14.00 to 16.00 in the Main Amphitheatre The session will be open to all people already registered and any o...

  19. Genome-Wide Association Study of Down Syndrome-Associated Atrioventricular Septal Defects

    National Research Council Canada - National Science Library

    Ramachandran, Dhanya; Zeng, Zhen; Locke, Adam E; Mulle, Jennifer G; Bean, Lora J H; Rosser, Tracie C; Dooley, Kenneth J; Cua, Clifford L; Capone, George T; Reeves, Roger H; Maslen, Cheryl L; Cutler, David J; Feingold, Eleanor; Sherman, Stephanie L; Zwick, Michael E

    2015-01-01

    .... We performed a genome-wide association study using logistic regression analysis on 452 individuals with Down syndrome, consisting of 210 cases with complete atrioventricular septal defects and 242...

  20. Congenital complete atrioventricular block associated with QT prolongation: Description of a patient with an unusual outcome.

    Science.gov (United States)

    Mendoza, Alberto; Belda, Silvia; Salguero, Rafael; Granados, Miguel Angel

    2010-08-01

    The association of a complete atrioventricular block with long QT syndrome is relatively common and carries a high risk of torsades de pointes (TdP) and sudden death. It is probably due to a downregulation of potassium channel currents (I (Ks) and I (Kr)) that impairs ventricular repolarization, prolongs the QT interval and increases susceptibility to TdP, so it must be considered a channelopathy. This report describes a 6 year-old boy, with a complete atrioventricular block diagnosed at 5 months of age, who at the age of 1 year started having episodes of TdP associated with a prolonged QT interval. He was treated successfully with propranolol and with a pacemaker implant. At age 3 the complete atrioventricular block reversed spontaneously to a first degree atrioventricular block.

  1. Effect of right ventricular pacing lead site on left ventricular function in patients with high-grade atrioventricular block: results of the Protect-Pace study.

    Science.gov (United States)

    Kaye, Gerald C; Linker, Nicholas J; Marwick, Thomas H; Pollock, Lucy; Graham, Laura; Pouliot, Erika; Poloniecki, Jan; Gammage, Michael

    2015-04-07

    Chronic right ventricle (RV) apical (RVA) pacing is standard treatment for an atrioventricular (AV) block but may be deleterious to left ventricle (LV) systolic function. Previous clinical studies of non-apical pacing have produced conflicting results. The aim of this randomized, prospective, international, multicentre trial was to compare change in LV ejection fraction (LVEF) between right ventricular apical and high septal (RVHS) pacing over a 2-year study period. We randomized 240 patients (age 74 ± 11 years, 67% male) with a high-grade AV block requiring >90% ventricular pacing and preserved baseline LVEF >50%, to receive pacing at the RVA (n = 120) or RVHS (n = 120). At 2 years, LVEF decreased in both the RVA (57 ± 9 to 55 ± 9%, P = 0.047) and the RVHS groups (56 ± 10 to 54 ± 10%, P = 0.0003). However, there was no significant difference in intra-patient change in LVEF between confirmed RVA (n = 85) and RVHS (n = 83) lead position (P = 0.43). There were no significant differences in heart failure hospitalization, mortality, the burden of atrial fibrillation, or plasma brain natriutetic peptide levels between the two groups. A significantly greater time was required to place the lead in the RVHS position (70 ± 25 vs. 56 ± 24 min, P < 0.0001) with longer fluoroscopy times (11 ± 7 vs. 5 ± 4 min, P < 0.0001). In patients with a high-grade AV block and preserved LV function requiring a high percentage of ventricular pacing, RVHS pacing does not provide a protective effect on left ventricular function over RVA pacing in the first 2 years. ClinicalTrials.gov number NCT00461734. Published on behalf of the European Society of Cardiology. All rights reserved. © The Author 2014. For permissions please email: journals.permissions@oup.com.

  2. Förpackning av keramiska substrat

    OpenAIRE

    Karlsson, Jan

    2008-01-01

    Detta examensarbete handlar om forpackning av keramiska substrat. Canning ar det universella namnet pa forpackning av keramiska substrat. Keramiska substrat kan vara katalysatorer eller partikelfilter som anvands som ett efterbehandlingssystem i bensin och Diesel applikationer. Examensarbetet genomfordes hos Scania CV AB. I installationsprocessen sveps en keramisk fibermatta runt det keramiska substratet. Substratet inkapslas sedan med ett metalholje. Rapporten inleds med att beskriva olika i...

  3. Valproic Acid as a Cause of Transient Atrio-Ventricular Conduction Block Episodes.

    Science.gov (United States)

    Davutoglu, Vedat; Neyal, Munife; Altunbas, Gokhan

    2017-01-01

    Herein we share, to our knowledge for the first time, a a case of valproic acid use complicated by symptomatic atrio-ventricular conduction block episodes on Holter monitoring. Symptomatic atrio-ventricular block episodes should be considered as an unusual side effect of valproic acid despite normal blood therapeutic level. Before consideration of pacemaker implantation in such cases, valproic acid usage should be investigated, and dose reduction should be attempted.

  4. Efficient Software HEVC to AVS2 Transcoding

    Directory of Open Access Journals (Sweden)

    Yucong Chen

    2016-09-01

    Full Text Available The second generation of Audio and Video coding Standard (AVS is developed by the IEEE 1857 Working Group under project 1857.4 and was standardized in 2016 by the AVS Working Group of China as the new broadcasting standard AVS2. High Efficient Video Coding (HEVC is the newest global video coding standard announced in 2013. More and more codings are migrating from H.264/AVC to HEVC because of its higher compression performance. In this paper, we propose an efficient HEVC to AVS2 transcoding algorithm, which applies a multi-stage decoding information utilization framework to maximize the usage of the decoding information in the transcoding process. The proposed algorithm achieves 11×–17× speed gains over the AVS2 reference software RD 14.0 with a modest BD-rate loss of 9.6%–16.6%.

  5. Contribution of copy-number variation to Down syndrome-associated atrioventricular septal defects.

    Science.gov (United States)

    Ramachandran, Dhanya; Mulle, Jennifer G; Locke, Adam E; Bean, Lora J H; Rosser, Tracie C; Bose, Promita; Dooley, Kenneth J; Cua, Clifford L; Capone, George T; Reeves, Roger H; Maslen, Cheryl L; Cutler, David J; Sherman, Stephanie L; Zwick, Michael E

    2015-07-01

    The goal of this study was to identify the contribution of large copy-number variants to Down syndrome-associated atrioventricular septal defects, the risk for which in the trisomic population is 2,000-fold more as compared with that of the general disomic population. Genome-wide copy-number variant analysis was performed on 452 individuals with Down syndrome (210 cases with complete atrioventricular septal defects; 242 controls with structurally normal hearts) using Affymetrix SNP 6.0 arrays, making this the largest heart study conducted to date on a trisomic background. Large, common copy-number variants with substantial effect sizes (OR > 2.0) do not account for the increased risk observed in Down syndrome-associated atrioventricular septal defects. By contrast, cases had a greater burden of large, rare deletions (P Down syndrome-associated atrioventricular septal defects, whereas large, common copy-number variants do not appear to increase the risk of Down syndrome-associated atrioventricular septal defects. The genetic architecture of atrioventricular septal defects is complex and multifactorial in nature.

  6. Arctic Visiting Speakers Series (AVS)

    Science.gov (United States)

    Fox, S. E.; Griswold, J.

    2011-12-01

    The Arctic Visiting Speakers (AVS) Series funds researchers and other arctic experts to travel and share their knowledge in communities where they might not otherwise connect. Speakers cover a wide range of arctic research topics and can address a variety of audiences including K-12 students, graduate and undergraduate students, and the general public. Host applications are accepted on an on-going basis, depending on funding availability. Applications need to be submitted at least 1 month prior to the expected tour dates. Interested hosts can choose speakers from an online Speakers Bureau or invite a speaker of their choice. Preference is given to individuals and organizations to host speakers that reach a broad audience and the general public. AVS tours are encouraged to span several days, allowing ample time for interactions with faculty, students, local media, and community members. Applications for both domestic and international visits will be considered. Applications for international visits should involve participation of more than one host organization and must include either a US-based speaker or a US-based organization. This is a small but important program that educates the public about Arctic issues. There have been 27 tours since 2007 that have impacted communities across the globe including: Gatineau, Quebec Canada; St. Petersburg, Russia; Piscataway, New Jersey; Cordova, Alaska; Nuuk, Greenland; Elizabethtown, Pennsylvania; Oslo, Norway; Inari, Finland; Borgarnes, Iceland; San Francisco, California and Wolcott, Vermont to name a few. Tours have included lectures to K-12 schools, college and university students, tribal organizations, Boy Scout troops, science center and museum patrons, and the general public. There are approximately 300 attendees enjoying each AVS tour, roughly 4100 people have been reached since 2007. The expectations for each tour are extremely manageable. Hosts must submit a schedule of events and a tour summary to be posted online

  7. Transitory complete atrioventricular block associated to ingestion of Nerium oleander.

    Science.gov (United States)

    Nishioka, S de A; Resende, E S

    1995-01-01

    Self-medication with plants can lead to severe poisoning. Oleander (Nerium oleander) is an ornamental plant whose toxicity to man is due to a mixture of nondigitalis cardiac glycosides. The clinical manifestations of oleander poisoning combine cardiac and gastrointestinal symptoms, and are similar to those of a digitalis overdose. Following the ingestion of tea made of the leaves of oleander, a 33-year-old woman developed dizziness, vomiting and abdominal cramps as main symptoms, and complete atrioventricular block that reverted within 24 hours. She remained with bradycardia, dizziness and diarrhea for about 6 days. On admission she had a serum potassium of 6.7 mEq/L and a serum creatinine of 2.3 mg%, that progressively returned to normal levels. Clinicians must include oleander poisoning in the differential diagnosis of bradyarrhythmias, particularly in children and young people without known cardiovascular disease, in areas where this plant either is used as a herbal medicine or is known as poisonous.

  8. Cilia gene mutations cause atrioventricular septal defects by multiple mechanisms.

    Science.gov (United States)

    Burnicka-Turek, Ozanna; Steimle, Jeffrey D; Huang, Wenhui; Felker, Lindsay; Kamp, Anna; Kweon, Junghun; Peterson, Michael; Reeves, Roger H; Maslen, Cheryl L; Gruber, Peter J; Yang, Xinan H; Shendure, Jay; Moskowitz, Ivan P

    2016-07-15

    Atrioventricular septal defects (AVSDs) are a common severe form of congenital heart disease (CHD). In this study we identified deleterious non-synonymous mutations in two cilia genes, Dnah11 and Mks1, in independent N-ethyl-N-nitrosourea-induced mouse mutant lines with heritable recessive AVSDs by whole-exome sequencing. Cilia are required for left/right body axis determination and second heart field (SHF) Hedgehog (Hh) signaling, and we find that cilia mutations affect these requirements differentially. Dnah11avc4 did not disrupt SHF Hh signaling and caused AVSDs only concurrently with heterotaxy, a left/right axis abnormality. In contrast, Mks1avc6 disrupted SHF Hh signaling and caused AVSDs without heterotaxy. We performed unbiased whole-genome SHF transcriptional profiling and found that cilia motility genes were not expressed in the SHF whereas cilia structural and signaling genes were highly expressed. SHF cilia gene expression predicted the phenotypic concordance between AVSDs and heterotaxy in mice and humans with cilia gene mutations. A two-step model of cilia action accurately predicted the AVSD/heterotaxyu phenotypic expression pattern caused by cilia gene mutations. We speculate that cilia gene mutations contribute to both syndromic and non-syndromic AVSDs in humans and provide a model that predicts the phenotypic consequences of specific cilia gene mutations. © The Author 2016. Published by Oxford University Press. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

  9. Congenital complete atrioventricular block in the early pediatric population

    Directory of Open Access Journals (Sweden)

    Riccardo Cappato

    2010-05-01

    Full Text Available Congenital complete atrioventricular block (CCAVB is a rare potentially lethal disease with an estimated incidence of 1 every 15.000 to 20.000 live born infants. In structurally normal hearts two kinds of congenital heart block can be identified: one usually diagnosed in utero associated with the circulating maternal anti-SS-A/Ro and anti-SS-B/La antibodies, the other kind is detected later in the neonatal period or during the infancy or childhood and present no clear relation with maternal antibodies. Nowadays, the diagnosis can be made in utero as early as between week 16 and 28 of gestation by foetal echocardiography. The mortality in isolated CCAVB is estimated between 8 and 16% and between 4 and 8% in children and adults. The mortality and morbidity of patients diagnosed outside the neonatal period is significantly lower than those with a in utero diagnosis. Risk factors for worse outcome in CCAVB are the foetal diagnosis, the presence of hydrops fetalis, delivery at

  10. Situasjonsbestemt ledelse av studentgrupper i friluftsliv

    Directory of Open Access Journals (Sweden)

    Odd Lennart Vikene

    2014-05-01

    Full Text Available Artikkelen gir et praktisk eksempel på hvordan ulike studentgrupper i forbindelse med bygging av nødbivuakk i vinterfjellet opplevde min situasjonsbestemte ledelse som veileder. Teorigrunnlaget viser til situasjonsbestemte ledelsesmodeller og hva som kjennetegner god veiledning i friluftsliv. Datainnsamlingen bygger på kvantitative data fra et spørreskjema og benyttes til å analysere studentenes opplevelse av veileders ledelse ut i fra rangeringsmetoden Visuell Analog Skala (VAS. Fra samme spørreskjema var det også et åpent spørsmål som benyttes til refleksjon over studentenes opplevelse av sikkerhet i undervisningssituasjonen. Resultatene viser at studentgruppene opplevde klare ledelsesforskjeller gjennom de ulike fasene som ledelsen ble delt opp i, men at ledelsesatferden varierte lite i forhold til gruppenes erfaringsgrunnlag. Resultatene tyder på at jeg som veileder i stor grad har blitt påvirket av mine tidligere erfaringer og den potensielle risikoen som ligger ved aktiviteten. Selv om den situasjonsbestemte ledelsen varierte lite mellom de tre gruppene, viser resultatenes store standardavvik at de ulike smågruppene opplevde at ledelsen varierte. Dette tyder på at jeg som veileder til en viss grad har evnet å benytte situasjonsbestemt ledelse i praksis. På grunn av studentgruppenes relativt like oppfatning av ledelsen i de ulike fasene, viser resultatene også noe av vanskelighetene veileder har i forhold til å gjøre en korrekt vurdering av gruppens evner og erfaring i relasjon til læringssituasjonene som oppstår. Sentralt for ledelsen er likevel at studentgruppene opplevde ledelsen som betryggende, noe som gir studentene et godt grunnlag for senere opplevelser i tilknytning til vinterfriluftsliv og bygging av nødbivuakk.

  11. Fetal tachyarrhythmia with 1:1 atrioventricular conduction. Adenosine infusion in the umbilical vein as a diagnostic test

    Directory of Open Access Journals (Sweden)

    Tiago L. L. Leiria

    2000-07-01

    Full Text Available This is the report of a case of fetal tachyarrhythmia with 1:1 atrioventricular conduction detected by pre-natal echocardiography in a fetus at 25-weeks gestation. Adenosine infusion via cordocentesis was performed as a diagnostic test to differentiate between atrioventricular nodal reentrant supraventricular tachyarrhythmia and atrial flutter. After infusion, transient 2:1 atrioventricular dissociation was obtained and the diagnosis of atrial flutter was made. Transplacental therapy with digoxin and amiodarone was then successfully used.

  12. Introduksjon til bruk av prosessimuleringsprogrammet Aspen Plus

    OpenAIRE

    Sjøvik, Torbjørn Eig

    2013-01-01

    Denne masteroppgaven er en introduksjon i bruk av prosessimuleringsprogrammet Aspen Plus, med tanke på framtidig bruk i prosessfagene ved institutt for matematiske realfag og teknologi ved Universitetet for Miljø og Biovitenskap. Målet var å finne ut om programmet er egnet å bruke i undervisning av prosessfag. For å løse problemstillingen ble simuleringer i Aspen Plus satt opp og løst, med økende grad av vanskelighet. Dette resulterte i en brukerveiledning, som kan hjelpe nye brukere i å k...

  13. Complete atrioventricular block in acute coronary syndrome: prevalence, characterisation and implication on outcome.

    Science.gov (United States)

    Aguiar Rosa, Silvia; Timóteo, Ana Teresa; Ferreira, Lurdes; Carvalho, Ramiro; Oliveira, Mario; Cunha, Pedro; Viveiros Monteiro, André; Portugal, Guilherme; Almeida Morais, Luis; Daniel, Pedro; Cruz Ferreira, Rui

    2017-06-01

    The aim was to characterise acute coronary syndrome patients with complete atrioventricular block and to assess the effect on outcome. Patients admitted with acute coronary syndrome were divided according to the presence of complete atrioventricular block: group 1, with complete atrioventricular block; group 2, without complete atrioventricular block. Clinical, electrocardiographic and echocardiographic characteristics and prognosis during one year follow-up were compared between the groups. Among 4799 acute coronary syndrome patients admitted during the study period, 91 (1.9%) presented with complete atrioventricular block. At presentation, group 1 patients presented with lower systolic blood pressure, higher Killip class and incidence of syncope. In group 1, 86.8% presented with ST-segment elevation myocardial infarction (STEMI), and inferior STEMI was verified in 79.1% of patients in group 1 compared with 21.9% in group 2 ( Pcoronary intervention ( P<0.001). During hospitalisation group 1 had worse outcomes, with a higher incidence of cardiogenic shock (33.0% vs. 4.5%; P<0.001), ventricular arrhythmias (17.6% vs. 3.6%; P<0.001) and the need for invasive mechanical ventilation (25.3% vs. 5.1%; P<0.001). After a propensity score analysis, in a multivariate regression model, complete atrioventricular block was an independent predictor of hospital mortality (odds ratio 3.671; P=0.045). There was no significant difference in mortality at one-year follow-up between the study groups. Complete atrioventricular block conferred a worse outcome during hospitalisation, including a higher incidence of cardiogenic shock, ventricular arrhythmias and death.

  14. Echocardiographic estimation of acute haemodynamic response during optimization of multisite pace-maker using different pacing modalities and atrioventricular delays

    Directory of Open Access Journals (Sweden)

    Šalinger-Martinović Sonja

    2009-01-01

    Full Text Available Background/Aim. Cardiac resynchronization therapy (CRT improves ventricular dyssynchrony and is associated with an improvement in symptoms, quality of life and prognosis in patients with severe heart failure and intraventricular conduction delay. Different pacing modalities produce variable activation patterns and may be a cause of different haemodynamic changes. The aim of our study was to investigate acute haemodynamic changes with different CRT configurations during optimization procedure. Methods. This study included 30 patients with severe left ventricular systolic dysfunction and left bundle branch block with wide QRS (EF 24.33 ± 3.7%, QRS 159 ± 17.3 ms, New York Heart Association III/IV 25/5 with implanted CRT device. The whole group of patients had severe mitral regurgitation in order to measure dP/dt. After implantation and before discharge all the patients underwent optimization procedure guided by Doppler echocardiography. Left and right ventricular pre-ejection intervals (LVPEI and RVPEI, interventricular mechanical delay (IVD and the maximal rate of ventricular pressure rise during early systole (max dP/dt were measured during left and biventricular pacing with three different atrioventricular (AV delays. Results. After CRT device optimization, optimal AV delay and CRT mode were defined. Left ventricular pre-ejection intervals changed from 170.5 ± 24.6 to 145.9 ± 9.5 (p < 0.001, RVPEI from 102.4 ± 15.9 to 119.8 ± 10.9 (p < 0.001, IVD from 68.1 ± 18.3 to 26.5 ± 8.2 (p < 0.001 and dP/dt from 524.2 ± 67 to 678.2 ± 88.5 (p < 0.01. Conclusion. In patients receiving CRT echocardiographic assessment of the acute haemodynamic response to CRT is a useful tool in optimization procedure. The variability of Doppler parameters with different CRT modalities emphasizes the necessity of individualized approach in optimization procedure.

  15. Outcomes of AV Fistulas and AV Grafts after Interventional Stent-Graft Deployment in Haemodialysis Patients

    Energy Technology Data Exchange (ETDEWEB)

    Schmelter, Christopher, E-mail: christopher.schmelter@klinikum-ingolstadt.de; Raab, Udo, E-mail: udo.raab@klinikum-ingolstadt.de [Klinikum Ingolstadt, Department of Diagnostic and Interventional Radiology (Germany); Lazarus, Friedrich, E-mail: friedrich.lazarus@klinikum-ingolstadt.de [Klinikum Ingolstadt, Department of Nephrology (Germany); Ruppert, Volker, E-mail: volker.ruppert@klinikum-ingolstadt.de [Klinikum Ingolstadt, Department of Vascular Surgery (Germany); Vorwerk, Dierk, E-mail: dierk.vorwerk@klinikum-ingolstadt.de [Klinikum Ingolstadt, Department of Diagnostic and Interventional Radiology (Germany)

    2015-08-15

    PurposeThe study was designed to assess outcomes of arteriovenous (AV) accesses after interventional stent-graft deployment in haemodialysis patients.Materials and Methods63 haemodialysis patients with 66 AV fistulas and AV grafts were treated by interventional stent-graft deployment from 2006 to 2012 at our hospital. Data of these patients were retrospectively analysed for location of deployed stent-grafts, occurrence and location of (re-)stenosis and (re-)thrombosis. Complex stenosis was the most frequent indication for stent-graft deployment (45.5 %), followed by complications of angioplasty with vessel rupture or dissection (31.8 %).ResultsA high rate of procedural success was achieved (98.5 %). The most frequent location of the deployed stent-graft was the draining vein (66.7 %). Stent-graft deployment was more frequent in AV grafts than in AV fistulas. Primary patency was 45.5 % at 6 month, 31.3 % at 12 month and 19.2 % at 24 month. Primary patency was significantly better for AV fistulas than for AV grafts with deployed stent-grafts. Patency of the deployed stent-graft was much better than overall AV access primary patency with deployed stent-graft. Re-stenosis with thrombosis was the most frequent indication for re-intervention. Most frequent location of re-stenosis was the draining vein (37.1 %), followed by stenosis at the AV access (29.5 %) and the deployed stent-graft (23.5 %).ConclusionRe-stenosis and re-thrombosis remain frequent in AV fistulas and AV grafts in haemodialysis patients despite stent-graft deployment. Re-stenosis of the deployed stent-graft is, only in the minority of the cases, responsible for AV access dysfunction.

  16. Fortid nr. 3/2008. Ringvirkninger av Israels opprettelse

    OpenAIRE

    2008-01-01

    Leder (s. 5) Korttekster: Mindre nasjon. Mer teori. Av Geirr Olav Gram (s. 7-8) Historiefaget i all sin bredde. Av Maria Halle (s. 8-9) Tema: Ringvirkninger av Israels opprettelse Al-Nakba 1948 - 60 år siden katastrofen. Av Jørgen Jensehaugen (s. 9-10) "Et folk som alle andre": Norsk-jødiske perspektiver på opprettelsen av Israel. Av Vibeke Kieding Banik (s. 12-19) Remembering Al-Nakba 60 years later. Av Ahmad H. Sa'di (s. 20-26) Israel and the exodus of the Jews of ...

  17. Opplevelse av luksus : en konformativ og eksplorativ analyse av luksusbegrepet mot smarttelefoner og nettbrett.

    OpenAIRE

    Akimov, Sergej Aleksandrovitsch

    2011-01-01

    Formålet med denne studien var å undersøke luksusopplevelsen til smarttelefoner og nettbrett, med utgangspunkt i underliggende luksusmotiver. Den fastsatte problemstillingen var todelt. For det første skulle jeg identifisere graden av luksus på smarttelefoner av to ulike merker og hvilke motiver som var de mest fremtredende for disse produktene. Den andre delen av problemstillingen fokuserte på hvorvidt det eksisterer forskjeller i opplevd luksus på ett merke, på tvers av to produktkategorier...

  18. Forandring av selvoppfatning blant studenter i løpet av en bachelorutdanning i sykepleie

    OpenAIRE

    John Olav Bjørnestad; Anne Valen-Senstad Skisland; Olle Söderhamn

    2010-01-01

    Selvoppfatning er av betydning for faglig framgang og kreativitet. Hensikten med denne studien var å beskrive forandring av selvoppfatning hos en gruppe sykepleierstudenter i løpet av sin treårige bachelorutdanning. En studiegruppe med 127 sykepleierstudenter ved en norsk høgskole besvarte et spørreskjema i første og siste studieår. Skalaer for måling av generell selvoppfatning og regelbevissthet samt spørsmål om bakgrunnsvariabler inngikk i spørreskjemaet. Resultatene viste at selvoppfatning...

  19. Forandring av selvoppfatning blant studenter i løpet av en bachelorutdanning i sykepleie

    Directory of Open Access Journals (Sweden)

    John Olav Bjørnestad

    2010-01-01

    Full Text Available Selvoppfatning er av betydning for faglig framgang og kreativitet. Hensikten med denne studien var å beskrive forandring av selvoppfatning hos en gruppe sykepleierstudenter i løpet av sin treårige bachelorutdanning. En studiegruppe med 127 sykepleierstudenter ved en norsk høgskole besvarte et spørreskjema i første og siste studieår. Skalaer for måling av generell selvoppfatning og regelbevissthet samt spørsmål om bakgrunnsvariabler inngikk i spørreskjemaet. Resultatene viste at selvoppfatningen økte signifikant i løpet av utdanningen i den totale studiegruppen, og viktige faktorer var barn og opplevelse av tilfredshet. For ca 45% av deltakerne var selvoppfatningen enten lavere eller uforandret. Regelbevissthet minket i løpet av utdanningen og var ikke assosiert til studentenes selvoppfatning. Fortsatt forskning behøves for å klarlegge mulige påvirkningsfaktorer og for å finne tiltak som kan fremme en positiv utvikling av selvoppfatning hos studenter.

  20. Konstruktion av hisslås

    OpenAIRE

    Lundin, Christian; Dalstam, Robert

    2010-01-01

    Examensarbetet ”Konstruktion av hisslås” som utförts på avdelningen för maskinteknik vid Blekinge Tekniska Högskola i samarbete med Nami lift AB i Tollarp. Dagens hisslås köper Nami av en leverantör som nu blivit uppköpta av Namis konkurrent. Därför vill de undersöka om det finns en möjlighet att tillverka egna lås till ett billigare pris. Önskemålet var att låset skulle vara en elektromekanisk konstruktion som drivs av en solenoid och låset måste uppfylla de säkerhetskrav som finns för hissa...

  1. Distributed Trust Management and Rogue AV Software

    Science.gov (United States)

    2010-06-10

    Software Secured Order 0 WIN PC® Defender 6 Months License SubsaiJtjon indudes ~ version updates, definition updates, standart rustomer support... standart customer support for 1 year. Only today limited ollerwith special discount~ $69.99. Q Lifetime UNUMITED LlceMt, Best Cholet ! WIN PC...2010 Basic Business Model • Rogue AV basic: $0 • Rogue AV full: $30-$100 • Multi-year licensing: ~$20 more • Bundling other applications: ~$20 more

  2. Konformasjonsanalyse og teoretiske beregninger av morfin

    OpenAIRE

    Syvertsen, Linda

    2013-01-01

    Master i biomedisin Morfin og morfinderivater er de beste smertestillende medisinene vi har i dag. Dessverre har disse medikamentene en mørk bakside i form av alvorlige bivirkninger som blant annet eufori, avhengighet og respirasjonsundertrykkelse. Til tross for omfattende forskning, har man hittil ikke klart å utvikle morfinderivater med like god smertestillende effekt, men med færre alvorlige bivirkninger. Mye forskningsarbeid har blitt utført i forbindelse med fremstilling av ulike deri...

  3. Genome-Wide Association Study of Down Syndrome-Associated Atrioventricular Septal Defects.

    Science.gov (United States)

    Ramachandran, Dhanya; Zeng, Zhen; Locke, Adam E; Mulle, Jennifer G; Bean, Lora J H; Rosser, Tracie C; Dooley, Kenneth J; Cua, Clifford L; Capone, George T; Reeves, Roger H; Maslen, Cheryl L; Cutler, David J; Feingold, Eleanor; Sherman, Stephanie L; Zwick, Michael E

    2015-07-20

    The goal of this study was to identify the contribution of common genetic variants to Down syndrome-associated atrioventricular septal defect, a severe heart abnormality. Compared with the euploid population, infants with Down syndrome, or trisomy 21, have a 2000-fold increased risk of presenting with atrioventricular septal defects. The cause of this increased risk remains elusive. Here we present data from the largest heart study conducted to date on a trisomic background by using a carefully characterized collection of individuals from extreme ends of the phenotypic spectrum. We performed a genome-wide association study using logistic regression analysis on 452 individuals with Down syndrome, consisting of 210 cases with complete atrioventricular septal defects and 242 controls with structurally normal hearts. No individual variant achieved genome-wide significance. We identified four disomic regions (1p36.3, 5p15.31, 8q22.3, and 17q22) and two trisomic regions on chromosome 21 (around PDXK and KCNJ6 genes) that merit further investigation in large replication studies. Our data show that a few common genetic variants of large effect size (odds ratio >2.0) do not account for the elevated risk of Down syndrome-associated atrioventricular septal defects. Instead, multiple variants of low-to-moderate effect sizes may contribute to this elevated risk, highlighting the complex genetic architecture of atrioventricular septal defects even in the highly susceptible Down syndrome population. Copyright © 2015 Ramachandran et al.

  4. Third-degree AV block from extended-release diltiazem ingestion in a nine-month-old.

    Science.gov (United States)

    Wills, Brandon K; Liu, J Marc; Wahl, Michael

    2010-04-01

    Calcium channel blocker (CCB) overdose is associated with dysrhythmias and atrioventricular (AV) block, however, experience with infant CCB overdose is limited. A 9-month-old girl was found playing with tablets of extended-release diltiazem 120 mg. The patient had two episodes of emesis, which contained pill fragments, and was brought to the Emergency Department (ED) 4.5 h after being found. Vital signs were: rectal temperature 37.1 degrees C, pulse 87 beats/min, respiratory rate 30-40 breaths/min, blood pressure 72/48 mm Hg, and oxygen saturation (SpO(2)) 99% on room air. Otherwise, the patient was well-appearing, with normal skin color and examination. The electrocardiogram revealed third-degree atrioventricular block with a ventricular rate of 90 beats/min, QRS 68 ms, and QTc 411 ms. Atropine 0.1 mg i.v. was given, which increased the heart rate to 100-110 beats/min. Calcium gluconate 500 mg was also given intravenously. Laboratory evaluation revealed bicarbonate 17 mEq/L, anion gap 16, and glucose 129 mg/dL. On hospital day 1, the patient was noted to have a junctional rhythm with a rate of 90-100, and systolic blood pressure of 80-90 mm Hg. No additional medications were given. Early on day 2, the patient converted spontaneously to a normal sinus rhythm and was discharged approximately 42 h after presentation to the ED. In addition to bradycardia and hypotension, this 9-month-old patient manifested third-degree AV block after ingesting extended-release diltiazem. Copyright 2010 Elsevier Inc. All rights reserved.

  5. Node Resource Tape

    Science.gov (United States)

    2001-01-01

    This video shows footage from the construction of the International Space Station's Node 1 at Marshall Space Flight Center. The Expedition 1 crew, William Shepherd, Yuri Gidzenko, and Sergei Krikalev, inspects the Node.

  6. Multiple node remote messaging

    Energy Technology Data Exchange (ETDEWEB)

    Blumrich, Matthias A. (Ridgefield, CT); Chen, Dong (Croton on Hudson, NY); Gara, Alan G. (Mount Kisco, NY); Giampapa, Mark E. (Irvington, NY); Heidelberger, Philip (Cortlandt Manor, NY); Ohmacht, Martin (Yorktown Heights, NY); Salapura, Valentina (Chappaqua, NY); Steinmacher-Burow, Burkhard (Esslingen, DE); Vranas, Pavlos (Danville, CA)

    2010-08-31

    A method for passing remote messages in a parallel computer system formed as a network of interconnected compute nodes includes that a first compute node (A) sends a single remote message to a remote second compute node (B) in order to control the remote second compute node (B) to send at least one remote message. The method includes various steps including controlling a DMA engine at first compute node (A) to prepare the single remote message to include a first message descriptor and at least one remote message descriptor for controlling the remote second compute node (B) to send at least one remote message, including putting the first message descriptor into an injection FIFO at the first compute node (A) and sending the single remote message and the at least one remote message descriptor to the second compute node (B).

  7. Modular sensor network node

    Science.gov (United States)

    Davis, Jesse Harper Zehring [Berkeley, CA; Stark, Jr., Douglas Paul; Kershaw, Christopher Patrick [Hayward, CA; Kyker, Ronald Dean [Livermore, CA

    2008-06-10

    A distributed wireless sensor network node is disclosed. The wireless sensor network node includes a plurality of sensor modules coupled to a system bus and configured to sense a parameter. The parameter may be an object, an event or any other parameter. The node collects data representative of the parameter. The node also includes a communication module coupled to the system bus and configured to allow the node to communicate with other nodes. The node also includes a processing module coupled to the system bus and adapted to receive the data from the sensor module and operable to analyze the data. The node also includes a power module connected to the system bus and operable to generate a regulated voltage.

  8. Related Drupal Nodes Block

    NARCIS (Netherlands)

    Van der Vegt, Wim

    2010-01-01

    Related Drupal Nodes Block This module exposes a block that uses Latent Semantic Analysis (Lsa) internally to suggest three nodes that are relevant to the node a user is viewing. This module performs three tasks. 1) It periodically indexes a Drupal site and generates a Lsa Term Document Matrix.

  9. Acute evaluation of programmer-guided AV/PV and VV delay optimization comparing an IEGM method and echocardiogram for cardiac resynchronization therapy in heart failure patients and dual-chamber ICD implants.

