TDZ-induced plant regeneration in Astragalus cicer L. | Basalma ...
African Journals Online (AJOL)
We developed a regeneration protocol using thidiazuron (TDZ) with a high frequency in vitro root induction in Astragalus cicer. High in vitro germination ratio (75%) for hard-seeds of A. cicer was also achieved. For this, hypocotyl and cotyledon explants were cultured on Murashige and Skoog medium supplemented with ...
Gnat, Sebastian; Małek, Wanda; Oleńska, Ewa; Wdowiak-Wróbel, Sylwia; Kalita, Michał; Łotocka, Barbara; Wójcik, Magdalena
2015-01-01
The phylogeny of symbiotic genes of Astragalus glycyphyllos L. (liquorice milkvetch) nodule isolates was studied by comparative sequence analysis of nodA, nodC, nodH and nifH loci. In all these genes phylograms, liquorice milkvetch rhizobia (closely related to bacteria of three species, i.e. Mesorhizobium amorphae, Mesorhizobium septentrionale and Mesorhizobium ciceri) formed one clearly separate cluster suggesting the horizontal transfer of symbiotic genes from a single ancestor to the bacteria being studied. The high sequence similarity of the symbiotic genes of A. glycyphyllos rhizobia (99-100% in the case of nodAC and nifH genes, and 98-99% in the case of nodH one) points to the relatively recent (in evolutionary scale) lateral transfer of these genes. In the nodACH and nifH phylograms, A. glycyphyllos nodule isolates were grouped together with the genus Mesorhizobium species in one monophyletic clade, close to M. ciceri, Mesorhizobium opportunistum and Mesorhizobium australicum symbiovar biserrulae bacteria, which correlates with the close relationship of these rhizobia host plants. Plant tests revealed the narrow host range of A. glycyphyllos rhizobia. They formed effective symbiotic interactions with their native host (A. glycyphyllos) and Amorpha fruticosa but not with 11 other fabacean species. The nodules induced on A. glycyphyllos roots were indeterminate with apical, persistent meristem, an age gradient of nodule tissues and cortical vascular bundles. To reflect the symbiosis-adaptive phenotype of rhizobia, specific for A. glycyphyllos, we propose for these bacteria the new symbiovar "glycyphyllae", based on nodA and nodC genes sequences.
Ampomah, Osei Yaw; Mousavi, Seyed Abdollah; Lindström, Kristina; Huss-Danell, Kerstin
2017-01-01
Rhizobia nodulating native Astragalus and Oxytropis spp. in Northern Europe are not well-studied. In this study, we isolated bacteria from nodules of four Astragalus spp. and two Oxytropis spp. from the arctic and subarctic regions of Sweden and Russia. The phylogenetic analyses were performed by using sequences of three housekeeping genes (16S rRNA, rpoB and recA) and two accessory genes (nodC and nifH). The results of our multilocus sequence analysis (MLSA) of the three housekeeping genes tree showed that all the 13 isolates belonged to the genus Mesorhizobium and were positioned in six clades. Our concatenated housekeeping gene tree also suggested that the isolates nodulating Astragalus inopinatus, Astragalus frigidus, Astragalus alpinus ssp. alpinus and Oxytropis revoluta might be designated as four new Mesorhizobium species. The 13 isolates were grouped in three clades in the nodC and nifH trees. 15 N analysis suggested that the legumes in association with these isolates were actively fixing nitrogen. Copyright © 2016 Elsevier GmbH. All rights reserved.
Paola Leonetti; Gian Paolo Accotto; Moemen S. Hanafy; Vitantonio Pantaleo
2018-01-01
Cicer arietinum L. (chickpea) is the world's fourth most widely grown pulse. Chickpea seeds are a primary source of dietary protein for humans, and chickpea cultivation contributes to biological nitrogen fixation in the soil, given its symbiotic relationship with rhizobia. Therefore, chickpea cultivation plays a pivotal role in innovative sustainable models of agro-ecosystems inserted in crop rotation in arid and semi-arid environments for soil improvement and the reduction of chemical inputs...
Comparative efficiency of chemical and radiation mutagens on two Cicer arietinum Rhizobial strains
Energy Technology Data Exchange (ETDEWEB)
Khare, A K; Shinde, D A; Nayak, M L [Jawaharlal Nehru Krishi Vishwa Vidyalaya, Indore (India)
1982-03-01
A comparison of efficacy due to chemical and radiation mutagens on morphology, nutritional totipotence and symbiotic character of two Cicer arietinum rhizobia has been made. The mutants produced as a result of radiations (gamma and UV rays) differed from parents in that, the mutant colony size was bigger and gelatinase activity was higher. The mutants were not deficient nutritionally, had wider host range and the size and number of nodules produced were higher. Radiation mutagenic effects were more pronounced than chemical mutagens. The mutants derived from chemicals were not as efficient as radiation mutants although they were better than parents in total nodulation.
Armas-Capote, Natalia; Pérez-Yépez, Juan; Martínez-Hidalgo, Pilar; Garzón-Machado, Víctor; Del Arco-Aguilar, Marcelino; Velázquez, Encarna; León-Barrios, Milagros
2014-03-01
Cicer canariense is a threatened perennial wild chickpea endemic to the Canary Islands. In this study, rhizobia that nodulate this species in its natural habitats on La Palma (Canary Islands) were characterised. The genetic diversity and phylogeny were estimated by RAPD profiles, 16S-RFLP analysis and sequencing of the rrs, recA, glnII and nodC genes. 16S-RFLP grouped the isolates within the Mesorhizobium genus and distinguished nine different ribotypes. Four branches included minority ribotypes (3-5 isolates), whereas another five contained the predominant ribotypes that clustered with reference strains of M. tianshanense/M. gobiense/M. metallidurans, M. caraganae, M. opportunistum, M. ciceri and M. tamadayense. The sequences confirmed the RFLP groupings but resolved additional internal divergence within the M. caraganae group and outlined several potential novel species. The RAPD profiles showed a high diversity at the infraspecific level, except in the M. ciceri group. The nodC phylogeny resolved three symbiotic lineages. A small group of isolates had sequences identical to those of symbiovar ciceri and were only detected in M. ciceri isolates. Another group of sequences represented a novel symbiotic lineage that was associated with two particular chromosomal backgrounds. However, nodC sequences closely related to symbiovar loti predominated in most isolates, and they were detected in several chromosomal backgrounds corresponding to up to nine Mesorhizobium lineages. The results indicated that C. canariense is a promiscuous legume that can be nodulated by several rhizobial species and symbiotypes, which means it will be important to determine the combination of core and symbiotic genes that produce the most effective symbiosis. Copyright © 2013 Elsevier GmbH. All rights reserved.
International Nuclear Information System (INIS)
Noreen, R.; Shafique, A.; Haque, S.E.; Ali, S.A.
2016-01-01
Three isolates each of fluorescent Pseudomonas (NAFP-19, NAFP-31 and NAFP-32) and rhizobia (NFB- 103, NFB-107 and NFB-109) which were originally isolated from root nodules of mungbean (Vigna radiata) showed significant biocontrol activity in the screen house and under field condition, against root rotting fungi viz., Macrophomina phaseolina, Fusarium solani, F. oxysporum and Rhizoctonia solani evaluated on chickpea. Biocontrol potential of these isolates was also evaluated against Meloidogyne incognita, the root knot nematode. Application of Pseudomonas and rhizobial isolates as a soil drench, separately or mixed significantly reduced root rot disease under screen house and field conditions. Nematode penetration in roots was also found significantly less in rhizobia or Pseudomonas treatments used separately or mixed as compared to control. Fluorescent Pseudomonas treated plants produced greater number of nodules per plant than control plants and about equal to rhizobia treated plants, indicating that root nodule associated fluorescent Pseudomonas enhance root nodulation. (author)
1985-09-01
bitterbrush Purshia glandulosa Apache plume Fallugia paradoxa Arizona fesce Festuca arizonica Ashe juniper Juniperus ashei Australian saltbush Atriplex...elm Ulmus crassifolia *Cheatgrass Bromus tectorum -Chinkapin oak Quercus muhlenbergii Cholla Opuntia, spp. * Cicer milkvetch Astragalus cicer Clovers...Linum lewisii Little bluestem Schizachyrium scoparium *Littleleaf palo verde Cercidium microphyllum *Live oak Quercus virginiana Lovegrasses Eragrostis
How legumes recognize rhizobia.
Via, Virginia Dalla; Zanetti, María Eugenia; Blanco, Flavio
2016-01-01
Legume plants have developed the capacity to establish symbiotic interactions with soil bacteria (known as rhizobia) that can convert N2 to molecular forms that are incorporated into the plant metabolism. The first step of this relationship is the recognition of bacteria by the plant, which allows to distinguish potentially harmful species from symbiotic partners. The main molecular determinant of this symbiotic interaction is the Nod Factor, a diffusible lipochitooligosaccharide molecule produced by rhizobia and perceived by LysM receptor kinases; however, other important molecules involved in the specific recognition have emerged over the years. Secreted exopolysaccharides and the lipopolysaccharides present in the bacterial cell wall have been proposed to act as signaling molecules, triggering the expression of specific genes related to the symbiotic process. In this review we will briefly discuss how transcriptomic analysis are helping to understand how multiple signaling pathways, triggered by the perception of different molecules produced by rhizobia, control the genetic programs of root nodule organogenesis and bacterial infection. This knowledge can help to understand how legumes have evolved to recognize and establish complex ecological relationships with particular species and strains of rhizobia, adjusting gene expression in response to identity determinants of bacteria.
Integrated management of Fusarium wilt of chickpea (Cicer ...
African Journals Online (AJOL)
user
2013-07-17
Jul 17, 2013 ... Key words: Integrated management, Fusarium wilt, Fusarium oxysporum f. sp. ciceris, chickpea (Cicer arietinum L.), antagonists, botanicals, fungicides. INTRODUCTION. Chickpea (Cicer arietinum L.) is a vital source of plant- derived edible protein in many countries. Chickpea also has advantages in the ...
A Review of Recent Research Progress on the Astragalus Genus
Directory of Open Access Journals (Sweden)
Xiaoxia Li
2014-11-01
Full Text Available Astragalus L., is one of the largest genuses of flowering plants in the Leguminosae family. Roots of A. membranaceus Bge. var. mongholicus (Bge. Hsiao, A. membranaceus (Fisch. Bge. and its processed products are listed in the China Pharmacopeia for “qi deficiency” syndrome treatment. However, more and more researches on other species of Astragalus have been conducted recently. We summarize the recent researches of Astragalus species in phytochemistry and pharmacology. More than 200 constituents, including saponins and flavonoids, obtained from 46 species of Astragalus genus were collected for this article. In pharmacological studies, crude extracts of Astragalus, as well as isolated constituents showed anti-inflammatory, immunostimulant, antioxidative, anti-cancer, antidiabetic, cardioprotective, hepatoprotective, and antiviral activities. The goal of this article is to provide an overview of chemical and pharmacological studies on the Astragalus species over the last 10 years, which could be of value to new drug or food supplement research and development.
Gnat, Sebastian; Małek, Wanda; Oleńska, Ewa; Trościańczyk, Aleksandra; Wdowiak-Wróbel, Sylwia; Kalita, Michał; Wójcik, Magdalena
2015-11-01
We assessed the genomic diversity and genomic relationship of 28 Astragalus glycyphyllos symbionts by three methodologies based on PCR reaction, i.e., RAPD, ERIC-PCR, and AFLP. The AFLP method with one PstI restriction enzyme and selective PstI-GC primer pair had a comparable discriminatory power as ERIC-PCR one and these fingerprinting techniques distinguished among the studied 28 A. glycyphyllos symbionts 18 and 17 genomotypes, respectively. RAPD method was less discriminatory in the genomotyping of rhizobia analyzed and it efficiently resolved nine genomotypes. The cluster analysis of RAPD, ERIC-PCR, and AFLP profiles resulted in a generally similar grouping of the test strains on generated dendrograms supporting a great potential of these DNA fingerprinting techniques for study of genomic polymorphism and evolutionary relationship of A. glycyphyllos nodulators. The RAPD, ERIC-PCR, and AFLP pattern similarity coefficients between A. glycyphyllos symbionts studied was in the ranges 8-100, 18-100, and 23-100%, respectively.
Astragalus Injection for Hypertensive Renal Damage: A Systematic Review
Directory of Open Access Journals (Sweden)
Tian Sun
2012-01-01
Full Text Available Objective. To evaluate the effectiveness of astragalus injection (a traditional Chinese patent medicine for patients with renal damage induced by hypertension according to the available evidence. Methods. We searched MEDLINE, China National Knowledge Infrastructure (CNKI, Chinese VIP Information, China Biology Medicine (CBM, and Chinese Medical Citation Index (CMCI, and the date of search starts from the first of database to August 2011. No language restriction was applied. We included randomized controlled trials testing astragalus injection against placebo or astragalus injection plus antihypertensive drugs against antihypertensive drugs. Study selection, data extraction, quality assessment, and data analyses were conducted according to the Cochrane review standards. Results. 5 randomized trials (involving 429 patients were included and the methodological quality was evaluated as generally low. The pooled results showed that astragalus injection was more effective in lowering β2-microglobulin (β2-MG, microalbuminuria (mAlb compared with placebo, and it was also superior to prostaglandin in lowering blood urea nitrogen (BUN, creatinine clearance rate (Ccr. There were no adverse effects reported in the trials from astragalus injection. Conclusions. Astragalus injection showed protective effects in hypertensive renal damage patients, although available studies are not adequate to draw a definite conclusion due to low quality of included trials. More rigorous clinical trials with high quality are warranted to give high level of evidence.
Phytoremediation of heavy and transition metals aided by legume-rhizobia symbiosis
DEFF Research Database (Denmark)
Hao, X.; Taghavi, S.; Xie, P.
2014-01-01
Legumes are important for nitrogen cycling in the environment and agriculture due to the ability of nitrogen fixation by rhizobia. In this review, we introduce an important and potential role of legume-rhizobia symbiosis in aiding phytoremediation of some metal contaminated soils as various legumes...... have been found to be the dominant plant species in metal contaminated areas. Resistant rhizobia used for phytoremediation could act on metals directly by chelation, precipitation, transformation, biosorption and accumulation. Moreover, the plant growth promoting (PGP) traits of rhizobia including...... is not clear. Therefore, to obtain the maximum benefits from legumes assisted by rhizobia for phytoremediation of metals, it is critical to have a good understanding of interactions between PGP traits, the symbiotic plant-rhizobia relationship and metals....
Secondary metabolites from the roots of Astragalus maximus
Directory of Open Access Journals (Sweden)
J. Ghasemian-Yadegari
2017-04-01
Full Text Available Background and objectives: Astragalus is one of the most abundant genera of flowering plants in Iran. There are a few reports on phytochemical investigation of this valuable genus. Saponins, flavonoids and polysaccharides have been reported as the most important metabolites in Astragalus species. In the present research, we aimed to identify the foremost constituents of Astragalus maximus. Method: Phytochemical analysis of the ethyl acetate (EtOAc fraction of Astragalus maximus roots was performed using different methods of chromatography such as HPLC, SPE and preparative TLC. The structures of the isolated compounds were elucidated on the basis of extensive spectral evidence from 1D and 2D NMR including DQF-COSY, HSQC, HMBC, and DEPT, in comparison with reported values in the literature. Results: Analysis of the extract yielded three flavonoids namely liquiritigenin, formononetin, isoquercitrin and one acylated cycloartane-type saponin, astragaloside I. Conclusion: According to the results of our study, cycloartane-type saponin and flavonoids were the important metabolites in A. maximus.
Zhang, Xin-Hui; Lang, Duo-Yong; Chen, Jing; Zhao, Yun-Sheng; Wu, Xiu-Li; Fu, Xue-Yan
2014-02-01
To exploring the relationship between continuous cropping obstacle and autotoxicity of Astragalus membranaceus var. mongholicus, autotoxic effect of plant aqueous extract were determined. Distilled water (CK), aqueous extract of plant, including root, stem and leaf (12.5, 25, 50 and 100 mg/mL respectively)were applied to testing their effect on early growth of Astragalus membranaceus var. mongholicus. Specifically, seed germination rate, germination index, emergence rate, elongation of radical and embryo, and seedling vigor index were determined. The aqueous extract of root, stem, and leaf at 25 mg/mL significantly inhibited the seed germination and seedling growth of Astragalus membranaceus var. mongholicus, and this inhibitory effect generally increased with the increase of the concentration of aqueous extracts. To the comprehensive allelopathic effect, the extracts from Astragalus membranaceus var. mongholicus stem were more inhibitory than those from leaf and root. The germination index and seedling vigor index were more sensitive to extract than other determined parameters. Aqueous extracts from Astragalus membranaceus var. mongholicus plant gave inhibitory effects on Astragalus. membranaceus var. mongholicus germination and seedling growth, and this inhibitory effect generally increased with the increases of aqueous extract concentration at a certain ranges. In conclusion, there is an autotoxicity in continuous cropping of Astragalus membranaceus var. mongholicus.
Trade, Diplomacy, and Warfare: The Quest for Elite Rhizobia Inoculant Strains
Directory of Open Access Journals (Sweden)
Alice Checcucci
2017-11-01
Full Text Available Rhizobia form symbiotic nitrogen-fixing nodules on leguminous plants, which provides an important source of fixed nitrogen input into the soil ecosystem. The improvement of symbiotic nitrogen fixation is one of the main challenges facing agriculture research. Doing so will reduce the usage of chemical nitrogen fertilizer, contributing to the development of sustainable agriculture practices to deal with the increasing global human population. Sociomicrobiological studies of rhizobia have become a model for the study of the evolution of mutualistic interactions. The exploitation of the wide range of social interactions rhizobia establish among themselves, with the soil and root microbiota, and with the host plant, could constitute a great advantage in the development of a new generation of highly effective rhizobia inoculants. Here, we provide a brief overview of the current knowledge on three main aspects of rhizobia interaction: trade of fixed nitrogen with the plant; diplomacy in terms of communication and possible synergistic effects; and warfare, as antagonism and plant control over symbiosis. Then, we propose new areas of investigation and the selection of strains based on the combination of the genetic determinants for the relevant rhizobia symbiotic behavioral phenotypes.
Number and Effectiveness of Pea Rhizobia in Danish Soils
DEFF Research Database (Denmark)
Engvild, K.C.
1989-01-01
Most of 44 Danish soils tested contain between 1000 and 10 000 pea rhizobia (Rhizobium leguminosarum biovar viceae) per gram. Pea rhizobia were not detected in acid moor and forest soils. Only one case of failed nodulation in peas in the field has been noted, in spots in a reclaimed sandy heath m...
Evolution and homology of the astragalus in early amniotes: new fossils, new perspectives.
O'Keefe, F Robin; Sidor, Christian A; Larsson, Hans C E; Maga, Abdoudaye; Ide, Oumarou
2006-04-01
The reorganization of the ankle in basal amniotes has long been considered a key innovation allowing the evolution of more terrestrial and cursorial behavior. Understanding how this key innovation arose is a complex problem that largely concerns the homologizing of the amniote astragalus with the various ossifications in the anamniote tarsus. Over the last century, several hypotheses have been advanced homologizing the amniote astragalus with the many ossifications in the ankle of amphibian-grade tetrapods. There is an emerging consensus that the amniote astragalus is a complex structure emerging via the co-ossification of several originally separate elements, but the identities of these elements remain unclear. Here we present new fossil evidence bearing on this contentious question. A poorly ossified, juvenile astragalus of the large captorhinid Moradisaurus grandis shows clear evidence of four ossification centers, rather than of three centers or one center as posited in previous models of astragalus homology. Comparative material of the captorhinid Captorhinikos chozaensis is also interpretable as demonstrating four ossification centers. A new, four-center model for the homology of the amniote astragalus is advanced, and is discussed in the context of the phylogeny of the Captorhinidae in an attempt to identify the developmental transitions responsible for the observed pattern of ossification within this clade. Lastly, the broader implications for amniote phylogeny are discussed, concluding that the neomorphic pattern of astragalus ossification seen in all extant reptiles (including turtles) arose within the clade Diapsida.