    Science.gov (United States)

    Baker, James H; McKenzie, John; Beau, Scott; Greer, G Stephen; Porterfield, James; Fedor, Matthew; Greenberg, Steven; Daoud, Emile G; Corbisiero, Raffaele; Bailey, J Russell; Porterfield, Linda

    2007-02-01

    Intracardiac delay optimization of biventricular and dual-chamber pacing devices currently relies on time-consuming echocardiographic measurements. A novel intracardiac electrogram (IEGM) method for atrioventricular (AV/PV) and interventricular (VV) delay optimization was developed, which can be performed during routine device follow-up. In this prospective, nonrandomized, multi-center trial, patients previously implanted with St. Jude Medical cardiac resynchronization therapy defibrillator (CRT-D) devices or dual-chamber implantable cardioverter defibrillators (ICDs) underwent standard AV/PV and/or VV delay optimization guided by Doppler echocardiogram measurements of the maximum aortic velocity time integral (aortic VTI). Aortic VTI measurements applying the IEGM method recommended delays were then obtained in all patients. Fifty-eight patients (age: 68 +/- 11 years; 81% male; 74% ischemic) and 57 patients (age: 71 +/- 10 years; 74% male; 71% ischemic) were enrolled for AV/PV and VV delay evaluation, respectively. An independent core lab determined the maximum aortic VTIs. Data analysis of the AV, PV, and VV delays demonstrated the concordance correlation coefficient (CCC) between the standard method aortic VTI values and the IEGM method aortic VTI values was 97.5%, 96.1%, and 96.6%, respectively. All analyses demonstrated that the CCC > 90% (P method provides a reliable and simpler alternative to standard techniques for the optimization of AV/PV and VV delay settings in patients with CRT-D devices and dual-chamber ICDs.

  10. Dicty_cDB: FC-AV24 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AV24 (Link to dictyBase) - - - Contig-U16482-1 FC-AV24E (Li...nk to Original site) - - - - - - FC-AV24E 591 Show FC-AV24 Library FC (Link to library) Clone ID FC-AV24 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AV/FC-AV24Q.Seq.d/ Representative seq. ID FC-AV...24E (Link to Original site) Representative DNA sequence >FC-AV24 (FC-AV24Q) /CSM/FC/FC-AV/FC-AV24Q.Seq....RFWYFLSKIVKMKKSTGEIL NVTEIFEDKPQKVKNFGVFIRYNSRSGTHNIYKEYRDLTRCGAVSQMYDEMASRHSARES SIHIIDIKEIAASLTRRANTKQFHDS

  11. Myocardial infarction, symptomatic third degree atrioventricular block and pulmonary embolism caused by thalidomide: a case report.

    Science.gov (United States)

    Zhang, Shengyu; Yang, Jing; Jin, Xiaofeng; Zhang, Shuyang

    2015-12-18

    Thalidomide has been reported to cause numerous thromboembolic events. Deep vein thrombosis and pulmonary embolism are more common. It can also cause bradycardia and even total atrioventricular block. Rarely, it causes coronary artery spasm and even myocardial infarction. But almost simultaneous onset of myocardial infarction, third degree atrioventricular block and pulmonary embolism in one patient has not been reported so far. A 53-year old man presented because of chest pain, nausea and then syncope for several minutes. Previous medical history included neurodermitis for which thalidomide was given and hypercholesterolemia with simvastatin taking. The patient didn't exhibit any other established risk factors for coronary artery disease. Electrocardiography showed sinus rhythm with third degree atrioventricular block and complete right bundle branch block, and precordial leads ST segment elevation. The diagnosis of acute coronary syndrome was suspected, but further coronary angiography demonstrated no flow-limiting lesions in coronary arteries, and temporary pacemaker was implanted. After admission, low SpO2 and elevated D-dimer level was mentioned. Further computed tomography pulmonary angiography revealed pulmonary embolism. Thalidomide was thought to be the cause of hypercoagulability and coronary spasm, so it was ceased immediately. Therapeutic low molecule weight heparin was initiated and then switched to warfarin with appropriate INR, and nifedipine was described for coronary spasm. The patient's symptoms completely relived and SpO2 recovered, and atrioventricular block had disappeared during hospitalization with pacemaker removed. This is the very first case in which myocardial infarction, third degree atrioventricular block and pulmonary embolism almost simultaneously developed. We should be ware that anti-thrombotic prophylaxis, which needs further investigation for optimal drug and dosage, may be beneficial in thalidomide therapy. And it is also

  12. Arvelig hemokromatose - nytten av screening

    Directory of Open Access Journals (Sweden)

    Arne Åsberg

    2009-10-01

    Full Text Available Arvelig hemokromatose fører til jernopphopning i kroppen, men gir sjelden alvorlig helseskade. Nesten alle hemokromatosepasienter i vårt land er homozygote for C282Y-mutasjonen i HFE-genet. Omtrent 7 per 1000 innbyggere har denne genotypen. Alvorlig syke blir bare omkring 5-15% av homozygote menn og nesten ingen kvinner. Likevel er det holdepunkter for at screening for hemokromatose blant friske, yngre menn kan være kostnadseffektivt. Det er relativt lett å påvise om en person er disponert for sykdommen, i god tid før den bryter ut, og forebyggende behandling er billig og effektiv. Imidlertid kan vi ikke forutsi hvilke screeningpositive personer som ubehandlet får alvorlig sykdom. Et kontrollert forsøk med screening bør gjennomføresHereditary hemochromatosis – benefits of screening. Hereditary hemochromatosis leads to iron accumulation in the body; however, serious illness due to hemochromatosis is rare. In Norway, almost all patients with hemochromatosis are homozygous for the C282Ymutation in the HFE-gene, a genotype carried by about 7 per 1000 inhabitants. Serious complications are seen in only about 5-15% of homozygous men and in very few women. Nevertheless, screening young men for hemochromatosis may be cost-effective. Detecting predisposed men is relatively straightforward, and prophylactic treatment is cheap and effective. However, we can not predict, among screen-positive men, the few who untreated will become seriously ill. A controlled screening trial should be conducted.

  13. Mönsteranalys av inomhusluft. Undersökning av luftkvaliteten i sjuka hus med flytspackelproblem

    OpenAIRE

    Bornehag, Carl-Gustaf

    1994-01-01

    Den hälsomässiga effekten som rapporteras i samband med sjuka-hus syndromet (SBS), vars orsak är okänd, kan betraktas som ett mönster av icke specifika symptom såsom irritationer i ögon, näsa och mun, upplevelser av torra sletnhinnor och hud, hudrodnad, mental trötthet och upplevelse av svag men ihållande lukt. Aven exponeringar i inomhusluften kan beskrivas som ett mönster av en mängd olika ämnen, exempelvis VOC, partiklar, sporer m. m. Detta innebär att en av svårigheterna med att undersöka...

  14. Läs med flyt! : - en studie av elevers tidiga utveckling av avkodning

    OpenAIRE

    Bryne, Camilla

    2013-01-01

    Syftet med detta arbete är att studera elevers tidiga utveckling av förmågan att avkoda text och attbeskriva huvudtyper av olika utvecklingsvägar. Frågor som besvaras är vilka steg som kanidentifieras i utvecklingen av förmågan av avkoda text i den tidiga läsutvecklingen i årskurs ettoch två samt vilka huvudtyper av utvecklingsvägar som kan identifieras. För att svara på dessafrågor har 46 elevers tidiga läsning analyserats vid tre tillfällen under ett år. Vid läsningenanalyseras fyra olika a...

  15. [Atrioventricular defect with 2 valves associated with absence of the pericardium. Report of a case].

    Science.gov (United States)

    Miranda-Chávez, Irma; Muñoz-Castellanos, Luis; Kimura-Hayama, Erick; Vidal-Rojo, Paola; Figueroa-Solano, Javier; de Micheli Serra, Alfredo; Buendía-Hernández, Alfonso

    2013-01-01

    We present a case of a patient with a cardiac malformation that represents a form of embryo-anatomical transition of an atrioventricular septal defect between a 2 valves form to a common valve form. This entity was associated with pericardium absence. Throughout several studies we have precisely established a diagnostic sequence by determining the adequate contribution of each method and we have been able to clear out the proper nomenclature of the atrioventricular cushion defect. Copyright © 2012 Instituto Nacional de Cardiología Ignacio Chávez. Published by Masson Doyma México S.A. All rights reserved.

  16. Biventricular pacing preserves left ventricular performance in patients with high-grade atrio-ventricular block: a randomized comparison with DDD(R) pacing in 50 consecutive patients.

    Science.gov (United States)

    Albertsen, Andi E; Nielsen, Jens C; Poulsen, Steen H; Mortensen, Peter T; Pedersen, Anders K; Hansen, Peter S; Jensen, Henrik K; Egeblad, Henrik

    2008-03-01

    We aimed to investigate whether biventricular (BiV) pacing minimizes left ventricular (LV) dyssynchrony and preserves LV ejection fraction (LVEF) as compared with standard dual-chamber DDD(R) pacing in consecutive patients with high-grade atrio-ventricular (AV) block. Fifty patients were randomized to DDD(R) pacing or BiV pacing. LVEF was measured using three-dimensional echocardiography. Tissue-Doppler imaging was used to quantify LV dyssynchrony in terms of number of segments with delayed longitudinal contraction (DLC). LVEF was not different between groups after 12 months (P = 0.18). In the DDD(R) group LVEF decreased significantly from 59.7(57.4-61.4)% at baseline to 57.2(52.1-60.6)% at 12 months of follow-up (P = 0.03), whereas LVEF remained unchanged in the BiV group [58.9(47.1-61.7)% at baseline vs. 60.1(55.2-63.3)% after 12 months (P = 0.15)]. Dyssynchrony was more prominent in the DDD(R) group than in the BiV group at baseline (2.2 +/- 2.2 vs. 1.4 +/- 1.3 segments with DLC per patient, P = 0.10); and at 12 month follow-up (1.8 +/- 1.9 vs. 0.8 +/- 0.9 segments with DLC per patient, P = 0.02). NT-proBNP was unchanged in the DDD(R) group during follow-up (122 +/- 178 pmol/L vs. 91 +/- 166 pmol/L, NS) but decreased significantly in the BiV-group (from 198 +/- 505 pmol/L to 86 +/- 95 pmol/L after 12 months, P = 0.02). BiV pacing minimizes LV dyssynchrony, preserves LV function, and reduces NT-proBNP in contrast to DDD(R) pacing in patients with high-grade AV block.

  17. Regional utbredelse av elbiler i Norge fram mot 2030

    OpenAIRE

    Hebib, Amar; Strandhagen, Stig Carlson

    2016-01-01

    I denne oppgaven har vi prognostisert utbredelsen av elektriske biler i Norge frem mot 2030. Primærkilden er Norsk Elbilforenings spørreundersøkelse fra 2014. Ved hjelp av den statistiske programvaren SPSS har vi analysert ulike årsaker til valg av elektriske biler i Bergen, Oslo, Stavanger, Trondheim og resten av landet. Vi har visuelt fremstilt fordelingen av de elektriske kjøretøyene i Norge ved bruk av kartprogramvaren ArcMap, og utført en litteraturstudie der vi har sett på dagens virkem...

  18. Regional utbredelse av elbiler i Norge fram mot 2030

    OpenAIRE

    Hebib, Amar; Strandhagen, Stig Carlson

    2015-01-01

    I denne oppgaven har vi prognostisert utbredelsen av elektriske biler i Norge frem mot 2030. Primærkilden er Norsk Elbilforenings spørreundersøkelse fra 2014. Ved hjelp av den statistiske programvaren SPSS har vi analysert ulike årsaker til valg av elektriske biler i Bergen, Oslo, Stavanger, Trondheim og resten av landet. Vi har visuelt fremstilt fordelingen av de elektriske kjøretøyene i Norge ved bruk av kartprogramvaren ArcMap, og utført en litteraturstudie der vi har sett på dagens virkem...

  19. Veileder for kravspesifikasjon for leie av kontorarealer

    DEFF Research Database (Denmark)

    Førland-Larsen, Arne

    Investorer og leietakere blir stadig mer interessert i helse- og miljøkvaliteter. Men kunnskapen er lav hos de fleste om hva de skal etterspørre og hvordan slike kvaliteter kan dokumenteres. Meglere har en viktig rolle som formidler av kvaliteter. Grønn Byggallianse har i samarbeid med blant annet...... Norsk Eiendom, Enova og NGBC utarbeidet en mal for standard kravspesifikasjon for leie av kontorlokaler. Målet med malen er å bidra til at leietager får det produktet han trenger til riktig pris og at man unngår unødig miljøbelastning. Målet er videre at å bidra og stimulere til, at innleie....../utleie prosesser startes med en dialogbasert prosess. Standarden er tenkt som et hjelpemiddel til en systematisk gjennomgang av, og diskusjon av hvilke kvaliteter som har prioritet, høy, middel eller lav prioritet for leietaker. Resultatet av dialog og diskusjon fastlegger endelige krav til kvalitet og...

  20. Relação entre a persistência da condução pela via lenta nodal após ablação de taquicardia por reentrada nodal e a recorrência clínica Persistence of AV conduction over the slow pathway after AVRNT radiofrequency ablation and its relation to the recurrences

    Directory of Open Access Journals (Sweden)

    Márcio A. Silva

    1998-08-01

    Full Text Available OBJETIVO: Verificar se a persistência de salto nodal relaciona-se à taxa de recorrência de taquicardia por reentrada nodal (TRN após ablação com radiofreqüência (RF da via lenta do nó atrioventricular. MÉTODOS: Num seguimento de 20±12 meses, foi analisada a recorrência de TRN em 126 pacientes consecutivos submetidos a ablação com RF da via lenta nodal. O critério de interrupção do procedimento foi a não reindução da TRN, após estimulação atrial programada, com e sem isoproterenol intravenoso. Ao final do procedimento, 98 pacientes não apresentavam salto nodal, e em 28 persistia o salto nodal e/ou o eco atrial. RESULTADOS: Houve recorrência clínica de TRN em 15 (11% pacientes: 9 no grupo sem salto nodal e/ou eco atrial e em 6 do grupo que persistiu com salto e/ou eco atrial. A recorrência tendeu a ser maior no 2º grupo (9% vs 21%, mas não houve significância estatística entre os resultados (p=0,09. CONCLUSÃO: Desde que a TRN não possa ser induzida após a infusão de isoproterenol, a recorrência espontânea da arritmia após a ablação por RF da via lenta nodal não é diferente entre pacientes que persistem ou não com salto nodal e/ou eco atrial.PURPOSE: The aim of this study is to verify whether the persistence of conduction over the slow pathway is related to an increased trend for recurrence. METHODS: Recurrence rate was retrospectively analyzed in 126 patients who underwent slow pathway radiofrequency (RF catheter ablation during a follow-up of 20±12 months. The ablative procedure was interrupted when AVNRT was no longer induced by atrial stimulation after intravenous infusion of isoproterenol. Ninety-eight patients had no evidence of slow pathway whereas 28 patients persisted with AV node jump and atrial echo beat. RESULTS: There were 15 recurrences: 9% of those who had no evidence of slow pathway (9 of 98 patients and 21% of those with AV node jump and/or atrial echo beat but this difference was not

  1. Utprøving av metodikker for modellering av overvann i et urbant område ved bruk av ArcGIS, MIKE21 og MIKE FLOOD

    OpenAIRE

    Johansen, Jarle Andre; Moldekleiv, Hans Jakob Saxe

    2016-01-01

    I de siste århundrene har det blitt registrert forandringer i klimasystemet. Det er sannsynlig at dette er en konsekvens av menneskers forbruk av fossilt brennstoff. Klimaendringene vises i en høynet middeltemperatur for store deler av jordkloden. I Norge blir klimaendringene synlige i form av at det har blitt mer nedbør og at nedbørshendelsene har blitt mer intense. Denne tendensen blir av de fleste forskere framskrevet til å vedvare. Samtidig med klimautviklingen har samfunnet blitt forandr...

  2. IAS 41 - Värdering av skog

    OpenAIRE

    Hellsten, Fredric; Thorsson, Johan

    2006-01-01

    Införandet av standarden IAS/IFRS i Sverige är en effekt av den internationalisering som skett de senaste åren. En stor skillnad märks bland de företag som nu måste redovisa tillgångar till verkliga värden istället för som tidigare till historiska värden. Skogskoncernerna ställs inför ett sådant faktum. Effekten blir att en mer rättvisande bild av skogens värde uppkommer. De intervjuade företagen, Bergvik Skog AB, Holmen, SCA, Sveaskog och Öhrlings PricewaterhouseCoopers håller med om att dol...

  3. Dicty_cDB: FC-AV21 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AV21 (Link to dictyBase) - - - Contig-U15736-1 FC-AV21E (Li...nk to Original site) - - - - - - FC-AV21E 635 Show FC-AV21 Library FC (Link to library) Clone ID FC-AV21 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AV/FC-AV21Q.Seq.d/ Representative seq. ID FC-AV2...1E (Link to Original site) Representative DNA sequence >FC-AV21 (FC-AV21Q) /CSM/FC/FC-AV/FC-AV21Q.Seq....ignments: (bits) Value FC-AV21 (FC-AV21Q) /CSM/FC/FC-AV/FC-AV21Q.Seq.d/ 573 e-162 VHK407 (VHK407Q) /CSM/VH/V

  4. Dicty_cDB: FC-AV22 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AV22 (Link to dictyBase) - - - Contig-U16260-1 FC-AV22Z (Li...nk to Original site) - - FC-AV22Z 672 - - - - Show FC-AV22 Library FC (Link to library) Clone ID FC-AV22 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AV/FC-AV22Q.Seq.d/ Representative seq. ID FC-AV2...2Z (Link to Original site) Representative DNA sequence >FC-AV22 (FC-AV22Q) /CSM/FC/FC-AV/FC-AV22Q.Seq....ignments: (bits) Value FC-AV22 (FC-AV22Q) /CSM/FC/FC-AV/FC-AV22Q.Seq.d/ 1281 0.0

  5. Bioseguridad en granjas avícolas

    OpenAIRE

    Sandra L. Ricaurte Galindo

    2005-01-01

    La bioseguridad es el conjunto de prácticas de manejo diseñadas para prevenir la entrada y transmisión de agentes patógenos que puedan afectar la sanidad en las granjas avícolas. La bioseguridad es una parte fundamental de cualquier empresa avícola ya que proporciona un aumento de la productividad de la parvada y un aumento en el rendimiento económico. En líneas generales, se debe contemplar la localización de la granja, características constructivas de los galpones, control de parvadas extr...

  6. Exome sequencing identifies rare variants in multiple genes in atrioventricular septal defect

    NARCIS (Netherlands)

    D'Alessandro, Lisa C. A.; Al Turki, Saeed; Manickaraj, Ashok Kumar; Manase, Dorin; Mulder, Barbara J. M.; Bergin, Lynn; Rosenberg, Herschel C.; Mondal, Tapas; Gordon, Elaine; Lougheed, Jane; Smythe, John; Devriendt, Koen; Bhattacharya, Shoumo; Watkins, Hugh; Bentham, Jamie; Bowdin, Sarah; Hurles, Matthew E.; Mital, Seema

    2016-01-01

    The genetic etiology of atrioventricular septal defect (AVSD) is unknown in 40% cases. Conventional sequencing and arrays have identified the etiology in only a minority of nonsyndromic individuals with AVSD. Whole-exome sequencing was performed in 81 unrelated probands with AVSD to identify

  7. Increased sarcolemmal Na+/H+ exchange activity in hypertrophied myocytes from dogs with chronic atrioventricular block

    NARCIS (Netherlands)

    van Borren, Marcel M. G. J.; Vos, Marc A.; Houtman, Marien J. C.; Antoons, Gudrun; Ravesloot, Jan H.

    2013-01-01

    Dogs with compensated biventricular hypertrophy due to chronic atrioventricular block (cAVB), are more susceptible to develop drug-induced Torsade-de-Pointes arrhythmias and sudden cardiac death. It has been suggested that the increased Na+ influx in hypertrophied cAVB ventricular myocytes

  8. Atrioventricular muscular dystrophy in a 5-month-old English springer spaniel.

    Science.gov (United States)

    Lai, Serene R

    2009-12-01

    Primary persistent atrial standstill due to atrioventricular muscle dystrophy is a rare familial disease in dogs. The diagnosis of this disorder in a 5-month-old English springer spaniel is the earliest in dogs that have been presented at the Ontario Veterinary College.

  9. Longitudinal echocardiographic follow-up in children with congenital complete atrioventricular block

    NARCIS (Netherlands)

    Beaufort-Krol, Gertie C. M.; Leeuwen, Miek J. M. Schasfoort-Van; Stienstra, Ymkje; Bink-Boelkens, Margreet Th. E.

    2007-01-01

    Background: Due to a low heart rate (HR) in children with congenital complete atrioventricular block (CCAVB), a larger stroke volume of the left ventricle (LV) may be expected. If so, end-diastolic (LVEDD) and end-systolic (LVESD) diameters may be enlarged and even dilated cardiomyopathy (DCM) may

  10. Evolution and scaling of atrioventricular conduction time in mammals. [Pt. 2

    NARCIS (Netherlands)

    Meijler, F.L.; Strackee, J.

    2006-01-01

    Changes of the PR interval (atrioventricular delay) in relation to changes of heart size in mammalian species (scaling) confront us with a perplexing lack of understanding of an essential funetion of the heart. The PR interval controls the duration of late diastolic blood flow from the atria to the

  11. Atrioventricular septal defect : advanced imaging from early development to long-term follow-up

    NARCIS (Netherlands)

    Calkoen, Emmeline E.

    2016-01-01

    The aim of this thesis is to review the current knowledge on atrioventricular septal defect (AVSD) (Part 1), to study the pathogenesis of AVSD (Part 2) and finally to analyze cardiac outcome long-term after AVSD correction (Part 3). Studies are performed with novel imaging techniques. In part 2 it

  12. Complete paroxysmal atrioventricular block in a 2-year-old girl

    DEFF Research Database (Denmark)

    Holst, Line Marie; Dixen, Ulrik; Jeppesen, Dorthe L

    2015-01-01

    We present a case of atypical syncope in a 2-year-old, otherwise healthy girl. The patient presented with three episodes of syncope without any precipitating factors and no family history of sudden unexpected death. Holter monitoring revealed 24 events of complete atrioventricular block lasting u...

  13. Kunstpunkalliansen : En alternativ estetisk kontinuitet fra slutten av 1960-tallet til begynnelsen av 1990-tallet

    OpenAIRE

    Storsve, Gaute

    2007-01-01

    I denne oppgaven har jeg forsøkt å vise at det finnes en alternativ estetisk kontinuitet innenfor populærmusikken fra slutten av 1960-tallet til begynnelsen av 1990-tallet. Det som kjennetegner denne kontinuiteten er ulike former for krysninger av punkelementer med en sterk kunstbevissthet. Jeg valgte å kalle dette for kunstpunkalliansen. For å illustrere hva kunstpunkalliansen er har jeg analysert tre låter fra tre forskjellige band fra tre forskjellige tiår: The Velvet Undergrounds «Ven...

  14. Utforming av innendeltaker-design grafer i Microsoft Excel 2007

    OpenAIRE

    Strømgren, Børge; Løkke, Gunn; Olsen, Fie; Løkke, Jon Arne

    2010-01-01

    I artikkelen gis det beskrivelser av hvordan grafer for framstilling av innendeltaker tilba-ketrekkingsingsdesign (reversering), multielementdesign og multippel basislinjedesign kan konstrueres i Microsoft Excel 2007 for Windows. Det gis tips om hvordan ferdige grafer kan overføres fra Excel til andre relevante programmer. Forutsetning for bruk av framstillingen er korrekt installert Microsoft Excel 2007 for Windows. Beskrivelsene er tenkt å gi utfyllende informasjon om konstruksjon av innend...

  15. Live and Dead Nodes

    DEFF Research Database (Denmark)

    Jørgensen, Sune Lehman; Jackson, A. D.

    2005-01-01

    In this paper, we explore the consequences of a distinction between `live' and `dead' network nodes; `live' nodes are able to acquire new links whereas `dead' nodes are static. We develop an analytically soluble growing network model incorporating this distinction and show that it can provide...... a quantitative description of the empirical network composed of citations and references (in- and out-links) between papers (nodes) in the SPIRES database of scientific papers in high energy physics. We also demonstrate that the death mechanism alone can result in power law degree distributions for the resulting...... network....

  16. Long-term follow-up of DDD and VDD pacing: a prospective non-randomized single-centre comparison of patients with symptomatic atrioventricular block.

    Science.gov (United States)

    Marchandise, Sébastien; Scavée, Christophe; le Polain de Waroux, Jean-Benoit; de Meester, Christophe; Vanoverschelde, Jean-Louis; Debbas, Nadia

    2012-04-01

    This prospective non-randomized single-centre registry compared clinical outcome, pacing parameters, and long-term survival in patients receiving VDD or DDD pacemaker (PMs) for symptomatic atrioventricular (AV) block. Single-lead VDD (n= 166) and DDD (n= 254) PMs were implanted in 420 successive patients with isolated AV block between January 2001 and December 2009. At the end of the follow-up period [median 25 (1-141) months], there was no difference in the incidence of atrial fibrillation [11.2% in the VDD group; 11.4% in the DDD group (P= 0.95)], myocardial infarction [31.1% in the VDD group; 25.2% in the DDD group (P= 0.20)], or dilated cardiomyopathy [9.9% in the VDD group; 8.9% in the DDD group (P= 0.74)]. At last follow-up, 65.9% of the VDD PMs and 89.3% of the DDD PMs were still programmed in their original mode with good atrial sensing. Due to permanent atrial fibrillation, 7.9% patients out of the VDD group had been switched to VVIR mode and 8.7% patients out of the DDD group to VVIR or DDIR mode. The P-wave amplitude was poor (sensed P-wave DDD PM (PDDD patients had been switched to VVIR pacing mode due to P-wave undersensing and AV dissociation (P= 0.003). Symptomatic atrial undersensing requiring upgrading was similar in both groups. The overall survival, adjusted for age, was not significantly different in the VDD and the DDD group (log rank: 0.26). Moreover, Cox survival analysis excluded the pacing mode as a significant predictor of mortality [hazard ratio (HR) = 0.79, confidence interval (CI) (0.46-1.35), P= 0.39]. Comparing VDD and DDD pacing, a significantly larger number of VDD-paced patients developed poor atrial signal detection without clinical impact. However, atrial under sensing did not influence the incidence of atrial fibrillation, myocardial infarction, dilated cardiomyopathy, or mortality.

  17. Institusjonelle felt og forståelser av evaluering

    DEFF Research Database (Denmark)

    Halvorsen, Anne; Breidahl, Karen Nielsen; Furubo, Jan-Eric

    2016-01-01

    I Norge ble det i årene 2006-2009 gjennomført en omfattende reform med etablering av en ny arbeids- og velferdstjenestene (NAV). Reformen ble gjort til gjenstand for en omfattende evaluering, EVANAV, over flere år. I evalueringens siste fase ble det iverksatt en evaluering av evalueringen av refo...

  18. REMINDER PREPARATION FOR RETIREMENT PROGRAMME - AVS SEMINAR

    CERN Multimedia

    Social Service

    2001-01-01

    The AVS seminar, which had to be cancelled in March this year, will be held on: Wednesday 26 September from 14:00 to 16:00 in the Main Amphitheatre The session will be led by Mr. Lorenz STAMPFLI. The session is open to all people already registered and any other person who is interested, without the need to register.

  19. REMINDER Preparation for Retirement Programme - AVS Seminar

    CERN Multimedia

    Social Service

    2001-01-01

    The AVS seminar, which had to be cancelled in March this year, will be held on: Wednesday 26 September from 14:00 to 16:00 in the Main Amphitheatre The session will be led by Mr. Lorenz STAMPFLI. The session is open to all people already registered and any other person who is interested, without the need to register.

  20. Smertelindring av opioidavhengige pasienter. En oppgave om sykepleieres holdninger og kunnskaper om smertelindring av opioidavhengige pasienter

    OpenAIRE

    Selvig, Katrine Magelssen

    2013-01-01

    Hensikten med oppgaven var å belyse sykepleieres holdninger og kunnskap om smertelindring av opioidavhengige pasienter.Det viste seg at sykepleierne oppfattet å ikke ha tilstrekkelig kunnskap om smertelindring til opioidavhengige pasienter. Det å utvikle en tillitsfull relasjon var nødvendig for å yte god pleie. Holdninger ble identifisert som den viktigste faktoren som påvirket sykepleiernes intensjon om å yte pleie av høy kvalitet.

  1. Dicty_cDB: FC-AV04 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AV04 (Link to dictyBase) - - - Contig-U15991-1 FC-AV04P (Li...nk to Original site) FC-AV04F 307 FC-AV04Z 363 FC-AV04P 670 - - Show FC-AV04 Library FC (Link to library) Clone ID FC-AV...al site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AV/FC-AV04Q.Seq.d/ Representative seq. ID FC-AV...04P (Link to Original site) Representative DNA sequence >FC-AV04 (FC-AV04Q) /CSM/FC/FC-AV/FC-AV...B: ifnftskekkk*nnsfmfsvvtlffnfilfyffifnyffnyffisfffpiqiiiifnyfl fylffls*ipk*lki*av*dyfsnf*l**c*cslrnrkit**--

  2. Lymph node culture

    Science.gov (United States)

    ... get infected and you may need to take antibiotics) Nerve injury if the biopsy is done on a lymph node close to nerves (the numbness usually goes away in a few months) Alternative Names Culture - lymph node Images Lymphatic system Lymph ...

  3. Deploying Node.js

    CERN Document Server

    Pasquali, Sandro

    2015-01-01

    If you are an intermediate or advanced developer deploying your Node.js applications, then this book is for you. If you have already built a Node application or module and want to take your knowledge to the next level, this book will help you find your way.

  4. Congestive Heart Failure Leads to Prolongation of the PR Interval and Atrioventricular Junction Enlargement and Ion Channel Remodelling in the Rabbit

    Science.gov (United States)

    Nikolaidou, Theodora; Cai, Xue J.; Stephenson, Robert S.; Yanni, Joseph; Lowe, Tristan; Atkinson, Andrew J.; Jones, Caroline B.; Sardar, Rida; Corno, Antonio F.; Dobrzynski, Halina; Withers, Philip J.; Jarvis, Jonathan C.; Hart, George; Boyett, Mark R.

    2015-01-01

    Heart failure is a major killer worldwide. Atrioventricular conduction block is common in heart failure; it is associated with worse outcomes and can lead to syncope and bradycardic death. We examine the effect of heart failure on anatomical and ion channel remodelling in the rabbit atrioventricular junction (AVJ). Heart failure was induced in New Zealand rabbits by disruption of the aortic valve and banding of the abdominal aorta resulting in volume and pressure overload. Laser micro-dissection and real-time polymerase chain reaction (RT-PCR) were employed to investigate the effects of heart failure on ion channel remodelling in four regions of the rabbit AVJ and in septal tissues. Investigation of the AVJ anatomy was performed using micro-computed tomography (micro-CT). Heart failure animals developed first degree heart block. Heart failure caused ventricular myocardial volume increase with a 35% elongation of the AVJ. There was downregulation of HCN1 and Cx43 mRNA transcripts across all regions and downregulation of Cav1.3 in the transitional tissue. Cx40 mRNA was significantly downregulated in the atrial septum and AVJ tissues but not in the ventricular septum. mRNA abundance for ANP, CLCN2 and Navβ1 was increased with heart failure; Nav1.1 was increased in the inferior nodal extension/compact node area. Heart failure in the rabbit leads to prolongation of the PR interval and this is accompanied by downregulation of HCN1, Cav1.3, Cx40 and Cx43 mRNAs and anatomical enlargement of the entire heart and AVJ. PMID:26509807

  5. Postmoderne overbelastning : en komparativ analyse av tre storbyromaner

    OpenAIRE

    Andersen, Øystein

    2006-01-01

    Denne oppgaven er en komparativ analyse av tre storbyromaner; Crash av J.G. Ballard, Requiem for a Dream av Hubert Selby Jr, og Fight Club av Chuck Palahniuk. I hver av disse romanene skildres en form for stagnert storbytilværelse, der hovedkarakterenes liv er repeterende og stillestående. I et postmoderne samfunn i evig forandring, er det viktig å kunne tilpasse seg disse endringene, skifte kurs og ta i bruk nye muligheter. Dette er den postmoderne livsstrategi, en nødvendig strategi for å l...

  6. Anatomia da valva atrioventricular esquerda: I. As cúspides Anatomy of the left atrio-ventricular valve: I. The cusps

    Directory of Open Access Journals (Sweden)

    Antônio B. Prado Fortuna

    1988-12-01

    Full Text Available Os resultados de um estudo anatômico da valva atrioventricular esquerda, realizado em 30 corações aparentemente normais, conservados em formalina, são comparados aos dados da literatura, tendo por objetivo adequar a nomenclatura e os conceitos anatômicos clássicos aos atuais, baseados na ultra-sonografia e na prática cirúrgica corrente. O presente artigo tratará apenas das cúspides, sendo que os demais elementos anatômicos dessa valva atrioventricular esquerda fazem parte de uma "unidade aortoventricular", onde distinguimos a cúspide anterior, em continuidade com o trígono intervalvar e o anel aórtico, e um grupo de cúspides posteriores, em relação com a parede posterior do ventrículo esquerdo. A cúspide anterior está separada do grupo de cúspides posteriores, tanto no polo valvar superior como no inferior, por uma estrutura anatômica bem definida: a "lâmina juncional", superior e inferior, respectivamente. As cúspides do grupo posterior são designadas pela ordem numeral ordinal, a partir da lâmina juncional superior. Esta nomenclatura tem por objetivo destacar a cúspide como unidade funcional da valva e facilitar as referências ecocardiográficas e cirúrgicas, particularmente nos casos em que mais de 3 cúspides posteriores são encontradas.A review of the left atrio-ventricular valve anatomy is compared to a clinical oriented morphological study on 30 normal adult heart, preserved in formalin. The results will be presented in five separated sections: I. The cusps; II. The comissures; III. The chordae tendinae; IV. The papilary muscles; V. The valvar annulus. The present publication will deal with the cusps. The terms "left atrio-ventricular valve" and "cusps" are to be prefered to the more descriptive and traditional "mitral valve" and "leaflets". The anterior cusp, in continuity with the aortic annulus, and a group of posterior cusps, attached to the posterior left wall, are described. An ordinal numerical

  7. Forskere i norske avisers dekning av skole

    Directory of Open Access Journals (Sweden)

    Emilia Andersson-Bakken

    2015-10-01

    Full Text Available Skolen er stadig i medienes søkelys, og i denne artikkelen ser vi nærmere på hvordan forskere bidrar med sine fagkunnskaper i skoledebatten i mediene. Den problemstillingen vi ønsker å besvare, er: Hvilken rolle har forskere i norske avisers dekning av skole? For å svare på dette har vi gjort en analyse av samtlige artikler om skole i VG, Bergens Tidende og Aftenposten i 2013. Resultatene viser at det forekommer en navngitt forsker i ca. 12 % av avisenes artikler om skole (209 av 1712 artikler. Det er imidlertid forskjell mellom avisene, og i VG opptrer det forskere i ca. 24 % av artiklene om skole, mens andelen både i Aftenposten og BT er ca. 11 %. Undersøkelsen viser videre at det er mange forskere som får mulighet til å uttale seg om skole i disse tre avisene, men det store flertallet av disse uttaler seg kun én gang. Vi fant også at forskere ofte uttaler seg om rammene for skolens undervisningsvirksomhet, og sjelden om det som foregår i klasserommene. Resultatene av vår empiriske undersøkelse stemmer i stor grad overens med hovedtendensene i tidligere studier av forskere i media, noe som indikerer at forskernes rolle i norske avisers skoledekning ikke skiller seg markant ut fra den rollen forskere har i media generelt. Våre resultater peker imidlertid på én viktig forskjell: Forskere ser ut til å være uvanlig godt synlige i norske avisers dekning av skole.Nøkkelord: skoleforskning, media, forskningsformidlingAbstractSchool is a frequently debated topic in the media, and this article investigates how researchers contribute with their knowledge in this media debate. The research question is: What characterizes researcher participation in Norwegian newspaper coverage of school? To answer this question we have analyzed all articles about school in the Norwegian newspapers VG, Bergens Tidende and Aftenposten during 2013. The results show that there is a named researcher in about 12 % of the newspaper articles about school

  8. Prevalence of cardiac dyssynchrony and correlation with atrio-ventricular block and QRS width in dilated cardiomyopathy

    DEFF Research Database (Denmark)

    Anzouan-Kacou, J B; Ncho-Mottoh, M P; Konin, C

    2012-01-01

    Cardiac dyssynchrony causes disorganised cardiac contraction, delayed wall contraction and reduced pumping efficiency. We aimed to assess the prevalence of different types of dyssynchrony in patients with dilated cardiomyopathy (DCM), and to establish the correlation between atrio-ventricular blo...

  9. Samhandling på tvers av lokasjoner ved hjelp av videokonferanse : Casestudie av virtuelle møter innenfor driftsorganisasjonen i Det norske oljeselskap

    OpenAIRE

    Volden, Helene

    2016-01-01

    Globaliseringen de siste årene har bidratt til endringer av samfunnet og organisasjonslivet. Arbeid skjer til alle døgnets tider og man befinner seg på ulike steder. Teknologien tillater å kunne gjennomføre møter på tvers av lokasjoner, og antall virtuelle møter er spådd en økning fremover. Olje- og gassindustrien er de mest erfarne brukerne av videokonferanse i norsk næringsliv. Denne studien skal belyse hvordan virtuelle møter kan bli mer effektive i arbeidet på tvers av loka...

  10. Permanent His-Bundle Pacing: Case Studies.

    Science.gov (United States)

    Vijayaraman, Pugazhendhi; Dandamudi, Gopi

    2016-12-01

    His bundle pacing (HBP) is a physiological alternative to right ventricular pacing. In addition to patients with normal His-Purkinje conduction, HBP can be valuable in patients with infranodal atrioventricular (AV) block and patients undergoing AV node ablation. The following case studies illustrate the challenges associated with HBP. © 2016 Wiley Periodicals, Inc.

  11. Atrioventricular block in coronary artery bypass surgery: perioperative predictors and impact on mortality

    Directory of Open Access Journals (Sweden)

    Ricardo Medeiros Piantá

    2015-04-01

    Full Text Available AbstractIntroduction:Disturbances of the cardiac conduction system are frequent in the postoperative period of coronary artery bypass surgery. They are mostly reversible and associated with some injury of the conduction tissue, caused by the ischemic heart disease itself or by perioperative factors.Objective:Primary: investigate the association between perioperative factors and the emergence of atrioventricular block in the postoperative period of coronary artery bypass surgery. Secondary: determine the need for temporary pacing and of a permanent pacemaker in the postoperative period of coronary artery bypass surgery and the impact on hospital stay and hospital mortality.Methods:Analysis of a retrospective cohort of patients submitted to coronary artery bypass surgery from the database of the Postoperative Heart Surgery Unit of the Sao Lucas Hospital of the Pontifical Catholic University of Rio Grande do Sul, using the logistic regression method.Results:In the period from January 1996 to December 2012, 3532 coronary artery bypass surgery were carried out. Two hundred and eighty-eight (8.15% of the total sample patients had atrioventricular block during the postoperative period of coronary artery bypass surgery, requiring temporary pacing. Eight of those who had atrioventricular block progressed to implantation of a permanent pacemaker (0.23% of the total sample. Multivariate analysis revealed a significant association of atrioventricular block with age above 60 years (OR=2.34; CI 95% 1.75-3.12; P<0.0001, female gender (OR=1.37; CI 95% 1.06-1.77; P=0.015, chronic kidney disease (OR=2.05; CI 95% 1.49-2.81; P<0.0001, atrial fibrillation (OR=2.06; CI 95% 1.16-3.66; P=0.014, functional class III and IV of the New York Heart Association (OR=1.43; CI 95% 1.03-1.98; P=0.031, perioperative acute myocardial infarction (OR=1.70; CI 95% 1.26-2.29; P<0.0001 and with the use of the intra-aortic balloon in the postoperative period of coronary artery bypass

  12. Radiofrequency Catheter Ablation of Coexistent Idiopathic Left Ventricular Tachycardia and Atrioventricular Nodal Reentrant Tachycardia

    Directory of Open Access Journals (Sweden)

    Ken-Pen Weng

    2005-10-01

    Full Text Available A healthy 15-year-old male patient presented with a 6-month history of recurrent attacks of palpitations. On multiple emergency room visits, a sustained wide QRS complex tachycardia with a right bundle branch block and northwest axis deviation was documented. The tachycardia was not terminated by intravenous adenosine, but was suppressed with intravenous verapamil. There was no evidence of structural heart disease, myocarditis, long QT syndrome, or electrolyte imbalance after a series of standard examinations. Idiopathic left ventricular tachycardia (ILVT was suspected. Electrophysiologic studies revealed 2 inducible tachycardias, which were shown to represent atrioventricular nodal reentrant tachycardia (AVNRT and ILVT. Transformation from AVNRT to ILVT occurred spontaneously following atrial pacing. Successful ablation of ILVT and the slow atrioventricular nodal pathway resulted in cure of the double tachycardia.

  13. Novel insights on effect of atrioventricular programming of biventricular pacemaker in heart failure – a case series

    Directory of Open Access Journals (Sweden)

    Rafique Asim M

    2006-10-01

    Full Text Available Abstract Background Echocardiography plays an integral role in the diagnosis of congestive heart failure including measurement of left heart pressure as well as mechanical dyssynchrony. Methods In this report we describe novel therapeutic uses of echo pulsed wave Doppler in atrioventricular pacemaker optimization in patients who had either not derived significant symptomatic benefit post biventricular pacemaker implantation or deteriorated after deriving initial benefit. In these patients atrioventricular optimization showed novel findings and improved cardiac output and symptoms. Results In 3 patients with Cheyne Stokes pattern of respiration echo Doppler showed worsening of mitral regurgitation during hyperpneac phase in one patient, marked E and A fusion in another patient and exaggerated ventricular interdependence in a third patient thus highlighting mechanisms of adverse effects of Cheyne Stokes respiration in patients with heart failure. All 3 patients required a very short atrioventricular delay programming for best cardiac output. In one patient with recurrent congestive heart failure post cardiac resynchronization, mitral inflow pulse wave Doppler showed no A wave until a sensed atrioventricular delay of 190 ms was reached and showed progressive improvement in mitral inflow pattern until an atrioventricular delay of 290 ms. In 2 patients atrioventricular delay as short as 50 ms was required to allow E and A separation and prevent diastolic mitral regurgitation. All patients developed marked improvement in congestive heart failure symptoms post echo-guided biv pacemaker optimization. Conclusion These findings highlight the value of echo-guided pacemaker optimization in symptomatic patients post cardiac resynchronization treatment.

  14. Dimensionering av Södersjukhusets sterilcentral

    OpenAIRE

    Munguia Chang, Daniel; Dahlgren, Emma

    2016-01-01

    I dagsläget pågår en omfattande planering av utbyggnationen samt upprustningen av Södersjukhuset. Byggnationen beräknas preliminärt vara i bruk under mars 2018. I och med förändringen kommer sjukhuset få en helt ny sterilcentral.  Till en sterilcentral anländer kontaminerat medicinskt gods från tillhörande eller externa sjukhus. Efter att ha genomgått diskdesinficering och autoklavering på sterilcentralen kommer godset så småningom ut som sterilt för ytterligare användning.  Det finns idag en...

  15. Exponerade hatkommentarer : En studie av svensk hatkommentarsklassificering

    OpenAIRE

    Johansson, Kim

    2016-01-01

    I detta arbete presenteras hatfulla kommentarer på internet som ett sam- hällsproblem som vi bör göra något åt. Webbplatsen Exponerat.net presenteras som en källa till hatfulla kommentarer. Med hjälp av ett förenklande antagande om att de kommentarer som finns på Exponerat kan utgöra en god representation för hatfulla kommentarer på internet konstruerar vi en klassificerare. Klassificeraren utvärderas i två steg; det ena med hjälp av tiofaldig korsvalidering och det andra manu...

  16. Late recovery of surgically-induced atrioventricular block in patients with congenital heart disease.

    Science.gov (United States)

    Bruckheimer, Elchanan; Berul, Charles I; Kopf, Gary S; Hill, Sharon L; Warner, Kenneth A; Kleinman, Charles S; Rosenfeld, Lynda E; Nehgme, Rodrigo A

    2002-06-01

    To assess the incidence and establish possible predictors of late recovery of post-surgical heart block, treated with pacemaker implantation, in patients with congenital heart defects. The American College of Cardiology/American Heart Association Task Force has recommended pacemaker implantation for advanced second or third degree atrioventricular block which persists for 7 to 14 days after surgery. The incidence of late recovery of post-surgical heart block following pacemaker implantation has not been reported. Records of 44 patients with post-surgical heart block who underwent pacemaker implantation at our institutions since 1976 were reviewed for demographic, anatomic, surgical and surface electrocardiographic data to assess the incidence of, and factors associated with, recovery of atrioventricular conduction on long-term follow-up. 32% (14) of patients recovered atrioventricular conduction at a median follow-up of 5.5 years while 68% (30) remained pacemaker dependent. The groups were similar in age and weight at surgery and period of follow-up p = 0.5). Types of defect and surgical repair were not significantly different (p > 0.1). There was a similar number of patients with second degree-type II block in both groups (p = 0.15). The groups did not differ in timing of pacemaker implantation (14 days p = 0.18). Late recovery of atrioventricular conduction following pacemaker implantation for postsurgical heart block is common. However, clinical predictors, with reference to current recommendations, could not be identified. Prospective electrophysiologic evaluations may be warranted to establish guidelines for long term pacemaker dependency and criteria for pacing.

  17. Studenters opplevelse av egen og andres bruk av bærbar datamaskin i forelesninger

    Directory of Open Access Journals (Sweden)

    Halgeir Leiknes

    2014-02-01

    Full Text Available Denne studien har sett nærmere på studenters bruk av egen bærbar datamaskin (heretter kalt PC i en forelesningssituasjon. Vi har sett på studenters begrunnelse for bruk og faktiske anvendelse av PC. Studien ble gjennomført i to omganger med fire års mellomrom, der både PC-brukere og de som ikke brukte PC (ikke-brukere svarte.Studenters bruk av PC fremstår som et bevisst valg, og flertallet av studenter velger å ikke benytte PC. Andelen som bruker PC har økt noe, men økningen kan i stor grad forklares med økt tilgjengelighet av egen PC fra 2007 til 2011.Vi ser en klar tendens til at brukerne og ikke-brukerne har ulik oppfatning av andelen faglig og ikke-faglig bruk av PC. Forskjellen består i at ikke-brukerne rapporterer langt mer ikke-faglig aktivitet. Resultatene indikerer at ikke-brukerne forstyrres langt mer av underholdningsrelatert PC-bruk enn av faglig bruk og at de er svært sensitive for slik ikke-faglig bruk.SummaryThis study examined students’ use of their own laptop computer (hereafter called PC in a lecture setting. We have looked at students’ actual use of the PC, as well as their reasons for doing so. The study was conducted in two rounds, separated by four years, with both PC users and non-users (those who did not use a computer responses.Students’ use of PC appears to be a conscious choice, and the majority of students choose not to use a PC. The proportion using a PC increased slightly, but this increase can be largely explained by the increased availability and affordability of PCs from 2007 to 2011.We see a clear tendency for users and non-users to have different perceptions of the proportion of professional and non-professional use of the PC; non-users report far greater non-professional activities. The results indicate that non-users are disrupted far more by entertainment-related PC use than professional use and that they are very sensitive to such non-professional use.

  18. "Come as You Are" : En undersøkelse av fansens sakralisering av Kurt Cobain.

    OpenAIRE

    Winding-Sørensen, Anne

    2011-01-01

    I denne oppgaven tar jeg bruker jeg populærkulturen for å vise hvordan religiøse uttrykk kommer til synes gjennom fansens sakralisering av deres idol. For å vise hvordan ulike subkulturer i samfunnet bruker kjendiser for å skape en identitet og tilhørighet til andre mennesker har jeg brukt Kurt Coabin som eksempel på hvordan grungebevegelsen ikke bare var en musikkstil, men ble også en livsstil som skape rammer og strukturer for den gruppen av mennesker som følte et samhold til andre i denne...

  19. Fylogenetisk analyse av helgenom NGS-data av Bacillus cereus-gruppen

    OpenAIRE

    Simensen, Benedicte Been

    2015-01-01

    Sammenlikning av bakteriers genom er en effektiv måte å kartlegge hva som skiller arter og stammer fra hverandre. For å sammenlikne hele genomer fra bakterier er det vanlig å sekvensere. Utfordringen er dagens sekvenseringsteknologi, som ikke klarer å lese av hele lengden til genom-sekvensen, men kutter DNA-molekylene i kortere fragmenter før avlesning. Resultatet etter sekvensering er et stort antall korte fragmenter som etter sekvensering må pusles sammen til et fullstendig genom. Til dette...

  20. Kossan i sociala medier : Personifiering av kon inom marknadsföring av mejeriprodukter

    OpenAIRE

    Carlsson, Andrea

    2017-01-01

    Syftet med studien var att undersöka porträtterandet av kossan inom marknadsföring av mejeriprodukter i sociala medier. Undersökningens analys utfördes på mejeriföretaget Arlas Instagramkonto @arlasverige. Instagramkontots inlägg som publicerats mellan december månad 2015 till december månad 2016 innehållande en eller flera verkliga kossor analyserades. Metoderna som brukades var kvalitativ bild- och textanalys med kvantitativa inslag. Frågeställningarna undersökningen baserades på var: Hur p...

  1. Teknologisk fravalg og tilvalg av fremtidig syke og funksjonshemmede

    Directory of Open Access Journals (Sweden)

    Berge Solberg

    2008-05-01

    Full Text Available I dette nummeret av Etikk i praksis ønsker vi å fokusere på et betent problemområde, nemlig etikken rundt teknologisk fravalg og tilvalg av fremtidige syke og funksjonshemmede barn. Det handler om abort, medisinsk teknologi og valg av barn. Det kan synes som om vi står overfor nye muligheter for fravalg og tilvalg som ikke bare setter en ny debatt, men som samtidig krever en tilbakevending og nyåpning av tidligere gjennomdiskuterte spørsmål og tema. Debattene rundt «valg av barn» berører dype, eksistensielle dimensjoner ved menneskelivet. I tillegg berører det store samfunnsmessige temaer som inklusjon og menneskeverd, selvbestemmelse, abort, eugenikk og samfunnets forståelse av funksjonshemming.http://dx.doi.org/10.5324/eip.v2i1.1686

  2. Kritik av riskbegreppet - berättigad eller ej?

    DEFF Research Database (Denmark)

    Nexøe, Jørgen; Halvorsen, Peder; Kristiansen, Ivar Sønbø

    2009-01-01

    "Först och främst inte skada" (Primum non nocere) - så lyder ett av buden i den Hippokratiska eden. Men alla medicinska åtgärder kan medföra oönskade effekter. Undersökning och behandling av friska i förebyggande syfte är inget undantag. Ett problem är att negativa effekter och skador av förebygg...

  3. Om implementering av frekvenshopping i OpenBTS.

    OpenAIRE

    Bremseth, Morten

    2011-01-01

    Denne Rapporten gir en forklaring på hva programvaredefinert radio er generelt. Den omtaler en konkret realisering ved hjelp av programvaren GNU Radio og den universale radioenheten USRP (Universal Software Radio Peripheral). GSM forklares slik at leseren får den nødvendige oversikten som trengs for å forstå resten av rapporten. Frekvenshopping forklares generelt og hvordan det er gjort i GSM. Det fremstilles en mulig realisering av frekvenshopping med USRP. Programvaren som benyttes for å o...

  4. Bakteriell produksjon av sulfid for felling av metaller i avløpsvann fra gruver optimalisering og oppskalering av prosessen

    OpenAIRE

    Nygaard, K.; Christensen, B

    1995-01-01

    Det er gjennomført forsøk i laboratorieskala og i liten pilotskala for å vurdere om bakteriell sulfat-reduksjon kan utnyttes til å produsere hydrogensulfid for felling av tungmetaller i sur avrenning fra nedlagte kisgruver. Det ble tilført etanol som vekstsubstrat for bakteriene. I laboratorieforsøkene ble det påvist sulfatreduksjonsaktivitet allerede etter få dager, mens det i pilotforsøkene tok ca 7 uker å få i gang prosessen. Metaller ble fjernet fra vannfasen som metallsulfider. Effektivi...

  5. Konsum av risiko-matvarer - Beskrivelse av en undersøkelse som skal kartlegge konsum av matvarer med betydning for inntaket av miljøgifter

    Directory of Open Access Journals (Sweden)

    Helle Margrete Meltzer

    2009-11-01

    Full Text Available  SAMMENDRAGI perioden 1999-2001 vil det bli gjennomført tre kostholdsundersøkelser som til sammen skal kartlegge konsum avmatvarer med betydning for inntaket av miljøgifter i Norge, fortrinnsvis kadmium, kvikksølv, PCB og dioksiner.Disse giftene finnes hovedsakelig i krabbe, flatfisk, skjell, gjedde og abbor, lever eller nyre fra vilt og viltvoksendesopp. Fordi gjennomsnittskonsumet er lavt, spørres det ikke spesifikt om disse matvarene i landsdekkende kostholdsundersøkelsersom 'Norkost'. Hensikten med studien er å kunne gi en bedre beskrivelse av eksponeringsfordelingeni befolkningen med tanke på miljøgifter. Fordelingen er antakelig skjev, dvs. et stort antall personerventes å ha et lavt inntak og noen få personer ventes å ha et relativt høyt inntak av de undersøkte stoffene. Eventuelleukjente risikogrupper vil kunne avdekkes, og det er av stor interesse å undersøke hvor stor eksponeringen i deutsatte gruppene er.Del A av undersøkelsen er landsdekkende og omfatter en postal frekvensundersøkelse til 10 000 tilfeldig valgtepersoner mellom 18 og 79 år. Del B omfatter en postal frekvensundersøkelse til 6000 tilfeldig valgte personer i sekskommuner, der tre er kystkommuner og tre er innlandskommuner. Kommunene blir valgt ut fra kjennskap til godtilgang på de aktuelle matvarene. Vi antar at der tilgangen på matvarene er god, er konsumet høyere. Del C avundersøkelsen vil omfatte høykonsumenter av aktuelle matvarer, valgt fra del B av undersøkelsen. Dette vil være endybdestudie der analyser av miljøgifter i blod, hår og urin også skal inngå.Undersøkelsen er den første i sitt slag her til lands og vi kjenner ikke til at tilsvarende studier er gjort i andreland. Hensikten med artikkelen er å gi en beskrivelse av undersøkelsen i en tidlig fase av gjennomføringen.Meltzer HM, Bergsten C, Stene LC, Stigum H, Wiborg ML, Lund-Larsen K, Alexander J. Consumption ofcontaminated foods – Description of a dietary survey

  6. Incidence and predictors of asymptomatic atrial fibrillation in patients older than 70 years with complete atrioventricular block and dual chamber pacemaker implantation.

    LENUS (Irish Health Repository)

    Radeljic, Vjekoslav

    2012-01-31

    AIM: To evaluate predictors of asymptomatic atrial fibrillation in patients older than 70 years with complete atrioventricular (AV) block, normal left ventricular systolic function, and implanted dual chamber (DDD) pacemaker. METHODS: Hundred and eighty six patients with complete AV block were admitted over one year to the Sisters of Mercy University Hospital. The study recruited patients older than 70 years, with no history of atrial fibrillation, heart failure, or reduced left ventricular systolic function. All the patients were implanted with the same pacemaker. Out of 103 patients who were eligible for the study, 81 (78%) were evaluated. Among those 81 (78%) were evaluated. Eighty one (78%) patients were evaluated. Follow-up time ranged from 12 to 33 months (average +\\/-standard deviation 23 +\\/- 5 months). Primary end-point was asymptomatic atrial fibrillation occurrence recorded by the pacemaker. Atrial fibrillation occurrence was defined as atrial high rate episodes (AHRE) lasting >5 minutes. Binary logistic regression was used to identify the predictors of development of asymptomatic atrial fibrillation. Results. The 81 patients were stratified into two groups depending on the presence of AHRE lasting >5 minutes (group 1 had AHRE>5 minutes and group 2 AHRE<5 minutes). AHRE lasting >5 minutes were detected in 49 (60%) patients after 3 months and in 53 (65%) patients after 18 moths. After 3 months, only hypertension (odds ratio [OR], 17.63; P = 0.020) was identified as a predictor of asymptomatic atrial fibrillation. After 18 months, hypertension (OR, 14.0; P = 0.036), P wave duration >100 ms in 12 lead ECG (OR, 16.5; P = 0.001), and intracardial atrial electrogram signal amplitude >4 mV (OR, 4.27; P = 0.045) were identified as predictors of atrial fibrillation. CONCLUSION: In our study population, hypertension was the most robust and constant predictor of asymptomatic atrial fibrillation after 3 months, while P wave duration >100 ms in 12-lead ECG and

  7. The comparative relationships between locations of the papillary muscles and electrophysiologic QRS axis in patients with atrioventricular septal defect and common as opposed to separate orifices in the valve guarding the common atrioventricular junction.

    Science.gov (United States)

    Low, Liying; Idriss, Salim F; Anderson, Robert H; Maynard, Charles; Wagner, Galen; Hakacova, Nina

    2017-03-01

    Knowledge regarding factors that influence deviation of the QRS axis is important when seeking to differentiate between physiological and pathological changes. We hypothesised that, in contrast to those patients with an atrioventricular septal defect and common atrioventricular junction permitting only atrial shunting, those associated with ventricular shunting would show no relationship between the positions of the papillary muscles and the degree of the leftward deviation of the QRS axis. We compared the positions of endocardial origin of the papillary muscles, and the frontal plane QRS axis, in patients with atrioventricular septal defects and common atrioventricular junction permitting exclusively atrial as opposed to atrial and ventricular shunting. We analysed 18 patients with atrial and ventricular shunting and 23 patients with exclusively atrial shunting. The correlation coefficient between the ratio of distances of the papillary muscles from the mid-septum and the amount of leftward deviation in the frontal plane QRS axis was 0.1 (p=0.4) in those with ventricular shunting and 0.26 (p=0.01) in those with exclusively atrial shunting. In contrast to patients with the so-called primum form of atrioventricular septal defect, in whom the locations of the papillary muscles correlate with the degree of QRS axis, such relationships are lacking in patients with defects permitting both atrial and ventricular shunting. It may be, therefore, that the presence of ventricular shunting and/or their younger age causes pressure overload, which negates the leftward QRS forces caused by the abnormally positioned papillary muscles.

  8. Barndom på nett - En kvalitativ analyse av mammabloggeres fremstilling av egne barn på Internett

    OpenAIRE

    Sinding-Larsen, Helene

    2015-01-01

    Master i sosialt arbeid Denne studien tar for seg et relativt nytt og lite utforsket tema, nemlig fremstillinger av barn i mammablogger. Mammablogger kan forstås og utforskes som en slags personlig dagbok på Internett, hvor bloggeren deler fortellinger fra seg og sine barns hverdagsliv. Jeg har, gjennom et sosialkonstruksjonistisk perspektiv og inspirert av diskursteori, rettet fokus mot hvordan et utvalg av norske mammabloggere fremstiller sine barn. De ulike fremstillingene jeg har funne...

  9. SEM, TEM, and IHC Analysis of the Sinus Node and Its Implications for the Cardiac Conduction System

    Directory of Open Access Journals (Sweden)

    D. Mandrioli

    2013-01-01

    Full Text Available More than 100 years after the discovery of the sinus node (SN by Keith and Flack, the function and structure of the SN have not been completely established yet. The anatomic architecture of the SN has often been described as devoid of an organized structure; the origin of the sinus impulse is still a matter of debate, and a definite description of the long postulated internodal specialized tract conducting the impulse from the SN to the atrioventricular node (AVN is still missing. In our previously published study, we proposed a morphologically ordered structure for the SN. As a confirmation of what was presented then, we have added the results of additional observations regarding the structural particularities of the SN. We investigated the morphology of the sinus node in the human hearts of healthy individuals using histochemical, immunohistochemical, optical, and electron microscopy (SEM, TEM. Our results confirmed that the SN presents a previously unseen highly organized architecture.

  10. Betydning av fruktose for kostrelaterte helseproblemer

    OpenAIRE

    Kolderup, Astrid

    2013-01-01

    Synet på sukker som næringsmiddel har endret seg de siste ti-årene. Tidligere antakelser, som blant annet at sukker ikke virker fetende, er i dag erstattet med kunnskap om klare sammenhenger mellom sukkerinntak og sykdom. Fruktoses rolle i denne sammenhengen er fortsatt noe uklar. Målet med denne litteraturgjennomgangen er å beskrive kroppens håndtering av fruktose, samt diskutere fruktoses rolle i kostrelaterte helseproblemer, med fokus på blodglukosehomeostase, fedme og karsykdom. På gr...

  11. Diskursordning och hegemoni : Representationer av en skola

    OpenAIRE

    Öhman, Anna

    2012-01-01

    Den här artikeln utforskar, genom en mångperspektivistisk diskursanalys, tidningsartiklar, en vetenskaplig artikel, ett myndighetsbrev, bloggar och ett reportage skrivna om en specifik grundskola i Sverige, som har blivit känd för sitt lyckade utvecklingsarbete med elevernas studieresultat. Enligt denna artikel är bilden som förmedlas genom media mycket positiv tills en artikel följd av en blogg, förändrade diskursordningen på ett hegemoniskt sätt. Den här artikeln beskriver den diskursiva fö...

  12. Anterograde conduction to the His bundle during right ventricular overdrive pacing distinguishes septal pathway atrioventricular reentry from atypical atrioventricular nodal reentrant tachycardia.

    Science.gov (United States)

    Nagashima, Koichi; Kumar, Saurabh; Stevenson, William G; Epstein, Laurence M; John, Roy M; Tedrow, Usha B; Koplan, Bruce A; Michaud, Gregory F

    2015-04-01

    Distinguishing orthodromic atrioventricular reciprocating tachycardia (ORT) using a retrograde septal accessory pathway (AP) from atypical atrioventricular nodal reentrant tachycardia (AVNRT) may be challenging. Specifically, excluding the presence and participation of an AP may require multiple diagnostic maneuvers. The purpose of this study was to assess the relative value of commonly used right ventricular (RV) pacing maneuvers, including identification of anterograde His-bundle activation with entrainment, to differentiate ORT using a retrograde septal AP from atypical AVNRT. From March 2009 to June 2014, 56 patients (28 female; age 43.9 ± 17.4 years) who underwent electrophysiologic study and ablation for supraventricular tachycardia (26 ORT using septal AP and 30 atypical AVNRT) that exhibited a concentric atrial activation pattern and a septal ventriculoatrial interval >70 ms were analyzed. Overdrive pacing maneuvers or ventricular extrastimuli failed on at least 1 occasion to correctly identify a septal AP. Overall, 16 ORT patients and 26 AVNRT patients had successful RV entrainment, and 12 (75%) ORT patients showed anterograde His capture (11 patients) and/or anterograde septal ventricular capture (3 patients). None of the patients with atypical AVNRT showed anterograde conduction to the His bundle with entrainment. RV pacing maneuvers are useful to exclude an AP in patients with AVNRT having concentric atrial activation sequence and a septal ventriculoatrial interval >70 ms; however, none are consistently diagnostic. When observed in this patient population, anterograde His-bundle or septal ventricular capture during RV entrainment was diagnostic for ORT using a septal AP. Copyright © 2015 Heart Rhythm Society. Published by Elsevier Inc. All rights reserved.

  13. Påvirkning av personlighetstrekk på klageprosesser, og effekten av kausal prosess på hindsight bias

    OpenAIRE

    Iqbal, Quddos

    2010-01-01

    Hindsight bias er et begrep som omhandler en persons evne til å føle på forhånd hva resultatet blir. Et begrep som ser på folks følelse av å vite at hendelses utfall ble som forventet. Grad av self monitoting forteller om en persons handlinger er refleksjoner av han og hans meninger, eller av andres forventninger. Avhandlingen tar for seg self monitoring i interaksjon med hva slags klagetype en er (påfører selvforskyldt skade på mobil telefon, eller produktfeil), og hva slags klagebehandling ...

  14. Dicty_cDB: FC-AV01 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AV01 (Link to dictyBase) - - - Contig-U16311-1 FC-AV01Z (Li...nk to Original site) - - FC-AV01Z 643 - - - - Show FC-AV01 Library FC (Link to library) Clone ID FC-AV01 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AV/FC-AV01Q.Seq.d/ Representative seq. ID FC-AV...01Z (Link to Original site) Representative DNA sequence >FC-AV01 (FC-AV01Q) /CSM/FC/FC-AV/FC-AV01Q.Seq....ed Amino Acid sequence ---SGSHGGSQSQSAGSDSQSAGSESSQSESGSQSQSESGSQSQSQSGSQSFSGSLYSGS YSGSQSGSQSGNSGAAVKQTGAGS

  15. Primary biventricular repair of atrioventricular septal defects: an analysis of reoperations.

    Science.gov (United States)

    Vohra, Hunaid A; Chia, Alicia X F; Yuen, Ho Ming; Vettukattil, Joseph J; Veldtman, Gruschen; Gnanapragasam, James; Roman, Kevin; Salmon, Anthony P; Haw, Marcus P

    2010-09-01

    The purpose of this study was to analyze the factors affecting reoperation after primary biventricular atrioventricular septal defect (AVSD) repair. Between April 1997 and April 2007, 93 consecutive patients underwent surgery for biventricular correction of AVSD with a median age of 5.8 months (range, 9 days to 68.9 years). Fifty-three patients had complete AVSD, 6 patients had an intermediate type, and 29 patients had partial AVSD; 4 patients had a complete AVSD with associated tetralogy of Fallot, and 1 patient had a complete AVSD with double-outlet right ventricle. There was no in-hospital mortality. There were 2 late deaths (2.2%). Forty-three reoperations were performed in 23 patients (24.7%), of which 18 were for repair of significant left atrioventricular valve regurgitation and 8 were mitral valve replacements. Seven patients (7.5%) required insertion of a permanent pacemaker. The overall 5-year freedom from reoperation after AVSD repair was 73.6% +/- 4.8%. In the multivariate analysis for complete AVSDs, Down syndrome (p = 0.01) and the presence of right ventricular dominance (p = 0.03) were independent predictors of reoperation. At last follow-up, 76 patients (83.5%) were in New York Heart Association class I, and 68 patients (74.7%) were not taking any heart failure medications. Echocardiographic examination showed absent to mild left atrioventricular valve regurgitation in 76.5%; moderate, in 19.8%; and severe, in 3.7% of patients. Down syndrome and right ventricular dominance are independent predictors of reoperation after complete AVSD repair. Biventricular repair of isolated AVSD with a small left ventricle can be successfully accomplished with no mortality. 2010 The Society of Thoracic Surgeons. Published by Elsevier Inc. All rights reserved.

  16. Masquerading bundle branch block as a presenting manifestation of complete atrioventricular block that caused syncope.

    Science.gov (United States)

    Jiao, Zhenyu; Tian, Ying; Yang, Xinchun; Liu, Xingpeng

    2017-10-01

    A 59-year-old male patient was admitted with the main complaints of stuffiness and shortness of breath. An ECG from precordial leads on admission showed masquerading bundle branch block. Syncope frequently occurred after admission. During syncope episodes, ECG telemetry showed that the syncope was caused by intermittent complete atrioventricular block, with the longest RR interval lasting for 4.36 s. At the gap of syncope, ECG showed complete right bundle branch block accompanied by alternation of left anterior fascicular block and left posterior fascicular block. The patient was implanted with a dual-chamber permanent pacemaker. Follow-up of 9 months showed no reoccurrence of syncope.

  17. Robot-Assisted Partial Atrioventricular Canal Defect Repair and Cryo-Maze Procedure.

    Science.gov (United States)

    Mandal, Kaushik; Srivastava, Aseem R; Nifong, L Wiley; Chitwood, W Randolph

    2016-02-01

    Atrial septal defect is one of the most common congenital heart anomalies in adults. Patients with partial atrioventricular canal defects, previously known as ostium primum atrial septal defect, usually present at an early age, and only a few reach adulthood without surgical correction. Herein, we describe a young woman who presented with an ostium primum defect and severe symptomatic mitral and tricuspid regurgitation with paroxysmal atrial fibrillation. A complex repair was successfully done through a left atrial approach using robot-assistance. Copyright © 2016 The Society of Thoracic Surgeons. Published by Elsevier Inc. All rights reserved.