Effect of compounds astragalus extract and cysteamine on finishing pigs growth and protein turnover
International Nuclear Information System (INIS)
Wang Cheng; Wang Zhisheng; Zhou Anguo; Liu Guilian; Xue Bai
2008-01-01
32 PIC pigs, weighted 59.82±1.32 kg on average, were subjected randomly to 4 treatments for determining the effects of extrogenous metabolism-regulating agents on pig performance, protein turn-over and nitrogen retention by using isotope ( 15 N-Gly) technique and nitrogen balance trial. The 4 treatments were: (1) basal diet; (2) basal diet plus cysteamine (70mg/kg, CS group); (3) basal diet plus non-stable astragalus extracts 250mg/kg (NCAE group); (4) basal diet plus stably astragalus extracts 250mg/kg (CAE group). Astragalus extracts and cysteamine, especially NCAE, redounded to increase pig performance, especially increase average day gain (P<0.05). Both astragalus extracts and cysteamine accelerated protein aggradation rate and amino acid utilization rate, as well as biological value. Astragalus extracts helped to accelerate the synthesis rate of amino acid into body protein and reduce the excretion rate of endogenous urine nitrogen. The mechanism of increasing protein deposition of cysteamine is reducing body protein degradation rate (26.71% reduction, compared to control group), while that of astragalus extracts is bilateral, reducing protein degradation rate (24.84% and 3.66% reduction for NCAE and CAE) and accelerating protein synthesis rate (22.86% and 19.18% increase for NCAE and CAE). Both astragalus extracts and cysteamine contributed the increasing nitrogen retention, net nitrogen utilization and biological value. (authors)
Diversity and numbers of root-nodule bacteria (rhizobia in Polish soils
Directory of Open Access Journals (Sweden)
Stefan Martyniuk
2011-01-01
Full Text Available Using a sand pouch-plant infection method, populations of several species of root-nodule bacteria (rhizobia were enumerated in eighty soils collected throughout Poland. Rhizobium leguminosarum bv. viciae (symbionts of pea, faba bean, vetch and R. leguminosarum bv. trifolii (symbionts of clover were detected in 77 and 76 soils, respectively. Most of these soils contained moderate and high numbers of these species of the rhizobia. Symbionts of beans, R. leguminosarum bv. phaseoli, were assessed in 76 soils; of this number 15 soils had no detectable populations of bean rhizobia and in 40 soils high or moderate numbers of these bacteria were found. Bradyrhizobium sp. (Lupinus, root-nodule bacteria of lupine and serradella, were absent in 19 soils, out of 80 tested, and 34 soils were colonised by high or moderate populations of bradyrhizobia. Sinorhizobium meliloti, rhizobia nodulating alfalfa, were sparse in the examined soils; with 56 soil containing no detectable numbers of S. meliloti and only 6 soils harbouring high or moderate populations of this species. The estimated numbers of the rhizobia in the studied soils were also related to some physical and chemical properties of these soils.
International Nuclear Information System (INIS)
Abdel Raouf, A.M.N
2010-01-01
The present work aimed at utilization of wastelands and improving their fertility status through the following topics:1- Isolation and identification of rhizobia from wastelands, then selecting the most resistant isolate to saline conditions.2- Studying the effect of radiation on the most salt tolerant rhizobia and marketing rhizobia using molecular and microbiological techniques.3- Identification and culturing of selected compatible rhizobia to be used in application experiments as a bio fertilizer to inoculate the leguminous crops in order to improve the efficiency of the Rhizobium-legume symbiosis and reclamation of wastelands.4- Application of molecular and nuclear techniques such 16S ribosomal RNA and studying the sequence for these strains for comparison between the most potent rhizobia.5- Determination of protein profile for the most potent rhizobia to throw light about similarities between these strains.6- Attempts to apply polymerase chain reaction (PCR) and use primers for differentiation between the most potent rhizobia.7- Experimental fields for growing some leguminous plants inoculated with irradiated and non-irradiated rhizobia and irrigated with different concentrations of sea water and their effects on growth and total N content of plants.
Functional Genomics Approaches to Studying Symbioses between Legumes and Nitrogen-Fixing Rhizobia.
Lardi, Martina; Pessi, Gabriella
2018-05-18
Biological nitrogen fixation gives legumes a pronounced growth advantage in nitrogen-deprived soils and is of considerable ecological and economic interest. In exchange for reduced atmospheric nitrogen, typically given to the plant in the form of amides or ureides, the legume provides nitrogen-fixing rhizobia with nutrients and highly specialised root structures called nodules. To elucidate the molecular basis underlying physiological adaptations on a genome-wide scale, functional genomics approaches, such as transcriptomics, proteomics, and metabolomics, have been used. This review presents an overview of the different functional genomics approaches that have been performed on rhizobial symbiosis, with a focus on studies investigating the molecular mechanisms used by the bacterial partner to interact with the legume. While rhizobia belonging to the alpha-proteobacterial group (alpha-rhizobia) have been well studied, few studies to date have investigated this process in beta-proteobacteria (beta-rhizobia).
Directory of Open Access Journals (Sweden)
Haifeng Li
2016-01-01
Full Text Available Astragalus membranaceus is a medicinal plant traditionally used in China for a variety of conditions, including inflammatory and neural diseases. Astragalus polysaccharides are shown to reduce the adverse effect of levodopa which is used to treat Parkinson’s disease (PD. However, the neuroprotective effect of Astragalus polysaccharides per se in PD is lacking. Using Caenorhabditis elegans models, we investigated the protective effect of astragalan, an acidic polysaccharide isolated from A. membranaceus, against the neurotoxicity of 6-hydroxydopamine (6-OHDA, a neurotoxin that can induce parkinsonism. We show that 6-OHDA is able to degenerate dopaminergic neurons and lead to the deficiency of food-sensing behavior and a shorter lifespan in C. elegans. Interestingly, these degenerative symptoms can be attenuated by astragalan treatment. Astragalan is also shown to alleviate oxidative stress through reducing reactive oxygen species level and malondialdehyde content and increasing superoxide dismutase and glutathione peroxidase activities and reduce the expression of proapoptotic gene egl-1 in 6-OHDA-intoxicated nematodes. Further studies reveal that astragalan is capable of elevating the decreased acetylcholinesterase activity induced by 6-OHDA. Together, our results demonstrate that the protective effect of astragalan against 6-OHDA neurotoxicity is likely due to the alleviation of oxidative stress and regulation of apoptosis pathway and cholinergic system and thus provide an important insight into the therapeutic potential of Astragalus polysaccharide in neurodegeneration.
Directory of Open Access Journals (Sweden)
Yassine MABROUK
2016-05-01
Full Text Available This study examined the capacity of Rhizobium sp. strain PchAZM to reduce parasitism of chickpea by Orobanche foetida under greenhouse conditions, and assessed the relative impact of rhizobia on the expression of chickpea defense response against broomrape. Growth chamber experiments using Petri dishes revealed that rhizobia infection on chickpea roots reduced broomrape seed germination, and restricted the broomrape attachment to host roots while retarding tubercle formation and development by the parasite. In pot experiments, chickpea roots inoculated with rhizobia reduced the total number of broomrape by up to 90%. Broomrape necrosis was observed both before and after parasite attachment to inoculated chickpea roots in Petri dishes and pot experiments. Reduction in infection was accompanied by enhanced levels of the defence-related enzymes phenylalanine ammonia lyase (PAL and peroxidase (POX. Increased levels of phenolics were recorded in the roots of rhizobia-inoculated plants grown in the presence of broomrape. The results suggest that rhizobia could be used for protection of chickpea against O. foetida.
Lang, Duo-yong; Fu, Xue-yan; Rong, Jia-wang; Zhang, Xin-hui
2015-01-01
To explore the relationship between continuous cropping obstacle and autotoxicity of Astragalus membranaceus var. mongholicus. Distilled water(CK), water extracts of rhizosphere soil(50, 100, 200 and 400 mg/mL) were applied to test their effect on early growth and physiological characteristics of Astragalus membranaceus var. mongholicus. The water extracts from rhizospher soil of cultivated Astragalus membranaceus var. mongholicus significantly increased seedling emergence rate, root length and vigor index of Astragalus membranaceus var. mongholicus seedling when at the concentration of 100 mg/mL or below, however,there was no significant effect at 200 mg/mL or higher. The water extracts from rhizosphere soil of cultivated Astragalus membranaceus var. mongholicus significantly reduced the SOD activity in Astragalus membranaceus var. mongholicus seedling at 400 mg/mL and POD activity at 200 mg/mL and 400 mg/mL,while significantly increased the MDA content. Water extracts from Astragalus membranaceus var. mongholicus rhizosphere soil significantly affected Astragalus membranaceus var. mongholicus germination and seedling growth in a concentration-dependent manner, generally, low concentrations increased the SOD and POD activity which improved seed germination and seedling growth, while high concentrations caused cell membrane damage of the seedling.
Evolutionary Dynamics of Nitrogen Fixation in the Legume–Rhizobia Symbiosis
Fujita, Hironori; Aoki, Seishiro; Kawaguchi, Masayoshi
2014-01-01
The stabilization of host–symbiont mutualism against the emergence of parasitic individuals is pivotal to the evolution of cooperation. One of the most famous symbioses occurs between legumes and their colonizing rhizobia, in which rhizobia extract nutrients (or benefits) from legume plants while supplying them with nitrogen resources produced by nitrogen fixation (or costs). Natural environments, however, are widely populated by ineffective rhizobia that extract benefits without paying costs and thus proliferate more efficiently than nitrogen-fixing cooperators. How and why this mutualism becomes stabilized and evolutionarily persists has been extensively discussed. To better understand the evolutionary dynamics of this symbiosis system, we construct a simple model based on the continuous snowdrift game with multiple interacting players. We investigate the model using adaptive dynamics and numerical simulations. We find that symbiotic evolution depends on the cost–benefit balance, and that cheaters widely emerge when the cost and benefit are similar in strength. In this scenario, the persistence of the symbiotic system is compatible with the presence of cheaters. This result suggests that the symbiotic relationship is robust to the emergence of cheaters, and may explain the prevalence of cheating rhizobia in nature. In addition, various stabilizing mechanisms, such as partner fidelity feedback, partner choice, and host sanction, can reinforce the symbiotic relationship by affecting the fitness of symbionts in various ways. This result suggests that the symbiotic relationship is cooperatively stabilized by various mechanisms. In addition, mixed nodule populations are thought to encourage cheater emergence, but our model predicts that, in certain situations, cheaters can disappear from such populations. These findings provide a theoretical basis of the evolutionary dynamics of legume–rhizobia symbioses, which is extendable to other single-host, multiple
Rhizobia and their bio-partners as novel drivers for functional remediation in contaminated soils.
Teng, Ying; Wang, Xiaomi; Li, Lina; Li, Zhengao; Luo, Yongming
2015-01-01
Environmental pollutants have received considerable attention due to their serious effects on human health. There are physical, chemical, and biological means to remediate pollution; among them, bioremediation has become increasingly popular. The nitrogen-fixing rhizobia are widely distributed in the soil and root ecosystems and can increase legume growth and production by supplying nitrogen, resulting in the reduced need for fertilizer applications. Rhizobia also possess the biochemical and ecological capacity to degrade organic pollutants and are resistant to heavy metals, making them useful for rehabilitating contaminated soils. Moreover, rhizobia stimulate the survival and action of other biodegrading bacteria, thereby lowering the concentration of pollutants. The synergistic action of multiple rhizobial strains enhances both plant growth and the availability of pollutants ranging from heavy metals to persistent organic pollutants. Because phytoremediation has some restrictions, the beneficial interaction between plants and rhizobia provides a promising option for remediation. This review describes recent advances in the exploitation of rhizobia for the rehabilitation of contaminated soil and the biochemical and molecular mechanisms involved, thereby promoting further development of this novel bioremediation strategy into a widely accepted technique.
Zhang, He-ting; Wang, Jian; Cheng, Ming-en; Duan, Hai-yan; Peng, Hua-sheng
2015-12-01
To investigate the main cultivation areas of Astragalus membranaceus var. mongholicus, and to clarify its present cultivation status and commercial specification grades. Astragalus membranaceus var. mongholicus cultivated in Hunyuan and Ying County of Shanxi, Longxi, Weiyuan and Min County of Gansu and Wuchuan, Guyang and Chifeng of Inner Mongolia were investigated, including their ecological environment, cultivation history and present situation, harvesting and processing as well as commercial specification grades. The cultivation methods of Astragalus membranaceus var. mongholicus changed greatly in the main cultivation areas. In Gansu and Inner Mongolia, the current major cultivation method was 2 - 3 years of seedling transplantation method, while the 3 - 5 years of seed-directly-sowed method in Inner Mongolia had been almost abandoned, and the 6 - 8 years of mountain direct seeding method was still in application in Hunyuan county of Shanxi province. On the other hand, the harvest method of Astragalus membranaceus var. mongholicus had been gradually changed from manual harvesting in ancient times to the current mechanical harvesting although the latter method did more damage to environment of cultivation areas and the resource of Astragalus membranaceus var. mongholicus in regions Hunyuan county of Shanxi. Through investigating the processing methods of Astragalus membranaceus var. mongholicus in different cultivation areas, it was found that processing method varied from area to area, and no unified specifications had been formulated on processing methods in market. In addition, the current processing method was too complicated in processing the slices of prepared Astragali Radix and most were self processing by farmers themselves, creating market disorders. Moreover, the Astragali Radix products were basically without grading classification but sold as bulk cargo. It is urgent to unify the specifications and grades of Astragali Radix product, and standardize
Rhizobia and their bio-partners as novel drivers for functional remediation in contaminated soils
Teng, Ying; Wang, Xiaomi; Li, Lina; Li, Zhengao; Luo, Yongming
2015-01-01
Environmental pollutants have received considerable attention due to their serious effects on human health. There are physical, chemical, and biological means to remediate pollution; among them, bioremediation has become increasingly popular. The nitrogen-fixing rhizobia are widely distributed in the soil and root ecosystems and can increase legume growth and production by supplying nitrogen, resulting in the reduced need for fertilizer applications. Rhizobia also possess the biochemical and ecological capacity to degrade organic pollutants and are resistant to heavy metals, making them useful for rehabilitating contaminated soils. Moreover, rhizobia stimulate the survival and action of other biodegrading bacteria, thereby lowering the concentration of pollutants. The synergistic action of multiple rhizobial strains enhances both plant growth and the availability of pollutants ranging from heavy metals to persistent organic pollutants. Because phytoremediation has some restrictions, the beneficial interaction between plants and rhizobia provides a promising option for remediation. This review describes recent advances in the exploitation of rhizobia for the rehabilitation of contaminated soil and the biochemical and molecular mechanisms involved, thereby promoting further development of this novel bioremediation strategy into a widely accepted technique. PMID:25699064
Rhizobia and their bio-partners as novel drivers for functional remediation in contaminated soils
Directory of Open Access Journals (Sweden)
Ying eTeng
2015-02-01
Full Text Available Environmental pollutants have received considerable attention due to their serious effects on human health. There are physical, chemical, and biological means to remediate pollution; among them, bioremediation has become increasingly popular. The nitrogen-fixing rhizobia are widely distributed in the soil and root ecosystems and can increase legume growth and production by supplying nitrogen, resulting in the reduced need for fertilizer applications. Rhizobia also possess the biochemical and ecological capacity to degrade organic pollutants and are resistant to heavy metals, making them useful for rehabilitating contaminated soils. Moreover, rhizobia stimulate the survival and action of other biodegrading bacteria, thereby lowering the concentration of pollutants. The synergistic action of multiple rhizobial strains enhances both plant growth and the availability of pollutants ranging from heavy metals to persistent organic pollutants. Because phytoremediation has some restrictions, the beneficial interaction between plants and rhizobia provides a promising option for remediation. This review describes recent advances in the exploitation of rhizobia for the rehabilitation of contaminated soil and the biochemical and molecular mechanisms involved, thereby promoting further development of this novel bioremediation strategy into a widely accepted technique.
Astragalus L. (Fabaceae) is an enormous and diverse plant genus with a cosmopolitan distribution, but relatively few breeding biologies are known for its member species. Threadstalk (or basalt) milkvetch, Astragalus filipes Torrey ex. A. Gray, is common and widespread throughout the US Intermountai...
Astragalus friederikeanus Kit Tan & Zeitlinger (Fabaceae), a new species from south Anatolia, Turkey
DEFF Research Database (Denmark)
Tan, Kit; Zeitlinger, Jörg
2007-01-01
A new species from south Anatolia, Turkey, Astragalus friederikeanus Kit Tan & Zeitlinger (Fabaceae), is described and illustrated. The diagnostic morphological characters separating it from other members of sect. Onobrychium Boiss. are listed.......A new species from south Anatolia, Turkey, Astragalus friederikeanus Kit Tan & Zeitlinger (Fabaceae), is described and illustrated. The diagnostic morphological characters separating it from other members of sect. Onobrychium Boiss. are listed....
Analysis of genetic diversity in chickpea ( Cicer arietinum L ...
African Journals Online (AJOL)
Genetic diversity of seven chickpea (Cicer arietinum L.) cultivars of Pakistani origin ... effective method to determine the variations among the chickpea cultivars. ... to broaden the germplasm base in the future for chickpea breeding programs.
Genetic Diversity and Symbiotic Efficiency of Indigenous Common Bean Rhizobia in Croatia
Directory of Open Access Journals (Sweden)
Ines Pohajda
2016-01-01
Full Text Available Nodule bacteria (rhizobia in symbiotic associations with legumes enable considerable entries of biologically fixed nitrogen into soil. Efforts are therefore made to intensify the natural process of symbiotic nitrogen fixation by legume inoculation. Studies of field populationsof rhizobia open up the possibility to preserve and probably exploit some indigenous strains with hidden symbiotic or ecological potentials. The main aim of the present study is to determine genetic diversity of common bean rhizobia isolated from different field sites in central Croatia and to evaluate their symbiotic efficiency and compatibility with host plants. The isolation procedure revealed that most soil samples contained no indigenous common bean rhizobia. The results indicate that the cropping history had a significant impact on the presence of indigenous strains. Although all isolates were found to belong to species Rhizobium leguminosarum, significant genetic diversity at the strain level was determined. Application of both random amplifi cation of polymorphic DNA (RAPD and enterobacterial repetitive intergenic consensus–polymerase chain reaction (ERIC-PCR methods resulted in similar grouping of strains. Symbiotic efficiency of indigenous rhizobia as well as their compatibility with two commonly grown bean varieties were tested in field experiments. Application of indigenous rhizobial strains as inoculants resulted in significantly different values of nodulation, seed yield as well as plant nitrogen and seed protein contents. The most abundant nodulation and the highest plant nitrogen and protein contents were determined in plants inoculated with R. leguminosarum strains S17/2 and S21/6. Although, in general, the inoculation had a positive impact on seed yield, differences depending on the applied strain were not determined. The overall results show the high degree of symbiotic efficiency of the specific indigenous strain S21/6. These results indicate different
Genetic Diversity and Symbiotic Efficiency of Indigenous Common Bean Rhizobia in Croatia.
Pohajda, Ines; Babić, Katarina Huić; Rajnović, Ivana; Kajić, Sanja; Sikora, Sanja
2016-12-01
Nodule bacteria (rhizobia) in symbiotic associations with legumes enable considerable entries of biologically fixed nitrogen into soil. Efforts are therefore made to intensify the natural process of symbiotic nitrogen fixation by legume inoculation. Studies of field populations of rhizobia open up the possibility to preserve and probably exploit some indigenous strains with hidden symbiotic or ecological potentials. The main aim of the present study is to determine genetic diversity of common bean rhizobia isolated from different field sites in central Croatia and to evaluate their symbiotic efficiency and compatibility with host plants. The isolation procedure revealed that most soil samples contained no indigenous common bean rhizobia. The results indicate that the cropping history had a significant impact on the presence of indigenous strains. Although all isolates were found to belong to species Rhizobium leguminosarum , significant genetic diversity at the strain level was determined. Application of both random amplification of polymorphic DNA (RAPD) and enterobacterial repetitive intergenic consensus-polymerase chain reaction (ERIC- -PCR) methods resulted in similar grouping of strains. Symbiotic efficiency of indigenous rhizobia as well as their compatibility with two commonly grown bean varieties were tested in field experiments. Application of indigenous rhizobial strains as inoculants resulted in significantly different values of nodulation, seed yield as well as plant nitrogen and seed protein contents. The most abundant nodulation and the highest plant nitrogen and protein contents were determined in plants inoculated with R. leguminosarum strains S 17/2 and S 21/6 . Although, in general, the inoculation had a positive impact on seed yield, differences depending on the applied strain were not determined. The overall results show the high degree of symbiotic efficiency of the specific indigenous strain S 21/6 . These results indicate different symbiotic
Symbiotic effectiveness of pea-rhizobia associations and the ...
African Journals Online (AJOL)
微软用户
2011-05-02
May 2, 2011 ... cultivar interactions on nodule and shoot biomass or N acquisition have been ... pea–rhizobia associations in two different soil types. Materials and ...... of Rawalakot Azad Jammu and Kashmir, Pakistan. Afr. J. Biotechnol.
Maesen, van der L.J.G.
1972-01-01
1. The history of the chickpea or gram, Cicer arietinum L., has been described from Homer's time and the earliest finds, 5450 B.C. in Hacilar, Turkey, up to the present day. The crop was first domesticated in Asia Minor and was introduced in IndiaSu, Guobin; Chen, Xiankun; Liu, Zhuangzhu; Yang, Lihong; Zhang, La; Stålsby Lundborg, Cecilia; Wen, Zehuai; Guo, Xinfeng; Qin, Xindong; Liang, Jueyao; Liu, Xusheng
2016-12-01
Acute respiratory tract infections (ARTIs) are common in children and can involve both upper and lower airways. Many children experience frequent ARTI episodes or recurrent respiratory tract infections (RRTIs) in early life, which creates challenges for paediatricians, primary care physicians, parents and carers of children.In China, Astragalus (Huang qi), alone or in combination with other herbs, is used by Traditional Chinese Medicine (TCM) practitioners in the form of a water extract, to reduce the risk of ARTIs; it is believed to stimulate the immune system. Better understanding of the therapeutic mechanisms of Astragalus may provide insights into ARTI prevention, and consequently reduced antibiotic use. To assess the effectiveness and safety of oral Astragalus for preventing frequent episodes of acute respiratory tract infections (ARTIs) in children in community settings. We searched the Cochrane Central Register of Controlled Trials (CENTRAL, Issue 12, 2015), MEDLINE (Ovid) (1946 to 31 December 2015), Embase (Elsevier) (1974 to 31 December 2015), AMED (Ovid) (1985 to 31 December 2015), Chinese National Knowledge Infrastructure (CNKI) (1979 to 31 December 2015) and Chinese Scientific Journals full text database (CQVIP) (1989 to 31 December 2015), China Biology Medicine disc (CBM 1976 to 31 December 2015) and Wanfang Data Knowledge Service Platform (WanFang) (1998 to 31 December 2015). We included randomised controlled trials (RCTs) comparing oral Astragalus as a sole Chinese herbal preparation with placebo to prevent frequent episodes of ARTIs in children. We used standard Cochrane methodological procedures for this review. We assessed search results to identify relevant studies. We planned to extract data using standardised forms. Disagreements were to be resolved through discussion. Risk of bias was to be assessed using the Cochrane 'Risk of bias' tool. We planned to use mean difference (MD) or standardised mean difference (SMD) for continuous data and risk
Selenium hyperaccumulation by Astragalus (Fabaceae) does not inhibit root nodule symbiosis.
Alford, Elan R; Pilon-Smits, Elizabeth A H; Fakra, Sirine C; Paschke, Mark W
2012-12-01
A survey of the root-nodule symbiosis in Astragalus and its interaction with selenium (Se) has not been conducted before. Such studies can provide insight into how edaphic conditions modify symbiotic interactions and influence partner coevolution. In this paper plant-organ Se concentration ([Se]) was investigated to assess potential Se exposure to endophytes. • Selenium distribution and molecular speciation of root nodules from Se-hyperaccumulators Astragalus bisulcatus, A. praelongus, and A. racemosus was determined by Se K-edge x-ray absorption spectroscopy. A series of greenhouse experiments were conducted to characterize the response of root-nodule symbiosis in Se-hyperaccumulators and nonhyperaccumulators. • Nodules in three Se-hyperaccumulators (Astragalus crotalariae, A. praelongus, and A. preussii) are reported for the first time. Leaves, flowers, and fruits from Se-hyperaccumulators were routinely above the hyperaccumulator threshold (1,000 µg Se g(-1) DW), but root samples rarely contained that amount, and nodules never exceeded 110 µg Se g(-1) DW. Nodules from A. bisulcatus, A. praelongus, and A. racemosus had Se throughout, with a majority stored in C-Se-C form. Finally, an evaluation of nodulation in Se-hyperaccumulators and nonhyperaccumulators indicated that there was no nodulation inhibition because of plant Se tolerance. Rather, we found that in Se-hyperaccumulators higher levels of Se treatment (up to 100 µM Se) corresponded with higher nodule counts, indicating a potential role for dinitrogen fixation in Se-hyperaccumulation. The effect was not found in nonhyperaccumulators. • As the evolution of Se hyperaccumulation in Astragalus developed, root-nodule symbiosis may have played an integral role.
Saha, Sudip; Dutta, Ayan; Bhattacharya, Avisek; DasGupta, Maitrayee
2014-01-01
Symbiosis Receptor Kinase (SYMRK), a member of the Nod factor signaling pathway, is indispensible for both nodule organogenesis and intracellular colonization of symbionts in rhizobia-legume symbiosis. Here, we show that the intracellular kinase domain of a SYMRK (SYMRK-kd) but not its inactive or full-length version leads to hyperactivation of the nodule organogenic program in Medicago truncatula TR25 (symrk knockout mutant) in the absence of rhizobia. Spontaneous nodulation in TR25/SYMRK-kd was 6-fold higher than rhizobia-induced nodulation in TR25/SYMRK roots. The merged clusters of spontaneous nodules indicated that TR25 roots in the presence of SYMRK-kd have overcome the control over both nodule numbers and their spatial position. In the presence of rhizobia, SYMRK-kd could rescue the epidermal infection processes in TR25, but colonization of symbionts in the nodule interior was significantly compromised. In summary, ligand-independent deregulated activation of SYMRK hyperactivates nodule organogenesis in the absence of rhizobia, but its ectodomain is required for proper symbiont colonization. PMID:25304318
Kristal M. Watrous; James H. Cane
2011-01-01
Astragalus L. (Fabaceae) is an enormous and diverse plant genus with a cosmopolitan distribution, but relatively few breeding biologies are known for its member species. Threadstalk (or basalt) milkvetch, Astragalus filipes Torrey ex. A. Gray, is common and widespread throughout the U.S. Intermountain West, including the Great Basin. It is being studied and ultimately...
Liao, Jingzhu; Li, Chanyi; Huang, Jing; Liu, Wuping; Chen, Hongce; Liao, Shuangye; Chen, Hongyuan; Rui, Wen
2018-01-15
Honey-processed Astragalus is a dosage form of Radix Astragalus mixed with honey by a traditional Chinese medicine processing method which strengthens the tonic effect. Astragalus polysaccharide (APS), perform its immunomodulatory effects by relying on the tonic effect of Radix Astragalus , therefore, the improved pharmacological activity of honey-processed Astragalus polysaccharide (HAPS) might be due to structural changes during processing. The molecular weights of HAPS and APS were 1,695,788 Da, 2,047,756 Da, respectively, as determined by high performance gel filtration chromatography combined with evaporative light scattering detection (HPGFC-ELSD). The monosaccharide composition was determined by ultra-performance liquid chromatogram quadrupole time-of-flight mass spectrometry (UPLC/ESI-Q-TOF-MS) after pre-column derivatization with 1-phenyl-3-methyl-5-pyrazolone (PMP). The results showed that the essential components were mannose, glucose, xylose, arabinose, glucuronic acid and rhamnose, is molar ratios of 0.06:28.34:0.58:0.24:0.33:0.21 and 0.27:12.83:1.63:0.71:1.04:0.56, respectively. FT-IR and NMR analysis of HAPS results showed the presence of uronic acid and acetyl groups. The anti-inflammatory activities of HAPS were more effective than those of APS according to the NO contents and the expression of IFN-γ, IL-1β, IL-22 and TNF-α in lipopolysaccharide (LPS)-induced RAW264.7 cells. This findings suggest that the anti-inflammatory and bioactivity improvement might be associated with molecular structure changes, bearing on the potential immunomodulatory action.
Directory of Open Access Journals (Sweden)
Jingzhu Liao
2018-01-01
Full Text Available Honey-processed Astragalus is a dosage form of Radix Astragalus mixed with honey by a traditional Chinese medicine processing method which strengthens the tonic effect. Astragalus polysaccharide (APS, perform its immunomodulatory effects by relying on the tonic effect of Radix Astragalus, therefore, the improved pharmacological activity of honey-processed Astragalus polysaccharide (HAPS might be due to structural changes during processing. The molecular weights of HAPS and APS were 1,695,788 Da, 2,047,756 Da, respectively, as determined by high performance gel filtration chromatography combined with evaporative light scattering detection (HPGFC-ELSD. The monosaccharide composition was determined by ultra-performance liquid chromatogram quadrupole time-of-flight mass spectrometry (UPLC/ESI-Q-TOF-MS after pre-column derivatization with 1-phenyl-3-methyl-5-pyrazolone (PMP. The results showed that the essential components were mannose, glucose, xylose, arabinose, glucuronic acid and rhamnose, is molar ratios of 0.06:28.34:0.58:0.24:0.33:0.21 and 0.27:12.83:1.63:0.71:1.04:0.56, respectively. FT-IR and NMR analysis of HAPS results showed the presence of uronic acid and acetyl groups. The anti-inflammatory activities of HAPS were more effective than those of APS according to the NO contents and the expression of IFN-γ, IL-1β, IL-22 and TNF-α in lipopolysaccharide (LPS-induced RAW264.7 cells. This findings suggest that the anti-inflammatory and bioactivity improvement might be associated with molecular structure changes, bearing on the potential immunomodulatory action.
Fetotoxicity of Astragalus lentiginosus (locoweed) in Spanish goats
Locoweeds (plant species of Astragalus and Oxytropis containing swainsonine) cause large economic losses to the livestock industry in the western United States and in other regions of the world. Embryo and fetal loss is commonly reported when pregnant animals grazed locoweeds. Pregnant Spanish goa...
Leonetti, Paola; Accotto, Gian Paolo; Hanafy, Moemen S.; Pantaleo, Vitantonio
2018-01-01
Cicer arietinum L. (chickpea) is the world's fourth most widely grown pulse. Chickpea seeds are a primary source of dietary protein for humans, and chickpea cultivation contributes to biological nitrogen fixation in the soil, given its symbiotic relationship with rhizobia. Therefore, chickpea cultivation plays a pivotal role in innovative sustainable models of agro-ecosystems inserted in crop rotation in arid and semi-arid environments for soil improvement and the reduction of chemical inputs. Indeed, the arid and semi-arid tropical zones of Africa and Asia have been primary areas of cultivation and diversification. Yet, nowadays, chickpea is gaining prominence in Canada, Australia, and South America where it constitutes a main ingredient in vegetarian and vegan diets. Viruses and plant parasitic nematodes (PPNs) have been considered to be of minor and local impact in primary areas of cultivation. However, the introduction of chickpea in new environments exposes the crop to these biotic stresses, compromising its yields. The adoption of high-throughput genomic technologies, including genome and transcriptome sequencing projects by the chickpea research community, has provided major insights into genome evolution as well as genomic architecture and domestication. This review summarizes the major viruses and PPNs that affect chickpea cultivation worldwide. We also present an overview of the current state of chickpea genomics. Accordingly, we explore the opportunities that genomics, post-genomics and novel editing biotechnologies are offering in order to understand chickpea diseases and stress tolerance and to design innovative control strategies. PMID:29599788
Leonetti, Paola; Accotto, Gian Paolo; Hanafy, Moemen S; Pantaleo, Vitantonio
2018-01-01
Cicer arietinum L. (chickpea) is the world's fourth most widely grown pulse. Chickpea seeds are a primary source of dietary protein for humans, and chickpea cultivation contributes to biological nitrogen fixation in the soil, given its symbiotic relationship with rhizobia. Therefore, chickpea cultivation plays a pivotal role in innovative sustainable models of agro-ecosystems inserted in crop rotation in arid and semi-arid environments for soil improvement and the reduction of chemical inputs. Indeed, the arid and semi-arid tropical zones of Africa and Asia have been primary areas of cultivation and diversification. Yet, nowadays, chickpea is gaining prominence in Canada, Australia, and South America where it constitutes a main ingredient in vegetarian and vegan diets. Viruses and plant parasitic nematodes (PPNs) have been considered to be of minor and local impact in primary areas of cultivation. However, the introduction of chickpea in new environments exposes the crop to these biotic stresses, compromising its yields. The adoption of high-throughput genomic technologies, including genome and transcriptome sequencing projects by the chickpea research community, has provided major insights into genome evolution as well as genomic architecture and domestication. This review summarizes the major viruses and PPNs that affect chickpea cultivation worldwide. We also present an overview of the current state of chickpea genomics. Accordingly, we explore the opportunities that genomics, post-genomics and novel editing biotechnologies are offering in order to understand chickpea diseases and stress tolerance and to design innovative control strategies.
Directory of Open Access Journals (Sweden)
Paola Leonetti
2018-03-01
Full Text Available Cicer arietinum L. (chickpea is the world's fourth most widely grown pulse. Chickpea seeds are a primary source of dietary protein for humans, and chickpea cultivation contributes to biological nitrogen fixation in the soil, given its symbiotic relationship with rhizobia. Therefore, chickpea cultivation plays a pivotal role in innovative sustainable models of agro-ecosystems inserted in crop rotation in arid and semi-arid environments for soil improvement and the reduction of chemical inputs. Indeed, the arid and semi-arid tropical zones of Africa and Asia have been primary areas of cultivation and diversification. Yet, nowadays, chickpea is gaining prominence in Canada, Australia, and South America where it constitutes a main ingredient in vegetarian and vegan diets. Viruses and plant parasitic nematodes (PPNs have been considered to be of minor and local impact in primary areas of cultivation. However, the introduction of chickpea in new environments exposes the crop to these biotic stresses, compromising its yields. The adoption of high-throughput genomic technologies, including genome and transcriptome sequencing projects by the chickpea research community, has provided major insights into genome evolution as well as genomic architecture and domestication. This review summarizes the major viruses and PPNs that affect chickpea cultivation worldwide. We also present an overview of the current state of chickpea genomics. Accordingly, we explore the opportunities that genomics, post-genomics and novel editing biotechnologies are offering in order to understand chickpea diseases and stress tolerance and to design innovative control strategies.
Astragalus Mongholicus Regulate the Toll-Like-Receptor 4 ...
African Journals Online (AJOL)
Backgroud: According to the traditional view, we depend on three methods to treat tumors; surgery, chemotherapy and radiotherapy. However, these methods have its own limitations in application. Traditional Chinese Medicine (TCM) is one of the oldest healing systems. Astragalus mongholicus (AMs) that is the common ...
Medicago truncatula Zinc-Iron Permease6 provides zinc to rhizobia-infected nodule cells.
Abreu, Isidro; Saéz, Ángela; Castro-Rodríguez, Rosario; Escudero, Viviana; Rodríguez-Haas, Benjamín; Senovilla, Marta; Larue, Camille; Grolimund, Daniel; Tejada-Jiménez, Manuel; Imperial, Juan; González-Guerrero, Manuel
2017-11-01
Zinc is a micronutrient required for symbiotic nitrogen fixation. It has been proposed that in model legume Medicago truncatula, zinc is delivered by the root vasculature into the nodule and released in the infection/differentiation zone. There, transporters must introduce this element into rhizobia-infected cells to metallate the apoproteins that use zinc as a cofactor. MtZIP6 (Medtr4g083570) is an M. truncatula Zinc-Iron Permease (ZIP) that is expressed only in roots and nodules, with the highest expression levels in the infection/differentiation zone. Immunolocalization studies indicate that it is located in the plasma membrane of nodule rhizobia-infected cells. Down-regulating MtZIP6 expression levels with RNAi does not result in any strong phenotype when plants are fed mineral nitrogen. However, these plants displayed severe growth defects when they depended on nitrogen fixed by their nodules, losing of 80% of their nitrogenase activity. The reduction of this activity was likely an indirect effect of zinc being retained in the infection/differentiation zone and not reaching the cytosol of rhizobia-infected cells. These data are consistent with a model in which MtZIP6 would be responsible for zinc uptake by rhizobia-infected nodule cells in the infection/differentiation zone. © 2017 John Wiley & Sons Ltd.
Effects of gamma irradiation on the shoot length of Cicer seeds
International Nuclear Information System (INIS)
Toker, Cengiz; Uzun, Bulent; Canci, Huseyin; Oncu Ceylan, F.
2005-01-01
The effects of radiation on the shoot and root lengths of germinated seedling of irradiated seeds of Cicer species, i.e. three kabuli types and four desi types of cultivated chickpea (Cicer arietinum Ladiz.) and 2 annual wild types (C. reticulatum Ladiz. and C. bijugum K.H. Rech.) were investigated. The seeds were irradiated with a 60 Co gamma source using 0, 200, 300 and 400 Gy doses at 1.66 kGy h -1 . At 200 Gy minor effects could be observed, but at 400 Gy an obvious depression of shoot length was observed. The kabuli types were more affected than the desi ones. The critical dose that prevented the shoot and root elongation varied among species and also ranged from genotypes to genotype within species
Directory of Open Access Journals (Sweden)
Damaris K. Ondieki
2017-01-01
Full Text Available Limited nitrogen (N content in the soil is a major challenge to sustainable and high crop production in many developing countries. The nitrogen fixing symbiosis of legumes with rhizobia plays an important role in supplying sufficient N for legumes and subsequent nonleguminous crops. To identify rhizobia strains which are suitable for bioinoculant production, characterization of rhizobia is a prerequisite. The objective of this study was to assess the morphological and genetic diversity of rhizobia that nodulates cowpea in agricultural soils of lower eastern Kenya. Twenty-eight rhizobia isolates were recovered from soil samples collected from farmers’ fields in Machakos, Makueni, and Kitui counties in lower eastern Kenya and characterized based on morphological characteristics. Thirteen representative isolates were selected and characterized using BOX repetitive element PCR fingerprinting. Based on the dendrogram generated from morphological characteristics, the test isolates were distributed into two major clusters at a similarity of 75%. Phylogenetic tree, based on BOX repetitive element PCR, grouped the isolates into two clusters at 90% similarity level. The clustering of the isolates did not show a relationship to the origin of soil samples, although the isolates were genetically diverse. This study is a prerequisite to the selection of suitable cowpea rhizobia to develop bioinoculants for sustainable crop production in Kenya.
Ondieki, Damaris K; Nyaboga, Evans N; Wagacha, John M; Mwaura, Francis B
2017-01-01
Limited nitrogen (N) content in the soil is a major challenge to sustainable and high crop production in many developing countries. The nitrogen fixing symbiosis of legumes with rhizobia plays an important role in supplying sufficient N for legumes and subsequent nonleguminous crops. To identify rhizobia strains which are suitable for bioinoculant production, characterization of rhizobia is a prerequisite. The objective of this study was to assess the morphological and genetic diversity of rhizobia that nodulates cowpea in agricultural soils of lower eastern Kenya. Twenty-eight rhizobia isolates were recovered from soil samples collected from farmers' fields in Machakos, Makueni, and Kitui counties in lower eastern Kenya and characterized based on morphological characteristics. Thirteen representative isolates were selected and characterized using BOX repetitive element PCR fingerprinting. Based on the dendrogram generated from morphological characteristics, the test isolates were distributed into two major clusters at a similarity of 75%. Phylogenetic tree, based on BOX repetitive element PCR, grouped the isolates into two clusters at 90% similarity level. The clustering of the isolates did not show a relationship to the origin of soil samples, although the isolates were genetically diverse. This study is a prerequisite to the selection of suitable cowpea rhizobia to develop bioinoculants for sustainable crop production in Kenya.
Directory of Open Access Journals (Sweden)
Yung-Cheng Huang
2017-12-01
Full Text Available Astragalus membranaceus is commonly used in traditional Chinese medicine for strengthening the host defense system. Astragalus membranaceus-polysaccharides is an effective component with various important bioactivities, such as immunomodulation, antioxidant, anti-diabetes, anti-inflammation and neuroprotection. In the present study, we determine the effects of Astragalus membranaceus-polysaccharides on metabolically stressed transgenic mice in order to develop this macromolecules for treatment of sporadic Alzheimer’s disease, a neurodegenerative disease with metabolic risk factors. Transgenic mice, at 10 weeks old prior to the appearance of senile plaques, were treated in combination of administrating high-fat diet and injecting low-dose streptozotocin to create the metabolically stressed mice model. Astragalus membranaceus-polysaccharides was administrated starting at 14 weeks for 7 weeks. We found that Astragalus membranaceus-polysaccharides reduced metabolic stress-induced increase of body weight, insulin and insulin and leptin level, insulin resistance, and hepatic triglyceride. Astragalus membranaceus-polysaccharides also ameliorated metabolic stress-exacerbated oral glucose intolerance, although the fasting blood glucose was only temporally reduced. In brain, metabolic stress-elicited astrogliosis and microglia activation in the vicinity of plaques was also diminished by Astragalus membranaceus-polysaccharides administration. The plaque deposition, however, was not significantly affected by Astragalus membranaceus-polysaccharides administration. These findings suggest that Astragalus membranaceus-polysaccharides may be used to ameliorate metabolic stress-induced diabesity and the subsequent neuroinflammation, which improved the behavior performance in metabolically stressed transgenic mice.
Genetic characterization of three varieties of Astragalus lentiginosus (Fabaceae).
Brian J. Knaus; Rich C. Cronn; Aaron. Liston
2005-01-01
Astragalus lentiginosus is a polymorphic species that occurs in geologically young habitats and whose varietal circumscription implies active morphological and genetic differentiation. In this preliminary study, we evaluate the potential of amplified fragment length polymorphism (AFLP) markers to resolve infraspecific taxa in three varieties of...