  18. Implementeringsforskning: vitenskap for forbedring av praksis

    Directory of Open Access Journals (Sweden)

    Signe Flottorp

    2013-11-01

    Full Text Available Medisinsk forskning har ført til store framskritt de siste tiårene. Det er investert mye mer ressurser på basalforskning og klinisk forskning enn på å utvikle og evaluere metoder for å sikre at pasientene får nytte av forskningen. Formålet med implementeringsforskning er å redusere gapet mellom forskning og praksis, ved å utvikle og evaluere tiltak som kan sikre at behandlingen som pasientene mottar er kunnskapsbasert, at den er omsorgsfull og av god kvalitet.I denne artikkelen gjør vi rede for hva implementering og implementeringsforskning er. Vi belyser historikken til denne unge vitenskapen, og illustrerer mangfoldet i de faglige tilnærmingene og begrepene som brukes om det å få forskning brukt i praksis. Det finnes en rekke teorier om endring av atferd, både på individnivå og på organisatorisk nivå. Teoriene er imidlertid i liten grad testet empirisk, særlig når det gjelder å endre atferd i helsetjenesten.Systematiske oversikter over metodisk gode studier er den beste kilden til informasjon om effekt av implementeringstiltak. The Cochrane Effective Practice and Organisation of Care Group (EPOC er en viktig kilde for slike oversikter. De systematiske oversiktene som er utarbeidet på dette feltet viser at passive dissemineringstiltak har begrenset effekt, mens mer aktive tiltak kan ha liten til moderat effekt. Det er ofte betydelig variasjon i effekt på tvers av studiene. Det er derfor viktig å få bedre kunnskap om hvilke faktorer som kan forklare slike forskjeller i effekt.Vi gir eksempler på norske implementeringsstudier, og refererer bidrag fra forskere ved Kunnskapssenteret. Implementeringsforskningen kan, hvis den lykkes, sikre pasientene bedre behandling.Flottorp S, Aakhus E. Implementation research: science for improving practice. Nor J Epidemiol 201 3; 23 (2: 187-196.ENGLISH SUMMARY Medical research has led to major advances in recent decades. More resources have been invested in basic and clinical research

  19. Atrial rate adaptive pacing: what happens to AV conduction?

    Science.gov (United States)

    Linde, C; Nordlander, R; Rosenqvist, M

    1994-10-01

    To investigate if an nonphysiological prolongation of the AV interval is common during activity sensor modulated atrial rate adaptive (AAIR) pacing, 21 patients with sinus node disease treated with fixed rate atrial (AAI) or AAIR pacemakers were examined. Spike-Q intervals were compared at different heart rates obtained by overdrive pacing at rest and during exercise (Study I), measured during exercise at unresponsive (AAI), optimal (AAIR) and over responsive programming (AAIR+) of the activity sensor (Study II), and finally examined by 24-hour Holter recording in AAI and AAIR pacing modes (Study III). Study I: The spike-Q interval increased significantly with increasing heart rate at rest, but not during exercise. At rest the spike-Q interval was significantly higher at all heart rates compared to exercise. There was a significant positive correlation between the maximal spike-Q interval at rest and the maximal spike-Q interval during exercise (r = 0.63). Study II: The spike-Q interval was shortest in the AAI and longest in the AAIR+ mode in all patients. Study III: During AAI or AAIR pacing the spike-Q interval was longest at night and shortest in the morning. The mean spike-Q interval was longer in AAIR than in AAI pacing. No statistical difference between the maximal spike-Q intervals observed during the two modes was, however, found. Variations in spike-Q interval are generally caused by changes in autonomic tone or medication with drugs with antiarrhythmic effect.(ABSTRACT TRUNCATED AT 250 WORDS)

  20. AV Rising: Demand, Budgets, and Circulation Are All Up.

    Science.gov (United States)

    Oder, Norman

    1998-01-01

    A survey of 486 public libraries found that audiovisual (AV) budgets have increased 53% in the last five years. Provides data on average size of AV collections; budget break downs; circulation; audiobook, video, and music CD purchases; popular authors and titles in abridged and unabridged audiobooks; and problems with audiobook, video, and music…

  1. EST Table: AV404903 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404903 prgv0575 11/12/09 GO hit GO:0004174(electron-transferring-flavoprotein deh...w homology 10/09/10 low homology 10/09/10 low homology 10/09/10 low homology AV404903 prgv ...

  2. EST Table: AV398806 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398806 NV060303 11/12/09 GO hit GO:0005488(binding)|GO:0005515(protein binding)|G... aa gnl|Amel|GB16637-PA 10/09/10 74 %/237 aa gi|91092680|ref|XP_971368.1| PREDICTED: similar to AGAP009538-PA [Tribolium castaneum] AV398806 NV06 ...

  3. EST Table: AV399953 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399953 br--0128 11/12/09 GO hit GO:0016491(oxidoreductase activity)|GO:0055114(ox...idation reduction) 10/09/28 43 %/114 aa ref|XP_397141.3| PREDICTED: similar to NADPH dependent diflavin oxid...imilar to NADPH-dependent FMN and FAD containing oxidoreductase-like protein [Tribolium castaneum] AV399953 br-- ...

  4. Förstudie till implementering av Electronic Flight Bag

    OpenAIRE

    Löfgren Bengtson, Erik

    2013-01-01

    Flygbranschen har på senare år blivit överrumplad av den snabba expansionen av Electronic Flight Bags (EFB) och introduktionen av bärbara läsplattor har öppnat upp för ett mer ekonomiskt alternativ till fast installerad utrustning. Med anledning av detta har NextJet beslutat sig för att genomföra en förstudie för att se om det går att implementera EFB i bolaget på ett säkert och kostnadseffektivt sätt. Den här studien visar att implementering av Electronic Flight Bag inte kunde påvisa några d...

  5. Cofactor requirement of HpyAV restriction endonuclease.

    Directory of Open Access Journals (Sweden)

    Siu-Hong Chan

    Full Text Available BACKGROUND: Helicobacter pylori is the etiologic agent of common gastritis and a risk factor for gastric cancer. It is also one of the richest sources of Type II restriction-modification (R-M systems in microorganisms. PRINCIPAL FINDINGS: We have cloned, expressed and purified a new restriction endonuclease HpyAV from H. pylori strain 26695. We determined the HpyAV DNA recognition sequence and cleavage site as CCTTC 6/5. In addition, we found that HpyAV has a unique metal ion requirement: its cleavage activity is higher with transition metal ions than in Mg(++. The special metal ion requirement of HpyAV can be attributed to the presence of a HNH catalytic site similar to ColE9 nuclease instead of the canonical PD-X-D/EXK catalytic site found in many other REases. Site-directed mutagenesis was carried out to verify the catalytic residues of HpyAV. Mutation of the conserved metal-binding Asn311 and His320 to alanine eliminated cleavage activity. HpyAV variant H295A displayed approximately 1% of wt activity. CONCLUSIONS/SIGNIFICANCE: Some HNH-type endonucleases have unique metal ion cofactor requirement for optimal activities. Homology modeling and site-directed mutagenesis confirmed that HpyAV is a member of the HNH nuclease family. The identification of catalytic residues in HpyAV paved the way for further engineering of the metal binding site. A survey of sequenced microbial genomes uncovered 10 putative R-M systems that show high sequence similarity to the HpyAV system, suggesting lateral transfer of a prototypic HpyAV-like R-M system among these microorganisms.

  6. Cofactor requirement of HpyAV restriction endonuclease.

    Science.gov (United States)

    Chan, Siu-Hong; Opitz, Lars; Higgins, Lauren; O'loane, Diana; Xu, Shuang-Yong

    2010-02-05

    Helicobacter pylori is the etiologic agent of common gastritis and a risk factor for gastric cancer. It is also one of the richest sources of Type II restriction-modification (R-M) systems in microorganisms. We have cloned, expressed and purified a new restriction endonuclease HpyAV from H. pylori strain 26695. We determined the HpyAV DNA recognition sequence and cleavage site as CCTTC 6/5. In addition, we found that HpyAV has a unique metal ion requirement: its cleavage activity is higher with transition metal ions than in Mg(++). The special metal ion requirement of HpyAV can be attributed to the presence of a HNH catalytic site similar to ColE9 nuclease instead of the canonical PD-X-D/EXK catalytic site found in many other REases. Site-directed mutagenesis was carried out to verify the catalytic residues of HpyAV. Mutation of the conserved metal-binding Asn311 and His320 to alanine eliminated cleavage activity. HpyAV variant H295A displayed approximately 1% of wt activity. Some HNH-type endonucleases have unique metal ion cofactor requirement for optimal activities. Homology modeling and site-directed mutagenesis confirmed that HpyAV is a member of the HNH nuclease family. The identification of catalytic residues in HpyAV paved the way for further engineering of the metal binding site. A survey of sequenced microbial genomes uncovered 10 putative R-M systems that show high sequence similarity to the HpyAV system, suggesting lateral transfer of a prototypic HpyAV-like R-M system among these microorganisms.

  7. Involved Node Radiation Therapy

    DEFF Research Database (Denmark)

    Maraldo, Maja V; Aznar, Marianne C; Vogelius, Ivan R

    2012-01-01

    PURPOSE: The involved node radiation therapy (INRT) strategy was introduced for patients with Hodgkin lymphoma (HL) to reduce the risk of late effects. With INRT, only the originally involved lymph nodes are irradiated. We present treatment outcome in a retrospective analysis using this strategy...... to 36 Gy). Patients attended regular follow-up visits until 5 years after therapy. RESULTS: The 4-year freedom from disease progression was 96.4% (95% confidence interval: 92.4%-100.4%), median follow-up of 50 months (range: 4-71 months). Three relapses occurred: 2 within the previous radiation field......, and 1 in a previously uninvolved region. The 4-year overall survival was 94% (95% confidence interval: 88.8%-99.1%), median follow-up of 58 months (range: 4-91 months). Early radiation therapy toxicity was limited to grade 1 (23.4%) and grade 2 (13.8%). During follow-up, 8 patients died, none from HL, 7...

  8. Node seniority ranking

    CERN Document Server

    Fioriti, Vincenzo

    2014-01-01

    Recent advances in graph theory suggest that is possible to identify the oldest nodes of a network using only the graph topology. Here we report on applications to heterogeneous real world networks. To this end, and in order to gain new insights, we propose the theoretical framework of the Estrada communicability. We apply it to two technological networks (an underground, the diffusion of a software worm in a LAN) and to a third network representing a cholera outbreak. In spite of errors introduced in the adjacency matrix of their graphs, the identification of the oldest nodes is feasible, within a small margin of error, and extremely simple. Utilizations include the search of the initial disease-spreader (patient zero problem), rumors in social networks, malware in computer networks, triggering events in blackouts, oldest urban sites recognition.

  9. Node web development

    CERN Document Server

    Herron, David

    2013-01-01

    Presented in a simple, step-by-step format, this book is an introduction to web development with Node.This book is for anybody looking for an alternative to the ""P"" languages (Perl, PHP, Python), or anyone looking for a new paradigm of server-side application development.The reader should have at least a rudimentary understanding of JavaScript and web application development.

  10. Atypical Chordae Tendineae of the Canine (Canis familiaris) Right Atrioventricular Valve.

    Science.gov (United States)

    Cope, L A

    2016-12-01

    The canine right atrioventricular valve cusps are anchored to papillary muscles by chordae tendineae. During ventricular systole, these tendineae keep the cusps from being pushed into the atrium. While this is the general description for chordae tendineae, several researchers have briefly documented chordae tendineae in animal and human hearts that do not attach to papillary muscles. In the 39 canine hearts examined, atypical chordae tendineae were observed in two hearts. In both dogs, a single stranded chordae tendineae extended from the free edge of the parietal cusp of the right atrioventricular valve to the ventricular free wall. While the discovery of these atypical tendineae provides additional information on canine cardiac anatomy, their presence may also be clinically significant. A review of the veterinary and biomedical literature showed entanglement in normal chordae tendineae can be a complication during cardiac catheterization or pacemaker lead placement. Given this issue with normal chordae tendineae, it seems logical to propose that these atypical tendineae could also cause catheter or pacemaker lead entanglement and therefore warrant further study and documentation. © 2016 Blackwell Verlag GmbH.

  11. Atrio-ventricular block requiring pacemaker in patients with late onset Pompe disease.

    Science.gov (United States)

    Sacconi, Sabrina; Wahbi, Karim; Theodore, Guillaume; Garcia, Jérémy; Salviati, Leonardo; Bouhour, Françoise; Vial, Christophe; Duboc, Denis; Laforêt, Pascal; Desnuelle, Claude

    2014-07-01

    Enzyme replacement therapy consistently improves cardiac function in infantile and juvenile onset patients with Pompe disease and cardiomyopathy, but is apparently not effective in preventing rhythm disorders, an emerging cardiac phenotype in long term survivors. In patients with late onset Pompe disease cardiomyopathy is an exceptional finding while heart rhythm disorders seem to be more frequent. We retrospectively identified, among a cohort of 131 French late onset Pompe disease patients, four patients with severe atrio-ventricular blocks requiring pacemaker implantation. These patients had no other risk factors for cardiovascular diseases or cardiomyopathy. In one patient the atrioventricular block was discovered while still asymptomatic. Cardiac conduction defects are relatively rare in late onset Pompe disease and may occur even in absence of cardiac symptoms or EKG abnormalities. However because of the possible life-threatening complications associated with these conduction defects, cardiac follow-up in patients with late onset Pompe disease should include periodical Holter-EKG monitoring. Copyright © 2014 Elsevier B.V. All rights reserved.

  12. Når kontakter betyr alt : En studie av bruken av nettverksmediet LinkedIn

    OpenAIRE

    Blaalid, Maren Hyvang

    2012-01-01

    LinkedIn er et av de mest populære sosiale mediene i Norge og tiltrekker seg stadig flere medlemmer. I denne masteroppgaven studerer jeg bruken av LinkedIn for å undersøke hva som er det særegne ved dette nettverksmediet. Jeg har utført en spørreundersøkelse blant 280 brukere for å få innsikt i hvem de er, hvorfor de bruker LinkedIn og hvordan de gjør det. Funnene fra analysen viser at brukerne kjennetegnes ved at de er selvstendige og formålsrasjonelle, som bruker LinkedIn strategisk for å n...

  13. Framtagning av en Maintenance Organisation Expositon

    OpenAIRE

    Vukasinovic, Zoran; Mehmeti, Adnan

    2012-01-01

    För att få bedriva underhållsverksamhet på flygplan över 5700kg så måste underhållsorganisationen i fråga vara godkänd av Transportstyrelsen samt följa EU:s flygsäkerhetsmyndighet EASAs Part 145 regelverk. För att berörda myndigheter ska få sig en insikt i hur underhållsorganisationera ser ut och fungerar så måste dessa skriva en verkstadshandbok som beskriver verksamheten och processer. Detta är ett krav som finns beskrivet i Part 145 regelverket. Uppgiften blev att skriva ett förslag på kap...

  14. Pseudo cryomapping for ablation of atrioventricular nodal reentry tachycardia: A single center North American experience

    Directory of Open Access Journals (Sweden)

    Vaibhav K. Moondra

    2017-07-01

    Conclusions: In conclusion, anatomic cryoablation of AVNRT utilizing a 6 mm electrode catheter with mapping performed at −80° Celsius is a safe procedure with good long term efficacy. Transient A-V block during the index procedure increases the risk of late recurrence.

  15. A case of pancreatic AV malformation in an elderly man.

    Science.gov (United States)

    Gupta, Vipin; Kedia, Saurabh; Sonika, Ujjwal; Madhusudhan, Kumble Seetharama; Pal, Sujoy; Garg, Pramod

    2018-02-05

    A 60-year-old man presented with recurrent abdominal pain and weight loss for 6 months. Abdominal imaging showed a large vascular lesion in the head and neck of pancreas suggestive of arteriovenous malformation (AV malformation). Endoscopic ultrasound was done which showed features of AV malformation with no evidence of pancreatic malignancy. Surgery was planned for definitive treatment of malformation. Digital subtraction angiography with angioembolization was done prior to surgery to reduce vascularity of the lesion. He recovered after a pylorus preserving pancreaticoduodenectomy. Histopathology of the resected specimen confirmed the pancreatic AV malformation. There has been no recurrence at 2 years of follow-up.

  16. Contribuição da análise eletrofisiológica e anatômica do circuito atípico da taquicardia atrioventricular nodal Contribution of the electrophysiological and anatomical analysis of the atypical atrioventricular nodal tachycardia circuit

    Directory of Open Access Journals (Sweden)

    Maila Seifert Macedo Silva

    2007-02-01

    patients with nodal atrioventricular tachycardia (NAVT. METHODS: 145 male and female patients aged 16-84 years, with NAVT who had undergone radiofrequency catheter ablation in the posteroseptal region of the right atrium were studied. Evaluation criteria were anatomical location and electrophysiological behavior of retrograde conduction during NAVT, in order to understand the nodal reentrant circuit (classifying the tachycardia as typical or atypical, and monitoring of retrograde conduction during JET episodes for risk-predicting AVB events. RESULTS: Of the 145 patients studied, 132 (91% met electrophysiological and anatomical criteria of the typical form of NAVT, and 13 (9% of atypical form. During the ablation, 5.3% with the typical form and 30.8% of the atypical form presented risk events for AVB. After the ablation, complications were a total AVB episode in one patient and a first-degree AVB episode in another in the typical group, and one first-degree AVB in the atypical group. All three episodes were preceded by risk events and resulted in permanent nodal injury. CONCLUSION: Patients with atypical NAVT presented higher percentages of risk events for atrioventricular block than did patients with the typical form (p=0.021.A careful observation of retrograde conduction during JET episodes is vital in order to avoid permanent damage in AV nodal conduction, such as TAVB, after the ablation procedure.

  17. [The coexistence of a para hisian accessory pathway and a complete atrioventricular block in a 32 years old patient].

    Science.gov (United States)

    Petipe Kappe, C; Halimi, F; Leclercq, J-F

    2015-02-01

    The present case report describes a 32-year-old patient with complete atrioventricular block coexisting with a permanent ventricular preexcitation. The patient ended up with pacemaker implantation without requiring ablation of accessory pathway. Copyright © 2013 Elsevier Masson SAS. All rights reserved.

  18. Marinøkologisk vurdering av utslippssted - og innlagringsdyp for utslippet til Bekkelaget renseanlegg Fase 1

    OpenAIRE

    J. Magnusson; Bjerkeng, B.

    1998-01-01

    Rapporten beregner innlagring og fortynning av renset avløpsvann fra Bekkelaget renseanlegg ved ulike utslippsdyp. Ut fra resultatene diskuteres hvilke alternativer som foreløpig virker mest gunstige for resipienten. For en endelig bedømmelse av effekten av de ulike alternativene anbefales bruk av modellberegninger. Oslo vann og avløpsverk (OVA)

  19. Marinøkologisk vurdering av utslippssted - og innlagringsdyp for utslippet til Bekkelaget renseanlegg Fase 1

    OpenAIRE

    J. Magnusson; Bjerkeng, B.

    1998-01-01

    Rapporten beregner innlagring og fortynning av renset avløpsvann fra Bekkelaget renseanlegg ved ulike utslippsdyp. Ut fra resultatene diskuteres hvilke alternativer som foreløpig virker mest gunstige for resipienten. For en endelig bedømmelse av effekten av de ulike alternativene anbefales bruk av modellberegninger.

  20. Compositional mapping of Vesta quadrangle Av-10

    Science.gov (United States)

    Tosi, F.; Palmer, E.; De Sanctis, M. C.; Nathues, A.; Pieters, C.; Ammannito, E.; Capaccioni, F.; Frigeri, A.; Palomba, E.; Zambon, F.; Jaumann, R.; Le Corre, L.; Preusker, F.; Stephan, K.; Raymond, C. A.; Reddy, V.; Russell, C. T.

    2012-04-01

    The Dawn spacecraft entered orbit around asteroid 4 Vesta in mid-July 2011. Since then, the Visible and InfraRed Imaging Spectrometer (VIR) acquired hyperspectral images of Vesta's surface in the overall wavelength range from 0.25 to 5.1 μm. During the Approach and Survey mission phases (23 July through 29 August 2011), VIR obtained resolved images of Vesta with spatial resolution between 1.31 km and 0.68 km/pix. More than 65% of the surface, from the South Pole up to ˜40°N, was observed under different illumination conditions and local solar elevations. Further data were acquired in the subsequent HAMO and LAMO phases. Based on this datasets, the Dawn Team is conducting mineralogical mapping of Vesta's surface in the form of 15 quadrangle maps. In this work we present the results of the spectroscopic analysis carried out for the quadrangle Av-10 ("Oppia"), spanning Vesta's latitude 22S° - 22N° and longitude 288° - 360°. Vesta is known to have a basaltic surface from visible/near-infrared reflectance spectroscopy. Although pyroxenes' spectral signatures at about 0.9 and 1.9 µm are ubiquitous on Vesta and largely dominate its surface composition, significant variability in slope, strength and wavelength position of the center of these features can be measured, which indicate multiple physical surface processes. Absorption band depth is sensitive to abundance, texture and multiple scattering effects. On the other hand, the position of the band centers is sensitive to Calcium and Magnesium abundance in pyroxenes, which is crucial to establish a link with Howardite, Eucrite and Diogenite meteorites' clan (HEDs). On the basis of several spectral indices, the surface of Vesta can be divided into different terrain types, which are mostly related to specific geological units or morphological surface features. By combining VIR channels and ratios into colour images, the presence and abundance of these materials can be revealed. Among the terrain types identified on

  1. Open Source AV solution supporting In Situ Simulation

    DEFF Research Database (Denmark)

    Krogh, Kristian; Pociunas, Gintas; Dahl, Mads Ronald

    the software to meet our expectations for a portable AV system for VAD. The system would make use of “off the shelf” hardware components which are widely available and easily replaced or expanded. The developed AV software and coding is contracted to be available as Copyleft Open Source to ensure low cost...... a stable AV software that has be developed and implemented for an in situ simulation initiative. This version (1.3) is the first on released as Open Source (Copyleft) software (see QR tag). We have found that it is possible to deliver multi-camera video assisted debriefing in a mobile, in situ simulation...... environment using an AV system constructed from “off the shelf” components and Open Source software....

  2. Knihovna Sociologického ústavu AV ČR

    Czech Academy of Sciences Publication Activity Database

    Hesová, Nela

    2017-01-01

    Roč. 7, č. 3 (2017) E-ISSN 1805-2800 Institutional support: RVO:68378025 Keywords : library Subject RIV: AF - Documentation, Librarianship, Information Studies https://www.lib.cas.cz/casopis-informace/knihovna-sociologickeho-ustavu-av-cr/

  3. Navy AV-8B Crash Survivable Flight Incident Recorder (CSFIR)

    National Research Council Canada - National Science Library

    1998-01-01

    ...) met at the Naval Air Weapons Development Center, Building P302, China Lake, CA for a Program Review I Technical Interchange Meeting in support of the AV-8B Crash Survivable Flight Incident Recorder System (CSFIR...

  4. Porträtt - bilder av människan

    OpenAIRE

    Fagerholm, Tanja

    2016-01-01

    Mitt examensarbete är nödvändigtvis inte ett slutresultat av mina visuella arbeten under studietiden utan snarare resultatet av en ständigt pågående process i att hitta min plats inom konsten. En frågeställning jag brottats med under studiernas gång är begreppet konstnär. Vad är en konstnär? Vad är konst? För att närma mig förväntningarna på hur en riktig konstnär bör vara har jag gått tillbaka till en klassisk form av måleri, nämligen avbildning av människor. Istället för att använda mi...

  5. Liv og lerret Fire portretter og et "kryptoportrett" av Gustav KLimt

    OpenAIRE

    Gamborg, Siri Angela

    2009-01-01

    Studie av fire portretter og et "kryptoportrett" av Gustav Klimt. Analysen fokuserer på Klimts avbildning av kvinner og menn på forskjellig måte og ved hjelp av ulike stilistiske virkemidler. Kjønnsaspektet i studien er belyst utfra samtidskonteksten og kvinnenes spesielle situasjon i Wien rundt århundreskiftet 1800/1900 og Klimts fremstilling av disse elementene i sine portretter.

  6. EST Table: AV403989 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV403989 pg--0306 10/09/28 100 %/137 aa ref|NP_037751.1| Q protein [Enterobacteria ...phage HK97] gb|AAF31144.1| Q protein [Enterobacteria phage HK97] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h AV404408 pg-- ...

  7. Atle Næss: Roten av minus en

    Directory of Open Access Journals (Sweden)

    Linda Hamrin Nesby

    2006-06-01

    Full Text Available Atle Næss har skrevet flere romaner, og to biografier om hhv Edevard Munch og Galileo Galilei. Med Roten av minus en kombinerer han roman- og biografigenren, og skriver både en kjærlighetshistorie, et utkast til en biografi og et riss av en selvbiografi som i sum blir til en roman om hvorvidt livet har den orden og nødvendighet som biografien er satt til å formidle

  8. EST Table: AV403854 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV403854 pg--0133 10/09/28 98 %/123 aa ref|ZP_03045664.1| tail length tape measure ...protein [Escherichia coli E22] gb|EDV82450.1| tail length tape measure protein [Escherichia coli E22] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h AV404025 pg-- ...

  9. EST Table: AV399879 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399879 NV120899 10/09/28 100 %/196 aa ref|YP_002884369.1| IE-1 [Bombyx mandarina ...nucleopolyhedrovirus] gb|ACQ57320.1| IE-1 [Bombyx mandarina nucleopolyhedrovirus] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h AV399445 NV12 ...

  10. EST Table: AV399317 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399317 NV120063 10/09/28 100 %/262 aa ref|YP_002884369.1| IE-1 [Bombyx mandarina ...nucleopolyhedrovirus] gb|ACQ57320.1| IE-1 [Bombyx mandarina nucleopolyhedrovirus] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h AV399445 NV12 ...

  11. EST Table: AV399810 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399810 NV120810 10/09/28 69 %/173 aa ref|YP_002884353.1| PP34 [Bombyx mandarina n...ucleopolyhedrovirus] gb|ACQ57304.1| PP34 [Bombyx mandarina nucleopolyhedrovirus] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h AV399543 NV12 ...

  12. EST Table: AV399857 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399857 NV120871 10/09/28 88 %/122 aa ref|YP_002884320.1| ODV-E25 [Bombyx mandarin...a nucleopolyhedrovirus] gb|ACQ57271.1| ODV-E25 [Bombyx mandarina nucleopolyhedrovirus] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h AV399408 NV12 ...

  13. EST Table: AV399758 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399758 NV120722 10/09/28 100 %/229 aa ref|YP_002884369.1| IE-1 [Bombyx mandarina ...nucleopolyhedrovirus] gb|ACQ57320.1| IE-1 [Bombyx mandarina nucleopolyhedrovirus] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h AV399445 NV12 ...

  14. EST Table: AV399854 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399854 NV120868 10/09/28 86 %/123 aa ref|YP_002884262.1| BRO-A [Bombyx mandarina ...nucleopolyhedrovirus] gb|ACQ57213.1| BRO-A [Bombyx mandarina nucleopolyhedrovirus] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h AV399449 NV12 ...

  15. EST Table: AV399743 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399743 NV120679 11/12/09 n.h 10/09/28 84 %/219 aa ref|NP_047426.1| ARIF-1 [Bombyx... mori NPV] gb|AAC63695.1| ARIF-1 [Bombyx mori NPV] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h AV399743 NV12 ...

  16. EST Table: AV404219 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404219 pg--0716 10/09/28 88 %/150 aa ref|YP_002928933.1| Host specificity protein... J [Escherichia coli BW2952] gb|ACR63430.1| Host specificity protein J [Escherichia coli BW2952] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h AV404050 pg-- ...

  17. AVS (Application Visualization System) user`s guide

    Energy Technology Data Exchange (ETDEWEB)

    Masuko, Kenji; Kato, Katsumi [Research Organization for Information Science Technology, Tokai, Ibaraki (Japan); Gorai, Kazuo; Yamazaki, Kazuhiko

    1996-03-01

    Computer and network environment for image processing has been developed and maintained under the course of establishing a distributed processing environment by the information system operating division. We introduced a server for image processing, AVS for image processing software and an animation processing system (video, frame scan converter). This report summarizes the information to use AVS and to develop and maintain computer and network environment for image processing. (author).

  18. EST Table: AV398238 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398238 NV021277 11/12/09 GO hit GO:0004871(signal transducer activity)|GO:0005515...zinc ion binding) 10/09/28 91 %/106 aa ref|XP_002007246.1| GI12833 [Drosophila mojavensis] gb|EDW17722.1| GI12833 [Drosophila mojav...1.1| hypothetical protein TcasGA2_TC003318 [Tribolium castaneum] AV398238 NV02 ...

  19. EST Table: AV403342 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV403342 msgV0350 11/12/09 GO hit GO:0004867(serine-type endopeptidase inhibitor ac...erpin-28 [Bombyx mori] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h AV403342 msgV ...

  20. EST Table: AV399322 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399322 NV120068 10/09/28 86 %/174 aa ref|NP_047489.1| VP39 [Bombyx mori NPV] gb|A...AC63758.1| VP39 [Bombyx mori NPV] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h AV399298 NV12 ...

  1. EST Table: AV405409 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV405409 wdV10576 11/12/09 n.h 10/09/28 33 %/246 aa ref|XP_001866937.1| scavenger r...ef|XP_967476.1| PREDICTED: similar to scavenger receptor cysteine-rich protein isoform 1 [Tribolium castaneum] AV405409 wdV1 ... ...eceptor cysteine-rich protein [Culex quinquefasciatus] gb|EDS44206.1| scavenger receptor cysteine-rich prote

  2. Marcus Gerbezius (1658–1718 and his first description of a complete atrioventricular block

    Directory of Open Access Journals (Sweden)

    Zvonka Zupanič Slavec

    2016-01-01

    Full Text Available Background: Marcus Gerbezius, a distinguished Slovenian physician and scientist from the turn of the 17th to the 18th Century, published in the year 1717 an article in the annual journal of the German Academy of Natural Scientists in Halle, in which he described a patient with a clinical presentation of extreme bradycardia due to a complete atrioventricular block. Methods: methodology of history of medicine, analysis of archival materials, documents, and various publications.Results: Presentation of the life and work of Marcus Gerbezius, emphasizing the significance of his pioneering discovery of what is known today as Adams-Stokes Syndrome.Conclusion: The article by Gerbezius was published almost 50 years before Morgagni’s, and about 150 years before Adams’ or Stokes’ articles on the same subject; therefore the name of Gerbezius should be included in the eponym name of the disorder “Syndrome Gerbezius-Morgagni-Adams-Stokes” – Syndrome GMAS.

  3. Transient complete atrioventricular block following transvenous electrical cardioversion of atrial fibrillation in a horse.

    Science.gov (United States)

    van Loon, G; De Clercq, D; Tavernier, R; Amory, H; Deprez, P

    2005-07-01

    Transvenous electrical cardioversion was attempted in a horse with drug refractory atrial fibrillation. A temporary pacing catheter and two defibrillation catheters were inserted transvenously into the right ventricular apex, the right atrium and the pulmonary artery, respectively. Under general anaesthesia 100, 200, 300 and 360 J monophasic shocks were delivered between both defibrillation catheters but sinus rhythm could not be restored. Immediately after the 200, 300 and 360 J shock, transient third-degree atrioventricular block occurred for a period of, respectively, 15, 40 and 55 s. These periods of profound bradycardia were corrected by temporary right ventricular pacing until spontaneous conduction resumed. It is concluded that temporary right ventricular pacing should be available during electrical cardioversion of atrial fibrillation in horses.

  4. Reversible complete atrioventricular block after percutaneous ASD device closure in a child <15 kg.

    Science.gov (United States)

    Rohit, Manoj Kumar; Puri, Kriti; Vadivelu, Ramalingam

    2014-01-01

    Transcatheter device closure of atrial septal defect (ASD) in small children less than 15 kg may be associated with increased complications. Complete atrioventricular heart block (CHB) is a rare complication of ASD device closure in such a setting. We report the case of a 2-year-old girl, less than 15 kg, who underwent device closure of ASD with Amplatzer Septal Occluder and subsequently developed CHB 12 h after the procedure which resolved completely with steroid treatment on fifth day. Case report of a similar kind is rarely reported in the literature. Despite adequate postero-inferior margin CHB may still occur in small children as in our case. Copyright © 2014 Cardiological Society of India. All rights reserved.

  5. Near miss sudden cardiac death on a young patient with repaired atrioventricular septal defect.

    Science.gov (United States)

    Papadopoulou, Sofia A; Dimopoulos, Konstantinos; Gatzoulis, Michael A

    2008-11-28

    Patients with congenital heart disease often face the prospect of long-term haemodynamic or arrhythmic complications for which lifelong follow-up in specialist adult congenital heart disease (ACHD) centres is required. We describe the case of a 25-year-old man with repaired atrioventricular septal defect who was referred to our centre after a ventricular fibrillation arrest. Serial echocardiograms in previous years had shown progressive severe left ventricular outflow obstruction, but the patient had not been operated on as he was deemed asymptomatic and reluctant to consider surgery. Management and criteria for further intervention in ACHD patients often differ from those of patients with acquired heart disease and reliance on symptoms alone is not good practice and may prove catastrophic.

  6. TAQUICARDIA POR REENTRADA DEL NODO AURÍCULO-VENTRICULAR / Atrioventricular nodal reentrant tachycardia

    Directory of Open Access Journals (Sweden)

    Jéssica Mirella Mercedes

    2013-01-01

    Full Text Available Resumen La taquicardia por reentrada del nodo aurículo–ventricular representa una parte significativa de las taquiarritmias que los médicos asisten en los servicios de urgencias. Constituye la taquicardia paroxística más frecuente, y es característico que se presente sobre todo en mujeres entre la cuarta y la quinta década de la vida. El diagnóstico puede hacerse con alta fiabilidad mediante el electrocardiograma de superficie y algunos casos complejos o dudosos, mediante los estudios electrofisiológicos. Su tratamiento debe ser dirigido hacia la curación definitiva mediante la técnica de ablación endocavitaria, pero de acuerdo a su disponibilidad o las preferencias del paciente se puede indicar tratamiento farmacológico. En este artículo se resumen las técnicas diagnósticas, los tipos de taquicardia por reentrada intranodal y los principales aspectos del tratamiento. / Abstract Atrioventricular nodal reentrant tachycardia represents a significant part of tachyarrhythmias seen by attending physicians in emergency departments. It is the most common paroxysmal tachycardia, and it occurs primarily in women between their fourth and fifth decades of life. Diagnosis can be made with high reliability by surface electrocardiogram and complex or borderline cases by electrophysiological studies. Its treatment should be aimed towards definitive healing by endocardial ablation technique, but depending on availability or patient preferences drug treatment may be indicated. This article summarizes the diagnostic techniques, types of atrioventricular nodal reentrant tachycardia and major aspects of treatment.