Rodrigues, Dalila Ribeiro; Silva, Aleksandro Ferreira da; Cavalcanti, Maria Idaline Pessoa; Escobar, Indra Elena Costa; Fraiz, Ana Carla Resende; Ribeiro, Paula Rose de Almeida; Ferreira Neto, Reginaldo Alves; Freitas, Ana Dolores Santiago de; Fernandes-Júnior, Paulo Ivan
2018-02-02
Erythrina velutina ("mulungu") is a legume tree from Caatinga that associates with rhizobia but the diversity and symbiotic ability of "mulungu" rhizobia are poorly understood. The aim of this study was to characterize "mulungu" rhizobia from Caatinga. Bacteria were obteined from Serra Talhada and Caruaru in Caatinga under natural regeneration. The bacteria were evaluated to the amplification of nifH and nodC and to metabolic characteristics. Ten selected bacteria identified by 16S rRNA sequences. They were tested in vitro to NaCl and temperature tolerance, auxin production and calcium phosphate solubilization. The symbiotic ability were assessed in an greenhouse experiment. A total of 32 bacteria were obtained and 17 amplified both symbiotic genes. The bacteria showed a high variable metabolic profile. Bradyrhizobium (6), Rhizobium (3) and Paraburkholderia (1) were identified, differing from their geographic origin. The isolates grew up to 45°C to 0.51molL -1 of NaCl. Bacteria which produced more auxin in the medium with l-tryptophan and two Rhizobium and one Bradyrhizobium were phosphate solubilizers. All bacteria nodulated and ESA 90 (Rhizobium sp.) plus ESA 96 (Paraburkholderia sp.) were more efficient symbiotically. Diverse and efficient rhizobia inhabit the soils of Caatinga dry forests, with the bacterial differentiation by the sampling sites. Copyright © 2018 Sociedade Brasileira de Microbiologia. Published by Elsevier Editora Ltda. All rights reserved.
Li, Yan; Li, Xiangyue; Liu, Yajing; Wang, En Tao; Ren, Chenggang; Liu, Wei; Xu, Hualing; Wu, Hailong; Jiang, Nan; Li, Yunzhao; Zhang, Xiaoli; Xie, Zhihong
2016-05-01
Sesbania cannabina is a plant that grows naturally along the seashores in Rudong County, China (RDC) and it has been introduced into the Yellow River Delta (YRD) as a pioneer plant to improve the saline-alkaline soils. In order to investigate the diversity of S. cannabina rhizobia in these soils, a total of 198 rhizobial isolates were characterized and phylogenetic trees were constructed based on data from multilocus sequence analysis (MLSA) of the housekeeping genes recA, atpD and glnII, as well as 16S rRNA. Symbiotic features were also studied by establishing the phylogeny of the symbiotic genes nodA and nifH, and by performing nodulation assays. The isolates had highly conserved symbiotic genes and were classified into nine genospecies belonging to the genera Ensifer, Agrobacterium, Neorhizobium and Rhizobium. A unique community structure was detected in the rhizobia associated with S. cannabina in the saline-alkaline soils that was characterized by five novel genospecies and four defined species. In addition, Ensifer sp. I was the predominant rhizobia in YRD, whereas Ensifer meliloti and Neorhizobium huautlense were the dominant species in RDC. Therefore, the study demonstrated for the first time that this plant strongly selected the symbiotic gene background but not the genomic background of its microsymbionts. In addition, biogeographic patterns existed in the rhizobial populations associated with S. cannabina, which were mainly correlated with pH and salinity, as well as the mineral nutrient contents. This study provided novel information concerning the interaction between soil conditions, host plant and rhizobia, in addition to revealing the diversity of S. cannabina rhizobia in saline-alkaline soils. Copyright © 2016 Elsevier GmbH. All rights reserved.
The rediscovery of Astragalus autranii (Fabaceae) on Mt Tomor, south central Albania
DEFF Research Database (Denmark)
Tan, Kit; Shuka, Lulezim; Gjeta, Ermelinda
2015-01-01
Astragalus autranii (Fabaceae) placed by Sytin & Podlech in a section of its own (A. sect. Baldaccia) was described from a single specimen in the Barbey-Boissier Herbarium at Geneva. Our observations show that its placement in A. sect. Hololeuce would also be appropriate. The species was first co...... by Markgraf. Information on habitat, ecology and threat status are also detailed for the first time. Mt Tomor is designated as a protected National Park; however, some of the Astragalus populations may be affected by future road construction....
Published yields for chickpea (Cicer arietinum L.) are higher when the crop is planted in the fall rather than in the spring seasons (Singh et al 1989, Singh et al 1997). Because of its lack of cold hardiness alleles to survive freezing temperatures, chickpea is planted in the spring in temperate re...
Cook, Daniel; Gardner, Dale R; Pfister, James A; Stonecipher, Clinton A; Robins, Joseph G; Morgan, Jack A
2017-03-01
Rapid changes in the Earth's atmosphere and climate associated with human activity can have significant impacts on agriculture including livestock production. CO 2 concentration has risen from the industrial revolution to the current time, and is expected to continue to rise. Climatic changes alter physiological processes, growth, and development in numerous plant species, potentially changing concentrations of plant secondary compounds. These physiological changes may influence plant population density, growth, fitness, and toxin concentrations and thus influence the risk of toxic plants to grazing livestock. Locoweeds, swainsonine-containing Astragalus species, are one group of plants that may be influenced by climate change. We evaluated how two different swainsonine-containing Astragalus species responded to elevated CO 2 concentrations. Measurements of biomass, crude protein, water soluble carbohydrates and swainsonine concentrations were measured in two chemotypes (positive and negative for swainsonine) of each species after growth at CO 2 levels near present day and at projected future concentrations. Biomass and water soluble carbohydrate concentrations responded positively while crude protein concentrations responded negatively to elevated CO 2 in the two species. Swainsonine concentrations were not strongly affected by elevated CO 2 in the two species. In the different chemotypes, biomass responded negatively and crude protein concentrations responded positively in the swainsonine-positive plants compared to the swainsonine-negative plants. Ultimately, changes in CO 2 and endophyte status will likely alter multiple physiological responses in toxic plants such as locoweed, but it is difficult to predict how these changes will impact plant herbivore interactions.
Napolitano, Assunta; Akay, Seref; Mari, Angela; Bedir, Erdal; Pizza, Cosimo; Piacente, Sonia
2013-11-01
Astragalus species are widely used as health foods and dietary supplements, as well as drugs in traditional medicine. To rapidly evaluate metabolite similarities and differences among the EtOH extracts of the roots of eight commercial Astragalus spp., an approach based on direct analyses by ESI-MS followed by PCA of ESI-MS data, was carried out. Successively, quali-quantitative analyses of cycloartane derivatives in the eight Astragalus spp. by LC-ESI-MS(n) and PCA of LC-ESI-MS data were performed. This approach allowed to promptly highlighting metabolite similarities and differences among the various Astragalus spp. PCA results from LC-ESI-MS data of Astragalus samples were in reasonable agreement with both PCA results of ESI-MS data and quantitative results. This study affords an analytical method for the quali-quantitative determination of cycloartane derivatives in herbal preparations used as health and food supplements. Copyright © 2013 Elsevier B.V. All rights reserved.
Directory of Open Access Journals (Sweden)
Chuan Zou
2013-01-01
Full Text Available Aims. To explore whether Astragalus or its formulations could prevent upper respiratory infection in children with nephrotic syndrome and how best to use it. Methods. We transformed a common clinical question in practice to an answerable question according to the PICO principle. Databases, including the Cochrane Library (Issue 5, 2012, PUBMED (1966–2012.8, CBM (1978–2012.8, VIP (1989–2012.8, and CNKI (1979–2012.8, were searched to identify Cochrane systematic reviews and clinical trials. Then, the quality of and recommendations from the clinical evidence were evaluated using the GRADEpro software. Results. The search yielded 537 papers. Only two studies with high validity were included for synthesis calculations. The results showed that Astragalus granules could effectively reduce URTI in children with nephrotic syndrome compared with prednisone treatment alone (23.9% versus 42.9%; RR = 0.56 and 95% CI = 0.33–0.93. The dose of Astragalus granules was 2.25 gram (equivalent to 15 gram crude Astragalus twice per day, at least for 3–6 months. The level of evidence quality was low, but we still recommended the evidence to the patient according to GRADEpro with the opinion of the expert. Followup showed the incidence of URTI in this child decreased significantly. Conclusions. Astragalus granules may reduce the incidence of URTI in children with nephrotic syndrome.
Directory of Open Access Journals (Sweden)
Simona Adesso
2018-03-01
Full Text Available Astragalus membranaceus, dried root extract, also known as Astragali radix, is used in traditional Chinese medicine as a tonic remedy. Moreover, it has been reported that Astragalus membranaceus could attenuate intestinal inflammation; however, the underlying mechanism for its anti-inflammatory activity in intestinal epithelial cells (IECs remains unclear. In this study, we evaluated Astragalus membranaceus extract (5–100 µg/mL in a model of inflammation and oxidative stress for IECs. We showed that Astragalus membranaceus extract reduced the inflammatory response induced by lipopolysaccharide from E. coli (LPS plus interferon-γ (IFN, decreasing tumor necrosis factor-α (TNF-α release, cycloxygenase-2 (COX-2 and inducible nitric oxide synthase (iNOS expression, nitrotyrosine formation, nuclear factor-κB (NF-κB activation, and reactive oxygen species (ROS release in the non-tumorigenic intestinal epithelial cell line (IEC-6. The antioxidant potential of Astragalus membranaceus extract was also evaluated in a model of hydrogen peroxide (H2O2-induced oxidative stress in IEC-6, indicating that this extract reduced ROS release and increased nuclear factor (erythroid-derived 2-like 2 (Nrf2 activation and the expression of antioxidant cytoprotective factors in these cells. The results contributed to clarify the mechanisms involved in Astragalus membranaceus extract-reduced inflammation and highlighted the potential use of this extract as an anti-inflammatory and antioxidant remedy for intestinal diseases.
Secondary Metabolites of Astragalus cruciatus Link. and Their Chemotaxonomic Significance
Directory of Open Access Journals (Sweden)
Wassila Benchadi
2013-03-01
Full Text Available In continuation of our chemical studies on the secondary metabolites of Algerian saharan species, we report on the isolation, from the methanol extract of the whole plant Astragalus cruciatus Link. , of seven known compounds including two saponins named azukisaponin V (1 and astragaloside VIII (2, four flavonoids called narcissin (3, nicotiflorin (4, kaempferol 3-O- α -L-rhamnopyranosyl-(1 ¦ 4- α -L-rhamnopyranosyl-(1 ¦ 6-β-D-glucopyranoside (5 and 5,7,2’-trihydroxyflavone (6 and one phytosterol glycoside, daucosterol (7. All the isolated compounds were characterized by using spectroscopic methods especially 1D and 2D NMR and ESI mass spectrometry and comparison with literature data . The chemotaxonomic and systematic characters of the genus Astragalus are summarized in this study to show its interesting chemodiversity throughout the world, as well as to establish the chemotaxonomical classification of this genus.
Feng, Ningchuan; Zhang, Yumei; Fan, Wei; Zhu, Meilin
2018-02-01
Activated carbon was prepared from astragalus residue by KOH and then treated with cetyl trimethyl ammonium bromide (CTAB) and used for the removal of methylbenzene from aqueous solution. The samples were characterized by FTIR, XRD, SEM and Boehm titration. The results showed that CTAB changed the physicochemical properties of activated carbon significantly. The isotherm adsorption studies of methylbenzene onto the astragalus residue activated carbon (ASC) and CTAB-modified astragalus residue activated carbon (ASCCTAB) were examined by using batch techniques and agreed well with the Langmuir model. The maximum adsorption capacity of ASC and ASC-CTAB for methylbenzene determined from the Langmuir model was183.56 mg/g and 235.18 mg/g, respectively. The results indicated that using CTAB as a modifier for ASC modification could markedly enhance the methylbenzene removal from water.
Tian, Huiping; Lu, Jun; He, Hairong; Zhang, Lu; Dong, Yalin; Yao, Hongping; Feng, Weiyi; Wang, Siwen
2016-09-15
Astragalus is a traditional Chinese medicine that is widely used for tonifying Qi (Qi mainly means life energy) to treat diabetes mellitus and its complications. We performed a meta-analysis to evaluate the effect of Astragalus in adjuvant treatment of type 2 diabetes mellitus (T2DM), and to provide novel information to improve clinical decision-making. We conducted an exhaustive database search (PubMed, EMbase, Cochrane Library, China Knowledge Resource Integrated Database (CNKI), Wanfang data and SinoMed) of studies associated with "Astragalus" and "type 2 diabetes mellitus" until December 2015. Following quality assessment of study eligibility, the extracted data were statistically analyzed using STATA, ver. 12.0 (Stata Corp.). A total of 13 studies with 1054 participants were included in this meta-analysis. Two subgroups were identified, based on Astragalus dosing regimens: control group vs. Astragalus injection (AI); control group vs. Astragalus aqueous decoction (AAD). The pooled results showed that, in comparison with control group, Astragalus administration significantly reduced fasting plasma glucose (FPG) in both the AI group (WMD=-0.28, 95% CI=-0.46 to -0.10, P=0.002, I(2)=18.5%) and the AAD group (WMD=-0.83, 95% CI=-1.07 to -0.58, P=0.000, I(2)=0.0%); postprandial plasma glucose (PPG) was also significantly reduced in the AI group (WMD=-0.47, 95% CI=-0.77 to -0.17, P=0.002, I(2)=46.8%) and the AAD group (WMD=-1.19, 95% CI=-1.63 to -0.75, P=0.000, I(2)=49.3%). Fasting insulin (Fins) was significantly reduced only in the AAD treatment group (SMD=-0.33, 95% CI=-0.55 to -0.10, P=0.005, I(2)=1.0%) as was the homeostasis model assessment insulin resistance index (HOMA-IRI) levels (SMD=-1.66, 95% CI=-3.24 to -0.09, P=0.038, I(2)=94.0%). Although AAD treatment significantly reduced levels of glycated hemoglobin A1c (HbA1c) (WMD=-1.77, 95% CI=-3.06 to -0.47, P=0.007, I(2)=90.8%), AI treatment failed to show significant efficacy (WMD=-0.28, 95% CI=-0.63 to 0
Liang, Tu; Fu, Qing; Xin, Huaxia; Li, Fangbing; Jin, Yu; Liang, Xinmiao
2014-12-01
Water-soluble polysaccharides from traditional Chinese medicine (TCM) have properties of broad-spectrum treatment and low toxicity, making them as important components in natural medicines and health products. In order to solve the problem of polysaccharides characterization caused by their complex structures, a "bottom-up" approach was developed to complete the characterization of polysaccharides from Astragalus. Firstly, Astragalus pieces were extracted with hot water and then were precipitated by ethanol to obtain Astragalus polysaccharides. Secondly, a partial acid hydrolysis method was carried out and the effects of time, acid concentration and temperature on hydrolysis were investigated. The degree of hydrolysis increased along with the increase of hydrolysis time and acid concentration. The temperature played a great role in the hydrolysis process. No hydrolysis of the polysaccharides occurred at low temperature, while the polysaccharides were almost hydrolyzed to monosaccharide at high temperature. Under the optimum hydrolysis conditions (4 h, 1.5 mol/L trifluoroacetic acid, and 80 °C), Astragalus polysaccharides were hydrolyzed to characteristic oligosaccharide fragments. At last, a hydrophilic liquid chromatography-mass spectrometry method was used for the separation and structural characterization of the polysaccharide hydrolysates. The results showed that the resulting polysaccharides were mainly 1--> 4 linear glucan, and gluco-oligosaccharides with the degrees of polymerization (DP) of 4 - 11 were obtained after partial acid hydrolysis. The significance of this study is that it is the guidance for the characterization of other TCM polysaccharides.
Directory of Open Access Journals (Sweden)
Xiang Gao
Full Text Available Soybean red crown rot is a major soil-borne disease all over the world, which severely affects soybean production. Efficient and sustainable methods are strongly desired to control the soil-borne diseases.We firstly investigated the disease incidence and index of soybean red crown rot under different phosphorus (P additions in field and found that the natural inoculation of rhizobia and arbuscular mycorrhizal fungi (AMF could affect soybean red crown rot, particularly without P addition. Further studies in sand culture experiments showed that inoculation with rhizobia or AMF significantly decreased severity and incidence of soybean red crown rot, especially for co-inoculation with rhizobia and AMF at low P. The root colony forming unit (CFU decreased over 50% when inoculated by rhizobia and/or AMF at low P. However, P addition only enhanced CFU when inoculated with AMF. Furthermore, root exudates of soybean inoculated with rhizobia and/or AMF significantly inhibited pathogen growth and reproduction. Quantitative RT-PCR results indicated that the transcripts of the most tested pathogen defense-related (PR genes in roots were significantly increased by rhizobium and/or AMF inoculation. Among them, PR2, PR3, PR4 and PR10 reached the highest level with co-inoculation of rhizobium and AMF.Our results indicated that inoculation with rhizobia and AMF could directly inhibit pathogen growth and reproduction, and activate the plant overall defense system through increasing PR gene expressions. Combined with optimal P fertilization, inoculation with rhizobia and AMF could be considered as an efficient method to control soybean red crown rot in acid soils.
International Nuclear Information System (INIS)
Sun Zhiyong
2005-01-01
Objective: To investigate the therapeutic effect of oral liquid preparation of astragalus membranaceous in aged patients with chronic bronchial asthma with special reference on the serum SOD levels. Methods: Serum SOD levels were measured with RIA in 42 aged patients with chronic bronchial asthma both before and after a course of treatment with oral liquid preparation of astragalus membranaceous (10ml b. i. d for 3 months) as well as in 35 controls. Results: The patients general condition was greatly improved after the treatment. Before treatment, the serum SOD levels in the patients were significantly lower than those in controls (P 0.05). Conclusion: Oral liquid preparation of astragalus membranaceous was therapeutically useful for chronic bronchial asthma in aged patients with correction of the serum SOD levels. (authors)
Legume-rhizobia signal exchange: promiscuity and environmental effects
Directory of Open Access Journals (Sweden)
Mario Andrade Lira Junior
2015-09-01
Full Text Available Although signal exchange between legumes and their rhizobia is among the best-known examples of this biological process, most of the more characterized data comes from just a few legume species and environmental stresses. Although a relative wealth of information is available for some model legumes and some of the major pulses such as soybean, little is known about tropical legumes. This relative disparity in current knowledge is also apparent in the research on the effects of environmental stress on signal exchange; cool-climate stresses, such as low-soil temperature, comprise a relatively large body of research, whereas high-temperature stresses and drought are not nearly as well understood. Both tropical legumes and their environmental stress-induced effects are increasingly important due to global population growth (the demand for protein, climate change (increasing temperatures and more extreme climate behavior, and urbanization (and thus heavy metals. This knowledge gap for both legumes and their environmental stresses is compounded because whereas most temperate legume-rhizobia symbioses are relatively specific and cultivated under relatively stable environments, the converse is true for tropical legumes, which tend to be promiscuous and grow in highly variable conditions. This review will clarify some of this missing information and highlight fields in which further research would benefit our current knowledge.
Population structures of Astragalus filipes collections from western North America
B. Shaun Bushman; Kishor Bhattarai; Douglas A. Johnson
2010-01-01
The majority of species used for revegetation in semi-arid western rangelands of North America are grasses, with few forbs and nearly no legumes. Astragalus filipes (Torr. Ex A. Gray) is a western North American legume and a promising candidate for use in rangeland revegetation, but assessments of plant species diversity and structure are necessary to determine which...
Laranjo, M; Branco, C; Soares, R; Alho, L; Carvalho, M D E; Oliveira, S
2002-01-01
To test the hypothesis that differences in chickpea yields obtained in four distinct Portuguese regions (Beja, Elvas-Casas Velhas, Elvas-Estação Nacional de Melhoramento de Plantas (ENMP) and Evora) could be due to variation between the natural rhizobia populations. Estimation of the size of the different rhizobial populations showed that Elvas-ENMP population was the largest one. Elvas-ENMP population also revealed a higher proportion of isolates carrying more than one plasmid. Assessment of genetic diversity of the native rhizobia populations by a DNA fingerprinting PCR method, here designated as DAPD (Direct Amplified Polymorphic DNA), showed a higher degree of variation in Elvas-ENMP and Beja populations. The symbiotic effectiveness (SE) of 39 isolates was determined and ranged 13-34%. Statistical analysis showed that SE was negatively correlated with plasmid number of the isolate. The largest indigenous rhizobia population was found in Elvas-ENMP. DAPD pattern and plasmid profile analysis both suggested a higher genetic diversity among the populations of Elvas-ENMP and Beja. No relationship was found between SE of the isolates and their origin site. The large native population, rather than the symbiotic performance of individual rhizobia, could contribute to the higher chickpea yields obtained in Elvas-ENMP.
Directory of Open Access Journals (Sweden)
Lal Babu Chaudhary
2008-12-01
Full Text Available Astragalus is considered one of the most diverse genera in the family Leguminosae (nom. alt. Fabaceae. Although a large number of works have been carried out on the genus, no monograph is available except some regional accounts and revisions chiefly at sectional level. It may be due to the sheer size of the genus (ca. 3000 spp. and diverse nature, the genus is quite variable in habit and habitats, size of the plants, nature of indumentums, stipules, leaf rachis, types of inflorescence, relative length of petals, pods etc. Usually, genus is divided into eight to ten subgenera and more than 245 sections. In recently conducted molecular phylogenetic studies it has been shown that none of the subgenera and large sections are monophyletic. However, it has been clearly demonstrated that Astragalus is monophyletic except some outlier species. The chromosome numbers are also quite interesting and significant in Astragalus for its phylogenetic studies. There is a strong correlation between its geographic distribution and chromosome numbers. Currently about 80 species have been recorded from India chiefly from the Himalayas. Except some of our recent publications, not much studies have been carried out on the genus in India after 'The Flora of British India'. Astragalus is not of much economic importance, however, some of its species are well known for commercial gum tragacanth production especially in Iran and China. In India, A. candolleanus is a well known drug as ‘Rudanti’ or ‘Rudravanti’used for tuberculosis, skin diseases, coughs and blood purifier. The aim of this article is to review the entire work carried out on Astragalus and to bring out scattered information at one place for better understanding of the subject and to find out the future prospective of the research in India on the genus.
Clúa, Joaquín; Roda, Carla; Zanetti, María Eugenia; Blanco, Flavio A
2018-02-27
The root nodule symbiosis established between legumes and rhizobia is an exquisite biological interaction responsible for fixing a significant amount of nitrogen in terrestrial ecosystems. The success of this interaction depends on the recognition of the right partner by the plant within the richest microbial ecosystems on Earth, the soil. Recent metagenomic studies of the soil biome have revealed its complexity, which includes microorganisms that affect plant fitness and growth in a beneficial, harmful, or neutral manner. In this complex scenario, understanding the molecular mechanisms by which legumes recognize and discriminate rhizobia from pathogens, but also between distinct rhizobia species and strains that differ in their symbiotic performance, is a considerable challenge. In this work, we will review how plants are able to recognize and select symbiotic partners from a vast diversity of surrounding bacteria. We will also analyze recent advances that contribute to understand changes in plant gene expression associated with the outcome of the symbiotic interaction. These aspects of nitrogen-fixing symbiosis should contribute to translate the knowledge generated in basic laboratory research into biotechnological advances to improve the efficiency of the nitrogen-fixing symbiosis in agronomic systems.
TDZ-induced plant regeneration in Astragalus cicer L.
African Journals Online (AJOL)
SERVER
2008-04-17
Apr 17, 2008 ... 1Department of Field Crops, Faculty of Agriculture, University of Ankara, 06110 Dışkapı-Ankara, Turkey. ... seedling development and poor competition with weeds ... engineering methods may help to become widespread of.
Barr, W Andrew
2014-11-01
Bovid astragali are one of the most commonly preserved bones in the fossil record. Accordingly, astragali are an important target for studies seeking to predict the habitat preferences of fossil bovids based on bony anatomy. However, previous work has not tested functional hypotheses linking astragalar morphology with habitat while controlling for body size and phylogenetic signal. This article presents a functional framework relating the morphology of the bovid astragalus to habitat-specific locomotor ecology and tests four hypotheses emanating from this framework. Highly cursorial bovids living in structurally open habitats are hypothesized to differ from their less cursorial closed-habitat dwelling relatives in having (1) relatively short astragali to maintain rotational speed throughout the camming motion of the rotating astragalus, (2) a greater range of angular excursion at the hock, (3) relatively larger joint surface areas, and (4) a more pronounced "spline-and-groove" morphology promoting lateral joint stability. A diverse sample of 181 astragali from 50 extant species was scanned using a Next Engine laser scanner. Species were assigned to one of four habitat categories based on the published ecological literature. A series of 11 linear measurements and three joint surface areas were measured on each astragalus. A geometric mean body size proxy was used to size-correct the measurement data. Phylogenetic generalized least squares (PGLS) was used to test for differences between habitat categories while controlling for body size differences and phylogenetic signal. Statistically significant PGLS results support Hypotheses 1 and 2 (which are not mutually exclusive) as well as Hypothesis 3. No support was found for Hypothesis 4. These findings confirm that the morphology of the bovid astragalus is related to habitat-specific locomotor ecology, and that this relationship is statistically significant after controlling for body size and phylogeny. Thus, this study
PNT effect on diversity of Rhizobia associated with Sesbania sesban
International Nuclear Information System (INIS)
Sacko, O.; Yattara, I. I.; Diop, T.; Neyra, M.
2009-01-01
Tilemsi rock phosphate (TRP) of Mail is one of the best rock phosphates in West Africa. But it is less used because of its insoluble form. The main objective of this study is to investigate its effect on rhizobia living under a multipurpose leguminous tree. The substrates was Senega lean soil which was less poor in phosphorus and not sterilized. (Author)
Seed isolates of Alternaria and Aspergillus fungi increase germination of Astragalus utahensis
Sean D. Eldredge; Brad Geary; Scott L. Jensen
2016-01-01
Astragalus utahensis (Torr.) Torr. & A. Gray (Fabaceae) (Utah milkvetch) is native lo the arid Great Basin and has desirable attributes that make it a good candidate for restoration in arid, noncompetitive situations. Seed dormancy is a significant barrier to consistent establishment for this species. Species of Alternaria and Aspergillus fungi have...
Friesen, M L; Mathias, A
2010-02-01
While strategy variation is a key feature of symbiotic mutualisms, little work focuses on the origin of this diversity. Rhizobia strategies range from mutualistic nitrogen fixers to parasitic nonfixers that hoard plant resources to increase their own survival in soil. Host plants reward beneficial rhizobia with higher nodule growth rates, generating a trade-off between reproduction in nodules and subsequent survival in soil. However, hosts might not discriminate between strains in mixed infections, allowing nonfixing strains to escape sanctions. We construct an adaptive dynamics model of symbiotic nitrogen-fixation and find general situations where symbionts undergo adaptive diversification, but in most situations complete nonfixers do not evolve. Social conflict in mixed infections when symbionts face a survival-reproduction trade-off can drive the origin of some coexisting symbiont strategies, where less mutualistic strains exploit benefits generated by better mutualists.
Rhizobia Isolated from Coal Mining Areas in the Nodulation and Growth of Leguminous Trees
Directory of Open Access Journals (Sweden)
Ginaini Grazielli Doin de Moura
2016-01-01
Full Text Available ABSTRACT An alternative for recovery of areas degraded by coal mining is revegetation with rapidly growing leguminous trees, which often do not establish in low fertility soils. The objective of this study was to evaluate the efficiency of native rhizobia isolated from coal mining areas in the nodulation and growth of leguminous trees. We isolated 19 strains of rhizobia from a degraded soil near Criciúma, SC, Brazil, and evaluated the nodulation and growth-promoting capacity of the inoculated isolates for bracatinga (Mimosa scabrella, maricá (M. bimucronata and angico-vermelho (Parapiptadenia rigida. Isolates UFSC-B2, B6, B8, B9, B11 and B16 were able to nodulate bracatinga, providing average increases of 165 % in shoot dry matter, with a significant contribution to N accumulation. Isolates UFSC-B5, B12, and M8 favored nodulation and growth of maricá, especially isolate UFSC-B12, which promoted increases of 370 % in N accumulation compared to treatment with N fertilizer. All strains were inefficient in promoting growth and N uptake by angico-vermelho. In conclusion, isolation and use of selected rhizobia for bracatinga and maricá plant inoculation can contribute to the growth and accumulation of N, with prospects for use in programs for revegetation of degraded soils in coal mining areas.
esmaeil rezaei-chiyaneh; Esmaeil Gholinezhad
2015-01-01
Study of agronomic characteristics and advantage indices in intercropping of additive series of Chickpea (Cicer arietinum L.) and Black Cumin (Nigella sativa L.) Abstract In order to evaluate quantitive and qualitive yield of Chickpea (Cicer arietinum L.) and Black Cumin (Nigella sativa L.) in intercropping of additive series, a field experiment was arranged in a randomized complete block design with three replications in West Azerbaijan province- city Nagadeh, Iran during growing r...
First report of dodder (Cuscuta pentagona) on chickpea (Cicer arietinum) in the United States
Chickpea (Cicer arietinum L.) is an important rotational and an emerging specialty crop in the Pacific Northwest of the United States, in California, and in the Northern Great Plains of the USA and Canada. Dodders (Cuscuta spp.) are widespread parasitic weeds on many crops worldwide. Several Cusc...
Taxonomic Study of Endemic Species of Astragalus L. (Fabaceae of India
Directory of Open Access Journals (Sweden)
Lal Babu Chaudhary
2007-09-01
Full Text Available The goal of the study is to provide a comprehensive taxonomic account of 12 endemic species of Astragalus occurring in India. The north-west Himalayan region harbors more endemic species (11 spp. than eastern Himalaya where only two species have been noticed from Sikkim. Jammu & Kashmir with seven species occupies first position in the list of endemic species. Five species are strictly confined to Jammu & Kashmir, while two species to Uttaranchal and one species to Sikkim. Only one species (A. tenuicaulis is found in both the Himalayas, otherwise the elements of both the Himalayas are quite distinct from each other. Most of the endemic species of Astragalus have been observed quite rare in the nature except A. uttaranchalensis. In the present investigation, A. turgidus, a newly described species from Jammu & Kashmir, has been found conspecific to A. kashmirensis. For each species nomenclature, description, distribution, phenology, taxonomic notes, list of the investigated materials, distribution map and figures are given. A new combination A. falconeri var. pilosus (Ali Chaudhary has been proposed based on A. hoffmeisteri var. pilosus Ali. A new endemic species A. nainitalensis from Kumaon Himalaya has also been described here along with illustrations.
Directory of Open Access Journals (Sweden)
Heng Wee Tan
Full Text Available New Zealand became geographically isolated about 80 million years ago and this separation gave rise to a unique native flora including four genera of legume, Carmichaelia, Clianthus and Montigena in the Carmichaelinae clade, tribe Galegeae, and Sophora, tribe Sophoreae, sub-family Papilionoideae. Ten bacterial strains isolated from NZ Carmichaelinae growing in natural ecosystems grouped close to the Mesorhizobium huakuii type strain in relation to their 16S rRNA and nifH gene sequences. However, the ten strains separated into four groups on the basis of their recA and glnII sequences: all groups were clearly distinct from all Mesorhizobium type strains. The ten strains separated into two groups on the basis of their nodA sequences but grouped closely together in relation to nodC sequences; all nodA and nodC sequences were novel. Seven strains selected and the M. huakuii type strain (isolated from Astragalus sinicus produced functional nodules on Carmichaelia spp., Clianthus puniceus and A. sinicus but did not nodulate two Sophora species. We conclude that rhizobia closely related to M. huakuii on the basis of 16S rRNA and nifH gene sequences, but with variable recA and glnII genes and novel nodA and nodC genes, are common symbionts of NZ Carmichaelinae.
New Native Rhizobia Strains for Inoculation of Common Bean in the Brazilian Savanna
Directory of Open Access Journals (Sweden)
Fábio Martins Mercante
Full Text Available ABSTRACT Maximization of biological nitrogen fixation in the common bean (Phaseolus vulgaris L. crop depends on the genetic characteristics related to the plant, the symbiotic efficiency of rhizobia, and environmental factors. The objective of this study was to evaluate the performance of rhizobia selected beforehand from Cerrado (Brazilian tropical savanna soils in Mato Grosso do Sul. The experiments were conducted in 2007 in the municipalities of Aquidauana, Anaurilândia, Campo Grande, and Dourados, all located in the state of Mato Grosso do Sul. All procedures established followed the current recommendations of the Brazilian Ministry of Agriculture (Ministério de Agricultura, Pecuária e Abastecimento – MAPA, in accordance with the “official protocol for assessing the feasibility and agronomic efficiency of strains, and inoculant technologies linked to the process of biological nitrogen fixation in legumes”. The program for selection of rhizobia for inoculation in bean plants resulted in identification of different strains with high symbiotic efficiency, competitiveness, and genetic stability, based on the Embrapa Agropecuária Oeste collection of multifunctional microorganism cultures. In previous studies, 630 isolates of Rhizobium were evaluated. They were obtained from nodules of leucaena (380 or dry beans (250 from 87 locations, including 34 municipalities in Mato Grosso do Sul. Three of them stood out from the others: CPAO 12.5 L2, CPAO 17.5 L2, and CPAO 56.4 L2. Inoculation of these strains in bean plants demonstrated economic viability and high potential for obtaining a more effective inoculant suitable for trading purposes.
Directory of Open Access Journals (Sweden)
Dietrich Werner
2008-06-01
Full Text Available The major pools and turnover rates of the global carbon (C cycles are presented and compared to the human production of CO2 from the burning of fossil fuels (e.g. coal and oil and geothermal fuels (natural gases, both categorized as non-renewable energy resources which in amount reaches around 6.5 Gigatons C per year. These pools that serve as C-holding stallions are in the atmosphere, the land plant biomass, the organic soils carbon, the ocean carbon and the lithosphere. In another related case, the present focus in the area of nitrogen fixation is discussed with data on world production of grain legumes compared to cereals production and nitrogen fertilizer use. The focus to understand the molecular biology of the legume-rhizobia symbiosis as a major contributor to nitrogen fixation is in the areas of signal exchange between host plants and rhizobia in the rhizophere including the nod factor signalling, the infection and nodule compartmentation and the soils stress factors affecting the symbiosis. The use of the Legume-Rhizobia symbiosis as a biotest system for soil contaminants includes data for cadmium, arsenate, atrazine, lindane, fluoranthene, phenantrene and acenaphthene and also results on the mechanism, why the symbiotic system is more sensitive than test systems with plant growth parameters.
Astragalus Granule Prevents Ca2+ Current Remodeling in Heart Failure by the Downregulation of CaMKII
Directory of Open Access Journals (Sweden)
Sinai Li
2017-01-01
Full Text Available Background. Astragalus was broadly used for treating heart failure (HF and arrhythmias in East Asia for thousands of years. Astragalus granule (AG, extracted from Astragalus, shows beneficial effect on the treatment of HF in clinical research. We hypothesized that administration of AG prevents the remodeling of L-type Ca2+ current (ICa-L in HF mice by the downregulation of Ca2+/calmodulin-dependent protein kinase II (CaMKII. Methods. HF mice were induced by thoracic aortic constriction (TAC. After 4 weeks of AG treatment, cardiac function and QT interval were evaluated. Single cardiac ventricular myocyte was then isolated and whole-cell patch clamp was used to record action potential (AP and ICa-L. The expressions of L-type calcium channel alpha 1C subunit (Cav1.2, CaMKII, and phosphorylated protein kinase A (p-PKA were examined by western blot. Results. The failing heart manifested distinct electrical remodeling including prolonged repolarization time and altered ICa-L kinetics. AG treatment attenuated this electrical remodeling, supported by AG-related shortened repolarization time, decreased peak ICa-L, accelerated ICa-L inactivation, and positive frequency-dependent ICa-L facilitation. In addition, AG treatment suppressed the overexpression of CaMKII, but not p-PKA, in the failing heart. Conclusion. AG treatment protected the failing heart against electrical remodeling and ICa-L remodeling by downregulating CaMKII.
DEFF Research Database (Denmark)
Balaghi, Sima; Mohammadifar, Mohammad Amin; Zargaraan, Azizollaah
2011-01-01
The sugar composition and viscoelastic behaviour of Iranian gum tragacanth exuded by six species of Astragalus was investigated at a concentration of 1.3% and varying ionic strength using a controlled shear-rate rheometer. Compositional analysis of the six species of gum tragacanth by high...... of Astragalus, and this variation led to interesting differences in functional properties. Rheological measurements performed on dispersions of the six species of gum tragacanth demonstrated viscoelastic properties. The mechanical spectra derived from strain sweep and frequency sweep measurements indicated...... that the different gum tragacanth dispersions had distinctive viscoelastic behaviours. Investigation of the viscoelastic properties of the different gum dispersions in the presence of NaCl revealed that the addition of NaCl could lead to slight to drastic decreases in the G′, G″ or η∗ values of the various gums...
Chemical constituents from Astragalus annularis Forssk. and A. trimestris L., Fabaceae
Directory of Open Access Journals (Sweden)
Amr M. El-Hawiet
2010-11-01
Full Text Available The phytochemical investigation of the aerial parts of Astragalus annularis Forssk. and A. trimestris L., Fabaceae, growing in Egypt, resulted in the isolation of eight compounds, for the first time from these two species. These compounds were identified by chemical methods, NMR spectroscopy, UV spectroscopy as well as MS analysis. The antimicrobial activity of the isolated compounds were tested against Staphylococcus aureus, Esherichia coli and Candida albicans.
Muniz, Aleksander Westphal; de Sá, Enilson Luiz; Dalagnol, Gilberto Luíz; Filho, João Américo
2013-01-01
In vitro rooting and the acclimatization of micropropagated rootstocks of apple trees is essential for plant development in the field. The aim of this work was to assess the use of rhizobia of Adesmia latifolia to promote rooting and acclimatization in micropropagated Marubakaido apple rootstock. An experiment involving in vitro rooting and acclimatization was performed with four strains of rhizobium and two controls, one with and the other without the addition of synthetic indoleacetic acid. The inoculated treatments involved the use of sterile inoculum and inoculum containing live rhizobia. The most significant effects on the rooting rate, primary-root length, number of roots, root length, fresh-shoot biomass, and fresh-root biomass were obtained by inoculation with strain EEL16010B and with synthetic indole acetic acid. However, there was no difference in the growth of apple explants in the acclimatization experiments. Strain EEL16010B can be used to induce in vitro rooting of the Marubakaido rootstock and can replace the use of synthetic indoleacetic acid in the rooting of this cultivar.
Kishor Bhattarai; Douglas A. Johnson; Thomas A. Jones; Kevin J. Connors; Dale R. Gardner
2008-01-01
Astragalus filipes Torr. ex A. Gray (basalt milkvetch or threadstalk milkvetch) is a legume that is widely distributed in western North America andholds promise for revegetation and restoration programs in the western United States. Seed of 67 accessions was collected in 2003 from Utah, Nevada, Idaho, Oregon, California, and Washington. Field-collected forage samples...
Directory of Open Access Journals (Sweden)
Muhammad Ashfaq Anjum, Zahir Ahmad Zahir, Muhammad Arshad and Muhammad Ashraf
2011-04-01
Full Text Available A series of screening experiments to evaluate the effectiveness of rhizobia for producing auxins and improvegrowth and nodulation of mungbean (Vigna radiata L. were carried out under axenic conditions. Forty fouriolatess of rhizobia were isolated using standard procedures. Auxin biosynthesis by these rhizobial isolates wasdetermined in the absence and presence of L-Trp, a physiological precursor of auxins. Rhizobial isolates variedwidely in auxins biosynthesis capabilities. On the basis of auxins biosynthesis, a pouch experiment was conductedfor screening thirty four efficient isolates of rhizobia for the growth promotion of mung bean. Results of pouch studyshowed that inoculation with selected rhizobial isolates increased the root /shoot length, fresh, and dry shoot weightof mung bean up to 33, 59, 71, 148, 107 and 188%, respectively, over untreated control. Further studies are neededunder glasshouse and field conditions for confirmation of these results.