  7. Long-term outcomes following cryoablation of atrioventricular nodal reentrant tachycardia in children.

    Science.gov (United States)

    Karacan, Mehmet; Çelik, Nida; Akdeniz, Celal; Tuzcu, Volkan

    2018-01-09

    Atrioventricular nodal reentrant tachycardia (AVNRT) is a common tachyarrhythmia substrate in children, which is successfully treated by catheter ablation using radiofrequency or cryothermal energy. In recent years, cryoablation (Cryo) using electroanatomical system guidance is more commonly preferred for use in children in order to decrease the risk of an atrioventricular block. However, there are concerns regarding the long-term efficacy of Cryo in treating AVNRT. We aimed to evaluate the feasibility, safety, and long-term efficacy of Cryo for AVNRT in children. A total of 275 consecutive children above four years of age diagnosed with AVNRT were included in our study. The EnSite system (St. Jude Medical, Inc., St. Paul, MN, USA) was used to reduce or eliminate fluoroscopy. The study included 275 patients (148 females, age: 11.9 ± 3.6 years) undergoing catheter ablation for AVNRT from July 2012 to September 2016. Acute success was obtained in all (100%) patients with a mean procedure time of 140 ± 44 mins. Fluoroscopy was used in only 12 (4.4%) patients. During a follow-up time of 25.6 ± 13.5 months (median: 23 months), AVNRT recurred in 12 of 279 (4.4%) of the patients. Age, sex, number of Cryo lesions, and catheter tip size (6-mm vs. 8-mm) were not predictive for recurrence. In nine patients, a repeat ablation was successfully performed with cryoenergy. Cryo for AVNRT is a safe and effective procedure with excellent long-term outcomes. The use of electroanatomical systems during ablation significantly decreases exposure to fluoroscopy without compromising success. This article is protected by copyright. All rights reserved. This article is protected by copyright. All rights reserved.

  8. Konstruktionen av hälsa på Instagram : En studie av unga människors uppfattning av hälsa genom bild och text

    OpenAIRE

    Danielsson, Jennifer

    2014-01-01

    Unga människor är idag väl insatta användare av olika former av sociala medier - det är ofta en självklar del i deras vardag. Det sociala mediet Instagram har blivit oerhört populärt bland såväl barn som vuxna och används dagligen via mobilen för att förmedla ögonblicksbilder till omvärlden. I den här studien kommer Instagram - utifrån begrepp som hälsa, träning och konsumtion - analyseras med hjälp av teorier om makt och genus. Hälsomedvetenheten bland unga har genom spridningen på Instagram...

  9. Implementeringsstudie : en studie av lederroller ved implementering av LUS ved Berg skole

    OpenAIRE

    Michalsen, Anne Berit; Owren, Laila

    2010-01-01

    I denne masteroppgaven studerer vi en implementeringsprosess. I 2008-2009 skulle Leseutviklingsskjema (LUS) implementeres ved Berg skole, og vi ble bedt om å følge denne prosessen på nært hold. Vi mener at vi gjennom denne oppgaven gir kunnskap om en implementeringsprosess der en ekstern veileder har en sentral rolle i prosessen. Hvordan skolens ledelse og den eksterne veilederen inntar ulike roller gjennom implementeringen er en sentral del av vår studie. Formålet med oppgaven er dels å b...

  10. Compression in wearable sensor nodes: impacts of node topology.

    Science.gov (United States)

    Imtiaz, Syed Anas; Casson, Alexander J; Rodriguez-Villegas, Esther

    2014-04-01

    Wearable sensor nodes monitoring the human body must operate autonomously for very long periods of time. Online and low-power data compression embedded within the sensor node is therefore essential to minimize data storage/transmission overheads. This paper presents a low-power MSP430 compressive sensing implementation for providing such compression, focusing particularly on the impact of the sensor node architecture on the compression performance. Compression power performance is compared for four different sensor nodes incorporating different strategies for wireless transmission/on-sensor-node local storage of data. The results demonstrate that the compressive sensing used must be designed differently depending on the underlying node topology, and that the compression strategy should not be guided only by signal processing considerations. We also provide a practical overview of state-of-the-art sensor node topologies. Wireless transmission of data is often preferred as it offers increased flexibility during use, but in general at the cost of increased power consumption. We demonstrate that wireless sensor nodes can highly benefit from the use of compressive sensing and now can achieve power consumptions comparable to, or better than, the use of local memory.

  11. Spectral analysis of the quadrangles Av-13 and Av-14 on Vesta

    Science.gov (United States)

    Zambon, F.; Frigeri, A.; Combe, J.-Ph.; Tosi, F.; Longobardo, A.; Ammannito, E.; De Sanctis, M. C.; Blewett, D. T.; Scully, J.; Palomba, E.; Denevi, B.; Yingst, A.; Russell, C. T.; Raymond, C. A.

    2015-10-01

    The Av-13 (Tuccia) and Av-14 (Urbinia) quadrangles are located in the south-west region of Vesta. They are characterized by a large topographic variability, from the highest (Vestalia terra highlands) to the lowest (Rheasilvia basin). Many geological units in these quadrangles are not associated with mineralogical variability, as shown by the color-composite maps. Maps of mafic absorption band-center position reveal that the principal lithology is eucrite-rich howardite, but diogenite-rich howardite areas are also present, corresponding to particular features such as Antonia and Justina craters, which are characterized by strong mafic absorptions. These quadrangles, especially Urbinia, contain many bright ejecta, such as those of Tuccia crater, which are the highest reflectance materials on Vesta (Zambon et al., 2014). Dark areas are present and correspond to regions with deeper OH-signature. The two quadrangles contain many vertical ridge crests associated with the Rheasilvia impact. These ridges do not show mineralogical differences with respect to their surroundings, but have a distinctive appearance in color-ratio composite images.

  12. Disturbed Intracardiac Flow Organization After Atrioventricular Septal Defect Correction as Assessed With 4D Flow Magnetic Resonance Imaging and Quantitative Particle Tracing

    NARCIS (Netherlands)

    Calkoen, Emmeline E.; de Koning, Patrick J. H.; Blom, Nico A.; Kroft, Lucia J. M.; de Roos, Albert; Wolterbeek, Ron; Roest, Arno A. W.; Westenberg, Jos J. M.

    2015-01-01

    Objectives Four-dimensional (3 spatial directions and time) velocity-encoded flow magnetic resonance imaging with quantitative particle tracing analysis allows assessment of left ventricular (LV) blood flow organization. Corrected atrioventricular septal defect (AVSD) patients have an abnormal left

  13. NRC/UBC Node

    Energy Technology Data Exchange (ETDEWEB)

    Ellis-Perry, B. [Univ. of British Columbia, Vancouver, British Columbia (Canada); Yogendran, Y. [NRC Inst. for Fuel Cell Innovation, Vancouver, British Columbia (Canada)

    2004-07-01

    'Full text:' In the search for cleaner, more sustainable energy sources, many of the most promising breakthroughs have been in hydrogen technology. However, this promise will remain unfulfilled without public interest and enthusiasm, and without the infrastructure to support the technology. In order to get there, we have to test, perfect, and demonstrate technology that is safe and affordable, and we must do so in practical, familiar settings. Ideally, such settings should be easily accessible to the engineers, planners, and architects of tomorrow while providing a showcase for hydrogen technology that will attract the general public. This place is the NRC/UBC Hydrogen Node. The UBC campus in Point Grey is home to leading edge, internationally recognized researchers in a range of disciplines, both within the University and at the NRC Institute for Fuel Cell Innovation. On average, 40,000 students, faculty, and staff use the campus every day; UBC graduates go on to leadership positions in communities around the globe. Its spectacular setting makes UBC a popular destination for thousands of visitors from around the world. In 2006 UBC will host the World Urban Forum, and in 2010 it will be one of the sites for the Vancouver-Whistler Olympic Games. UBC and its South Campus neighbourhoods are developing as a model sustainable community, offering an excellent opportunity to develop and showcase hydrogen infrastructure and technology in a real-life, attractive setting that will be seen by thousands of people around the world. UBC's facilities, location, and Trek 2010 commitment to excellence in learning, research, and sustainability make it an ideal location for such a project. The H2 Village at UBC will be an integrated hydrogen demonstration project, linked to the hydrogen highway. This project is bringing together leading companies, researchers, and government agencies committed to making the refinement and early adoption of safe hydrogen technology a

  14. Overføring av avløpsvann fra Bekkelagets rensedistrikt til Sentralrenseanlegg Vest, SRV. En vurdering av konsekvensene for forholdene i Indre Oslofjord

    OpenAIRE

    J. Magnusson; Bjerkeng, B.

    1985-01-01

    Vurderingen legger særlig vekt på oksygenforholdene i Vestfjorden under sprangsjiktet . Det sikreste tiltaket ser ut til å være en ombygging av Bekkelaget R.A.til kjemisk rensing. Overføring til SRV vil gi økt direkte utslipp av oksygenforbrukende stoff til Vestfjorden. For overføring av 1/3 av avløpsvannmengden er det mulig at dette oppveies av minsket belastning fra organisk produksjon i overflaten. Overføringer på 2/3 og 3/3 ser ut til å gi uakseptable konsekvenser for oksygenforholdene i ...

  15. Early Correction of Common Atrioventricular Septal Defects: A Single-Center 20-Year Experience.

    Science.gov (United States)

    Vida, Vladimiro L; Tessari, Chiara; Castaldi, Biagio; Padalino, Massimo A; Milanesi, Ornella; Gregori, Dario; Stellin, Giovanni

    2016-12-01

    Over the past 20 years our policy has been to electively repair common atrioventricular canal defects (CAVCD) in patients between 8 and 12 weeks of age. We sought to evaluate the results of our past 20-year experience. From January 1992 to April 2014, 159 consecutive patients underwent CAVCD repair (133 patients had complete CAVCD and 26 patients had a transitional form of CAVCD). Surgical repair was accomplished with a double-patch (n = 137 [86%]) or a modified single patch (n = 22 [14%]) technique. Median age at operation was 96 days (interquartile range [IQR], 73-128 days); 90 patients were younger than 3 months of age. There were 3 operative (1.9%) and 12 late (7.7%) deaths. Median follow-up time after repair was 8.2 years (IQR, 3.6-15 years). Twenty patients (13%) required reoperation-16 (10%) for left atrioventricular valve (LAVV) regurgitation. Reoperation on the LAVV was more frequent in patients with a dysplastic LAVV preoperatively (p = 0.01; odds ratio [OR], 4.2; 95% confidence interval [CI], 1.33-13.5) and in patients who underwent closure for an absent/incomplete cleft at the time of repair (p = 0.01; OR, 5.4; 95% CI, 1.4-21). Late LAVV performance (regurgitation greater than or equal to moderate or the need for reoperation), including late deaths and patients who underwent reoperation, was significantly worse in patients older than 3 months at repair (10 of 83 patients [12%] versus 20 of 73 patients [27%]; hazard ratio [HR], 2.71; 95% CI, 1.19-6.19) and in patients with LAVV dysplasia (19 of 68 patients [28%] versus 11 of 88 patients [12%]; HR, 3; 95% CI, 1.53-8.51). Individualized early repair of CAVCD is safe and beneficial, with good early and long-term results. Copyright © 2016 The Society of Thoracic Surgeons. Published by Elsevier Inc. All rights reserved.

  16. The surgical anatomy of double-outlet right ventricle with concordant atrioventricular connection and noncommitted ventricular septal defect.

    Science.gov (United States)

    Stellin, G; Ho, S Y; Anderson, R H; Zuberbuhler, J R; Siewers, R D

    1991-12-01

    In describing hearts with double-outlet right ventricle, we have had problems with how best to use the term noncommitted as applied to the ventricular septal defect. We reviewed, therefore, 63 hearts with double-outlet right ventricle in the setting of usual atrial arrangement and a concordant atrioventricular connection. From these, 18 hearts with potentially noncommitted defects were identified and studied in detail. The defect was unequivocally remote from the ventricular outflow tracts in 16 of these hearts, being perimembranous with excavation to open into the inlet of the right ventricle in 12, two of these also having straddling of an atrioventricular valve. One heart had a muscular defect situated in the inlet part of the muscular septum, whereas the defect was the ventricular component of an atrioventricular septal defect in the other three. In the remaining two hearts the defect was anatomically juxtaposed to a subarterial outlet. The pathway to the outflow tract, however, was obstructed by leaflets of a straddling valve. Our study shows, therefore, the need to distinguish between anatomic "commitment" of the defect from the problems in terms of commitment that may confront the surgeon in the operating room. Not only does the distance between the interventricular communication and one of the subarterial outflow tract need to be assessed (the anatomic commitment), but also the presence and nature of any intervening extraneous tissues (the surgical commitment) requires assessment.

  17. The role of AV and VV optimization for CRT

    Directory of Open Access Journals (Sweden)

    William W. Brabham, M.D.

    2013-06-01

    Full Text Available Cardiac resynchronization therapy is an effective therapy for patients with left ventricular systolic dysfunction and a ventricular conduction delay; however, approximately 30% of patients do not experience significant clinical improvement with this treatment. Modern devices allow individualized programming of the AV delay and VV offset, which offer the possibility of improving clinical response rates with optimized programming. AV and VV delay optimization techniques have included echocardiography, device-based algorithms, and several other novel noninvasive techniques. While an acute improvement in hemodynamic function has been clearly demonstrated with optimized device settings, long-term clinical benefit is limited. In the majority of cases, an empiric AV delay with simultaneous biventricular or left ventricular pacing is adequate. The value of optimization of these intervals in “non-responders” still requires further investigation.

  18. Lesing av delvis motstridende tekster i syvende klasse

    Directory of Open Access Journals (Sweden)

    Wenke Mork Rogne

    2013-06-01

    Full Text Available I denne artikkelen ser vi på hvilken type informasjon elever i 7. klasse vektlegger for å konstruere en sammenhengende oppsummering av fire til dels motstridende tekster. Elever møter ofte flere tekster om samme tema – multiple tekster – og vi trenger økt kunnskap om hvordan de leser slike tekster. Elevene leste fire ulike tekster om en sykkelulykke. Tekstene presenterte informasjon som var delvis sammenfallende på tvers av alle tekstene, og delvis motstridende informasjon som innebar at enkelte tekster ga ulike beskrivelser av hendelsesforløpet. Vi testet elevenes ordavkodingsferdigheter, fikk dem til å fylle ut et spørreskjema om lesevaner og vi innhentet elevenes resultater på Nasjonal leseprøve. Etter lesing ba vi elevene gi en oppsummering av sykkelulykken. Elevene gjenga relativt mer sammenfallende informasjon enn motstridende informasjon. Gode resultater på Nasjonal leseprøve ser ut til å ha en sammenheng med elevenes ferdigheter i å konstruere en sammenhengende forståelse av de fire tekstene. Elever som oppga å lese mye på Internett hadde imidlertid fått med mindre av informasjonen som var felles for de fire tekstene i sine oppsummeringer. Vi fant også en negativ sammenheng mellom fritidslesing på Internett og resultatene fra Nasjonal leseprøve. Samlet sett indikerer resultatene at når elevene skal skape sammenheng mellom flere delvis motstridende tekster, så blir sammenfallende informasjon vektlagt mer enn motstridende informasjon. Dessuten ser det ut til at de elevene som bruker mest fritid til å lese på Internett, sliter mer med å sammenfatte innholdet i de fire tekstene enn de andre elevene.

  19. Smart Home Wireless Sensor Nodes

    DEFF Research Database (Denmark)

    Lynggaard, Per

    Smart homes are further development of intelligent buildings and home automation, where context awareness and autonomous behaviour are added. They are based on a combination of the Internet and emerging technologies like wireless sensor nodes. These wireless sensor nodes are challenging because....... This paper introduces an approach that considerably lowers the wireless sensor node power consumption and the amount of transmitted sensor events. It uses smart objects that include artificial intelligence to efficiently process the sensor event on location and thereby saves the costly wireless...

  20. Lack of physiological adaptation of the atrioventricular interval to heart rate in patients chronically paced in the AAIR mode.

    Science.gov (United States)

    Mabo, P; Pouillot, C; Kermarrec, A; Lelong, B; Lebreton, H; Daubert, C

    1991-12-01

    Seventeen consecutive patients, aged 56 +/- 12, were chronically paced in the AAIR mode for a symptomatic sinus node disease with atrial chronotropic incompetence defined by a peak exercise heart rate (HR) less than 75% of the maximal predicted heart rate (MPHR) mean = 65 +/- 10%). Sensors used were activity sensing (n = 7), minute ventilation (n = 6), or respiratory rate (n = 4). Basic pacing rate was programmed at 71 +/- 5 beats/min and the maximal sensor rate at approximately 85% MPHR (143 +/- 10); other sensor parameters were programmed individually. Six months after implant, two standardized and symptom limited exercise tests were performed in random order, AAI and AAIR modes, respectively. AAIR pacing significantly improved peak exercise HR (139 +/- 14 vs 112 +/- 30 beats/min; P less than 0.01), maximal sustained workload (132 +/- 42 vs 110 +/- 38 watts; P less than 0.02), and total exercise duration (724 +/- 299 vs 594 +/- 245 sec; p less than 0.02) compared to the AAI mode. In all 17 patients, HR was continuously sensor driven in the AAIR mode, making it possible to precisely study the adaptation of the stimulus-R interval and of the stimulus-R:RR ratio during exercise. Six patients normally adapted with a progressive shortening. Six others did not adapt at all without any variation of interval. Five patients paradoxically increased their stimulus-R interval (286 +/- 10 msec at peak E vs 220 +/- 19 msec at rest) and their stimulus-R:RR ratio (67 +/- 20% vs 29 +/- 4%), producing P waves occurring immediately after, or even within the R wave of the preceding cycle; two patients complained of severe exercise related symptoms corresponding to the so-called "AAIR pacemaker syndrome." The principal factors involved in the nonadaptation of AV interval to HR were related to the patient (organic heart disease, with the particular problem of the denervated heart; the bradytachy syndrome; and the use of drugs, especially beta blockers and Class I antiarrhythmic drugs

  1. Showrooming. -Kvalitativt studie av mindre, uavhengige butikker i klesbransjen.

    OpenAIRE

    Hoel, Beathe

    2016-01-01

    Denne oppgaven har som hensikt å undersøke hvordan showrooming atferd hos kundene påvirker de mindre klesbutikkene som ikke er tilknyttet en kjede. Problemstillingen i denne oppgaven er: Hvordan vurderer mindre, uavhengige butikker i klesbransjen de utfordringene som knyttes til trenden showrooming og hva gjør de for å motvirke eventuelle negative virkninger av slik forbrukeratferd? Studien har som formål å undersøke hyppigheten av showrooming atferd og om dette har noen negativer konsekv...

  2. EST Table: AV399445 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399445 NV120238 11/12/09 n.h 10/09/28 100 %/284 aa ref|YP_002884369.1| IE-1 [Bombyx mandarin...a nucleopolyhedrovirus] gb|ACQ57320.1| IE-1 [Bombyx mandarina nucleopolyhedrovirus] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h AV399445 NV12 ...

  3. Distribusjon av Polonium i fisk, med og uten avleiringshemmer

    OpenAIRE

    Veddeng, Hanne

    2012-01-01

    I forbindelse med utvinning av petroleumsressurser blir det sluppet ut store mengder produsert vann. Produsert vann er formasjonsvann fra reservoaret som følger med ved produksjonen av olje og gass. Når formasjonsvannet kommer i kontakt med sjøvann felles det ut uorganiske salter, som BaSO4. Dette er såkalte scaleavleiringer som utgjør et problem for oljeindustrien da det blant annet tetter igjen produksjonsrørene og gir en mindre effektiv produksjon. Som løsning på problemet tilsetter oljein...

  4. EST Table: AV399012 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399012 NV060536 11/12/09 n.h 10/09/28 65 %/135 aa ref|XP_396932.2| PREDICTED: similar to vav...ene:AGAP010292 10/09/10 65 %/135 aa gnl|Amel|GB13170-PA 10/09/10 57 %/138 aa gi|189241833|ref|XP_972772.2| PREDICTED: similar to vav1 [Tribolium castaneum] AV399012 NV06 ... ...7 %/132 aa C35B8.2b#CE39333#WBGene00006887#locus:vav- 1#status:Partially_confirmed#UniProt:Q45FX5#protein_id

  5. EST Table: AV398785 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398785 NV060280 11/12/09 n.h 10/09/28 40 %/193 aa ref|XP_002005659.1| GI20589 [Drosophila mojav...ensis] gb|EDW09594.1| GI20589 [Drosophila mojavensis] 10/08/28 40 %/193 aa FBpp0169806|DmojGI2.../10 n.h 10/09/10 35 %/184 aa gi|189234823|ref|XP_001809803.1| PREDICTED: similar to AGAP010960-PA [Tribolium castaneum] AV398785 NV06 ...

  6. EST Table: AV399741 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399741 NV120677 11/12/09 GO hit GO:0000213(tRNA-intron endonuclease activity)|GO:...0006388(tRNA splicing, via endonucleolytic cleavage and ligation) 10/09/28 42 %/119 aa ref|NP_001127799.2| t...0/08/27 n.h 10/09/10 n.h 10/09/10 35 %/145 aa gnl|Amel|GB15173-PB 10/09/10 n.h AV399741 NV12 ...

  7. Comparison of DDD versus VVIR pacing modes in elderly patients with atrioventricular block.

    Science.gov (United States)

    Kılıçaslan, Barış; Vatansever Ağca, Fahriye; Kılıçaslan, Esin Evren; Kınay, Ozan; Tigen, Kürşat; Cakır, Cayan; Nazlı, Cem; Ergene, Oktay

    2012-06-01

    Dual-chamber pacing is believed to have an advantage over single-chamber ventricular pacing. The aim of this study was to determine whether elderly patients who have implanted pacemakers for complete atrioventricular block gain significant benefits from dual-chamber (DDD) pacemakers compared with single chamber ventricular (VVIR) pacemakers. This study was designed as a randomized, two-period crossover study-each pacing mode was maintained for 1 month. Thirty patients (16 men, mean age 68.87 ± 6.89 years) with implanted DDD pacemakers were submitted to a standard protocol, which included an interview, pacemaker syndrome assessment, health related quality of life (HRQoL) questionnaires assessed by an SF-36 test, 6-minute walk test (6MWT), and transthoracic echocardiographic examinations. All of these parameters were obtained on both DDD and VVIR mode pacing. Paired data were compared. HRQoL scores were similar, and 6MWT results did not differ between the two groups. VVIR pacing elicited significant enlargement of the left atrium and impaired left ventricular diastolic functions as compared with DDD pacing. Two patients reported subclinical pacemaker syndrome, but this was not statistically significant. Our study revealed that in active elderly patients with complete heart block, DDD pacing and VVIR pacing yielded similar improvements in QoL and exercise performance. However, after a short follow-up period, we noted that VVIR pacing caused significant left atrial enlargement and impaired left ventricular diastolic functions.

  8. Adrenergic and cholinergic innervation of the atrioventricular valves in chinchilla (Chinchilla laniger).

    Science.gov (United States)

    Kuchinka, Jacek; Chrzanowska, Monika; Kuder, Tadeusz

    2017-05-29

    The arrangement of autonomous fibres was studied in the cardiac atrioventricular valves of small chinchillas. The dissected valves were stained entirely using the modified histochemical acetylcholine esterase technique (AChE) and the SPG-De la Torre method. Double immunocytochemical staining was also used for the expression of vesicular acetylcholine transporter (VAChT) and dopamine β hydroxylase (DBH). The study showed the presence of both cholinergic and adrenergic fibres, forming a kind of network on all cusps of both valves. The adrenergic network is always more strongly represented than the cholinergic network. The cholinergic nerve network of the "parietal" part formed mainly the parallel arrangement. As we move towards the free parts of the cusps, the arrangement becomes netted and radiant. Theadrenergic fibres formed only the netted arrangement, which was the most dense in the peripheral (parietal) part of the cusps. Some of the fibres in the vicinity of tendinous cords extended as far as the papillary muscles. Double immunocytochemical tests confirmed the presence and distribution of positive DBH and VAChT fibres. Some fibres (especially within the tendinous cords) show VAChT and DBH colocalization.

  9. Determinants of early dilated cardiomyopathy in neonates with congenital complete atrioventricular block.

    Science.gov (United States)

    Silvetti, Massimo Stefano; Drago, Fabrizio; Ravà, Lucilla

    2010-09-01

    Dilated cardiomyopathy (DCM) can occur in infants with congenital complete atrioventricular block (CCAVB) treated by permanent pacemaker (PM), even without other congenital heart defects. The objective is to find the risk factors of this complication. Retrospective analysis of a single-centre experience. Since 1992, 25 patients, aged 25 (1-355) days [median (range)], with normal ejection fraction (EF), underwent PM implantation (13 DDD, 12 VVIR) with an RV-pacing site. Follow-up was 4 (0.3-16) years. DCM occurred after 4 (3-23) months in eight patients (32%). Univariate analysis identified the following risk factors: younger age at implantation [5 (1-85) days vs. 90 (1-355) P = 0.007], a broad QRS (50 vs. 18% P = 0.03), prolonged QTc at implantation (63 vs. 0%, P = 0.001), and greater duration of heart rate >160 bpm during the first month after implantation (18 vs. 2%, P = 0.03). By multivariate analysis prolonged QTc was the only significant risk factor for DCM (hazard ratio: 23, P mode to allow predominant narrow QRS junctional rhythm (one patient each). Neonates with CCAVB without other congenital heart defects and prolonged QTc are at high risk for DCM possibly due to electromechanical dyssynchrony induced by high-rate RV pacing. In patients in whom RV pacing was discontinued, EF became normal.

  10. Transient sick sinus syndrome with complete atrioventricular block associated with ergonovine intake: A case report.

    Science.gov (United States)

    Wang, Hui-Ting; Liu, Wen-Hao; Chen, Yung-Lung

    2017-11-01

    More mature or older women are more likely to undergo in vitro fertilization and embryo implant. These women have a greater chance of receiving ergonovine therapy because of a suspected abortion. We present this case report to call attention to a latent lethal adverse effect in everyday obstetric practice using ergonovine. It requires more attention and close monitoring PATIENT CONCERNS:: We presented the case of a 38-year-old female patient with general weakness and mild chest tightness after ergonovine use. She was diagnosed as transient sick sinus syndrome and complete atrioventricular block with junctional escape rhythm after diagnostic work up. Conservative treatment with discontinuation of ergonovine and bed rest. Her sinus rhythm returned to normal the day after ergonovine was discontinued. The patient remained symptom-free since recovery of her sinus rhythm. Ergonovine may cause symptomatic and lethal bradyarrhythmia. Withdrawal of the causative medication and adequate supportive care can lead to a favorable outcome in these patients. More related cases should be reported. Further evaluation for treatment and prognosis are necessary.

  11. Transient proarrhythmic state following atrioventricular junction radiofrequency ablation: pathophysiologic mechanisms and recommendations for management.

    Science.gov (United States)

    Nowinski, Karolina; Gadler, Fredrik; Jensen-Urstad, Mats; Bergfeldt, Lennart

    2002-11-01

    The induction of complete heart block by radiofrequency ablation of the atrioventricular junction combined with pacemaker implantation has become an established therapy for rate control in patients with atrial fibrillation who are unresponsive to drugs. Reports of ventricular arrhythmias and sudden death after ablation have, however, raised concerns about safety. Ventricular arrhythmias are usually polymorphic and related to a phase of electrical instability due to an initial prolongation and then slow adaptation of repolarization caused by the change in heart rate and activation sequence. Structural heart disease, and other factors that predispose for the acquired long QT syndrome, seem to add to the risk. Ventricular activation and repolarization stabilize during the first week after the procedure. Routine pacing at 80 beats per minute during this phase is recommended, as well as in hospital monitoring for at least 48 hours. Patients with high-risk features for arrhythmias, such as congestive heart failure or impaired left ventricular function, may require pacing at higher rates. Adjustment of the pacing rate-although rarely below 70 beats per minute-is usually undertaken after a week in most patients, preferably after an electrocardiographic evaluation for repolarization abnormalities at the lower rate.

  12. Contribution of Copy Number Variation to Down Syndrome-associated Atrioventricular Septal Defects

    Science.gov (United States)

    Ramachandran, Dhanya; Mulle, Jennifer G.; Locke, Adam E.; Bean, Lora J.H.; Rosser, Tracie C.; Bose, Promita; Dooley, Kenneth J.; Cua, Clifford L.; Capone, George T.; Reeves, Roger H.; Maslen, Cheryl L.; Cutler, David J.; Sherman, Stephanie L.; Zwick, Michael E.

    2014-01-01

    Purpose The goal of this study was to identify the contribution of large copy number variants (CNV) to Down syndrome (DS) associated atrioventricular septal defects (AVSD), whose risk in the trisomic population is 2000-fold more compared to general disomic population. Methods Genome-wide CNV analysis was performed on 452 individuals with DS (210 cases with complete AVSD; 242 controls with structurally normal hearts) using Affymetrix SNP 6.0 arrays, making this the largest heart study conducted to date on a trisomic background. Results Large common CNVs with substantial effect sizes (OR>2.0) do not account for the increased risk observed in DS-associated AVSD. In contrast, cases had a greater burden of large rare deletions (p<0.01) and intersected more genes (p<0.007) when compared to controls. We also observed a suggestive enrichment of deletions intersecting ciliome genes in cases compared to controls. Conclusion Our data provide strong evidence that large rare deletions increase the risk of DS-associated AVSD, while large common CNVs do not appear to increase the risk of DS-associated AVSD. The genetic architecture of AVSD is complex and multifactorial in nature. PMID:25341113

  13. Use-dependent properties of flecainide acetate in accessory atrioventricular pathways.

    Science.gov (United States)

    Goldberger, J; Helmy, I; Katzung, B; Scheinman, M

    1994-01-01

    Flecainide acetate has been shown to have use-dependent properties. The use-dependent properties of flecainide were evaluated in 20 patients (13 men and 7 women, mean age 32 +/- 11 years) with accessory atrioventricular connections. Twenty to 30 stimulus drive trains were introduced in either the atrium or ventricle at progressively faster rates. The range of cycle lengths over which anterograde and retrograde conduction block occurred in the accessory pathway was assessed in the drug-free state and after oral loading with flecainide acetate. The block cycle length index was defined as the shortest cycle length during which 1:1 conduction was maintained in the accessory pathway minus the longest cycle length during which block in the accessory pathway occurred on the second paced beat. In the drug-free state, the (mean +/- SD) anterograde and retrograde block cycle length indexes were 20 +/- 12 and 20 +/- 9 ms, respectively. After flecainide therapy, the anterograde and retrograde block cycle length indexes increased to 80 +/- 33 and 65 +/- 29 ms, respectively (p = 0.002 compared with the drug-free state). The block cycle length index did not correlate with serum flecainide levels, but did correlate with other electrophysiologic markers of drug effect on accessory pathway conduction. The change in the block cycle length index demonstrates that flecainide has a progressive effect on accessory pathway conduction at more rapid rates, consistent with its in vitro use-dependent properties. This index is an excellent marker of drug efficacy.

  14. InterProScan Result: AV404435 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404435 AV404435_2_ORF1 15076070D471749D PROFILE PS50110 RESPONSE_REGULATORY 17.91...4 T IPR001789 Signal transduction response regulator, receiver domain Molecular Function: two-component resp

  15. Analys av Arbetsmiljöverkets tillämpning av enkätverktyget NOSACQ-50

    OpenAIRE

    Andersson, Robin

    2013-01-01

    År 2013 införde Arbetsmiljöverket ett nytt webbaserat enkätverktyg som skall kunna ge ett mått av säkerhetskulturen hos företag och organisationer. Denna enkät baserades på tidigare forskning som tog fram en enkät, NOSACQ-50, för just detta ändamål. Värt att notera är att Arbetsmiljöverkets version är förkortad där vissa påståenden togs bort och vissa skrevs om. Det är detta som analysen behandlar. Hur påverkas resultaten av dessa förändringar som genomfördes av Arbetsmiljöverket? Analysen un...

  16. Visualisering av farmakologiska substanser i levervävnad med hjälp av masspketrometrisk bildtagning

    OpenAIRE

    Mäkinen, Matias

    2017-01-01

    Målet för detta forskningsprojekt var att utveckla en metod med vars hjälp det är möjligt att detektera farmakologiska substanser i levervävnad med hjälp av masspektrometrisk bildtagning, så kallad MALDI-MSI. I litteraturen finns beskrivet tillämpningar av MALDI-MSI med vars hjälp det detekterats till exempel lipider i vävnader eller såsom i denna studie farmkologiska substanser. Arbetet bestod av två delmoment. I den första delen isolerades hepatocyter ur råttlever genom att perfusera k...

  17. Sentinel European Node Trial (SENT)

    DEFF Research Database (Denmark)

    Schilling, C.; Stoeckli, S. J.; Haerle, S. K.

    2015-01-01

    Purpose: Optimum management of the N0 neck is unresolved in oral cancer. Sentinel node biopsy (SNB) can reliably detect microscopic lymph node metastasis. The object of this study was to establish whether the technique was both reliable in staging the N0 neck and a safe oncological procedure...... in patients with early-stage oral squamous cell carcinoma. Methods: An European Organisation for Research and Treatment of Cancer-approved prospective, observational study commenced in 2005. Fourteen European centres recruited 415 patients with radiologically staged T1-T2N0 squamous cell carcinoma. SNB...... was undertaken with an average of 3.2 nodes removed per patient. Patients were excluded if the sentinel node (SN) could not be identified. A positive SN led to a neck dissection within 3 weeks. Analysis was performed at 3-year follow-up. Results: An SN was found in 99.5% of cases. Positive SNs were found in 23...

  18. Immunolymphoscintigraphy for Metastatic Sentinel Nodes

    DEFF Research Database (Denmark)

    Chakera, A.H.; Nielsen, B.S.; Madsen, J.

    2011-01-01

    Aim. To develop a method and obtain proof-of-principle for immunolymphoscintigraphy for identification of metastatic sentinel nodes. Methods. We selected one of four tumour-specific antibodies against human breast cancer and investigated (1), in immune- deficient (nude) mice with xenograft human...... in healthy rabbits. Results and Conclusion. Our paper suggests the theoretical possibility of a model of dual isotope immuno-lymphoscintigraphy for noninvasive, preoperative, malignant sentinel node imaging....

  19. Ungdommers opplevelser med overdreven bruk av online-rollespillet World of Warcraft

    DEFF Research Database (Denmark)

    Flaaten, Øivind; Torp, Steffen; Aarseth, Espen

    2010-01-01

    Ungdommers bruk av online-rollespill blir ofte problematisert (Falkner 2007). På bakgrunn av kvalitative intervjuer med ti ungdommer og fem pårørendekontakter beskrives i denne artikkelen ungdommenes opplevelser av online-spillet World of Warcraft (WoW). Denne pilotstudien gir en nyansert...... for konflikt og hjelpeløshet. Helsefremmende arbeid basert på dialog og tidlig intervensjon kan forhindre at online-spilladferd kommer ut av kontroll....