Effects of Astragalus polysaccharides on memory impairment in a diabetic rat model
Directory of Open Access Journals (Sweden)
Dun C
2016-07-01
Full Text Available Changping Dun,1 Junqian Liu,1 Fucheng Qiu,1 Xueda Wu,2 Yakun Wang,3 Yongyan Zhao,4 Ping Gu1 1Department of Neurology, the First Hospital of Hebei Medical University, 2Department of Cardiac Surgery, the Second Hospital of Hebei Medical University, 3Department of Endocrinology, the Fourth Hospital of Hebei Medical University, Shijiazhuang, 4Department of Nursing, Maternal and Child Health Hospital of Tangshan City, Tangshan, People’s Republic of China Objective: Astragalus polysaccharides (APS are active constituents of Astragalus membranaceus. In this study, we aimed to investigate the effects of APS on memory impairment in a diabetic rat model and their mechanisms. Methods: A diabetic model was established in 50 male Wistar rats with streptozotocin intraperitoneal injection. A blood glucose level higher than 16.7 mmol/L obtained 72 hours after the injection was regarded as a successful diabetic model. The modeled rats were divided into model group, high, medium, and low doses of APS, and piracetam groups (positive control. A group of ten rats without streptozotocin-induced diabetes were used as a normal control. After respective consecutive 8-week treatments, the levels of blood fasting plasma glucose, insulin, hemoglobin A1c, memory performance, hippocampal malondialdehyde, and superoxide dismutase were determined. Results: After the 8-week APS treatment, serum fasting plasma glucose, hemoglobin A1c, and insulin levels were decreased compared with those of the model group (P<0.05. Importantly, memory impairment in the diabetic model was reversed by APS treatments. In addition, hippocampal malondialdehyde concentration was lowered, whereas that of superoxide dismutase was higher after APS treatments. Conclusion: APS are important active components responsible for memory improvement in rats with streptozotocin-induced diabetes. The potential mechanism of action is associated with the effects of APS on glucose and lipid metabolism, and
Astragalus kongrensis Benth. Ex Baker (Fabaceae, a New Record for Central and North-West Himalayas
Directory of Open Access Journals (Sweden)
Lal Babu Chaudhary
2006-09-01
Full Text Available Astragalus kongrensis Benth. Ex Baker is reported for the first time from Central (Nepal and North-West Himalayas (India. Earlier the species was known from East Himalaya (Sikkim-India, Bhutan and China. The description and illustrations of the species are provided.
Directory of Open Access Journals (Sweden)
Manuel González-Guerrero
2016-07-01
Full Text Available Transition metals such as iron, copper, zinc, or molybdenum, are essential nutrients for plants. These elements are involved in almost every biological process, including photosynthesis, tolerance to biotic and abiotic stress, or symbiotic nitrogen fixation. However, plants often grow in soils with limiting metallic oligonutrient bioavailability. Consequently, to ensure the proper metal levels, plants have developed a complex metal uptake and distribution system, that not only involves the plant itself, but also its associated microorganisms. These microorganisms can simply increase metal solubility in soils and making them more accessible to the host plant, as well as induce the plant metal deficiency response, or deliver directly transition elements to cortical cells. Other, instead of providing metals can act as metal sinks, such as endosymbiotic rhizobia in legume nodules that requires relatively large amounts to carry out nitrogen fixation. In this review, we propose to do an overview of metal transport mechanisms in the plant-microbe system, emphasizing the role of arbuscular mycorrhizal fungi and endosymbiotic rhizobia.
Development of ESTs from chickpea roots and their use in diversity analysis of the Cicer genus
Directory of Open Access Journals (Sweden)
Eshwar K
2005-08-01
Full Text Available Abstract Background Chickpea is a major crop in many drier regions of the world where it is an important protein-rich food and an increasingly valuable traded commodity. The wild annual Cicer species are known to possess unique sources of resistance to pests and diseases, and tolerance to environmental stresses. However, there has been limited utilization of these wild species by chickpea breeding programs due to interspecific crossing barriers and deleterious linkage drag. Molecular genetic diversity analysis may help predict which accessions are most likely to produce fertile progeny when crossed with chickpea cultivars. While, trait-markers may provide an effective tool for breaking linkage drag. Although SSR markers are the assay of choice for marker-assisted selection of specific traits in conventional breeding populations, they may not provide reliable estimates of interspecific diversity, and may lose selective power in backcross programs based on interspecific introgressions. Thus, we have pursued the development of gene-based markers to resolve these problems and to provide candidate gene markers for QTL mapping of important agronomic traits. Results An EST library was constructed after subtractive suppressive hybridization (SSH of root tissue from two very closely related chickpea genotypes (Cicer arietinum. A total of 106 EST-based markers were designed from 477 sequences with functional annotations and these were tested on C. arietinum. Forty-four EST markers were polymorphic when screened across nine Cicer species (including the cultigen. Parsimony and PCoA analysis of the resultant EST-marker dataset indicated that most accessions cluster in accordance with the previously defined classification of primary (C. arietinum, C. echinospermum and C. reticulatum, secondary (C. pinnatifidum, C. bijugum and C. judaicum, and tertiary (C. yamashitae, C. chrossanicum and C. cuneatum gene-pools. A large proportion of EST alleles (45% were only
Zhai, Qiu-Li; Hu, Xiang-Dan; Xiao, Jing; Yu, Dong-Qing
2018-02-01
This study aimed to investigate the possible sensitivity of Astragalus polysaccharides, in order to improve the chemosensitivity of cervical cancer HeLa cells to cisplatin by regulating the cell autophagy, and explore its possible mechanism. In this study, HeLa cells were divided into control group, cisplatin group, Astragalus polysaccharide group, and Astragalus polysaccharide combined with cisplatin group. MTT assay was used to detect the proliferation of cervical cancer HeLa cells. Flow cytometry was used to detect the apoptosis and cycle of HeLa cells in each experimental group. RT-PCR was used to detect the mRNA expression of autophagy-related proteins beclin1, LC3Ⅱ and p62. The expression levels of autophagy-related proteins beclin1, LC3Ⅱ, LC3Ⅰ and p62 were detected by WB method. MTT results showed that compared with the control group, the proliferation of HeLa cells was significantly inhibited in each administration group( P HeLa cells was significantly increased( P HeLa cells to cisplatin by regulating the cell autophagy. Its possible mechanism of action is correlated with the up-regulation of autophagy-related proteins beclin1, the promote the conversion from LC3Ⅰ to LC3Ⅱ, the down-regulation of labeled protein p62, and the enhancement of HeLa cell autophagic activity, thereby increasing the sensitivity of HeLa cells to cisplatin chemotherapy. Copyright© by the Chinese Pharmaceutical Association.
Complete plastid genome of Astragalus mongholicus var. nakaianus (Fabaceae).
Choi, In-Su; Kim, Joo-Hwan; Choi, Byoung-Hee
2016-07-01
The first complete plastid genome (plastome) of the largest angiosperm genus, Astragalus, was sequenced for the Korean endangered endemic species A. mongholicus var. nakaianus. Its genome is relatively short (123,633 bp) because it lacks an Inverted Repeat (IR) region. It comprises 110 genes, including four unique rRNAs, 30 tRNAs, and 76 protein-coding genes. Similar to other closely related plastomes, rpl22 and rps16 are absent. The putative pseudogene with abnormal stop codons is atpE. This plastome has no additional inversions when compared with highly variable plastomes from IRLC tribes Fabeae and Trifolieae. Our phylogenetic analysis confirms the non-monophyly of Galegeae.
Characterization of indigenous rhizobia from Caatinga
Directory of Open Access Journals (Sweden)
Fernanda Cíntia Pires e Teixeira
2010-03-01
Full Text Available The aim of this study was to characterize rhizobial isolates from Cratylia mollis Mart. ex Benth, Calliandra depauperata Benth. and Mimosa tenuiflora (Willd. Poir. by means of rhizobial colonies morphology and restriction analysis of the 16S ribosomal gene (16S rDNA-ARDRA. Nodules were collected in the field and from plants cultivated in a greenhouse experiment using Caatinga soil samples. Sixty seven isolates were described by morphological analysis. Forty seven representative isolates were used for ARDRA analysis using seven restriction enzymes. We observed high diversity of both slow and fast-growing rhizobia that formed three morpho-physiological clusters. A few fast-growing isolates formed a group of strains of the Bradyrhizobium type; however, most of them diverged from the B. japonicum and B. elkanii species. Cratylia mollis nodule isolates were the most diverse, while all Mimosa tenuiflora isolates displayed fast growth with no pH change and were clustered into groups bearing 100% similarity, according to ARDRA results.
The Ribosomal RNA is a Useful Marker to Visualize Rhizobia Interacting with Legume Plants
Rinaudi, Luciana; Isola, Maria C.; Giordano, Walter
2004-01-01
Symbiosis between rhizobia and leguminous plants leads to the formation of nitrogen-fixing root nodules. In the present article, we recommend the use of the ribosomal RNA (rRNA) isolated from legume nodules in an experimental class with the purpose of introducing students to the structure of eukaryotic and prokaryotic ribosomes and of…
Nodulation outer proteins: double-edged swords of symbiotic rhizobia.
Staehelin, Christian; Krishnan, Hari B
2015-09-15
Rhizobia are nitrogen-fixing bacteria that establish a nodule symbiosis with legumes. Nodule formation depends on signals and surface determinants produced by both symbiotic partners. Among them, rhizobial Nops (nodulation outer proteins) play a crucial symbiotic role in many strain-host combinations. Nops are defined as proteins secreted via a rhizobial T3SS (type III secretion system). Functional T3SSs have been characterized in many rhizobial strains. Nops have been identified using various genetic, biochemical, proteomic, genomic and experimental approaches. Certain Nops represent extracellular components of the T3SS, which are visible in electron micrographs as bacterial surface appendages called T3 (type III) pili. Other Nops are T3 effector proteins that can be translocated into plant cells. Rhizobial T3 effectors manipulate cellular processes in host cells to suppress plant defence responses against rhizobia and to promote symbiosis-related processes. Accordingly, mutant strains deficient in synthesis or secretion of T3 effectors show reduced symbiotic properties on certain host plants. On the other hand, direct or indirect recognition of T3 effectors by plant cells expressing specific R (resistance) proteins can result in effector triggered defence responses that negatively affect rhizobial infection. Hence Nops are double-edged swords that may promote establishment of symbiosis with one legume (symbiotic factors) and impair symbiotic processes when bacteria are inoculated on another legume species (asymbiotic factors). In the present review, we provide an overview of our current understanding of Nops. We summarize their symbiotic effects, their biochemical properties and their possible modes of action. Finally, we discuss future perspectives in the field of T3 effector research. © 2015 Authors; published by Portland Press Limited.
Directory of Open Access Journals (Sweden)
F.V. Silva
2012-06-01
Full Text Available The aim of this work was to characterize rhizobia isolated from the root nodules of cowpea (Vigna unguiculata plants cultivated in Amazon soils samples by means of ARDRA (Amplified rDNA Restriction Analysis and sequencing analysis, to know their phylogenetic relationships. The 16S rRNA gene of rhizobia was amplified by PCR (polymerase chain reaction using universal primers Y1 and Y3. The amplification products were analyzed by the restriction enzymes HinfI, MspI and DdeI and also sequenced with Y1, Y3 and six intermediate primers. The clustering analysis based on ARDRA profiles separated the Amazon isolates in three subgroups, which formed a group apart from the reference isolates of Bradyrhizobium japonicum and Bradyrhizobium elkanii. The clustering analysis of 16S rRNA gene sequences showed that the fast-growing isolates had similarity with Enterobacter, Rhizobium, Klebsiella and Bradyrhizobium and all the slow-growing clustered close to Bradyrhizobium.
International Nuclear Information System (INIS)
Chaturvedi, C.; Singh, Renu
1990-01-01
32 P uptake in chickpea (Cicer arietinum L.) cultivars L-550 and C-235 as affected by vesicualr-arbuscular mycorrhiza (G. caledonicum) and Rhizobium was investigated in P deficient soils. Test plants coinoculated with the above two symbionts exhibited higher 32 P uptake than inoculated with either symbiont alone. Uninoculated plants showed minimum level of 32 P uptake. (author). 1 tab., 7 refs
Kulkarni, Suneeta; Nautiyal, Chandra Shekhar
1999-10-01
A method was developed for the fast screening and selection of high-temperature tolerant rhizobial strains from root nodules of Prosopis juliflora growing in alkaline soils. The high-temperature tolerant rhizobia were selected from 2,500 Rhizobium isolates with similar growth patterns on yeast mannitol agar plates after 72 h incubation at 30 and 45 degrees C, followed by a second screening at 47.5 degrees C. Seventeen high-temperature tolerant rhizobial strains having distinguishable protein band patterns were finally selected for further screening by subjecting them to temperature stress up to 60 degrees C in yeast mannitol broth for 6 h. The high-temperature tolerant strains were NBRI12, NBRI329, NBRI330, NBRI332, and NBRI133. Using this procedure, a large number of rhizobia from root nodules of P. juliflora were screened for high-temperature tolerance. The assimilation of several carbon sources, tolerance to high pH and salt stress, and ability to nodulate P. juliflora growing in a glasshouse and nursery of the strains were studied. All five isolates had higher plant dry weight in the range of 29.9 to 88.6% in comparison with uninoculated nursery-grown plants. It was demonstrated that it is possible to screen in nature for superior rhizobia exemplified by the isolation of temperature-tolerant strains, which established effective symbiosis with nursery-grown P. juliflora. These findings indicate a correlation between strain performance under in vitro stress in pure culture and strain behavior under symbiotic conditions. Pure culture evaluation may be a useful tool in search for Rhizobium strains better suited for soil environments where high temperature, pH, and salt stress constitutes a limitation for symbiotic biological nitrogen fixation.
Selenium hyperaccumulator plants like Stanleya pinnata, Astragalus bisulcatus and the newly discovered Se-accumulator Cardamine hupingshanensis may play an important role in the Se cycle from soil to plant to human in China. Se-hyperaccumulators can be used for agromining or for phytoremediation of ...
Directory of Open Access Journals (Sweden)
Milan Ugrinovic
2014-10-01
Full Text Available The impact of intercropping green bean (Phaseolus vulgaris L. with red beet (Beta vulgaris L. var. rubra and radish (Raphanus sativus L., two non-legume plants, on the plants’ yields, as well as the effect on occurrence and enumeration of microorganisms in the rhizosphere was studied. The intercrop efficacy evaluation, using Land equivalent ratio, revealed values above 1.0 for all intercropped treatments. Diversity of rhizobia from green bean nodules under different intercropping and fertilizing conditions was observed. On the basis of morphological and biochemical characteristics, 67 out of 158 isolates from green bean roots were selected as rhizobia (42.4%, confirmed by detection of 780 bp nifH gene fragments in nifH-PCR, and then clustered in 27 phenotype patterns. Production of exopolysaccharide succinoglycan was observed in 23 rhizobial isolates, while 6 were detected to solubilize tricalcium phosphate. Screening of genetic diversity using (GTG5-PCR fingerprinting showed presence of six different patterns on the 92% similarity level.
Directory of Open Access Journals (Sweden)
Hanne Frøkiær
Full Text Available Many foods and food components boost the immune system, but little data are available regarding the mechanisms by which they do. Bacterial strains have disparate effects in stimulating the immune system. In dendritic cells, the gram-negative bacteria Escherichia coli upregulates proinflammatory cytokines, whereas gram-positive Lactobacillus acidophilus induces a robust interferon (IFN-β response. The immune-modulating effects of astragalus root and elderberry fruit extracts were examined in bone marrow-derived murine dendritic cells that were stimulated with L. acidophilus or E. coli. IFN-β and other cytokines were measured by ELISA and RT-PCR. Endocytosis of fluorescence-labeled dextran and L. acidophilus in the presence of elderberry fruit or astragalus root extract was evaluated in dendritic cells. Our results show that both extracts enhanced L. acidophilus-induced IFN-β production and slightly decreased the proinflammatory response to E. coli. The enhanced IFN-β production was associated with upregulation of toll-like receptor 3 and to a varying degree, the cytokines IL-12, IL-6, IL-1β and TNF-α. Both extracts increased endocytosis in immature dendritic cells, and only slightly influenced the viability of the cells. In conclusion, astragalus root and elderberry fruit extracts increase the IFN-β inducing activity of L. acidophilus in dendritic cells, suggesting that they may exert antiviral and immune-enhancing activity.
Directory of Open Access Journals (Sweden)
Dilfuza Egamberdieva
2017-09-01
Full Text Available Salinity causes disturbance in symbiotic performance of plants, and increases susceptibility of plants to soil-borne pathogens. Endophytic bacteria are an essential determinant of cross-tolerance to biotic and abiotic stresses in plants. The aim of this study was to isolate non–rhizobial endophytic bacteria from the root nodules of chickpea (Cicer arietinum L., and to assess their ability to improve plant growth and symbiotic performance, and to control root rot in chickpea under saline soil conditions. A total of 40 bacterial isolates from internal root tissues of chickpea grown in salinated soil were isolated. Four bacterial isolates, namely Bacillus cereus NUU1, Achromobacter xylosoxidans NUU2, Bacillus thuringiensis NUU3, and Bacillus subtilis NUU4 colonizing root tissue demonstrated plant beneficial traits and/or antagonistic activity against F. solani and thus were characterized in more detail. The strain B. subtilis NUU4 proved significant plant growth promotion capabilities, improved symbiotic performance of host plant with rhizobia, and promoted yield under saline soil as compared to untreated control plants under field conditions. A combined inoculation of chickpea with M. ciceri IC53 and B. subtilis NUU4 decreased H2O2 concentrations and increased proline contents compared to the un-inoculated plants indicating an alleviation of adverse effects of salt stress. Furthermore, the bacterial isolate was capable to reduce the infection rate of root rot in chickpea caused by F. solani. This is the first report of F. solani causing root rot of chickpea in a salinated soil of Uzbekistan. Our findings demonstrated that the endophytic B. subtilis strain NUU4 provides high potentials as a stimulator for plant growth and as biological control agent of chickpea root rot under saline soil conditions. These multiple relationships could provide promising practical approaches to increase the productivity of legumes under salt stress.
Song, Qing-Hua; Xu, Rong-Mei; Zhang, Quan-Hai; Shen, Guo-Qing; Ma, Ming; Zhao, Xin-Ping; Guo, Yan-Hua; Wang, Yi
2014-01-01
To observe the combined effects of astragalus soup and persistent Taiji boxing on improving the immunity of women of advanced years. 120 elderly women lacking daily exercise were chosen as the study subjects. By using the table of random numbers, they were then divided into the control group and the experiment group, consisting of 60 each. The control group practiced Taiji boxing for 45 minutes twice a day. The experiment group did the same, and, in addition, took astragalus soup after each boxing. Indexes related to physical immunity of the two groups were observed and compared when they were first chosen, when the alternative treatment was applied three, six and twelve months later, respectively. The two groups demonstrated no significant differences in general data and research indexes when chosen (P > 0.05). Three months after the two groups were chosen and treated differently, the control group demonstrated no significant improvement while most indexes of the experiment group improved considerably (P > 0.05). After six months, the related indexes of both groups improved substantially (P soup.
Bagheri, Seyyed Majid; Keyhani, Leila; Heydari, Mehrangiz; Dashti-R, Mohammad Hossein
2015-01-01
In Iranian traditional medicine, gum obtained from Astragalus gummifer and some other species of Astragalus was used as analgesic agent. In this study, we investigated the antinociceptive effect of several concentrations (125, 250, and 500 μg/kg body weight) of Astragalus gummifer gum (AGG) on thermal and acetic acid induced pain in mice. AGG was dissolved in distillated water and injected i.p to male mice 15 minute before the onset of experiment. Writhing and hot-plate tests were applied to study the analgesic effect of AGG and compared with that of diclofenac sodium (30 mg/kg, i.p.) or morphine (8 mg/kg, i.p). To investigate the mechanisms involved in antinociception, yohimbine, naloxone, glibenclamide, and theophylline were used in writhing test. These drugs were injected intraperitoneally 15 min before the administration of AGG. The number of writhes were counted in 30 minutes and analyzed. AGG exhibited a significant antinociceptive effect and the most effective dose of AGG was 500 μg/kg. The most maximum possible effect (%MPE) was observed (117.4%) 15 min after drug administration. The %inhibition of acetic acid-induced writhing in AGG 125, 250 and 500 was 47%, 50% and 54% vs %15 of control and 66.3% of diclofenac sodium group. The antinociceptive effect induced by this gum in the writhing test was reversed by the systemic administration of yohimbine (α2-adrenergic antagonist), but naloxone, glibenclamide, and theophylline did not reverse this effect. The findings of this study indicated that AGG induced its antinociceptive through the adrenergic system.
Tripartite symbiosis of Sophora tomentosa, rhizobia and arbuscular mycorhizal fungi.
Toma, Maíra Akemi; Soares de Carvalho, Teotonio; Azarias Guimarães, Amanda; Martins da Costa, Elaine; Savana da Silva, Jacqueline; de Souza Moreira, Fatima Maria
Sophora tomentosa is a pantropical legume species with potential for recovery of areas degraded by salinization, and for stabilization of sand dunes. However, few studies on this species have been carried out, and none regarding its symbiotic relationship with beneficial soil microorganisms. Therefore, this study aimed to evaluate the diversity of nitrogen-fixing bacteria isolated from nodules of Sophora tomentosa, and to analyze the occurrence of colonization of arbuscular mycorrhizal fungi on the roots of this legume in seafront soil. Thus, seeds, root nodules, and soil from the rhizosphere of Sophora tomentosa were collected. From the soil samples, trap cultures with this species were established to extract spores and to evaluate arbuscular mycorhizal fungi colonization in legume roots, as well as to capture rhizobia. Rhizobia strains were isolated from nodules collected in the field or from the trap cultures. Representative isolates of the groups obtained in the similarity dendrogram, based on phenotypic characteristics, had their 16S rRNA genes sequenced. The legume species showed nodules with indeterminate growth, and reddish color, distributed throughout the root. Fifty-one strains of these nodules were isolated, of which 21 were classified in the genus Bacillus, Brevibacillus, Paenibacillus, Rhizobium and especially Sinorhizobium. Strains closely related to Sinorhizobium adhaerens were the predominant bacteria in nodules. The other genera found, with the exception of Rhizobium, are probably endophytic bacteria in the nodules. Arbuscular mycorrhizal fungi was observed colonizing the roots, but arbuscular mycorhizal fungi spores were not found in the trap cultures. Therefore Sophora tomentosa is associated with both arbuscular mycorhizal fungi and nodulating nitrogen-fixing bacteria. Copyright © 2017 Sociedade Brasileira de Microbiologia. Published by Elsevier Editora Ltda. All rights reserved.