  20. Open Source AV solution supporting In Situ Simulation and Clinical education

    DEFF Research Database (Denmark)

    Simonsen, Eivind Ortind; Pociunas, Gintas; Dahl, Mads Ronald

    2015-01-01

    for a portable AV system for VAD. The system would make use of components widely available and easily replaceable. The developed AV software and coding is contracted to be available as Copyleft Open Source to ensure low cost and a potential continues improvement and expansion of the AV system. Summary of results...... debriefing in a mobile, in situ simulation environment using an AV system constructed from “off the shelf” components and Open Source software....

  1. Rensing av avløpsvann fra settefiskanlegg med Algas Microfilter

    OpenAIRE

    Ohren, J.A.

    1987-01-01

    Rensing av avløpsvann fra settefiskanlegg er foretatt med Algas Microfilter: Under vanlig drift var avløpsvannets innhold av suspendert stoff, TOC, total nitrogen og total fosfor lavt. Renseeffektene var følgelig også lave. Ved vask av fiskekarene i settefiskanlegget økte ovennevnte innhold av forurensninger i avløpsvannet betydelig. Renseeffektene gjennom silen økte også betydelig. Algas

  2. Undersøkelser av utfordringer og vurdering av tiltak for renseanlegg tilknyttet Orklas produksjonslokaler på Rygge

    OpenAIRE

    Langfeldt, Samson

    2017-01-01

    Bakgrunnen for oppgaven ligger i at avløpsvannet fra produksjon av syltete rødbeter, sylteagurker, surkål m.m. ikke overholder kravene som er gitt i påslippsavtalen med kommunen. Dette kan føre til konsekvenser for fabrikkeierne, og ha negative konsekvenser på avløpsnettet. Denne oppgaven har fokusert på å finne årsaken til disse problemene samtidig som den gjør en teknisk analyse av mulige løsninger som kan fungere for anlegget. På anlegget er det blitt gjort undersøkelser avløpsvannets alka...

  3. Etableringen av Tesla Motors på det norske bilmarkedet : en empirisk studie av salgsdrivere og konkurranseeffekter

    OpenAIRE

    Asperheim, Hanne Henjum; Vedum, Anders

    2015-01-01

    Denne masterutredningen er en empirisk studie av Tesla Motors’ etablering på det norske bilmarkedet. Vi gjennomfører to separate analyser: Først fokuseres det på geografiske salgsforskjeller, deretter på effekten Tesla Motors har hatt på det norske nybilmarkedet. I vår første analyse utvikler vi en modell for å identifisere Teslas salgsdrivere, i form av geografiske og sosioøkonomiske variabler. Resultatene viser at et fylkes inntektsnivå, utdanningsnivå og miljøbevissthet har en positiv s...

  4. EST Table: AV401231 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV401231 e96h0406 10/09/28 100 %/169 aa ref|NP_001040343.1| peripheral-type benzodiazepine... receptor [Bombyx mori] gb|ABF51223.1| peripheral-type benzodiazepine receptor [Bombyx mori] 10/08/28

  5. EST Table: AV401520 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV401520 e96h0828 10/09/28 100 %/169 aa ref|NP_001040343.1| peripheral-type benzodiazepine... receptor [Bombyx mori] gb|ABF51223.1| peripheral-type benzodiazepine receptor [Bombyx mori] 10/08/28

  6. EST Table: AV398543 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398543 NV021933 10/09/28 92 %/127 aa ref|XP_001870751.1| transparent testa glabra...1 [Culex quinquefasciatus] gb|EDS34120.1| transparent testa glabra1 [Culex quinquefasciatus] 10/08/28 93 %/1

  7. EST Table: AV400552 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400552 br--1440 10/09/28 93 %/127 aa ref|XP_001870751.1| transparent testa glabra...1 [Culex quinquefasciatus] gb|EDS34120.1| transparent testa glabra1 [Culex quinquefasciatus] 10/08/28 94 %/1

  8. EST Table: AV404246 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404246 pg--0747 10/09/28 91 %/130 aa ref|ZP_06118881.2| DNA packaging protein FI ...[Clostridium hathewayi DSM 13479] gb|EFC94454.1| DNA packaging protein FI [Clostridium hathewayi DSM 13479

  9. EST Table: AV404642 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404642 prgv0279 10/09/28 81 %/116 aa ref|NP_001091796.1| programmed cell death pr...otein 5-like protein [Bombyx mori] gb|ABJ97180.1| programmed cell death protein 5-like protein [Bombyx mori

  10. EST Table: AV401011 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV401011 e96h0108 10/09/28 100 %/105 aa gb|ACZ13341.1| actin-4 [Bursaphelenchus xyl...ophilus] dbj|BAI52957.1| actin [Bursaphelenchus xylophilus] 10/08/28 100 %/105 aa FBpp0278212|DpseGA24908-PA

  11. EST Table: AV400057 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400057 br--0482 10/09/28 100 %/104 aa gb|ACZ13341.1| actin-4 [Bursaphelenchus xyl...ophilus] dbj|BAI52957.1| actin [Bursaphelenchus xylophilus] 10/08/28 100 %/104 aa FBpp0278212|DpseGA24908-PA

  12. EST Table: AV398858 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398858 NV060362 10/09/28 100 %/102 aa gb|ACZ13341.1| actin-4 [Bursaphelenchus xyl...ophilus] dbj|BAI52957.1| actin [Bursaphelenchus xylophilus] 10/08/28 100 %/102 aa FBpp0278212|DpseGA24908-PA

  13. EST Table: AV398786 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398786 NV060281 10/09/28 96 %/126 aa gb|ACZ13341.1| actin-4 [Bursaphelenchus xylo...philus] dbj|BAI52957.1| actin [Bursaphelenchus xylophilus] 10/08/28 96 %/126 aa FBpp0278212|DpseGA24908-PA 1

  14. EST Table: AV398357 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398357 NV021720 10/09/28 44 %/103 aa ref|XP_002435218.1| charged multivesicular b...ody protein, putative [Ixodes scapularis] gb|EEC08042.1| charged multivesicular body protein, putative [Ixod

  15. EST Table: AV404301 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404301 pg--0808 10/09/28 81 %/199 aa ref|ZP_05092873.1| phage tail tape measure p...rotein, lambda family [Carboxydibrachium pacificum DSM 12653] gb|EEB75267.1| phage tail tape measure protein

  16. EST Table: AV404116 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404116 pg--0495X 10/09/28 87 %/148 aa ref|YP_311293.1| putative tail length tape measure... protein [Shigella sonnei Ss046] gb|AAZ89058.1| putative tail length tape measure protein [Shigella s

  17. EST Table: AV404171 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404171 pg--0555 10/09/28 85 %/178 aa ref|ZP_05092873.1| phage tail tape measure p...rotein, lambda family [Carboxydibrachium pacificum DSM 12653] gb|EEB75267.1| phage tail tape measure protein

  18. Rektorers forståelse av mobbing i skolen

    DEFF Research Database (Denmark)

    Hansen, Helle Rabøl

    2008-01-01

    PÅ opfordring fra redaktionen gives en kommentar med dansk vinkel til den norske artikel 'Rektorers forståelse av mobbning i skolen'.Den omtalte artikel er at betragte som første trin i indførelse af en nordisk mobbeforståelse med undgangspunkt i Dan Olweus begrebsafgrænsning.Der savnes også en i...

  19. EST Table: AV399390 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399390 NV120162 11/12/09 n.h 10/09/28 100 %/181 aa ref|YP_002884244.1| Ac13-like protein [Bombyx mandarin...a nucleopolyhedrovirus] gb|ACQ57195.1| Ac13-like protein [Bombyx mandarina nucleopol

  20. EST Table: AV399744 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399744 NV120680 10/09/28 98 %/185 aa ref|YP_002884244.1| Ac13-like protein [Bombyx mandarin...a nucleopolyhedrovirus] gb|ACQ57195.1| Ac13-like protein [Bombyx mandarina nucleopolyhedrovirus] 1

  1. EST Table: AV399272 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399272 NV120003 10/09/28 100 %/126 aa ref|YP_002884257.1| Ac26-like protein [Bombyx mandarin...a nucleopolyhedrovirus] gb|ACQ57208.1| Ac26-like protein [Bombyx mandarina nucleopolyhedrovirus

  2. EST Table: AV399898 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399898 NV120920 10/09/28 86 %/105 aa ref|YP_002884244.1| Ac13-like protein [Bombyx mandarin...a nucleopolyhedrovirus] gb|ACQ57195.1| Ac13-like protein [Bombyx mandarina nucleopolyhedrovirus] 1

  3. EST Table: AV399551 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399551 NV120385 10/09/28 99 %/123 aa ref|YP_002884257.1| Ac26-like protein [Bombyx mandarin...a nucleopolyhedrovirus] gb|ACQ57208.1| Ac26-like protein [Bombyx mandarina nucleopolyhedrovirus] 1

  4. EST Table: AV400925 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400925 br--1989 10/09/28 35 %/122 aa ref|XP_967620.1| PREDICTED: similar to anopheles stephen...nl|Amel|GB19565-PA 10/09/10 35 %/122 aa gi|91093471|ref|XP_967620.1| PREDICTED: similar to anopheles stephensi ubiquitin, putative [Tribolium castaneum] FS914988 br-- ...

  5. EST Table: AV400204 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400204 br--0896 10/09/28 36 %/111 aa ref|XP_967620.1| PREDICTED: similar to anopheles stephen...093471|ref|XP_967620.1| PREDICTED: similar to anopheles stephensi ubiquitin, putative [Tribolium castaneum] FS914988 br-- ...

  6. EST Table: AV400917 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400917 br--1979 10/09/28 46 %/148 aa ref|XP_975194.1| PREDICTED: similar to something...|Amel|GB19080-PA 10/09/10 46 %/148 aa gi|91081571|ref|XP_975194.1| PREDICTED: similar to something about silencing protein 10 [Tribolium castaneum] FS937283 br-- ...

  7. EST Table: AV401629 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV401629 e96h0968 10/09/28 70 %/161 aa ref|XP_002431431.1| Karyogamy protein KAR4, ...putative [Pediculus humanus corporis] gb|EEB18693.1| Karyogamy protein KAR4, putative [Pediculus humanus cor

  8. EST Table: AV402944 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV402944 heS30768 10/09/28 76 %/117 aa gb|ACO12033.1| 40S ribosomal protein S8 [Lepeo...phtheirus salmonis] gb|ACO12251.1| 40S ribosomal protein S8 [Lepeophtheirus salmonis] 10/08/28 67 %/122 aa

  9. EST Table: AV404025 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404025 pg--0351 11/12/09 n.h 10/09/28 84 %/167 aa ref|ZP_05092873.1| phage tail tape measure... protein, lambda family [Carboxydibrachium pacificum DSM 12653] gb|EEB75267.1| phage tail tape measure

  10. EST Table: AV400897 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400897 br--1948 10/09/28 47 %/180 aa ref|XP_967144.2| PREDICTED: similar to corneal wound healing...TED: similar to corneal wound healing-related protein [Tribolium castaneum] CK493011 br-- ...

  11. EST Table: AV403922 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV403922 pg--0214 10/09/28 91 %/142 aa ref|ZP_06118881.2| DNA packaging protein FI ...[Clostridium hathewayi DSM 13479] gb|EFC94454.1| DNA packaging protein FI [Clostridium hathewayi DSM 13479

  12. EST Table: AV402755 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV402755 heS30447 10/09/28 32 %/161 aa ref|XP_001988342.1| GH10620 [Drosophila grims...hawi] gb|EDW03209.1| GH10620 [Drosophila grimshawi] 10/08/28 32 %/161 aa FBpp0144526|DgriGH10620-PA 10/08/2

  13. EST Table: AV404071 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404071 pg--0407 11/12/09 n.h 10/09/28 100 %/244 aa ref|YP_002928933.1| Host speci...ficity protein J [Escherichia coli BW2952] gb|ACR63430.1| Host specificity protein J [Escherichia coli BW295

  14. EST Table: AV404427 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404427 pg--0966 11/12/09 n.h 10/09/28 91 %/168 aa ref|YP_002928933.1| Host specif...icity protein J [Escherichia coli BW2952] gb|ACR63430.1| Host specificity protein J [Escherichia coli BW2952

  15. EST Table: AV404050 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404050 pg--0381 11/12/09 n.h 10/09/28 99 %/161 aa ref|YP_002928933.1| Host specif...icity protein J [Escherichia coli BW2952] gb|ACR63430.1| Host specificity protein J [Escherichia coli BW2952

  16. EST Table: AV400190 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400190 br--0867 10/09/28 67 %/134 aa ref|XP_974541.1| PREDICTED: similar to Media...%/108 aa gnl|Amel|GB13317-PA 10/09/10 67 %/134 aa gi|91083293|ref|XP_974541.1| PREDICTED: similar to Media

  17. EST Table: AV398908 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398908 NV060415 10/09/28 95 %/160 aa ref|XP_002004473.1| GI19595 [Drosophila mojav...ensis] ref|XP_002059335.1| GJ18395 [Drosophila virilis] gb|EDW08408.1| GI19595 [Drosophila mojavensis] gb|E

  18. EST Table: AV398210 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398210 NV021247 10/09/28 77 %/206 aa ref|XP_001998997.1| GI23318 [Drosophila mojav...ensis] gb|EDW14458.1| GI23318 [Drosophila mojavensis] 10/08/28 77 %/206 aa FBpp0172535|DmojGI23318-PA 10/08

  19. EST Table: AV404329 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404329 pg--0843 10/09/28 100 %/173 aa ref|NP_001136443.1| clathrin heavy chain [B...61 %/169 aa T20G5.1#CE00480#WBGene00011867#locus:chc-1#Clathrin heavy chain#status:Partially_confirmed#UniPr

  20. EST Table: AV400979 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400979 e96h0061 10/09/28 57 %/143 aa ref|XP_002004493.1| GI19964 [Drosophila mojav...ensis] gb|EDW08428.1| GI19964 [Drosophila mojavensis] 10/08/28 57 %/143 aa FBpp0169181|DmojGI19964-PA 10/08

  1. EST Table: AV401286 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV401286 e96h0482 10/09/28 55 %/188 aa ref|XP_002004616.1| GI19509 [Drosophila mojav...ensis] gb|EDW08551.1| GI19509 [Drosophila mojavensis] 10/08/28 55 %/188 aa FBpp0168726|DmojGI19509-PA 10/08

  2. EST Table: AV402088 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV402088 heS00552 10/09/28 57 %/120 aa ref|XP_002003339.1| GI17860 [Drosophila mojav...ensis] gb|EDW12781.1| GI17860 [Drosophila mojavensis] 10/08/28 57 %/120 aa FBpp0167077|DmojGI17860-PA 10/08

  3. EST Table: AV402568 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV402568 heS30139 10/09/28 48 %/151 aa ref|XP_002006691.1| GI18446 [Drosophila mojav...ensis] gb|EDW10626.1| GI18446 [Drosophila mojavensis] 10/08/28 48 %/151 aa FBpp0167663|DmojGI18446-PA 10/08

  4. EST Table: AV400537 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400537 br--1414 10/09/28 41 %/216 aa ref|XP_002000083.1| GI10045 [Drosophila mojav...ensis] gb|EDW15544.1| GI10045 [Drosophila mojavensis] 10/08/28 41 %/216 aa FBpp0159262|DmojGI10045-PA 10/08

  5. EST Table: AV400944 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400944 e96h0016 10/09/28 73 %/153 aa ref|XP_002005200.1| GI20361 [Drosophila mojav...ensis] gb|EDW09135.1| GI20361 [Drosophila mojavensis] 10/08/28 73 %/153 aa FBpp0169578|DmojGI20361-PA 10/08

  6. EST Table: AV405991 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV405991 wdV30476 10/09/28 81 %/103 aa ref|XP_002007281.1| GI12464 [Drosophila mojav...ensis] gb|EDW17757.1| GI12464 [Drosophila mojavensis] 10/08/28 81 %/103 aa FBpp0161681|DmojGI12464-PA 10/08

  7. EST Table: AV401018 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV401018 e96h0121 10/09/28 81 %/103 aa ref|XP_002007281.1| GI12464 [Drosophila mojav...ensis] gb|EDW17757.1| GI12464 [Drosophila mojavensis] 10/08/28 81 %/103 aa FBpp0161681|DmojGI12464-PA 10/08

  8. EST Table: AV399925 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399925 br--0031 10/09/28 87 %/140 aa ref|XP_002008796.1| GI13691 [Drosophila mojav...ensis] gb|EDW19272.1| GI13691 [Drosophila mojavensis] 10/08/28 87 %/140 aa FBpp0162908|DmojGI13691-PA 10/08

  9. EST Table: AV404790 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404790 prgv0452 10/09/28 65 %/113 aa ref|XP_001979237.1| GG24851 [Drosophila erec...10/09/10 59 %/106 aa gi|91086741|ref|XP_971589.1| PREDICTED: similar to riboflavin kinase [Tribolium castaneum] FS912700 prgv ...

  10. EST Table: AV400707 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400707 br--1674X 10/09/28 54 %/135 aa ref|XP_002008152.1| GI11978 [Drosophila mojav...ensis] gb|EDW18628.1| GI11978 [Drosophila mojavensis] 10/08/28 54 %/135 aa FBpp0161195|DmojGI11978-PA 10/0

  11. EST Table: AV406029 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV406029 wdV30520 10/09/28 70 %/125 aa ref|XP_002007572.1| GI12310 [Drosophila mojav...ensis] gb|EDW18048.1| GI12310 [Drosophila mojavensis] 10/08/28 71 %/125 aa FBpp0127559|DanaGF24367-PA 10/08

  12. EST Table: AV406016 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV406016 wdV30506 10/09/28 81 %/103 aa ref|XP_002007281.1| GI12464 [Drosophila mojav...ensis] gb|EDW17757.1| GI12464 [Drosophila mojavensis] 10/08/28 81 %/103 aa FBpp0161681|DmojGI12464-PA 10/08

  13. EST Table: AV404032 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404032 pg--0359 10/09/28 39 %/179 aa ref|XP_002008018.1| GI12064 [Drosophila mojav...ensis] gb|EDW18494.1| GI12064 [Drosophila mojavensis] 10/08/28 39 %/179 aa FBpp0161281|DmojGI12064-PA 10/08

  14. EST Table: AV403131 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV403131 msgV0077 10/09/28 92 %/200 aa ref|XP_002004473.1| GI19595 [Drosophila mojav...ensis] ref|XP_002059335.1| GJ18395 [Drosophila virilis] gb|EDW08408.1| GI19595 [Drosophila mojavensis] gb|E

  15. EST Table: AV405194 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV405194 prgv0919 10/09/28 65 %/160 aa ref|XP_002000766.1| GI22341 [Drosophila mojav...ensis] gb|EDW16227.1| GI22341 [Drosophila mojavensis] 10/08/28 65 %/160 aa FBpp0171558|DmojGI22341-PA 10/08

  16. EST Table: AV401292 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV401292 e96h0497 10/09/28 99 %/102 aa ref|XP_002004473.1| GI19595 [Drosophila mojav...ensis] ref|XP_002059335.1| GJ18395 [Drosophila virilis] gb|EDW08408.1| GI19595 [Drosophila mojavensis] gb|E

  17. EST Table: AV404233 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404233 pg--0732 10/09/28 70 %/129 aa ref|XP_002003556.1| GI21941 [Drosophila mojav...ensis] gb|EDW12998.1| GI21941 [Drosophila mojavensis] 10/08/28 70 %/129 aa FBpp0171158|DmojGI21941-PA 10/08

  18. EST Table: AV401287 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV401287 e96h0483 10/09/28 93 %/160 aa ref|XP_002004473.1| GI19595 [Drosophila mojav...ensis] ref|XP_002059335.1| GJ18395 [Drosophila virilis] gb|EDW08408.1| GI19595 [Drosophila mojavensis] gb|E

  19. EST Table: AV399270 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399270 NV060991 10/09/28 41 %/162 aa ref|XP_002007640.1| GI13052 [Drosophila mojav...ensis] gb|EDW18116.1| GI13052 [Drosophila mojavensis] 10/08/28 41 %/162 aa FBpp0162269|DmojGI13052-PA 10/08

  20. EST Table: AV405172 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV405172 prgv0893 10/09/28 85 %/198 aa gb|ABF55966.2| cleavage stimulation factor 6...ref|XP_970762.1| PREDICTED: similar to cleavage stimulation factor 64-kDa subunit [Tribolium castaneum] FS920483 prgv ...

  1. EST Table: AV400760 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400760 br--1758 10/09/28 64 %/214 aa ref|XP_307835.4| AGAP009424-PA [Anopheles ga...9241497|ref|XP_967205.2| PREDICTED: similar to neuron navigator 2 [Tribolium castaneum] BY916808 br-- ...

  2. EST Table: AV404441 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404441 pg--0982 10/09/28 79 %/229 aa ref|XP_001998398.1| GI23651 [Drosophila mojav...ensis] gb|EDW13859.1| GI23651 [Drosophila mojavensis] 10/08/28 79 %/229 aa FBpp0172868|DmojGI23651-PA 10/08

  3. EST Table: AV398368 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398368 NV021731 10/09/28 95 %/237 aa ref|NP_001136443.1| clathrin heavy chain [Bo...2 %/237 aa T20G5.1#CE00480#WBGene00011867#locus:chc-1#Clathrin heavy chain#status:Partially_confirmed#UniPro

  4. EST Table: AV398578 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398578 NV021976 10/09/28 61 %/149 aa ref|XP_968620.1| PREDICTED: similar to AGAP0.../08/28 55 %/161 aa FBpp0085738|SdhA-PC 10/08/27 60 %/131 aa C03G5.1#CE03917#WBGene00015391#locus:sdha-1#succinate dehydrogenase flav

  5. EST Table: AV399704 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399704 NV120582 10/09/28 80 %/230 aa ref|XP_001998398.1| GI23651 [Drosophila mojav...ensis] gb|EDW13859.1| GI23651 [Drosophila mojavensis] 10/08/28 80 %/230 aa FBpp0172868|DmojGI23651-PA 10/08

  6. EST Table: AV398478 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398478 NV021855 10/09/28 99 %/204 aa ref|NP_001136443.1| clathrin heavy chain [Bo...6 %/204 aa T20G5.1#CE00480#WBGene00011867#locus:chc-1#Clathrin heavy chain#status:Partially_confirmed#UniPro

  7. EST Table: AV398468 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398468 NV021845 10/09/28 40 %/208 aa ref|XP_001998750.1| GI23457 [Drosophila mojav...ensis] gb|EDW14211.1| GI23457 [Drosophila mojavensis] 10/08/28 40 %/208 aa FBpp0172674|DmojGI23457-PA 10/08

  8. EST Table: AV398644 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398644 NV060124 10/09/28 96 %/174 aa ref|XP_002004473.1| GI19595 [Drosophila mojav...ensis] ref|XP_002059335.1| GJ18395 [Drosophila virilis] gb|EDW08408.1| GI19595 [Drosophila mojavensis] gb|E

  9. Anisotropic conduction in the triangle of Koch of mammalian hearts: electrophysiologic and anatomic correlations

    NARCIS (Netherlands)

    Hocini, M.; Loh, P.; Ho, S. Y.; Sanchez-Quintana, D.; Thibault, B.; de Bakker, J. M.; Janse, M. J.

    1998-01-01

    The purpose of this study was to characterize anisotropy in the triangle of Koch by relating electrophysiology with anatomy. Atrioventricular (AV) node fast and slow pathway characteristics have been suggested to be due to nonuniform anisotropy in the triangle of Koch. During atrial pacing, we

  10. Nodoventricular accessory pathways in PRKAG2-dependent familial preexcitation syndrome reveal a disorder in cardiac development

    NARCIS (Netherlands)

    Tan, Hanno L.; van der Wal, Allard C.; Campian, Maria E.; Kruyswijk, Hittjo H.; ten Hove Jansen, Bram; van Doorn, Dirk-Jan; Oskam, Henk J.; Becker, Anton E.; Wilde, Arthur A. M.

    2008-01-01

    BACKGROUND: Familial preexcitation syndrome is linked to mutations in PRKAG2. Previous studies on the R302Q mutation have provided evidence for a remarkably high proportion of otherwise rare accessory pathways with atrioventricular (AV) node-like conduction properties (Mahaim fibers). Yet,

  11. Symposium: Paediatrics electrocardiography | Afolabi | Nigerian ...

    African Journals Online (AJOL)

    Therefore the electrical activity generated here spreads through the conduction tissue pathways, (i.e. atria, then to atrioventricular (AV) node, bundle of His and its branches, the purkinje system and ultimately to the ventricles resulting in an electrocardiographic complex consisting of PQRS-T during a cardiac cycle.

  12. Analysis of AVS-penogram in 3000 impotent patients

    Energy Technology Data Exchange (ETDEWEB)

    Minn, Young Guy; Choi, Hyung Ki [Yonsei University College of Medicine, Seoul (Korea, Republic of)

    1994-09-01

    Audio visual simulation penogram(AVS-penogram) is used as a screening method for evaluation of erectile dysfunction. In this study, 3000 patients were evaluated from Dec. 1986 to Dec. 1992 and finally diagnosed by comprehensive diagnostic methods. The patients were classified according to AVS-penogram curves into 4 types and correlated with the patient`s final diagnosis. For 800 patients who were evaluated with combined AVS-penogram and NPT monitoring, compatibility ratios between psychogenic and organic group were compared. After correlating each of the curve type with the patients and comparing erotic and nocturnal erection, following results were obtained. 1. The mean age of the patients was 41.25 years. 2. The overall rate of final diagnosis were 57.5%, 14.3%, 8.9% in psychogenic, arteriogenic and veogenic impotence. 3. Type I group was proved as psychogenic impotence in 87% of the patients. 4. Type IIA group was proved as organic impotence in 79% of the patients and most of them had neurogenic and arteriogenic impotence. 5. Type IIB group was proved as psychogenic impotence in 51%, organic impotence in 49% of the patients. Among the organic impotence group, most of them had arteriogenic, venogenic and neurogenic impotence. The difference of both group was statically insignificant. 6. Type IIC group was proved as psychogenic impotence in 39%, organic impotence in 61% of the patients. Further studies are needed for sub-classification of both groups. 7. The compatibility ratio of the AVS-penogram and NPTM was 85.9% in psychogenic group with normal finding in both tests and 44.7% in organic group with abnormal finding in both tests. In conclusion, AVS-penogram is a primary diagnostic method in screening impotent patients and type I is regarded as psychogenic impotence. In Type IIB and IIC, sub-classification of curve type is needed for differential diagnosis between psychogenic and organic impotence. (Abstract Truncated)

  13. En obekväm sanning eller en stor bluff? : En analys av den visuella gestaltningen av fenomenet "global uppvärmning" i filmmediet

    OpenAIRE

    Eriksson, Anton; Oretoft, Mikael

    2010-01-01

    En uppsats som kritiskt granskar och analyserar den visuella gestaltningen i två dokumentärfilmer. Huvudtemat i filmerna är global uppvärmning och konsekvenserna av detta. Uppsatsens syfte är att undersöka den visuella gestaltningen av den miljödebatt som filmerna är en del i och genom detta belysa frågor som berör visuell kultur och popularisering av vetenskap.

  14. Rekonstruering av cyanobakterien Planktothrix sine forekomster i Hålandsvatnet fra 1980 fram til 2014 under påvirkning av den vertsspesifikke parasitten Chytridiomycota

    OpenAIRE

    Westerås, Anne Charlotte

    2016-01-01

    Cyanobakterier har eksistert i ~ 3,5 milliarder år, noe som gir dem en historisk evolusjonær fordel ved tilpasning til enten menneskeskapte eller naturlige endringer. Algene kan danne oppblomstringer som ofte er giftige, hvorpå toksiske forekomster er et resultat av oligopeptid-produksjon. Slike peptider kodes av en meget gammel del av cyanobakterienes genom, og individer innenfor samme algepopulasjon kan ha ulik oligopeptid sammensetning eller profiler. Derfor antas horisontal ge...

  15. Functional Capacity of Patients with Pacemaker Due to Isolated Congenital Atrioventricular Block

    Directory of Open Access Journals (Sweden)

    Roberto Márcio de Oliveira Júnior

    2015-01-01

    Full Text Available Background: Isolated congenital atrioventricular block (CAVB is a rare condition with multiple clinical outcomes. Ventricular remodeling can occur in approximately 10% of the patients after pacemaker (PM implantation. Objectives: To assess the functional capacity of children and young adults with isolated CAVB and chronic pacing of the right ventricle (RV and evaluate its correlation with predictors of ventricular remodeling. Methods: This cross-sectional study used a cohort of patients with isolated CAVB and RV pacing for over a year. The subjects underwent clinical and echocardiographic evaluation. Functional capacity was assessed using the six-minute walk test. Chi-square test, Fisher's exact test, and Pearson correlation coefficient were used, considering a significance level of 5%. Results: A total of 61 individuals were evaluated between March 2010 and December 2013, of which 67.2% were women, aged between 7 and 41 years, who were using PMs for 13.5 ± 6.3 years. The percentage of ventricular pacing was 97.9 ± 4.1%, and the duration of the paced QRS complex was 153.7 ± 19.1 ms. Majority of the subjects (95.1% were asymptomatic and did not use any medication. The mean distance walked was 546.9 ± 76.2 meters and was strongly correlated with the predicted distance (r = 0.907, p = 0.001 but not with risk factors for ventricular remodeling. (Arq Bras Cardiol. 2014; [online].ahead print, PP.0-0 Conclusions: The functional capacity of isolated CAVB patients with chronic RV pacing was satisfactory but did not correlate with risk factors for ventricular remodeling.

  16. Tachycardia induction with ventricular extrastimuli differentiates atypical atrioventricular nodal reentrant tachycardia from orthodromic reciprocating tachycardia.

    Science.gov (United States)

    Obeyesekere, Manoj; Gula, Lorne J; Modi, Simon; Leong-Sit, Peter; Angaran, Paul; Mechulan, Alexis; Skanes, Allan C; Krahn, Andrew D; Yee, Raymond; Klein, George J

    2012-03-01

    Differentiating atypical atrioventricular nodal reentrant tachycardia (AVNRT) from septal orthodromic reentrant tachycardia (ORT(Septal)) is challenging in nonsustained tachycardia. When sustained, the postpacing interval minus tachycardia cycle length following entrainment (PPI(Entrainment) - TCL) and stimulation to atrial interval minus ventriculoatrial interval (Stim-A(Entrainment) - VA) are utilized. We hypothesized that the first tachycardia cycle after tachycardia induction with right ventricular apical extrastimulation would yield comparable information to entrainment, precluding the need for sustained tachycardia. Twenty-four patients with AVNRT (age 47 ± 18 years), 19 with ORT(Septal) (age 42 ± 17 years), and 15 with ORT over a left lateral accessory pathway (ORT(Left)) (age 41 ± 16 years) were included. The ventricular extrastimulus to atrial depolarization at tachycardia initiation (Stim-A(Initiation)) and tachycardia VA interval were measured to establish the Stim-A(Initiation) minus VA interval (Stim-A(Initiation) - VA). The ventricular extrastimulus to the subsequent right ventricular apical depolarization (postpacing interval at initiation, PPI(Initiation)) was utilized to obtain the PPI(Initiation) minus TCL (PPI(Initiation) - TCL). The AH interval associated with the PPI(Initiation) minus the AH in tachycardia was utilized to establish a corrected PPI(Initiation) minus TCL (cPPI(Initiation) - TCL). The intervals after tachycardia initiation were longer for AVNRT than for ORT: mean PPI(Initiation) - TCL (193 ± 44 vs 91 ± 73; P cPPI(Initiation) - TCL (174 ± 44 ms vs 88 ± 50 ms; P cPPI(Initiation) minus TCL against PPI(Entrainment) minus TCL was 0.71. cPPI(Initiation) minus TCL cPPI(Initiation) - TCL < 115 ms excludes AVNRT. Copyright © 2012 Heart Rhythm Society. Published by Elsevier Inc. All rights reserved.

  17. Exercise capacity in children with isolated congenital complete atrioventricular block: does pacing make a difference?

    Science.gov (United States)

    Blank, A Christian; Hakim, Sara; Strengers, Jan L; Tanke, Ronald B; van Veen, Toon A; Vos, Marc A; Takken, Tim

    2012-04-01

    The management of patients with isolated congenital complete atrioventricular block (CCAVB) has changed during the last decades. The current policy is to pace the majority of patients based on a variety of criteria, among which is limited exercise capacity. Data regarding exercise capacity in this population stems from previous publications reporting small case series of unpaced patients. Therefore, we have investigated the exercise capacity of a group of contemporary children with CCAVB. Sixteen children (mean age 11.5 ± 4; seven boys, nine girls) with CCAVB were tested. In 13 patients, a median number of three pacemakers were implanted, whereas in three patients no pacemaker was given. All patients had an echocardiogram and completed a cardiopulmonary cycle exercise test. Exercise parameters were determined and compared with reference values obtained from healthy Dutch peers. The peak oxygen uptake/body mass was reduced to 34.4 ± 9.5 ml kg(-1) min(-1) (79 ± 24% of predicted) and the ventilatory threshold was reduced to 52 ± 17% of peak oxygen uptake (78 ± 21% of predicted), whereas the peak work load/body mass was 2.8 ± 0.6 W/kg (91 ± 24% of predicted), which was similar to controls. Importantly, 25% of the paced patients showed upper rate restriction by the pacemaker. In conclusion, children with CCAVB show a reduced peak oxygen uptake and ventilatory threshold, whereas they show normal peak work rates. This indicates that they generate more energy during exercise from anaerobic energy sources. Paced children with CCAVB do not perform better than unpaced children.