Directory of Open Access Journals (Sweden)
Daniel J Ballhorn
Full Text Available Plant associations with root microbes represent some of the most important symbioses on earth. While often critically promoting plant fitness, nitrogen-fixing rhizobia and arbuscular mycorrhizal fungi (AMF also demand significant carbohydrate allocation in exchange for key nutrients. Though plants may often compensate for carbon loss, constraints may arise under light limitation when plants cannot extensively increase photosynthesis. Under such conditions, costs for maintaining symbioses may outweigh benefits, turning mutualist microbes into parasites, resulting in reduced plant growth and reproduction. In natural systems plants commonly grow with different symbionts simultaneously which again may interact with each other. This might add complexity to the responses of such multipartite relationships. We experimented with lima bean (Phaseolus lunatus, which efficiently forms associations with both types of root symbionts. We applied full light and low-light to each of four treatments of microbial inoculation. After an incubation period of 14 weeks, we quantified vegetative aboveground and belowground biomass and number and viability of seeds to determine effects of combined inoculant and light treatment on plant fitness. Under light-limited conditions, vegetative and reproductive traits were inhibited in AMF and rhizobia inoculated lima bean plants relative to controls (un-colonized plants. Strikingly, reductions in seed production were most critical in combined treatments with rhizobia x AMF. Our findings suggest microbial root symbionts create additive costs resulting in decreased plant fitness under light-limited conditions.
Nowak, Petri; Soupas, Laura; Thomas-Oates, Jane; Lindström, Kristina
2004-04-28
Sinorhizobium arboris and S. kostiense are rhizobia that nodulate the tropical leguminous trees Acacia senegal and Prosopis chilensis. The lipochito-oligosaccharidic signalling molecules (LCOs) of S. arboris HAMBI 2361 and S. kostiense HAMBI 2362 were analyzed by mass spectrometry. The major LCOs produced by the strains were shown to be pentameric, acylated with common fatty acids, N-methylated, O-6-carbamoylated and partially sulfated, as are the LCOs characterized to date for other Acacia-nodulating rhizobia. Besides the major LCOs the two strains produced (i) tetrameric LCOs, (ii) LCOs acylated with fatty acids other than those commonly found, (iii) LCOs with only an acyl substituent and (iv) noncarbamoylated LCOs. Production of LCOs (i) to (iii) are novel among Acacia-nodulating rhizobia. The roles of the different structural characteristics of LCOs in the rhizobium-A. senegal symbiosis are discussed. Specific structural features of the LCOs are proposed to be important in the selection of effective nitrogen-fixing rhizobia by A. senegal.
Directory of Open Access Journals (Sweden)
Muhammad Zafar-ul-Hye
2013-05-01
Full Text Available Plant growth promoting rhizobacteria (PGPR containing ACC-deaminase in combination with rhizobia can improve the growth and nodulation in plants by suppressing the endogenous level of ethylene. In the present study, ten strains, each of PGPR and rhizobia from the previously screened cultures were tested for their effect as co-inoculants on growth and nodulation of lentil in growth pouches under axenic conditions. Results showed that most of the combinations improved the lentil growth as compared to the un-inoculated control. Maximum increase in shoot length (1.87 fold, root length (1.97 fold and total biomass (1.98 fold over the un-inoculated control was observed in the treatment where the lentil seedlings were inoculated with the combination Z24P10. Co-inoculation also improved the nodulation in lentil and the maximum number of nodules plant-1 (24 nodules were observed in the combination Z22P10. However, there was no nodulation in few combinations. It is concluded that the co-inoculation with rhizobia and PGPR containing ACC-deaminase has improved the growth and nodulation in lentil under axenic conditions and the selected combinations may be evaluated in pot and field trials
Directory of Open Access Journals (Sweden)
Seyyed Majid Bagheri
2015-01-01
Full Text Available Background: In Iranian traditional medicine, gum obtained from Astragalus gummifer and some other species of Astragalus was used as analgesic agent. Objective: In this study, we investigated the antinociceptive effect of several concentrations (125, 250, and 500 μg/kg body weight of Astragalus gummifer gum (AGG on thermal and acetic acid induced pain in mice. Materials and Methods: AGG was dissolved in distillated water and injected i.p to male mice 15 minute before the onset of experiment. Writhing and hot-plate tests were applied to study the analgesic effect of AGG and compared with that of diclofenac sodium (30 mg/kg, i.p. or morphine (8 mg/kg, i.p. To investigate the mechanisms involved in antinociception, yohimbine, naloxone, glibenclamide, and theophylline were used in writhing test. These drugs were injected intraperitoneally 15 min before the administration of AGG. The number of writhes were counted in 30 minutes and analyzed. Results: AGG exhibited a significant antinociceptive effect and the most effective dose of AGG was 500 μg/kg. The most maximum possible effect (%MPE was observed (117.4% 15 min after drug administration. The %inhibition of acetic acid-induced writhing in AGG 125, 250 and 500 was 47%, 50% and 54% vs %15 of control and 66.3% of diclofenac sodium group. The antinociceptive effect induced by this gum in the writhing test was reversed by the systemic administration of yohimbine (α2 -adrenergic antagonist, but naloxone, glibenclamide, and theophylline did not reverse this effect. Conclusions: The findings of this study indicated that AGG induced its antinociceptive through the adrenergic system.
Paço, Ana; Brígido, Clarisse; Alexandre, Ana; Mateos, Pedro F; Oliveira, Solange
2016-01-01
The ClpB chaperone is known to be involved in bacterial stress response. Moreover, recent studies suggest that this protein has also a role in the chickpea-rhizobia symbiosis. In order to improve both stress tolerance and symbiotic performance of a chickpea microsymbiont, the Mesorhizobium mediterraneum UPM-Ca36T strain was genetically transformed with pPHU231 containing an extra-copy of the clpB gene. To investigate if the clpB-transformed strain displays an improved stress tolerance, bacterial growth was evaluated under heat and acid stress conditions. In addition, the effect of the extra-copies of the clpB gene in the symbiotic performance was evaluated using plant growth assays (hydroponic and pot trials). The clpB-transformed strain is more tolerant to heat shock than the strain transformed with pPHU231, supporting the involvement of ClpB in rhizobia heat shock tolerance. Both plant growth assays showed that ClpB has an important role in chickpea-rhizobia symbiosis. The nodulation kinetics analysis showed a higher rate of nodule appearance with the clpB-transformed strain. This strain also induced a greater number of nodules and, more notably, its symbiotic effectiveness increased ~60% at pH5 and 83% at pH7, compared to the wild-type strain. Furthermore, a higher frequency of root hair curling was also observed in plants inoculated with the clpB-transformed strain, compared to the wild-type strain. The superior root hair curling induction, nodulation ability and symbiotic effectiveness of the clpB-transformed strain may be explained by an increased expression of symbiosis genes. Indeed, higher transcript levels of the nodulation genes nodA and nodC (~3 folds) were detected in the clpB-transformed strain. The improvement of rhizobia by addition of extra-copies of the clpB gene may be a promising strategy to obtain strains with enhanced stress tolerance and symbiotic effectiveness, thus contributing to their success as crop inoculants, particularly under
Directory of Open Access Journals (Sweden)
Ana Paço
Full Text Available The ClpB chaperone is known to be involved in bacterial stress response. Moreover, recent studies suggest that this protein has also a role in the chickpea-rhizobia symbiosis. In order to improve both stress tolerance and symbiotic performance of a chickpea microsymbiont, the Mesorhizobium mediterraneum UPM-Ca36T strain was genetically transformed with pPHU231 containing an extra-copy of the clpB gene. To investigate if the clpB-transformed strain displays an improved stress tolerance, bacterial growth was evaluated under heat and acid stress conditions. In addition, the effect of the extra-copies of the clpB gene in the symbiotic performance was evaluated using plant growth assays (hydroponic and pot trials. The clpB-transformed strain is more tolerant to heat shock than the strain transformed with pPHU231, supporting the involvement of ClpB in rhizobia heat shock tolerance. Both plant growth assays showed that ClpB has an important role in chickpea-rhizobia symbiosis. The nodulation kinetics analysis showed a higher rate of nodule appearance with the clpB-transformed strain. This strain also induced a greater number of nodules and, more notably, its symbiotic effectiveness increased ~60% at pH5 and 83% at pH7, compared to the wild-type strain. Furthermore, a higher frequency of root hair curling was also observed in plants inoculated with the clpB-transformed strain, compared to the wild-type strain. The superior root hair curling induction, nodulation ability and symbiotic effectiveness of the clpB-transformed strain may be explained by an increased expression of symbiosis genes. Indeed, higher transcript levels of the nodulation genes nodA and nodC (~3 folds were detected in the clpB-transformed strain. The improvement of rhizobia by addition of extra-copies of the clpB gene may be a promising strategy to obtain strains with enhanced stress tolerance and symbiotic effectiveness, thus contributing to their success as crop inoculants
del Papa, María F.; Balagué, Laura J.; Sowinski, Susana Castro; Wegener, Caren; Segundo, Eduardo; Abarca, Francisco Martínez; Toro, Nicolás; Niehaus, Karsten; Pühler, Alfred; Aguilar, O. Mario; Martínez-Drets, Gloria; Lagares, Antonio
1999-01-01
We describe the isolation and characterization of alfalfa-nodulating rhizobia from acid soils of different locations in Central Argentina and Uruguay. A collection of 465 isolates was assembled, and the rhizobia were characterized for acid tolerance. Growth tests revealed the existence of 15 acid-tolerant (AT) isolates which were able to grow at pH 5.0 and formed nodules in alfalfa with a low rate of nitrogen fixation. Analysis of those isolates, including partial sequencing of the genes encoding 16S rRNA and genomic PCR-fingerprinting with MBOREP1 and BOXC1 primers, demonstrated that the new isolates share a genetic background closely related to that of the previously reported Rhizobium sp. Or191 recovered from an acid soil in Oregon (B. D. Eardly, J. P. Young, and R. K. Selander, Appl. Environ. Microbiol. 58:1809–1815, 1992). Growth curves, melanin production, temperature tolerance, and megaplasmid profiles of the AT isolates were all coincident with these characteristics in strain Or191. In addition to the ability of all of these strains to nodulate alfalfa (Medicago sativa) inefficiently, the AT isolates also nodulated the common bean and Leucaena leucocephala, showing an extended host range for nodulation of legumes. In alfalfa, the time course of nodule formation by the AT isolate LPU 83 showed a continued nodulation restricted to the emerging secondary roots, which was probably related to the low rate of nitrogen fixation by the largely ineffective nodules. Results demonstrate the complexity of the rhizobial populations present in the acidic soils represented by a main group of N2-fixing rhizobia and a second group of ineffective and less-predominant isolates related to the AT strain Or191. PMID:10103231
Directory of Open Access Journals (Sweden)
Rukhsana Satar
Full Text Available Abstract The present study demonstrates the immobilization of β-galactosidase from Cicer arietinum on a simple and inexpensive matrix, glutaraldehyde functionalized agarose (GFA, to suggest its potential application in hydrolyzing whey lactose in biotechnology industries. The designed matrix provided large surface area for the immobilization of β-galactosidase, apart from exhibiting greater biocatalytic activity in terms of selectivity, loading and stability. GFA retained 83% enzyme activity as a result of immobilization. Soluble and GFA bound Cicer arietinum β-galactosidase showed the same pH and temperature-optima at pH 5.0 and at 50 °C, respectively. However, immobilized enzyme exhibited a greater fraction of activity at both acidic and basic pH, and at higher temperature ranges. GFA bound enzyme lost only 20 % enzyme in the presence of 3% galactose, and retained 70 % activity even after its sixth repeated use. Immobilized enzyme showed pronounced lactose hydrolysis from whey in batch processes at 55 °C as compared to enzyme in solution.
Gao, Yugang; Zhao, Xueliang; Zang, Pu; Liu, Qun; Wei, Gongqing; Zhang, Lianxue
2014-01-01
The bovine viral diarrhea virus (BVDV), a single-stranded RNA virus, can cause fatal diarrhea syndrome, respiratory problems, and reproductive disorders in herds. Over the past few years, it has become clear that the BVDV infection rates are increasing and it is likely that an effective vaccine for BVDV will be needed. In this study, transgenic Astragalus was used as an alternative productive platform for the expression of glycoprotein E0. The immunogenicity of glycoprotein E0 expressed in transgenic Astragalus was detected in deer. The presence of pBI121-E0 was confirmed by polymerase chain reaction (PCR), transcription was verified by reverse transcription- (RT-) PCR, and recombinant protein expression was confirmed by ELISA and Western blot analyses. Deer that were immunized subcutaneously with the transgenic plant vaccine developed specific humoral and cell-mediated immune responses against BVDV. This study provides a new method for a protein with weak immunogenicity to be used as part of a transgenic plant vaccine.
Directory of Open Access Journals (Sweden)
Yugang Gao
2014-01-01
Full Text Available The bovine viral diarrhea virus (BVDV, a single-stranded RNA virus, can cause fatal diarrhea syndrome, respiratory problems, and reproductive disorders in herds. Over the past few years, it has become clear that the BVDV infection rates are increasing and it is likely that an effective vaccine for BVDV will be needed. In this study, transgenic Astragalus was used as an alternative productive platform for the expression of glycoprotein E0. The immunogenicity of glycoprotein E0 expressed in transgenic Astragalus was detected in deer. The presence of pBI121-E0 was confirmed by polymerase chain reaction (PCR, transcription was verified by reverse transcription- (RT- PCR, and recombinant protein expression was confirmed by ELISA and Western blot analyses. Deer that were immunized subcutaneously with the transgenic plant vaccine developed specific humoral and cell-mediated immune responses against BVDV. This study provides a new method for a protein with weak immunogenicity to be used as part of a transgenic plant vaccine.
Wang, S F; Wang, Q; Jiao, L J; Huang, Y L; Garfield, D; Zhang, J; Xu, L
2016-06-01
Traditional Chinese Medicine (tcm) is used in China as part of the treatment for non-small-cell lung cancer (nsclc) and often includes prescription of herbal therapy based on syndrome differentiation. Studies of various Astragalus-based Chinese medicines combined with platinum-based chemotherapy in the treatment of lung cancer are popular in East Asia, particularly in China. The aim of the present study was to perform a systematic review and meta-analysis comparing platinum-based chemotherapy alone with platinum-based chemotherapy plus Astragalus-based Chinese botanicals, with and without prescription based on syndrome differentiation, as first-line treatment for advanced nsclc. We searched the Chinese Biomedical Literature database, the China National Knowledge Internet, the VIP Chinese Science and Technology Periodicals Database, PubMed, embase, the Cochrane databases, and abstracts presented at meetings of the American Society of Clinical Oncology, the World Conference on Lung Cancer, the European Society for Medical Oncology, and the Chinese Society of Clinical Oncology for all eligible studies. Endpoints were overall survival; 1-year, 2-year, and 3-year survival rates; performance status; overall response rate; and grade 3 or 4 adverse events. Subgroup analyses based on herbal formulae individualized using syndrome differentiation or on oral or injection patent medicines were performed using the Stata software application (version 11.0: StataCorp LP, College Station, TX, U.S.A.) and a fixed-effects or random-effects model in case of heterogeneity. Results are expressed as a hazard ratio (hr) or relative risk (rr), with corresponding 95% confidence intervals (cis). Seventeen randomized studies with scores on the Jadad quality scale of 2 or more, representing 1552 patients, met the inclusion criteria. Compared with platinum-based chemotherapy alone, the addition of Astragalus-based tcm to chemotherapy was associated with significantly increased overall survival
Rhizobia symbiosis of seven leguminous species growing along Xindian riverbank of Northern Taiwan
Directory of Open Access Journals (Sweden)
Cheng-Tai Huang
2018-01-01
Full Text Available Legume-rhizobia symbioses of seven leguminous species growing along Xindian riverbank of Northern Taiwan were investigated in this study. These legumes form either determinate or indeterminate types of root nodules. The determinate nodules of Alysicarpus vaginalis, Desmodium. triflorum, D. heterophyllum, Sesbania cannabina and the indeterminate nodules of Mimosa pudica harbored bacteroids of morphological uniformity (length of 1-3 μm, while the indeterminate nodules of Crotalaria zanzibarica and Trifolium repens contained bacteroids of highly pleomorphism (size varying from 1 to 5 μm. The enclosed bacteria were isolated from respective nodules, and twenty slow-growing and nine fast-growing rhizobial isolates were recovered. The slow-growing isolates were classified to the genus Bradyrhizobium based on the 16S rRNA sequences, whereas the fast-growing rhizobia comprise four genera, Neorhizobium, Rhizobium, Cupriavidus and Paraburkholderia. Results of stable isotope analyses revealed that the seven leguminous species had similar and consistently negative δ15N values in leaves (mean of -1.2 ‰, whereas the values were positive (varying from 3.7 to 7.3 ‰ in the nodules. These values were significantly higher in the indeterminate nodules than those in the determinate ones. In addition, variations in the values of leaf δ13C (varying from -29 to -34‰ among the seven legumes were measured, indicating their photosynthetic water use efficiencies were different. This is the first field survey to report the rhizobial diversity and the nutrient relationships of sympatric legume in Taiwan.
Grönemeyer, Jann L.; Kulkarni, Ajinkya; Berkelmann, Dirk; Hurek, Thomas; Reinhold-Hurek, Barbara
2014-01-01
The rhizobial community indigenous to the Okavango region has not yet been characterized. The isolation of indigenous rhizobia can provide a basis for the formulation of a rhizobial inoculant. Moreover, their identification and characterization contribute to the general understanding of species distribution and ecology. Isolates were obtained from nodules of local varieties of the pulses cowpea, Bambara groundnut, peanut, hyacinth bean, and common bean. Ninety-one of them were identified by B...
Evaluation of nitrogen fixation rates of soybean and species of rhizobia
International Nuclear Information System (INIS)
Ping Shuzhen; You Chongbiao
1993-01-01
Using 1 '5N dilution technique the nitrogen fixing rates were estimated from symbiosis between 20 varieties of soybean and 2 species of rhizobia: Bradyrhizobium japonicum and Sinorhizobium fredii. The nodulation status such as size and number of nodules differed among the varieties and species of bacteria. The Ndfa% of these varieties ranged from 40% ∼ 59% for S. fredii, 38% ∼ 62% for B. japonicum and 32% ∼ 56% for inoculant of the mixture of the species, respectively. Among 3 inoculants the B. japonicum is the best one. The variety of soybean, however, plays a significant role in the symbiosis. Therefore, improving the soybean and selecting a good partner for raising the yield and nitrogen fixation are important
Pu, Wenjun; Wang, Dongmei; Zhou, Dan
2015-09-01
Eight phenolic compounds were isolated using bio-guided isolation and purified from the roots of Astragalus taipaishanensis Y. C. Ho et S. B. Ho (A. taipaishanensis) for the first time. Their structures were elucidated by ESI-MS, HR-ESI-MS, 1D-NMR and 2D-NMR as 7,2‧-dihydroxy-3‧,4‧-dimethoxy isoflavan (1), formononetin (2), isoliquiritigenin (3), quercetin (4), kaempferol (5), ononin (6), p-hydroxybenzoic acid (7) and vanillic acid (8). Six flavonoids (compounds 1-6) exhibited stronger antioxidant activities (determined by DPPH, ABTS, FRAP and lipid peroxidation inhibition assays) than those of BHA and TBHQ and also demonstrated noticeable protective effects (particularly quercetin and kaempferol) on Escherichia coli under oxidative stress. Additionally, the chemical constituents compared with those of Astragalus membranaceus and the structure-activity relationship of the isolated compounds were both analyzed. The results clearly demonstrated that A. taipaishanensis has the potential to be selected as an alternative medicinal and food plant that can be utilized in health food products, functional tea and pharmaceutical products.