  18. Atrioventricular canal defect and associated genetic disorders: new insights into polydactyly syndromes

    Directory of Open Access Journals (Sweden)

    M. Cristina Digilio

    2011-07-01

    Full Text Available Atrioventricular canal defect (AVCD is a common congenital heart defect (CHD, representing 7.4% of all cardiac malformations, considered secondary to an extracellular matrix anomaly. The AVCD is associated with extracardiac defects in about 75% of the cases. In this review we analyzed different syndromic AVCDs, in particular those associated with polydactyly disorders, which show remarkable genotype-phenotype correlations. Chromo - some imbalances more frequently associated with AVCD include Down syndrome, deletion 8p23 and deletion 3p25, while mendelian disorders include Noonan syndrome and related RASopathies, several polydactyly syndromes, CHARGE and 3C (cranio-cerebello-cardiac syndrome. The complete form of AVCD is prevalent in patients with chromosomal imbalances. Additional cardiac defects are found in patients affected by chromosomal imbalances different from Down syndrome. Left-sided obstructive lesions are prevalently found in patients with RASopathies. Patients with deletion 8p23 often display AVCD with tetralogy of Fallot or with pulmonary valve stenosis. Tetralogy of Fallot is the only additional cardiac defect found in patients with Down syndrome and AVCD. On the other hand, the association of AVCD and tetralogy of Fallot is also quite characteristic of CHARGE and 3C syndromes. Heterotaxia defects, including common atrium and anomalous pulmonary venous return, occur in patients with AVCD associated with polydactyly syndromes (Ellis-van Creveld, short rib polydactyly, oral-facial-digital, Bardet-Biedl, and Smith-Lemli-Opitz syndromes. The initial clinical evidence of anatomic similarities between AVCD and heterotaxia in polydactyly syndromes was corroborated and explained by experimental studies in transgenic mice. These investigations have suggested the involvement of the Sonic Hedgehog pathway in syndromes with postaxial polydactyly and heterotaxia, and ciliary dysfunction was detected as pathomechanism for these disorders

  19. Hormoners betydning for kognitiv utvikling : en studie av jenter med adrenogenitalt syndrom (AGS)

    OpenAIRE

    Schjølberg, Katrine Luisa Fernanda

    2010-01-01

    Bakgrunn: Studier av både mennesker og dyr som har vært utsatt for unormale mengder hormonkonsentrasjoner har vist endringer i utviklingen av kognitive ferdigheter. Andrenogenitalt syndrom(AGS) er en tilstand som fører til økt produksjon av androgener i fosterlivet. Denne tilstanden har vist klar sammenheng mellom dennes atypiske hormonnivå og atferd i form av både lekepreferanse og valg av lekepartner. I motsetning er litteraturen uklar på forholdet mellom deres hormonelle miljø og utvikling...

  20. Fremre korsbåndskade og utvikling av sekundær artrose

    OpenAIRE

    Holm, Stine

    2013-01-01

    Oppgaven er en blanding av et litteraturstudie og en kohortestudie. I litteraturstudien har jeg sett på hva fremre korsbånd og artrose er, og hvilke risikofaktorer som kan bidra/progrediere utvikling av artrose hos korsbåndsopererte. I kohortestudien har jeg og veilederen sett på forekomsten av artrose hos korsbåndsopererte- 10-20 år etter ACL rekonstruksjon. Ved hjelp av røntgen og klinisk undersøkelse vurderte vi tidligere korsbåndsopererte og grad av artroseforandringer. Vi så også på hvor...

  1. Sentinel lymph node biopsy in breast cancer

    African Journals Online (AJOL)

    Enrique

    lymph node metastases.1 Regional nodal status can be accu- rately predicted by identification and examination of the sen- tinel lymph node (SLN). If the SLN shows no evidence of tumour it is over 90% certain that the remaining regional lymph nodes are negative.2. The use of sentinel lymph node direction (SLND) in early.

  2. Sentinel node detection in cervical cancer

    NARCIS (Netherlands)

    Verheijen, R. H.; Pijpers, R.; van Diest, P. J.; Burger, C. W.; Buist, M. R.; Kenemans, P.

    2000-01-01

    For superficial tumors such as melanoma, breast, and vulvar cancer, sentinel node detection prevents unnecessary extensive lymph node dissections. Sentinel node detection has not yet proved feasible in tumors, such as cervical cancer, that drain to deep pelvic lymph nodes. We injected technetium-99m

  3. En påle genom Dracula-filmernas hjärta? : En komparativ analys av adaptationer av Bram Stokers Dracula (1897) från åren 2000-2014

    OpenAIRE

    Bahrman, Alexander

    2016-01-01

    En komparativ analys av adaptationer av Bram Stokers Dracula (1897) från åren 2000-2014 med syfte att undersöka resultatet av nästan 100 år av adaptationer och ett mål för att verkställa om en filmkanon har skapats kring karaktären.

  4. Transient complete atrioventricular block with Morgagni—Adams—Stokes attacks in a child after aortic valve replacement

    Directory of Open Access Journals (Sweden)

    D. R. Sabirova

    2014-01-01

    Full Text Available The diagnosis and treatment of life-threatening arrhythmias after surgical correction of congenital heart diseases is one the urgent problems in pediatrlc cardiology. The paper describes the clinical picture, diagnosis, and therapy in a patent with transient complete atrioventricular block after open heart surgery. A protracted Morgagni—Adams—Stokes attack is one of the causes of sudden cardiac death. The occurrence of even single syncopes in patients after surgery for congenital heart disease requires that the arrhythmogenic nature of the attack should be ruled out for the timely and adequate therapy including the implantation of antiarrhythmic devices.

  5. Intraoperative Sentinel Lymph Node Evaluation

    DEFF Research Database (Denmark)

    Shaw, Richard; Christensen, Anders; Java, Kapil

    2016-01-01

    -ready" intraoperative diagnostic test (one step nucleic acid amplification-OSNA, sysmex). METHODS: Two cohorts were assembled: cohort 1, OSCC with stage and site that closely match cases suitable for sentinel lymph node biopsy (SLNB); cohort 2, HNSCC with sufficient fresh tumour tissue available for the OSNA assay (>50......BACKGROUND: Intraoperative analysis of sentinel lymph nodes would enhance the care of early-stage oral squamous cell carcinoma (OSCC). We determined the frequency and extent of cytokeratin 19 (CK19) expression in OSCC primary tumours and surrounding tissues to explore the feasibility of a "clinic...

  6. Allocating resources between network nodes for providing a network node function

    NARCIS (Netherlands)

    Strijkers, R.J.; Meulenhoff, P.J.

    2014-01-01

    The invention provides a method wherein a first network node advertises available resources that a second network node may use to offload network node functions transparently to the first network node. Examples of the first network node are a client device (e.g. PC, notebook, tablet, smart phone), a

  7. Normalisation of left ventricular systolic function after change from VVI pacing to biventricular pacing in a child with congenital complete atrioventricular block, long-QT syndrome, and congenital muscular dystrophy

    DEFF Research Database (Denmark)

    Ellesøe, Sabrina G; Reimers, Jesper I; Andersen, Henrik

    2013-01-01

    Development of dilated cardiomyopathy in patients with congenital complete atrioventricular block with or without pacemaker is well described. We report a case of dilated cardiomyopathy in a child with congenital complete atrioventricular block, long-QT syndrome, and VVI pacemaker. Temporary pacing...

  8. Node.js by example

    CERN Document Server

    Tsonev, Krasimir

    2015-01-01

    If you are a JavaScript developer with no experience with Node.js or server-side web development, this book is for you. It will lead you through creating a fairly complex social network. You will learn how to work with a database and create real-time communication channels.

  9. Elective ilioingunial lymph node irradiation

    Energy Technology Data Exchange (ETDEWEB)

    Henderson, R.H.; Parsons, J.T.; Morgan, L.; Million, R.R.

    1984-06-01

    Most radiologists accept that modest doses of irradiation (4500-5000 rad/4 1/2-5 weeks) can control subclinical regional lymph node metastases from squamous cell carcinomas of the head and neck and adenocarcinomas of the breast. There have been few reports concerning elective irradiation of the ilioinguinal region. Between October 1964 and March 1980, 91 patients whose primary cancers placed the ilioinguinal lymph nodes at risk received elective irradiation at the University of Florida. Included are patients with cancers of the vulva, penis, urethra, anus and lower anal canal, and cervix or vaginal cancers that involved the distal one-third of the vagina. In 81 patients, both inguinal areas were clinically negative; in 10 patients, one inguinal area was positive and the other negative by clinical examination. The single significant complication was a bilateral femoral neck fracture. The inguinal areas of four patients developed mild to moderate fibrosis. One patient with moderate fibrosis had bilateral mild leg edema that was questionably related to irradiation. Complications were dose-related. The advantages and dis-advantages of elective ilioinguinal node irradiation versus elective inguinal lymph node dissection or no elective treatment are discussed.

  10. Critical nodes in signalling pathways

    DEFF Research Database (Denmark)

    Taniguchi, Cullen M; Emanuelli, Brice; Kahn, C Ronald

    2006-01-01

    Physiologically important cell-signalling networks are complex, and contain several points of regulation, signal divergence and crosstalk with other signalling cascades. Here, we use the concept of 'critical nodes' to define the important junctions in these pathways and illustrate their unique role...... using insulin signalling as a model system....

  11. Främjandet av kvinnliga entreprenörer

    OpenAIRE

    Palm, Caroline; Lindqvist, Jessica

    2008-01-01

    Trots en ökande trend av antalet kvinnliga entreprenörer är proportionen till manliga entreprenörer fortfarande relativt låg. Anledningen kan bland annat bero på att entreprenörskap definieras efter egenskaper som återfinns bland typiska manliga egenskaper som till exempel riskbenägenhet och en stor självtillit. Med stor sannolikhet är detta en av orsakerna till att få kvinnor kan identifiera sig själva med rollen som entreprenör. Denna studie undersöker vad som i nuläget utförs för att främj...

  12. Energieffektivering av skolfartyget M/S Michael Sars

    OpenAIRE

    Ekebom Oscar, Lindholm Andreas

    2017-01-01

    Syftet med detta examensarbete är att undersöka och utvärdera hur värmeförbrukningen ombord på skolfartyget M/S Michael Sars kan effektiveras. Vi genomförde detta på tre olika sätt. Det första var att undersöka hur en isolering av maskinrummet och dess trapphus kan sänka uppvärmningsbehovet. Vi beräknade värmegenomgången genom skrovet samt hur mycket isoleringsmaterial som behövs. Det andra alternativet för energieffektivering är att undersöka hur ett eventuellt byte av fartygets oljeeldade p...

  13. Successful radiofrequency catheter ablation of atrioventricular nodal reentrant tachycardia in a patient with dextrocardia due to unilateral pulmonary agenesis: a case report

    Directory of Open Access Journals (Sweden)

    Aksu T

    2015-02-01

    Full Text Available Tolga Aksu, Tumer Erdem Guler, Ebru Golcuk, Ismail Erden, Kazim Serhan Ozcan Department of Cardiology, Kocaeli Derince Education and Research Hospital, Derince, Kocaeli, Turkey Abstract: Radiofrequency catheter ablation of the slow pathway is considered to be the treatment of choice for patients with atrioventricular nodal reentrant tachycardia. We report a 34-year-old female with mirror image dextrocardia due to unilateral pulmonary agenesis who underwent successful slow pathway ablation for typical atrioventricular nodal reentrant tachycardia. Using contrast injection, cardiac anatomy was identified in a short time and successfully ablated. Keywords: dextrocardia, AVNRT, ablation, pulmonary agenesis

  14. "Det begynder næsten at bli beboeligt ogsaa i digternes verden" - samtidens resepsjon av Henrik Ibsens Lille Eyolf

    OpenAIRE

    Andersen, Torbjørn

    2010-01-01

    Avhandlingen er en undersøkelse av den skandinaviske samtidsresepsjonen av Henrik Ibsens drama Lille Eyolf (1894), begrenset til bokomtaler (ikke oppsetningskritikk). Artikler av Hans Robert Jauss, Jan Mucařovský og Felix Vodička danner det teoretiske utgangspunktet for arbeidet. I tillegg er Per Thomas Andersens klassifisering av fire hovedtyper kriterier for litteraturkritikk benyttet. Undersøkelsen bygger på et stort utvalg av tradisjonelle avisanmeldelser og tidsskriftartikler fra 1...

  15. EST Table: AV399321 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available |YP_002884363.1| IE-0 [Bombyx mandarina nucleopolyhedrovirus] gb|AAC63807.1| IE-0 [Bombyx mori NPV] gb|ACQ57314.1| IE-0 [Bombyx manda...rina nucleopolyhedrovirus] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h AV399487 NV12 ...

  16. EST Table: AV399146 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399146 NV060720 10/09/28 91 %/173 aa ref|YP_002884350.1| GP64/67 [Bombyx mandarin...a nucleopolyhedrovirus] gb|ACQ57301.1| GP64/67 [Bombyx mandarina nucleopolyhedrovirus] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h BP121286 NV06 ...

  17. EST Table: AV399657 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available YP_002884363.1| IE-0 [Bombyx mandarina nucleopolyhedrovirus] gb|AAC63807.1| IE-0 [Bombyx mori NPV] gb|ACQ57314.1| IE-0 [Bombyx mandar...ina nucleopolyhedrovirus] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h AV399487 NV12 ...

  18. EST Table: AV399890 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399890 NV120911 10/09/28 83 %/222 aa ref|YP_002884341.1| PIF-1 [Bombyx mandarina ...nucleopolyhedrovirus] gb|ACQ57292.1| PIF-1 [Bombyx mandarina nucleopolyhedrovirus] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h BP120262 NV12 ...

  19. EST Table: AV399458 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available |YP_002884259.1| LEF-6 [Bombyx mandarina nucleopolyhedrovirus] gb|AAC63702.1| LEF-6 [Bombyx mori NPV] gb|ACQ...57210.1| LEF-6 [Bombyx mandarina nucleopolyhedrovirus] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h AV399457 NV12 ...

  20. EST Table: AV398266 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available YP_002884363.1| IE-0 [Bombyx mandarina nucleopolyhedrovirus] gb|AAC63807.1| IE-0 [Bombyx mori NPV] gb|ACQ57314.1| IE-0 [Bombyx mandar...ina nucleopolyhedrovirus] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h AV399487 NV02 ...

  1. EST Table: AV399527 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available |YP_002884325.1| LEF-5 [Bombyx mandarina nucleopolyhedrovirus] gb|AAC63769.1| LEF-5 [Bombyx mori NPV] gb|ACQ...57276.1| LEF-5 [Bombyx mandarina nucleopolyhedrovirus] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h AV399374 NV12 ...

  2. EST Table: AV403832 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV403832 pg--0107 10/09/28 99 %/175 aa ref|NP_001103774.1| receptor expression enhancing... protein isoform 1 [Bombyx mori] gb|ABD36360.1| receptor expression enhancing protein isoform 1 [Bombyx.../10 56 %/174 aa gi|189239379|ref|XP_971918.2| PREDICTED: similar to receptor expression enhancing protein [Tribolium castaneum] NM_001110304 pg-- ...

  3. EST Table: AV399230 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399230 NV060841 10/09/28 97 %/150 aa ref|NP_001040380.1| F-box only protein 21 [B...ombyx mori] gb|ABF51283.1| F-box only protein 21 [Bombyx mori] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h FS910521 NV06 ...

  4. EST Table: AV400450 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV400450 br--1258 10/09/28 98 %/184 aa ref|NP_001040380.1| F-box only protein 21 [B...ombyx mori] gb|ABF51283.1| F-box only protein 21 [Bombyx mori] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h FS910521 br-- ...

  5. EST Table: AV399150 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399150 NV060726 10/09/28 98 %/124 aa ref|NP_001040380.1| F-box only protein 21 [B...ombyx mori] gb|ABF51283.1| F-box only protein 21 [Bombyx mori] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h FS910521 NV06 ...

  6. EST Table: AV399180 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV399180 NV060769 10/09/28 57 %/213 aa ref|XP_391845.2| PREDICTED: similar to tout-...:AGAP010388 10/09/10 57 %/213 aa gnl|Amel|GB17343-PA 10/09/10 55 %/209 aa gi|91076108|ref|XP_968944.1| PREDICTED: similar to tout-velu CG10117-PA [Tribolium castaneum] FS931854 NV06 ...

  7. EST Table: AV402302 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV402302 heS00852 10/09/28 98 %/239 aa ref|NP_001128387.1| scavenger receptor type ...C [Bombyx mori] dbj|BAG70411.1| scavenger receptor type C [Bombyx mori] 10/08/28 31 %/247 aa FBpp0259854|Dya...043.1| PREDICTED: similar to scavenger receptor SR-C-like protein [Tribolium castaneum] FS765704 heS0 ...

  8. EST Table: AV402699 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV402699 heS30352 10/09/28 96 %/136 aa ref|NP_001128387.1| scavenger receptor type ...C [Bombyx mori] dbj|BAG70411.1| scavenger receptor type C [Bombyx mori] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h FS765704 heS3 ...

  9. EST Table: AV402471 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV402471 heS01053 10/09/28 100 %/233 aa ref|NP_001128387.1| scavenger receptor type... C [Bombyx mori] dbj|BAG70411.1| scavenger receptor type C [Bombyx mori] 10/08/28 35 %/207 aa FBpp0123883|Da...12043.1| PREDICTED: similar to scavenger receptor SR-C-like protein [Tribolium castaneum] FS765704 heS0 ...

  10. EST Table: AV404429 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404429 pg--0968X 10/09/28 88 %/186 aa ref|NP_001116822.1| kinesin heavy chain [Bo...5-PA 10/08/27 44 %/109 aa R05D3.7#CE26945#WBGene00006840#locus:unc-116#Kinesin heavy chain#status:Confirmed#...56|ref|XP_973415.2| PREDICTED: similar to Kinesin heavy chain CG7765-PA [Tribolium castaneum] FS934567 pg-- ...

  11. EST Table: AV405279 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV405279 wdV10395 10/09/28 66 %/172 aa ref|XP_002062541.1| GK17594 [Drosophila will.../27 33 %/169 aa T21E12.4#CE23997#WBGene00000962#locus:dhc-1#dynein heavy chain#status:Partially_confirmed#Un...17|ref|XP_975584.1| PREDICTED: similar to dynein heavy chain [Tribolium castaneum] DC550560 wdV1 ...

  12. Severe atrioventricular decoupling, uncoupling, and ventriculoatrial coupling during enhanced atrial pacing: incidence, mechanisms, and implications for minimizing right ventricular pacing in ICD patients.

    Science.gov (United States)

    Sweeney, Michael O; Ellenbogen, Kenneth A; Tang, Anthony S L; Johnson, James; Belk, Paul; Sheldon, Todd

    2008-11-01

    AV Decoupling During Enhanced AAIR Pacing. Enhanced AAI/R pacing minimizes right ventricular pacing but may permit or induce AV decoupling (AV-DC) due to unrestricted AV intervals (AVIs). The purpose of this study was to characterize and quantify AVI behavior in a randomized trial of enhanced AAI/R pacing in ICD patients. One hundred twenty-one patients in the Marquis ICD MVPtrade mark Study, a randomized 1-month crossover comparison of cumulative% ventricular pacing (Cum%VP) in enhanced AAIR (MVP) vs DDD/R, were analyzed. AV-DC was defined as >or=40% AVIs >300 ms; VA coupling (VA-C) was defined as%V-atrial pace (AP) intervals 60 beats/min, rate response, and Cum%AP were associated with longer AVIs. Logistic regression identified baseline PR (odds ratio [OR]= 1.024, 95% confidence interval [CI] 1.007-1.042; P = 0.005), and Cum%AP (OR = 1.089, 95% CI 1.027-1.154; P = 0.004) as predictors of AV-DC. AV-DC was associated with approximately 10-fold increases in both Cum%VP (13.6 +/- 28.3% vs 1.2 +/- 3.9%; P = 0.023) due to transient AV-UC) and VA-C (6.0 +/- 17.5% vs 0.5 +/- 1.2%, P = 0.028). AV coupling (300 ms) was preserved in 104 (86%) patients. AV-DC, VA-C, and AV-UC may be worsened or induced by enhanced AAI/R pacing. Conservative programming of lower rate and rate response should reduce the risk of AV-DC by reducing Cum%AP.

  13. Inkludering av ungdom med minoritetsbakgrunn i NIF-organisert idrett

    Directory of Open Access Journals (Sweden)

    Mari Kristin Sisjord

    2014-10-01

    Full Text Available Norges Idrettsforbund og Olympiske og Paralympiske Komité (NIF har en uttalt målsetting om en åpen og inkluderende idrett. Hvordan kommer dette til uttrykk i den praktiske virksomheten? Denne artikkelen, som bygger på data fra en undersøkelse om likestilling og mangfold i den organiserte idretten (NIF, retter søkelyset mot arbeid med inklusjon av ungdom med minoritetsbakgrunn på ulike organisasjonsnivå i NIF: særforbund, idrettskretser og idrettslag. Datamaterialet er kvalitative intervju med representanter fra ulike organisasjonsnivå. Resultatene viser at NIFs overordnede politikk i varierende grad nedfelles i særforbundenes virksomhet, i idrettskretsene og i idrettslagene. Av særforbundene skiller Fotballforbundet og Klatreforbundet seg ut som aktive pådrivere i arbeidet med inkludering. Mange idrettslag oppfattet slike spørsmål som lite aktuelle i sitt rekrutteringsområde. Representanter for lag som hadde erfaring med inkludering og rekruttering av minoritetsungdom, tilkjennega varierte erfaringer og synspunkter.

  14. Two pedigrees of autosomal dominant atrioventricular canal defect (AVCD): Exclusion from the critical region on 8p

    Energy Technology Data Exchange (ETDEWEB)

    Amati, F.; Mari, A.; Mingarelli, R. [Universita Tor Vergata, Rome (Italy)] [and others

    1995-07-03

    Atrioventricular canal defects (AVCD) constitute the predominant congenital heart defect in Down`s syndrome. For this reason, a candidate gene involved in atrioventricular canal development was previously searched and excluded in dominant pedigrees of AVCD, using linkage analysis of polymorphisms from chromosome 21. Because of the striking association between 8p deletion and AVCD, a search for an AVCD gene was carried out in two pedigrees of individuals with autosomal dominant AVCD using a set of DNA markers of the 8pter{r_arrow}q12 region. These two families include affected individuals and subjects who have transmitted the defect but are not clinically affected. Two-point lod scores were significantly negative for all markers at penetrance levels of 90% and 50%. Multipoint analysis excluded the region covered by the markers LPL-D8S262 and 30 cM to either side of this area. This result corroborates heterogeneity of this heart defect and indicates that the genetic basis of familial AVCD is different from AVCD associated to either trisomy 21 or 8p deletion. 25 refs., 3 figs., 2 tabs.

  15. Surgical treatment of partial atrioventricular septal defect: functional analysis of the mitral valve in the postoperative period

    Directory of Open Access Journals (Sweden)

    Josué Viana Castro Neto

    2002-11-01

    Full Text Available OBJECTIVE: To study mitral valve function in the postoperative period after correction of the partial form of atrioventricular septal defect. METHODS: Fifty patients underwent surgical correction of the partial form of atrioventricular septal defect. Their mean age was 11.8 years and 62% of the patients were males. Preoperative echocardiography showed moderate and severe mitral insufficiency in 44% of the patients. The mitral valve cleft was sutured in 45 (90% patients (group II - GII. Echocardiographies were performed in the early postoperative period, and 6 and 12 months after hospital discharge. RESULTS: The patients who had some type of arrhythmia in the postoperative period had ostium primum atrial septal defect of a larger size (2.74 x 2.08 cm. All 5 patients in group I (GI, who did not undergo closure of the cleft, had a competent mitral valve or mild mitral insufficiency in the preoperative period. One of these patients began to have moderate mitral insufficiency in the postoperative period. On the other hand, in GII, 88.8% and 82.2% of the patients had competent mitral valve or mild mitral insufficiency in the early and late postoperative periods, respectively. CONCLUSION: The mitral valve cleft was repaired in 90% of cases. Echocardiography revealed competent mitral valve or mild mitral insufficiency in 88.8% and 82.2% of GII patients in the early and late postoperative periods, respectively.

  16. The effect of different atrioventricular delays on left atrium and left atrial appendage function in patients with DDD pacemaker.

    Science.gov (United States)

    Kanadaşı, Mehmet; Caylı, Murat; Sahin, Durmuş Yıldıray; Sen, Ömer; Koç, Mevlüt; Usal, Ayhan; Batur, Mustafa Kemal; Demirtaş, Mustafa

    2011-07-01

    Although it has been known that optimization of atrioventricular delay (AVD) has favorable effect on the left ventricular functions in patients with DDD pacemaker, the effect of different AVDs on left atrium (LA) and left atrial appendage (LAA) functions has not been exactly evaluated. The aim of the present study was to assess the effect of different AVDs on LA and LAA functions in DDD pacemaker implanted patients with atrioventricular block. Forty-eight patients with DDD pacemaker were enrolled into the study. Patients were divided into two groups according to the echocardiographic diastolic function: Group I (normal diastolic function) and Group II (diastolic dysfunction). LAA emptying velocity on pulsed wave Doppler and LAA late systolic wave velocity by using tissue Doppler were recorded. Patients were paced for five successive continuous pacing periods of 10 minutes duration using five selective AVDs (80-250 ms). Significant effect on LA and LAA functions has not been observed by the setting of AVD in Group I. However, when the AVD was gradually shortened form 150 ms to 80 ms, LA and LAA functions gradually decreased in Group II patients. When AVD increased to 200 ms, LA and LAA functions were improved. Further increase in AVD resulted in decreased LA and LAA functions. Setting of AVD has not significant effect on the LA and LAA functions in patients with normal diastolic function, but moderate prolongation of AVD in physiological limits improved LA and LAA functions in DDD pacemaker implanted patients with diastolic dysfunction. © 2011, Wiley Periodicals, Inc.

  17. Outcomes and Prognostic Factors for Adult Patients With Congenital Heart Disease Undergoing Primary or Reoperative Systemic Atrioventricular Valve Surgery.

    Science.gov (United States)

    Stephens, Elizabeth H; Han, Jiho; Ginns, Jonathan; Rosenbaum, Marlon; Chai, Paul; Bacha, Emile; Kalfa, David

    2017-05-01

    Adults with congenital heart disease (ACHD) undergoing systemic atrioventricular valve (SAVV) surgery are a complex, understudied population. We assessed midterm outcomes and prognostic factors in ACHD undergoing SAVV surgery. We performed retrospective evaluation of ACHD undergoing SAVV surgery from January 2005 to February 2016: 14 (33%) patients with congenital mitral valve stenosis/regurgitation, 15 (35%) with atrioventricular septal defect (AVSD), and 14 (33%) with congenitally corrected transposition of the great arteries (ccTGA) with systemic tricuspid valve regurgitation. Adverse events were defined as mortality, reoperation on SAVV, and late more-than-moderate (> moderate) SAVV regurgitation. Statistical analysis was performed using Fisher's exact test and one-way analysis of variance as well as univariate and multivariate risk factor analysis. Fifteen (35%) patients had preoperative systemic ventricular dysfunction, including 13 patients with ccTGA (93%, P moderate SAVV regurgitation, and SAVV reoperation rates were 5% (n = 2), 2% (n = 1), 9% (n = 3), and 7% (n = 3), respectively. On multivariate analysis, predischarge SAVV regurgitation grade was the only significant predictor of adverse events (odds ratio = 8.2, 95% confidence interval: 1.1-63.8, P = .045). Overall outcomes in this challenging population are good. The single factor associated with adverse events was predischarge SAVV regurgitation grade.

  18. Takotsubo Cardiomyopathy With Significant Coronary Stenosis and Atrioventricular Conduction Block: A Rare Case Report With 3 Year Follow-Up.

    Science.gov (United States)

    Saadatifar, Hakimeh; Khoshhal Dehdar, Fahimeh; Saadatifar, Samira; Moshkani Farahani, Maryam

    2016-02-01

    Takotsubo cardiomyopathy (TCMP) is a rare acute cardiomyopathy characterized by acute chest pain syndrome, similar to myocardial infarction, except that no significant stenosis is observed on coronary angiography in patients with this condition; these findings aid the diagnosis of TCMP. We discuss an unusual case of TCMP in a 45-year-old woman with complete heart block and significant coronary artery stenosis. Maximal exercise test and perfusion scan after 1 month from the acute event did not show any ischemia; therefore, revascularization was not recommended. Her follow-up with normal echocardiographic data 3 years after the first event showed no recurrence. The present case and a few previous cases have showed that severe coronary artery disease may be occur in patients with TCMP and that TCMP may be associated with a high-degree atrioventricular block. The association between atrioventricular conduction block and TCMP as well as significant coronary stenosis is rarely reported; therefore, coronary angiography should be performed in all patients with clinical TCMP and the previous definition should be reconsidered. The occurrence of arrhythmia and later recovery is expected in these patients (due to a catecholamine surge).

  19. O tornar-se avó no processo de individuação

    Directory of Open Access Journals (Sweden)

    Caroline Dal Ri Kipper

    Full Text Available O tornar-se avó assinala um período de transição no ciclo de vida familiar, marcado por transformações psíquicas significativas para os avós, caracterizando a quarta individuação. Este trabalho teve como objetivo investigar a experiência de tornar-se avó e sua importância no processo de individuação. Foi utilizado delineamento de estudo de caso coletivo. Onze avós maternas, com idades entre 49 e 66 anos, cujas filhas tiveram seu primeiro filho, responderam a uma entrevista semi-estruturada. Todas as avós tinham tido seus primeiros netos e a entrevista referia-se a sua experiência como avós desses netos. Os dados mostraram que o ser avó é uma fonte de renovação e renascimento. O estudo propiciou que as participantes refletissem sobre seus diferentes papéis familiares: avó, mãe, neta e filha. Os dados sugerem que tornar-se avó possibilita que antigos conflitos sejam repensados, renovando antigos vínculos e desejos, o que permite que a avó dê mais um passo rumo à sua individuação.

  20. AV nodal reentrant tachycardia or AV reentrant tachycardia using a concealed bypass tract-related adverse events.

    Science.gov (United States)

    Brembilla-Perrot, Béatrice; Bénichou, Maxime; Brembilla, Alice; Bozec, Erwan; Dorlet, Sarah; Sellal, Jean Marc; Olivier, Arnaud; Manenti, Vladimir; Villemin, Thibaut; Beurrier, Daniel; Moulin-Zinsch, Anne; De Chillou, Christian; Girerd, Nicolas

    2015-11-15

    To jointly study paroxysmal supraventricular tachycardia (SVT)-related adverse events (AE) and ablation-related complications, with specific emphasis on the predictors of SVT-related AE as well as their significance by investigating their association with long-term mortality. 1770 patients were included, aged 6 to 97, with either atrioventricular nodal reentrant tachycardia (AVNRT) or orthodromic atrioventricular reciprocal tachycardia (AVRT) mediated by concealed accessory pathway, consecutively referred for SVT work-up in a tertiary care center. SVT-related AE were identified in 339 patients (19%). Major AEs were identified in 23 patients (1%; 15 cardiac arrests or ventricular arrhythmias requiring cardioversion and 8 hemodynamic collapses). Other AE were related to syncope (n=236), acute coronary syndrome (n=57) and heart failure/rhythmic cardiomyopathy (n=21). In multivariable analysis, higher age, heart disease and requirement of isoproterenol to induce SVT were independently associated with a higher risk for SVT-related AE. During follow-up (2.8±3.0years), death occurred more frequently in patients with SVT-related AE, especially in patients with major adverse events (pSVT-related AE remained significantly associated with occurrence of death (HR=6.72, IC=(2.58-17.52), pSVT-related AE in the whole population referred for SVT were more frequent than immediate major ablation complications in patients undergoing SVT ablation (5/1186 vs. 23/1770, p=0.02). SVT-related AE are independent predictors of mortality and are more frequent than immediate major ablation complications in patients undergoing SVT ablation. The present findings support systematically performing SVT ablation in patients with SVT-related adverse events. Copyright © 2015. Published by Elsevier Ireland Ltd.

  1. T-760/15: Nederländerna mot Kommissionen : Analys av kommissionens prövning av selektivitet

    OpenAIRE

    Elofsson, Niklas

    2016-01-01

    I takt med att den ökade globaliseringen av den internationella handeln har möjligheterna för multinationella företag att påverka sin beskattning ökat. Företags olika upplägg för att minska sina skattekostnad har bekämpats allt eftersom de har växt fram. Under 2010-talet uppdagades att multinationella företag har fått minskade skatte-kostnader genom tillämpning av APA:or med medlemsstater. Kommissionen har påbörjat ett nitiskt arbete för att stoppa och återvinna dessa skattelättnader. Kommiss...

  2. Secure message authentication system for node to node network

    Science.gov (United States)

    Sindhu, R.; Vanitha, M. M.; Norman, J.

    2017-10-01

    The Message verification remains some of the best actual methods for prevent the illegal and dis honored communication after presence progressed to WSNs (Wireless Sensor Networks). Intend for this purpose, several message verification systems must stand established, created on both symmetric key cryptography otherwise public key cryptosystems. Best of them will have some limits for great computational then statement above in count of deficiency of climb ability then flexibility in node settlement occurrence. In a polynomial based system was newly presented for these problems. Though, this system then situations delay will must the dimness of integral limitation firm in the point of polynomial: once the amount of message transferred remains the greater than the limitation then the opponent will completely improve the polynomial approaches. This paper suggests using ECC (Elliptic Curve Cryptography). Though using the node verification the technique in this paper permits some nodes to transfer a limitless amount of messages lacking misery in the limit problem. This system will have the message cause secrecy. Equally theoretic study then model effects show our planned system will be effective than the polynomial based method in positions of calculation then statement above in privacy points though message basis privacy.

  3. Å LESE MEDIETEKSTER PÅ IPADEN. Observasjoner av en medievant fireårings bruk av iPad i hjemmet

    Directory of Open Access Journals (Sweden)

    Henriette Jæger

    2016-06-01

    Full Text Available Artikkelen tar utgangspunkt i tre observasjoner av en gutt på fire år som bruker iPad på fritiden. Den søker å synliggjøre de strategiene dette barnet velger for å skaffe seg tilgang til ulike medietekster, hvordan han leser og tolker dem, og den undersøker eventuelle spor av kritisk refleksjon hos barnet over disse tekstene. Teoretisk sett hviler den på en forståelse av mediekompetanse som en parallell prosess til utvikling av lese- og skrivekyndighet (literacy, og medieopplevelsene omtales som viktige møter med tekst. Artikkelen undersøker hvordan å lese medietekster kan legge et grunnlag for å utvikle en utvidet tekstkompetanse eller mediekompetanse. Konklusjonen legger vekt på motivasjon og lekenhet som barns primære inngang til medietekstene og som et grunnlag for å utvikle mediekompetanse (media literacy. The article is based on three observations of a four-year-old boy who uses the iPad in his spare time. It demonstrates the strategies that this boy applies to gain access to various media texts, and how he reads and interprets them. It also seeks to examine traces of critical reflection that he may demonstrate in relation to these texts. Theoretically, it rests on an understanding of media literacy as a parallel process to the development of literacy, and it seeks to demonstrate how reading media texts can create an important starting point for the development of media literacy. The Kindergarten practitioner’s role and opportunities to develop children's media literacy within a kindergarten context is a focus towards the end of the article. In conclusion, I argue that motivation and playfulness are important approaches to media texts and create an important foundation for the development of media literacy

  4. Vasospastic angina pectoris complicated by acute myocardial infarction and complete atrioventricular block

    Directory of Open Access Journals (Sweden)

    Pavlović Milan

    2011-01-01

    Full Text Available Background. A prolonged coronary artery spasm with interruption of coronary blood flow can lead to myocardial necrosis and increase of cardiospecific enzymes and can be complicated with cardiac rhythm disturbances, syncopc, or even sudden cardiac death. Case report. A 55-year old male felt a severe retrosternal pain when exposing himself to cold weather. The pain lasted for 20 minutes and was followed by the loss of conscience. Electrocardiogram (ECG showed a complete antrioventricular (AV block with nodal rhythm and marked elevation of ST segment in inferior leads. Electrocardiogram was soon normalized, but serum activities of cardiospecific enzymes were increased. Coronarography showed normal findings for the left coronary artery and a narrowing at the middle part of the right coronary artery, which disappeared after intracoronary application of nitroglycerine. The following therapy was prescribed: Diltiazem, Amlodipin, Isosorbid mononitrate, Molisdomin, Atrovastatin, Aspirin and Nitroglycerine spray. After 7 months medicaments were abandoned and the patient experienced again reccurent chest pain episodes at rest. Transitory ST segment elevation was recorded in inferior leads of ECG, but without increase of cardiospecific enzymes serum activities. After restoration of the medicament therapy anginal episodes ceased. Conclusion. Coronary dilators in maximal doses can prevent attacks of vasospastic angina.

  5. Diffusjon av influensa i Norge under spanskesyken 1918-19

    Directory of Open Access Journals (Sweden)

    Svenn-Erik Mamelund

    2009-10-01

    Full Text Available  SAMMENDRAGSpanskesyken var en verdensomspennende influensaepidemi som tok livet av minst 30 millioner mennesker,de fleste i løpet av noen få høstmåneder i 1918, men den strakk seg også inn i 1919. En siste svakbølge fant sted vinteren 1920. De første sporadiske tilfellene av spanskesyken i Norge oppsto i militærleirei begynnelsen av april 1918. Over tre måneder senere kom de første spredte tilfellene av det som skullevise seg å være starten på en ny stor influensapandemi. De første av disse oppsto i Kristiania, mest sannsynligetter smitteimport fra Skottland over Nordsjøen. Sommeren 1918 spredte spanskesyken seg raskt frasør til nord, fra kysten til innlandet innover fjordene, og fra de største byene og industrisentra via mindrebyer og andre tettsteder til landsbygda langs de viktigste ferdselsveiene. Da spanskesyken blusset opp igjenhøsten 1918 spredte den seg langsommere og trolig fra nord til sør, fortsatt fra kysten innover fjordene,men spredning fra byene langs kommunikasjonsveiene var mindre fremtredende. Vinteren 1918/19opptrådte influensaen spredt og sporadisk, tilsynelatende uten bestemt spredningsmønster og rekkefølge.Jernbanen, hurtigruten og automobilrutene spilte trolig en viktig rolle i spredningsprosessen, spesielt andrehalvår 1918. Ulik sosial interaksjon, for eksempel et marked som samlet store folkemengder, kan bidra til åforklare eksplosive utbrudd av influensa og diffusjon på lavt geografisk nivå.Mamelund S-E. The diffusion of influenza in Norway during the 1918-19 Pandemic.Nor J Epidemiol ENGLISH SUMMARYIn 1918-1919, a world-wide pandemic, the Spanish Influenza, swept over the entire globe, killing at least30 million people, most of them during the fall of 1918. A last, but small and less defined wave occurred inthe winter of 1920. The first sporadic cases of Spanish Influenza in Norway are known from army campsin the early days of April 1918. More than three months later, the first scattered

  6. Overvåking av norsk kosthold - metoder og resultater

    Directory of Open Access Journals (Sweden)

    Lars Johansson

    2009-11-01

    Full Text Available  SAMMENDRAGKunnskap om endringer i matvarenes sammensetning og befolkningens kosthold er grunnleggende for utformingog oppfølging av en helsefremmende mat- og ernæringspolitikk. Dagens system for overvåking avkostholdet bygger først og fremst på en matvaredatabase og opplysninger om forbruket av matvarer fra tretyper datasett; matforsyningsstatistikk, forbruksundersøkelser og kostholdsundersøkelser. Det avgis årlig envurdering av utviklingen i norsk kosthold i forhold til mat- og ernæringspolitiske målsettinger. Det norskesystemet for overvåking av kostholdet er blitt betydelig styrket i løpet av 1990-årene ved innføringen avregelmessige kostholdsundersøkelser blant landsrepresentative utvalg av befolkningen i ulike aldersgrupperog økte ressurser til analyse av næringsinnholdet i matvarer. Det er imidlertid beskjedent sammenlignet meddatainnsamlingen i land som USA og Storbritannia. Det norske overvåkingssystemet er forsatt i enutviklingsfase, og det må justeres og kompletteres etter hvert. Dessuten vil det arbeides med å kvalitetssikredatainnsamlingen.Johansson L. Surveillance of the diet in Norway – methods and results.Nor J Epidemiol ENGLISH SUMMARYKnowledge about changes in composition and intake of foods, as well as changes in the prevalence of dietrelatedhealth problems is fundamental for an effective food and nutrition policy. The National Council onNutrition and Physical Activity is responsible for evaluating changes in the diet. Annually the Council publishesreports about trends in the Norwegian diet, and suggests measures to improve the diet. The Council, incooperation with the National Food Authority and the Institute for Nutrition Research, University of Oslo,has established a national food and dietary surveillance system. This system is mainly based on a fooddatabase and food consumption data. The food consumption data include three principally different datasets: food supplies, household consumption surveys

  7. Axillary Lymph Nodes and Breast Cancer

    Science.gov (United States)

    ... nodes . The axillary nodes are the first place breast cancer is likely to spread. During breast surgery, some ... if cancer cells are present. This helps determine breast cancer stage and guide treatment. So, it is more ...

  8. Dual AV Nodal Nonreentrant Tachycardia Resulting in Inappropriate ICD Therapy in a Patient with Cardiac Sarcoidosis

    Directory of Open Access Journals (Sweden)

    Ankur A. Karnik, MD

    2014-01-01

    Full Text Available Dual atrioventricular nodal nonreentrant tachycardia (DAVNNT occurs due to concurrent antegrade conduction over fast and slow atrioventricular nodal pathways and is treated by slow pathway modification. We describe a unique case of a patient with cardiac sarcoidosis who received inappropriate ICD shocks for DAVNNT. Atrial and ventricular device electrograms satisfied both rate and V>A criteria for ventricular tachycardia. We postulate that alterations in refractoriness and conduction as is seen in cardiac sarcoidosis (CS may have contributed to occurrence of DAVNNT.

  9. Underwater Sensor Nodes and Networks

    Directory of Open Access Journals (Sweden)

    Jaime Lloret

    2013-09-01

    Full Text Available Sensor technology has matured enough to be used in any type of environment. The appearance of new physical sensors has increased the range of environmental parameters for gathering data. Because of the huge amount of unexploited resources in the ocean environment, there is a need of new research in the field of sensors and sensor networks. This special issue is focused on collecting recent advances on underwater sensors and underwater sensor networks in order to measure, monitor, surveillance of and control of underwater environments. On the one hand, from the sensor node perspective, we will see works related with the deployment of physical sensors, development of sensor nodes and transceivers for sensor nodes, sensor measurement analysis and several issues such as layer 1 and 2 protocols for underwater communication and sensor localization and positioning systems. On the other hand, from the sensor network perspective, we will see several architectures and protocols for underwater environments and analysis concerning sensor network measurements. Both sides will provide us a complete view of last scientific advances in this research field.

  10. Underwater sensor nodes and networks.

    Science.gov (United States)

    Lloret, Jaime

    2013-09-05

    Sensor technology has matured enough to be used in any type of environment. The appearance of new physical sensors has increased the range of environmental parameters for gathering data. Because of the huge amount of unexploited resources in the ocean environment, there is a need of new research in the field of sensors and sensor networks. This special issue is focused on collecting recent advances on underwater sensors and underwater sensor networks in order to measure, monitor, surveillance of and control of underwater environments. On the one hand, from the sensor node perspective, we will see works related with the deployment of physical sensors, development of sensor nodes and transceivers for sensor nodes, sensor measurement analysis and several issues such as layer 1 and 2 protocols for underwater communication and sensor localization and positioning systems. On the other hand, from the sensor network perspective, we will see several architectures and protocols for underwater environments and analysis concerning sensor network measurements. Both sides will provide us a complete view of last scientific advances in this research field.

  11. Rendyrking av funksjoner i NAV – renere eller mer kaotisk sosialt arbeid?

    OpenAIRE

    Myhre, Tone

    2017-01-01

    Det overordnede temaet for denne oppgaven er sosialt arbeid i NAV. Sosialtjenesten i NAV utgjør en av de største arbeidsplassene for sosialarbeidere i Norge. For å utøve sosialt arbeid i NAV, er det viktig med gode rammebetingelser. I denne oppgaven ønsker jeg derfor å se på hvordan organiseringen av NAV kan påvirke sosialarbeideres utøvelse av det sosiale arbeidet.

  12. Factors predicting non-sentinel lymph node involvement in sentinel node positive breast carcinoma.

    Science.gov (United States)

    Durak, Merih Güray; Akansu, Bülent; Akin, Mehmet Mustafa; Sevınç, Ali Ibrahim; Koçdor, Mehmet Ali; Saydam, Serdar; Harmancioğlu, Omer; Ellıdokuz, Hülya; Bekış, Recep; Canda, Tülay

    2011-01-01

    In routine practice, axillary lymph node dissection is performed in early invasive breast cancer patients with positive sentinel node biopsy. However, sentinel node is the only involved axillary node in 40-70% of patients, and determining factors that predict axillary non-sentinel node involvement will therefore prevent unnecessary axillary lymph node dissection and decrease morbidity. In this study, 119 invasive breast cancer patients with sentinel node metastasis who underwent axillary lymph node dissection between 1998-2009 at our institution were studied. Primary tumor characteristics and features of the metastatic tumors in sentinel nodes, such as microanatomic location, size of metastasis, and the ratio of metastatic tumor area to the total sentinel node area were evaluated. Student's t-test and multivariate logistic regression were used for statistical analysis. The mean age of the patients was 50.7 years (28-80). Forty-three patients (36%) had invasive ductal and 25 patients (21%) had invasive lobular carcinoma. Most of the patients had either pT1 (44%) or pT2 (54%) tumors. Fifty-four patients (45%) had no further positive nodes in the axilla. The metastatic deposits in the sentinel node were subcapsular in 16 patients (13%). The percent area of sentinel node occupied by tumor (p < 0.001), number of sentinel nodes (p=0.041), and microanatomic location of metastatic tumor (p=0.002) were significantly associated with non-sentinel node metastasis in univariate analysis. The percent area of sentinel node occupied by tumor (p < 0.001) and number of sentinel nodes (p=0.033) remained significantly associated with non-sentinel node involvement in multivariate analysis. In patients with invasive breast cancer and positive sentinel node, area percent of sentinel node occupied by tumor, and the number of sentinel nodes removed are independently predictive of non-sentinel node involvement.

  13. Safety and feasibility of single-catheter ablation using remote magnetic navigation for treatment of slow-fast atrioventricular nodal reentrant tachycardia compared to conventional ablation strategies

    NARCIS (Netherlands)

    F. Akca (Ferdi); B. Schwagten (Bruno); D.A.M.J. Theuns (Dominic); M. Takens (Marieke); P. Musters (Paul); T. Szili-Torok (Tamas)

    2013-01-01

    textabstractObjective Ablation of atrioventricular nodal re-entrant tachycardia (AVNRT) is a highly effective procedure both with radiofrequency (RF) and cryoenergy (CE). Conventionally, it requires several diagnostic catheters and hospital admission. This study assessed the safety and efficacy of a

  14. T.Node, industrial version of supernode

    Science.gov (United States)

    Flieller, Sylvain

    1989-12-01

    The Esprit I P1085 "SuperNode" project developed a modular reconfigurable archtecture, based on transputers. This highly parallel machine is now marketed by Telmat Informatique under the name T.Node. This paper presents the P1085 project, the architecture of SuperNode, its industrial implementation and its software enviroment.

  15. SENTINEL LYMPH NODES IN ENDOMETRIAL CANCER

    OpenAIRE

    A. I. Berishvili; O. V. Li; T. M. Kochoyan; N. V. Levkina; R. A. Kerimov; S. B. Polikarpova

    2017-01-01

    Endometrial cancer (EC) typically is treated surgically. Because of the adjuvant treatment implications, complete surgical staging including lymphadenectomy is recommended for high-risk ECs. Sentinel lymph node mapping has the potential to provide information about lymph node metastasis while avoiding potential complications of extended lymph node dissection.

  16. The hidden sentinel node in breast cancer

    NARCIS (Netherlands)

    Tanis, P. J.; van Sandick, J. W.; Nieweg, O. E.; Valdés Olmos, R. A.; Rutgers, E. J. T.; Hoefnagel, C. A.; Kroon, B. B. R.

    2002-01-01

    The purpose of this study was to analyse the occurrence of non-visualisation during preoperative lymphoscintigraphy for sentinel node identification in breast cancer. Preoperative lymphoscintigraphy was performed in 495 clinically node-negative breast cancer patients (501 sentinel node procedures)

  17. Tangofilmer - en genreanalyse : nærstudie av tangofilmgenren som fenomen innen den argentinske filmindustrien

    OpenAIRE

    Hjorteset, Rita

    2007-01-01

    Den argentinske tangoen gjør seg i dag gjeldende både i argentinsk og internasjonal film, noe som har vært utgangspunktet for ideen til denne oppgaven. ”Los muchachos de antes no usaban gomina” (Karene den gang brukte ikke bryl) (1937) regissert av Manuel Romero og ”Tango” (1997) regissert av Carlos Saura representerer to forskjellige eksempler fra tangofilmgenren. I denne oppgaven gjennomgås et korpus av filmer sammensatt av tre kilder i forhold til Rick Altmans 10 påstander om genre i b...

  18. OFFLOADING OF A WIRELESS NODE AUTHENTICATION WITH CORE NETWORK

    DEFF Research Database (Denmark)

    2017-01-01

    An example technique may include controlling receiving, by a second node from a first node in a wireless network, a request to offload authentication of the first node with the core network to the second node, controlling receiving, by the second node from the first node, data to be forwarded...... to the core network, performing, by the second node based on the request, an authentication with the core network on behalf of the first node while the first node is not connected with the second node, and controlling forwarding the received data from the second node to the core network while the first node...

  19. Kvällspressen, ledaren och könet : En studie om mediebevakningen av Mona Sahlin och Fredrik Reinfeldt

    OpenAIRE

    Yazdanfar, Sara

    2010-01-01

    Mona Sahlin och Fredrik Reinfeldt har under valet 2010 varit bevakade av medier som statsministerkandidater. Uppsatsen analyserar vilka likheter och skillnader det finns rapporteringen av dem på kvällspressens framsidor, hur genus framställs och vad kvällspressen fokuserar på i rapporteringen av dem. Med hjälp av tabloidformats- och genusteorier av text och bild samt en kritisk diskursanalys och semiotisk analys som metod har slutsatser framkommit. Rapporteringen av dem har inte varit positiv...

  20. Artificial vision support system (AVS(2)) for improved prosthetic vision.

    Science.gov (United States)

    Fink, Wolfgang; Tarbell, Mark A

    2014-11-01

    State-of-the-art and upcoming camera-driven, implanted artificial vision systems provide only tens to hundreds of electrodes, affording only limited visual perception for blind subjects. Therefore, real time image processing is crucial to enhance and optimize this limited perception. Since tens or hundreds of pixels/electrodes allow only for a very crude approximation of the typically megapixel optical resolution of the external camera image feed, the preservation and enhancement of contrast differences and transitions, such as edges, are especially important compared to picture details such as object texture. An Artificial Vision Support System (AVS(2)) is devised that displays the captured video stream in a pixelation conforming to the dimension of the epi-retinal implant electrode array. AVS(2), using efficient image processing modules, modifies the captured video stream in real time, enhancing 'present but hidden' objects to overcome inadequacies or extremes in the camera imagery. As a result, visual prosthesis carriers may now be able to discern such objects in their 'field-of-view', thus enabling mobility in environments that would otherwise be too hazardous to navigate. The image processing modules can be engaged repeatedly in a user-defined order, which is a unique capability. AVS(2) is directly applicable to any artificial vision system that is based on an imaging modality (video, infrared, sound, ultrasound, microwave, radar, etc.) as the first step in the stimulation/processing cascade, such as: retinal implants (i.e. epi-retinal, sub-retinal, suprachoroidal), optic nerve implants, cortical implants, electric tongue stimulators, or tactile stimulators.

  1. Rettferdige minutter: Fordeling av spilletid i fotballkamper for aldersbestemte klasser

    Directory of Open Access Journals (Sweden)

    Trine Anker

    2010-01-01

    Full Text Available På et fotballag i overgangen mellom barne- og ungdomsfotballen er spilletid på fotballbanen under kamp både en knapp ressurs og en kilde til diskusjoner om fordeling. Spørsmålet som er utgangspunkt for denne artikkelen, er hvilke hensyn som bør tas når trener og lagleder skal fordele samlet spilletid på enkeltspillere. Er det viktigst å vinne fotballkampen, eller har det størst betydning å fordele spilletiden mest mulig likt mellom spillerne? Skal det tas hensyn til guttenes evner, motivasjon og preferanser? Er deres familiebakgrunn og personlighet av betydning? Diskusjonen baserer seg på en gjennomgang av ulike politiske rettferdighetsteorier for fordeling av knappe goder.Nøkkelord: rettferdighet, practice, fordelingsrettferdighet, diskursetikk, idrettsetikkEnglish summary: Minutes of justice: Distribution of time during football matches in a boys' teamDuring a football match, time for playing can be considered as a limited good. In this article the point of departure is the redistribution of time in a boys' football team in the transition phase between children and youth football. The questions are how and under which conditions time for playing should be distributed among the players. Is winning the game more important than trying to let every player play for an equal amount of time? Should the boys' talents, motivation, and preferences be considered while distributing time, or are family background and personality of importance? Different theories of political justice for the distribution of limited goods underpin the discussion of how to distribute the minutes of playing time during a football match.http://dx.doi.org/10.5324/eip.v4i1.1737

  2. Norsk fiskeriforvaltning og bærekraft; en studie av forvaltningen av atlantisk laks (Salmo salar) og nordøstarktisk torsk (Gadus morhua)

    OpenAIRE

    Meaas, Anne Christine

    2012-01-01

    Laksefisket og torskefisket er forvaltet av to forskjellige sektorer, og laksefisket er i tillegg sektorovergripende på grunn av laksens anadrome livshistorie. Denne oppgaven har tatt for seg disse to forvaltningene, og sett på disse i lys av bærekraftbegrepet. Resultatene ble funnet gjennom litteraturstudier og personlig kommunikasjon med personer i forvaltningen. Lakseforvaltningen har høy sosial bærekraft, og laksefisket har et stort potensial som mål for turister og fritidsfiskere. Lak...

  3. Untraceable Mobile Node Authentication in WSN

    Directory of Open Access Journals (Sweden)

    Kyusuk Han

    2010-04-01

    Full Text Available Mobility of sensor node in Wireless Sensor Networks (WSN brings security issues such as re-authentication and tracing the node movement. However, current security researches on WSN are insufficient to support such environments since their designs only considered the static environments. In this paper, we propose the efficient node authentication and key exchange protocol that reduces the overhead in node re-authentication and also provides untraceability of mobile nodes. Compared with previous protocols, our protocol has only a third of communication and computational overhead. We expect our protocol to be the efficient solution that increases the lifetime of sensor network.

  4. Nonadiabatic eigenfunctions can have conical nodes

    Science.gov (United States)

    Foster, Peter W.; Peters, William K.; Jonas, David M.

    2017-09-01

    It has been argued the total vibrational probability amplitude for a molecular nonadiabatic eigenfunction should not have nodes unless required by symmetry. For a model with two nonadiabatically coupled electronic states, exact factorization of nonadiabatic eigenfunctions into a total vibrational probability amplitude and a normalized electronic factor reveals zero-dimensional nodes in nonadiabatic eigenfunctions over a two-dimensional vibrational space. These conical nodes have the shape of a right elliptical cone with the node at the vertex. Low dimensionality nodes are likely when the number of nonadiabatically coupled electronic states is less than or equal to the dimensionality of the vibrational space.

  5. EST Table: AV403753 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV403753 pg--0010X 11/12/09 GO hit GO:0000287(magnesium ion binding)|GO:0004427(inorganic...39 aa ref|NP_290858.1| inorganic pyrophosphatase [Escherichia coli O157:H7 EDL933] ref|NP_313231.1| inorganic... pyrophosphatase [Escherichia coli O157:H7 str. Sakai] ref|NP_418647.1| inorganic... pyrophosphatase [Escherichia coli str. K-12 substr. MG1655] ref|YP_313123.1| inorganic pyrophosphatase [Sh...igella sonnei Ss046] ref|YP_410472.1| inorganic pyrophosphatase [Shigella boydii Sb227] ref|YP_405834.1| inorganic

  6. EST Table: AV401507 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV401507 e96h0814 10/09/28 95 %/238 aa dbj|BAG15923.1| transposase [Bombyx mandarin...a] dbj|BAG15924.1| transposase [Bombyx mandarina] dbj|BAG15925.1| transposase [Bombyx mandarina] 10/08/28 n.h 10/08/27 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h FS797048 e96h ...

  7. Implementering av multivariabel reglering i DCS-miljö

    OpenAIRE

    Winberg, Johan

    2009-01-01

    Inom processindustrin finns en etablerad reglerhierarki där basreglering sker med PID-regulatorer och där avancerad, multivariabel styrning sköts av MPC-programvara. Steget mellan dessa två nivåer kan upplevas som stort. För mindre och snabba multivariabla processer undvikes helst en multivariabel ansats, med försämrad reglering som följd. På Preem AB har detta upplevts som ett problem. Syftet med examensarbetet har varit att utveckla en alternativ, multivariabel styrstrategi för en process m...

  8. En brukbarhetsanalys av avancerad fastighetsautomation under förvaltningsskedet

    OpenAIRE

    Esselin, Frida; Selimovic, Seherzada

    2015-01-01

    Avancerad fastighetsautomation intog marknaden under 2000-talets första år. Visionen var att skapa smarta byggnader där fastighetsövervakning, klimatstyrning och belysning sammankopplades mot en central huvuddator för att eliminera manuell styrning. Syftet med examensarbetet är att undersöka funktionalitet och reell brukbarhet hos ett av de första installationsobjekten, PostNords huvudkontor. Rapporten presenterar fastighetens övergripande funktioner samt analyserar hur systemstyrningen kan o...

  9. Guerrillero Heroico : Alberto Kordas fotografiske portrett av Che Guevara

    OpenAIRE

    Gulljord, Hanne Gudrun

    2010-01-01

    Fotografen Alberto Diaz Gutiérrez (1928-2001), bedre kjent som Alberto Korda, tok i 1960 et snapshot av Ernesto ”Che” Guevara de la Serna (1928-1967). Korda ga senere dette portrettet tittelen Guerrillero Heroico. Portrettet blir omtalt som vår tids mest reproduserte fotografi. Denne oppgaven behandler den visuelle kulturen som har oppstått rundt dette fotografiet, og tar i den sammenhengen utgangspunkt i de historiske kontekstene som synes medvirkende til at Guerrillero Heroico forflytter...

  10. Konservering av et knust vannfilter i steingods : redde et familieklenodium

    OpenAIRE

    Heggtveit, Hilde

    2007-01-01

    Oppgaven gikk ut på å konservere et vannfilter i privat eie som hadde blitt knust under en flytteprosess. Det var ulike problemstillinger som måtte løses for å gi et best mulig resultat for gjenstand og eier. Gjenstanden er i privat eie og det vil dermed bli andre etiske problemstillinger å ta hensyn til enn med en gjenstand som tilhører et museum. Museer har retningslinjer og strenge etiske regler å forholde seg til vedtekter som er vedtatt av styret til museet og internasjonale komitee...

  11. EST Table: AV398143 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398143 NV021176 10/09/28 100 %/213 aa ref|NP_001040254.1| beadex/dLMO protein [Bo...mbyx mori] gb|ABD36315.1| beadex/dLMO protein [Bombyx mori] 10/08/28 74 %/175 aa FBpp0262745|DyakGE17735-PA ... gnl|Amel|GB11268-PA 10/09/10 81 %/180 aa gi|91080717|ref|XP_975367.1| PREDICTED: similar to beadex/dLMO protein [Tribolium castaneum] FS794536 NV02 ...

  12. EST Table: AV398425 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398425 NV021796 10/09/28 92 %/176 aa ref|NP_001040254.1| beadex/dLMO protein [Bom...byx mori] gb|ABD36315.1| beadex/dLMO protein [Bombyx mori] 10/08/28 87 %/123 aa FBpp0262745|DyakGE17735-PA 1...a gnl|Amel|GB11268-PA 10/09/10 76 %/156 aa gi|91080717|ref|XP_975367.1| PREDICTED: similar to beadex/dLMO protein [Tribolium castaneum] FS794536 NV02 ...

  13. Konstruksjon av GaAs MMIC effektforsterker med integrert linearisering

    OpenAIRE

    Kippernes, Frank Åge

    2009-01-01

    Denne oppgaven tar for seg linearisering av GaAs MMIC effektforsterkere. Det er brukt en pHEMT-prosess og senterfrekvensen ligger på 2,45 GHz. Effektforsterkerne som er konstruert kan levere utgangseffekter i størrelsesorden 1 W. Agilent Advanced Design System (ADS) ble brukt til konstruksjon og simulering. Moderne modulasjonsteknikker med varierende envelope krever lineære forsterkere for å fungere. Ulinearitetene i forsterkeren vil forvrenge signalet og skape støy både i og utenfor båndet...

  14. EST Table: AV403042 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV403042 heS30974 10/09/28 62 %/228 aa ref|XP_321040.4| AGAP002015-PA [Anopheles ga...|DwilGK17594-PA 10/08/27 39 %/210 aa T21E12.4#CE23997#WBGene00000962#locus:dhc-1#dynein heavy chain#status:P...62 %/230 aa gi|91087317|ref|XP_975584.1| PREDICTED: similar to dynein heavy chain [Tribolium castaneum] DC550560 heS3 ...

  15. EST Table: AV404085 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404085 pg--0423X 10/09/28 100 %/117 aa gb|ACH69160.1| myosin heavy chain [Bombyx ...mori] 10/08/28 84 %/116 aa FBpp0291042|Mhc-PO 10/08/27 60 %/116 aa F11C3.3#CE09349#WBGene00006789#locus:unc-54#myosin heav... gnl|Amel|GB30329-PA 10/09/10 83 %/116 aa gi|189239929|ref|XP_001813306.1| PREDICTED: similar to Myosin heavy chain CG17927-PF isoform 1 [Tribolium castaneum] FJ029109 pg-- ...

  16. EST Table: AV404226 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV404226 pg--0725 10/09/28 81 %/264 aa gb|ACQ72825.1| myosin heavy chain [Bombyx ma...ndarina] 10/08/28 78 %/264 aa FBpp0291043|Mhc-PP 10/08/27 51 %/264 aa F11C3.3#CE09349#WBGene00006789#locus:unc-54#myosin heav... aa gnl|Amel|GB30329-PE 10/09/10 78 %/264 aa gi|189239927|ref|XP_001814139.1| PREDICTED: similar to Myosin heavy chain CG17927-PF isoform 7 [Tribolium castaneum] FJ029109 pg-- ...

  17. Targeted Delivery of Immunomodulators to Lymph Nodes

    Directory of Open Access Journals (Sweden)

    Jamil Azzi

    2016-05-01

    Full Text Available Active-targeted delivery to lymph nodes represents a major advance toward more effective treatment of immune-mediated disease. The MECA79 antibody recognizes peripheral node addressin molecules expressed by high endothelial venules of lymph nodes. By mimicking lymphocyte trafficking to the lymph nodes, we have engineered MECA79-coated microparticles containing an immunosuppressive medication, tacrolimus. Following intravenous administration, MECA79-bearing particles showed marked accumulation in the draining lymph nodes of transplanted animals. Using an allograft heart transplant model, we show that targeted lymph node delivery of microparticles containing tacrolimus can prolong heart allograft survival with negligible changes in tacrolimus serum level. Using MECA79 conjugation, we have demonstrated targeted delivery of tacrolimus to the lymph nodes following systemic administration, with the capacity for immune modulation in vivo.

  18. Targeted Delivery of Immunomodulators to Lymph Nodes.

    Science.gov (United States)

    Azzi, Jamil; Yin, Qian; Uehara, Mayuko; Ohori, Shunsuke; Tang, Li; Cai, Kaimin; Ichimura, Takaharu; McGrath, Martina; Maarouf, Omar; Kefaloyianni, Eirini; Loughhead, Scott; Petr, Jarolim; Sun, Qidi; Kwon, Mincheol; Tullius, Stefan; von Andrian, Ulrich H; Cheng, Jianjun; Abdi, Reza

    2016-05-10

    Active-targeted delivery to lymph nodes represents a major advance toward more effective treatment of immune-mediated disease. The MECA79 antibody recognizes peripheral node addressin molecules expressed by high endothelial venules of lymph nodes. By mimicking lymphocyte trafficking to the lymph nodes, we have engineered MECA79-coated microparticles containing an immunosuppressive medication, tacrolimus. Following intravenous administration, MECA79-bearing particles showed marked accumulation in the draining lymph nodes of transplanted animals. Using an allograft heart transplant model, we show that targeted lymph node delivery of microparticles containing tacrolimus can prolong heart allograft survival with negligible changes in tacrolimus serum level. Using MECA79 conjugation, we have demonstrated targeted delivery of tacrolimus to the lymph nodes following systemic administration, with the capacity for immune modulation in vivo. Copyright © 2016 The Authors. Published by Elsevier Inc. All rights reserved.

  19. Lymph Node Yield in Primary Retroperitoneal Lymph Node Dissection for Nonseminoma Germ Cell Tumors.

    Science.gov (United States)

    Nayan, Madhur; Jewett, Michael A S; Sweet, Joan; Anson-Cartwright, Lynn; Bedard, Philippe L; Moore, Malcolm; Chung, Peter; Warde, Padraig; Hamilton, Robert J

    2015-08-01

    The number of lymph nodes removed at surgery for various malignancies has diagnostic and prognostic value. However, there are limited data on the significance of the number of nodes removed at retroperitoneal lymph node dissection performed for testicular nonseminoma germ cell tumors. From 1979 to 2012 primary open retroperitoneal lymph node dissection was performed by a single experienced surgeon for clinical stage I/II testicular nonseminoma germ cell tumor in 157 patients. Node count was available in 111 cases (71%). Factors associated with total node count and nodes with viable cancer were assessed by linear regression. The association between node count and time to relapse was assessed by multivariate Cox proportional hazards models controlled for adjuvant chemotherapy. The median total lymph node count was 28 (IQR 19-38). Patient age, cancer laterality, body mass index, clinical stage, time from orchiectomy to retroperitoneal lymph node dissection, pathologist and lymph node dissection year were not associated with total lymph node count. A viable germ cell tumor was found in 70 patients (63%). Total node yield was not associated with nodal cancer metastasis. After lymph node dissection 17 patients (16%) received adjuvant chemotherapy. At a median 57-month followup 18 cases (17%) relapsed after primary retroperitoneal lymph node dissection. Increasing total node count was associated with a decreased risk of relapse on univariate and multivariate analysis (HR 0.96, 95% CI 0.92-0.99, p = 0.03 and HR 0.94, 95% CI 0.89-0.99, p = 0.017, respectively). No analyzed clinical or pathological variable was associated with the node yield of primary retroperitoneal lymph node dissection. However, there may be a relationship between the total node yield at retroperitoneal lymph node dissection and the risk of relapse. Copyright © 2015 American Urological Association Education and Research, Inc. Published by Elsevier Inc. All rights reserved.

  20. Altered left ventricular vortex ring formation by 4-dimensional flow magnetic resonance imaging after repair of atrioventricular septal defects.

    Science.gov (United States)

    Calkoen, Emmeline E; Elbaz, Mohammed S M; Westenberg, Jos J M; Kroft, Lucia J M; Hazekamp, Mark G; Roest, Arno A W; van der Geest, Rob J

    2015-11-01

    During normal left ventricular (LV) filling, a vortex ring structure is formed distal to the left atrioventricular valve (LAVV). Vortex structures contribute to efficient flow organization. We aimed to investigate whether LAVV abnormality in patients with a corrected atrioventricular septal defect (AVSD) has an impact on vortex ring formation. Whole-heart 4D flow MRI was performed in 32 patients (age: 26 ± 12 years), and 30 healthy subjects (age: 25 ± 14 years). Vortex ring cores were detected at peak early (E-peak) and peak late filling (A-peak). When present, the 3-dimensional position and orientation of the vortex ring was defined, and the circularity index was calculated. Through-plane flow over the LAVV, and the vortex formation time (VFT), were quantified to analyze the relationship of vortex flow with the inflow jet. Absence of a vortex ring during E-peak (healthy subjects 0%, vs patients 19%; P = .015), and A-peak (healthy subjects 10% vs patients 44%; P = .008) was more frequent in patients. In 4 patients, this was accompanied by a high VFT (5.1-7.8 vs 2.4 ± 0.6 in healthy subjects), and in another 2 patients with abnormal valve anatomy. In patients compared with controls, the vortex cores had a more-anterior and apical position, closer to the ventricular wall, with a more-elliptical shape and oblique orientation. The shape of the vortex core closely resembled the valve shape, and its orientation was related to the LV inflow direction. This study quantitatively shows the influence of abnormal LAVV and LV inflow on 3D vortex ring formation during LV inflow in patients with corrected AVSD, compared with healthy subjects. Copyright © 2015. Published by Elsevier Inc.