International Nuclear Information System (INIS)
Wu Yajun; Zheng Bingjie; Shi Lan; Fan Yaping
2004-01-01
Objective: To explore the effect of intravenous or intra-renal-capsular administration of astragalus and dopamine on the serum NO and renal tissue NO, ET contents in rat models of acute renal failure. Methods: Experimental rat models of acute renal failure induced by intraperitoneal injection of E. Coli endotoxin (lipo-polysaccharide) were prepared (n=60). Treatment with astragalus and dopamine was administered via either intravenous on intra-renal-capsular route (n=20 in each group). Serum NO and renal tissue NO (with nitric acid reductase method), ET (with RIA) contents were determined at 4, 8, 12, 16h after injection of endotoxin. Twenty shock models were left untreated and additional twenty rats receiving saline injection only served as controls. Results: In the intravenously treated group, the increase of serum NO and renal tissue NO, ET contents were significantly less than those in the untreated group (P<0.05). In the group treated via the intracapsular route , the increase of renal tissue NO and ET contents were much less than those in the intravenous group at 12 and 16h (P<0.05). Conclusion: Combined treatment with astragalus and dopamine could abate the abnormally high renal tissue contents of NO and ET after endotoxin shock in experimental rats and treatment with intra capsular administration seems to be more effective. (authors)
Directory of Open Access Journals (Sweden)
Gowda Cholenahalli LL
2008-10-01
Full Text Available Abstract Background Plant genetic resources (PGR are the basic raw materials for future genetic progress and an insurance against unforeseen threats to agricultural production. An extensive characterization of PGR provides an opportunity to dissect structure, mine allelic variations, and identify diverse accessions for crop improvement. The Generation Challenge Program http://www.generationcp.org conceptualized the development of "composite collections" and extraction of "reference sets" from these for more efficient tapping of global crop-related genetic resources. In this study, we report the genetic structure, diversity and allelic richness in a composite collection of chickpea using SSR markers, and formation of a reference set of 300 accessions. Results The 48 SSR markers detected 1683 alleles in 2915 accessions, of which, 935 were considered rare, 720 common and 28 most frequent. The alleles per locus ranged from 14 to 67, averaged 35, and the polymorphic information content was from 0.467 to 0.974, averaged 0.854. Marker polymorphism varied between groups of accessions in the composite collection and reference set. A number of group-specific alleles were detected: 104 in Kabuli, 297 in desi, and 69 in wild Cicer; 114 each in Mediterranean and West Asia (WA, 117 in South and South East Asia (SSEA, and 10 in African region accessions. Desi and kabuli shared 436 alleles, while wild Cicer shared 17 and 16 alleles with desi and kabuli, respectively. The accessions from SSEA and WA shared 74 alleles, while those from Mediterranean 38 and 33 alleles with WA and SSEA, respectively. Desi chickpea contained a higher proportion of rare alleles (53% than kabuli (46%, while wild Cicer accessions were devoid of rare alleles. A genotype-based reference set captured 1315 (78% of the 1683 composite collection alleles of which 463 were rare, 826 common, and 26 the most frequent alleles. The neighbour-joining tree diagram of this reference set represents
Jiang, Yiping; Qi, Xiaohui; Gao, Kai; Liu, Wenjun; Li, Na; Cheng, Ningbo; Ding, Gang; Huang, Wenzhe; Wang, Zhenzhong; Xiao, Wei
2016-10-01
Four Astragalus polysaccharides (APS1-APS4) were isolated from the water extract of Radix Astragali and purified through ethanol precipitation with 20 %, 40 %, 60 % and 80 % ethanol, respectively. The total sugar content was measured by sulfuric acid-phenol method. Their molecular weight was determined using high performance gel permeation chromatography (HPGPC) and their monosaccharide composition was analyzed by reversed-phase high performance liquid chromatography (HPLC) after pre-column derivatization. Then the immunobiologic activity of APS was evaluated by the experiment of spleen lymphocytes proliferation in vitro. The data suggested that precipitation by different concentration of ethanol will obtain different molecular weight APS, the higher concentration of ethanol the smaller molecular weight for APS. The molecular weights of four APS were 257.7 kDa, 40.1 kDa, 15.3 kDa and 3.2 kDa. Monosaccharide composition analysis indicated that APS1 consisted of glucose only, and APS2 all consisted of arabinose. APS3 consisted of rhamnose, glucose, galactose and arabinose and APS4 consisted of galactose and arabinose, in a molar ratio of 1:10.76:6.55:12 and 3.02:1. The result of immunobiologic activity assay showed that both APS2 and APS3 can effectively stimulate normal spleen lymphocyte proliferation in vitro. Apart from this, the effect of APS2 also showed dose dependent tendency from 6.25 μg/mL to 800 μg/mL. The result of this research indicated that Astragalus polysaccharides, which consist of arabinose and their molecular weight between 15.2 kDa to 40.1 kDa, neither too high nor too low, had significant immune activity.
Extraction and characterization of chickpea (Cicer arietinum) albumin and globulin.
Liu, L H; Hung, T V; Bennett, L
2008-06-01
Albumin and globulin fractions of 1 Desi and 2 Kabuli varieties of chickpeas (Cicer arietinum) were extracted with water and salt solutions (K(2)SO(4) and NaCl). The extractable yields and particularly the albumin-globulin ratio varied greatly with the extraction medium and chickpea variety. Depending on the procedure employed, albumin could be extracted as a major fraction of chickpea proteins. Higher levels of essential amino acids and sulfur containing amino acids were found in albumins than in globulins of all chickpeas investigated. The common structural characteristics of both Kabuli and Desi chickpea albumins and globulins were clearly identified by densitometric profiles of their sodium dodecyl sulfate polyacrylamide gel patterns. Albumins contained subunits with higher molecular weights than those of globulins. The in vitro digestibility of the chickpea proteins by papain, pepsin, chymotrypsin, and trypsin indicated that globulins were more susceptible to proteolytic hydrolysis.
Lam, Hong Kiat; Ross, John J; McAdam, Erin L; McAdam, Scott A M
2016-07-02
Chlorinated auxin (4-chloroindole-3-acetic acid, 4-Cl-IAA), a highly potent plant hormone, was once thought to be restricted to species of the tribe Fabeae within the Fabaceae, until we recently detected this hormone in the seeds of Medicago, Melilotus and Trifolium species. The absence of 4-Cl-IAA in the seeds of the cultivated species Cicer aeritinum from the Cicerae tribe, immediately basal to the Fabeae and Trifolieae tribes, suggested a single evolutionary origin of 4-Cl-IAA. Here, we provide a more robust phylogenetic placement of the ability to produce chlorinated auxin by screening key species spanning this evolutionary transition. We report no detectable level of 4-Cl-IAA in Cicer echinospermum (a wild relative of C. aeritinum) and 4 species (Galega officinalis, Parochetus communis, Astragalus propinquus and A. sinicus) from tribes or clades more basal or sister to the Cicerae tribe. We did detect 4-Cl-IAA in the dry seeds of 4 species from the genus Ononis that are either basal to the genera Medicago, Melilotus and Trigonella or basal to, but still within, the Fabeae and Trifolieae (ex. Parochetus) clades. We conclude that the single evolutionary origin of this hormone in seeds can be used as a phylogenetically informative trait within the Fabaceae.
SOMER, Güler; ÇALIŞKAN, A. Cengiz
2007-01-01
Astragalus plants have a wide range of applications in pharmaceuticals (gum tragacanth), as thickening agents in foods, and may have applications in controlling cancer cells. They are used as feed for animals and they are indicator plants for selenium. Because of their use in health-related areas it is very important to determine their selenium and trace element content with high accuracy. A new differential pulse polarographic method was established for trace element determination (...
International Nuclear Information System (INIS)
Boakye, Emmanuel Yaw
2013-03-01
Trees in general and leguminous trees in particular form an integral part of the traditional farming systems in Ghana. Compared to other plants, leguminous trees have the advantage that, they are generally capable of growing better on N-deficient soils due to their ability to convert unavailable atmospheric N_2 into plant utilizable N. However, several factors including the abundance and effectiveness of the specific rhizobial partner, the available N and P in soil, are among the important factors that severely affect how much N_2 can be fixed in these trees. This study was thus conducted to assess the abundance and characteristics of the rhizobia that nodulate 18 selected indigenous tree legumes grown in three representative soils of Ghana and to ascertain important soil nutrient constraints that affect their nodulation, nitrogen fixation and growth. The three soils belonged to the Hatso, Toje and Alajo local series (equivalent to Haplic lixisol, Rhodic lixisol and Calcic vertisol, respectively). The 200 Rhizobium isolates obtained from nodules of these tree legumes were found to be highly diverse and varied in their abilities to nodulate legumes other than the host plants from which they were isolated. The isolates were further characterized culturally, metabolically, phenotypically and for their effectiveness in fixing atmospheric nitrogen. Of the 10 multi-purpose shrubs and tree species belonging to the subfamily Mimosoideae examined as much as 70% of them formed nodules in the three soils, whiles only 20% and 10% of the tree legumes that formed nodules belong to Papilionoideae and Caesalpinoideae sub-families respectively. As to the Rhizobium isolates from these shrubs and tree species, those obtained from Pithecelobium spp and Melletia thonningi appeared to be highly specific, nodulating only their respective homologous hosts, while those from Acacia mangium, Albizia lebbek and Acacia auricloformis appeared to be slightly promiscuous, and moderately
A new species of Astragalus (Fabaceae from west coast of Baikal Lake (Irkutsk Oblast
Directory of Open Access Journals (Sweden)
N. V. Stepantsova
2015-05-01
Full Text Available A new species, Astragalus rytyensis Stepantsova (Fabaceae, growing on the west coast of the lake Baikal, is described. Morphological differences from related taxa – A. versicolor Pall., A. austrosibiricus Schischk., and A. inopinatus Boriss., are discussed and uncertain position of the new species in the system of the genus is emphasized which is intermediate between subg. Phaca (L. Bunge sect. Hemiphaca Bunge and subg. Cercidothrix Bunge sect. Onobrychium Bunge. Ecological and phonological features of A. rytyensis are reported and chromosome numbers of the new (2n = 6x = 48 and related species are counted.
Common bean and Medicago rhizobia isolated from five locations on the island of Lanzarote, the Canary Islands, by partial analysis of 10 chromosomal genes were shown to exhibit close similarity to Sinorhizobium meliloti. Several bean isolates from Lanzarote, mainland Spain and Tunisia nodulated Leu...
Directory of Open Access Journals (Sweden)
Yong Li
2012-06-01
Full Text Available We investigated the effects of Astragalus polysaccharide (APS on palmitate-induced insulin resistance in C2C12 skeletal muscle myotubes. Palmitate-reduced glucose uptake was restored by APS. APS prevented palmitate-induced C2C12 myotubes from impaired insulin signaling by inhibiting Ser307 phosphorylation of insulin receptor substrate-1 (IRS-1 and increasing Ser473 phosphorylation of Akt. Moreover, the increases in protein-tyrosine phosphatase-1B (PTP1B protein level and NF-κB activation associated with palmitate treatment were also prevented by APS. However the treatment with APS didn’t change AMP-activated protein kinase (AMPK activation in palmitate-induced myotubes. The results of the present study suggest that Astragalus polysaccharide inhibits palmitate-induced insulin resistance in C2C12 myotubes by inhibiting expression of PTP1B and regulating NF-κB but not AMPK pathway.
De Divinatione de Cicerón en su contexto político y religioso
Directory of Open Access Journals (Sweden)
Diony González Rendón
2010-01-01
Full Text Available En medio de la ya desgastada relación que se daba en Roma entre religión y política a mediados de la década de los años 40.a.C, Cicerón escribió un diálogo sobre la religión llamado De Divinatione, que en más de dos libros, presenta un argumento que se sustenta específicamente en el tema de la adivinación. En este diálogo el autor latino reprueba y ataca fuertemente al final del tratado las creencias supersticiosas que se practicaban en esta época. Los magistrados romanos ya no recurrían a los arúspices para consultar los signos divinos en beneficio del Estado, sino que los manipulan para alcanzar sus intereses políticos. Pero en medio de esta fuerte reprobación por parte de Cicerón, también hay un intento por preservar y propagar la religión verdadera y defender las costumbres de los antepasados que han sido consagradas por el tiempo, la mos maiorum.Amidst an already deteriorated relationship between religion and politics in Rome (40 BC, Cicero wrote a dialogue about religion called De Divinatione. The treatise is composed of two books in which Cicero addresses the subject of divination. At the end of this dialogue, he argues against the superstitious beliefs of his time, when the Roman magistrates, on behalf of the state, did not consult the auspices to read the divine signs anymore. Instead, they manipulated them to achieve their own political goals. Nevertheless, and despite of Cicero’s determined condemnation of divination, there was also an attempt to preserve and spread the true religion, and defend the immemorial ancestors’ customs, mos maiorum.
Martin, I.; Dopico, B.; Munoz, F.J.; Esteban, R.; Oomen, R.J.F.J.; Driouich, A.; Vincken, J.P.; Visser, R.G.F.; Labrador, E.
2005-01-01
We report the generation of Solanum tuberosum transformants expressing Cicer arietinum ßIII-Gal. ßIII-Gal is a ß-galactosidase able to degrade cell wall pectins during cell wall loosening that occurs prior to cell elongation. cDNA corresponding to the gene encoding this protein was identified among
Variation in the protein profiles in the gamma-irradiated chick pea (Cicer arietinum L.) seeds
International Nuclear Information System (INIS)
Farook, S.A.F.; Nizam, Jafar
1978-01-01
Water soluble seed proteins from the control as well as gamma ray treated material from the M 2 generation of Chick pea (Cicer arietinum L.) were separated by disc electrophoresis using 7.5 percent poly acrylamide gels. Average Rf values and percentage of similarity values were calculated. The comparisons of number and Rf values of protein bands were made to elucidate the differences in the treated material. Differences obtained in the seed protein profiles of the treated material suggest the presence of the qualitative variation in the proteins. Attempts were made to correlate the variation in the protein bands with the morphological changes in the mutants. (author)
Hernández, Anabel González; de Moura, Ginaini Doin; Binati, Renato Leal; Nascimento, Francisco Xavier Inês; Londoño, Diana Morales; Mamede, Ana Carolina Peixoto; da Silva, Emanuela Pille; de Armas, Rafael Dutra; Giachini, Admir José; Rossi, Márcio José; Soares, Cláudio Roberto Fonsêca Sousa
2017-09-01
Coal open pit mining in the South of Santa Catarina state (Brazil) was inappropriately developed, affecting approximately 6.700 ha. Re-vegetation is an alternative for the recovery of these areas. Furthermore, the use of herbaceous legumes inoculated with nitrogen fixing bacteria is motivated due to the difficulty implementing a vegetation cover in these areas, mainly due to low nutrient availability. Therefore, the aim of this work was to evaluate, among 16 autochthonous rhizobia isolated from the coal mining areas, those with the greatest potential to increase growth of the herbaceous legumes Vicia sativa and Calopogonium mucunoides. Tests were conducted in greenhouse containing 17 inoculation treatments (16 autochthonous rhizobia + Brazilian recommended strain for each plant species), plus two treatments without inoculation (with and without mineral nitrogen). After 60 days, nodulation, growth, N uptake, and symbiotic efficiency were evaluated. Isolates characterization was assessed by the production of indole acetic acid, ACC deaminase, siderophores, and inorganic phosphate solubilization. The classification of the isolates was performed by 16 S rDNA gene sequencing. Only isolates UFSC-M4 and UFSC-M8 were able to nodulate C. mucunoides. Among rhizobia capable of nodulating V. sativa, only UFSC-M8 was considered efficient. It was found the presence of more than one growth-promoting attributes in the same organism, and isolate UFSC-M8 presented all of them. Isolates were classified as belonging to Rhizobium, Burkholderia and Curtobacterium. The results suggest the inoculation of Vicia sativa with strain UFSC-M8, classified as Rhizobium sp., as a promising alternative for the revegetation of coal mining degraded areas.
Huisman, Rik; Bouwmeester, Klaas; Brattinga, Marijke; Govers, Francine; Bisseling, Ton; Limpens, Erik
2015-01-01
In biotrophic plant-microbe interactions, microbes infect living plant cells where they are hosted in a novel membrane compartment; the host-microbe interface. To create a host-microbe interface, arbuscular mycorrhizal (AM) fungi and rhizobia make use of the same endosymbiotic program. It is a
Tar'an, B; Warkentin, T D; Tullu, A; Vandenberg, A
2007-01-01
Ascochyta blight, caused by the fungus Ascochyta rabiei (Pass.) Lab., is one of the most devastating diseases of chickpea (Cicer arietinum L.) worldwide. Research was conducted to map genetic factors for resistance to ascochyta blight using a linkage map constructed with 144 simple sequence repeat markers and 1 morphological marker (fc, flower colour). Stem cutting was used to vegetatively propagate 186 F2 plants derived from a cross between Cicer arietinum L. 'ICCV96029' and 'CDC Frontier'. A total of 556 cutting-derived plants were evaluated for their reaction to ascochyta blight under controlled conditions. Disease reaction of the F1 and F2 plants demonstrated that the resistance was dominantly inherited. A Fain's test based on the means and variances of the ascochyta blight reaction of the F3 families showed that a few genes were segregating in the population. Composite interval mapping identified 3 genomic regions that were associated with the reaction to ascochyta blight. One quantitative trait locus (QTL) on each of LG3, LG4, and LG6 accounted for 13%, 29%, and 12%, respectively, of the total estimated phenotypic variation for the reaction to ascochyta blight. Together, these loci controlled 56% of the total estimated phenotypic variation. The QTL on LG4 and LG6 were in common with the previously reported QTL for ascochyta blight resistance, whereas the QTL on LG3 was unique to the current population.
Fu, Juan; Wang, Zenghui; Huang, Linfang; Zheng, Sihao; Wang, Dongmei; Chen, Shilin; Zhang, Haitao; Yang, Shihai
2014-09-01
Astragalus membranaceus is one of the most widely used traditional Chinese herbal medicines. It is used as immune stimulant, tonic, antioxidant, hepatoprotectant, diuretic, antidiabetic, anticancer, and expectorant. The current paper reviews the botanical characteristics, phytochemistry, and pharmacology of Astragali Radix. Information on Astragali Radix was gathered via the Internet (using Google Scholar, Baidu Scholar, Elsevier, ACS, Medline Plus, CNKI, and Web of Science) as well as from libraries and local books. More than 100 compounds, including flavonoids, saponins, polysaccharides, and amino acids, have so far been identified, and the various biological activities of the compounds have been reported. As an important traditional Chinese medicine, further studies on Astragali Radix can lead to the development of new drugs and therapies for various diseases. The improvement of its utilization should be studied further. Copyright © 2014 John Wiley & Sons, Ltd.
Directory of Open Access Journals (Sweden)
Arlem Nascimento de Oliveira
2010-10-01
Full Text Available Two rhizobia strains isolated from soils of the Central Amazonian floodplain produced appreciable quantities of crude alkaline protease extracts with inexpensive carbon and nitrogen sources. These protease crude extracts were optimally active at pH 9.0-11.0. The optimum temperatures were 35 ºC for Rhizobium sp. strain R-986 and 55 ºC for Bradyrhizobium sp. strain R-993. Protease activities in the crude extracts were enhanced in the presence of 5 mM metal ions, such as Na+, Ca2+, Mg2+ and Mn2+. Rhizobia proteases were strongly inhibited by PMSF, a serine-protease inhibitor. The enzymes were active in the presence of surfactants (SDS and Triton X-100 and stable in oxidizing (H2O2 and reducing agents (β-mercaptoethanol, and organic solvents (acetone, hexane, methanol, 1-propanol and toluene.Duas estirpes de rizóbia isoladas de solos de várzea da Amazônia Central produziram grandes quantidades de proteases alcalinas extracelulares, usando fontes baratas de carbono e nitrogênio. Os extratos brutos de proteases foram ativos em pH 9,0-11,0. As temperaturas ótimas foram de 35 ºC para a enzima do Rhizobium R-986 e de 55 ºC para a do Bradyrhizobium R-993. As atividades proteolíticas aumentaram na presença de 5 mM dos íons Na+, Ca2+ , Mg2+ e Mn2+ . As proteases secretadas pelos rizóbios foram fortemente inibidas por PMSF, um inibidor de serina protease. As enzimas foram ativas na presença de surfactantes (SDS e Triton X-100, e estáveis na presença de agentes oxidantes (H2O2 e redutores (β-mercaptoetanol e solventes orgânicos (acetona, hexano, metanol, 1-propanol e tolueno.
Astragalus polysaccharides lowers plasma cholesterol through mechanisms distinct from statins.
Directory of Open Access Journals (Sweden)
Yunjiu Cheng
Full Text Available To determine the efficacy and underlying mechanism of Astragalus polysaccharides (APS on plasma lipids in hypercholesterolemia hamsters. The effect of APS (0.25 g/kg/d on plasma and liver lipids, fecal bile acids and neutral sterol, cholesterol absorption and synthesis, HMG-CoA reductase activity, and gene and protein expressions in the liver and small intestine was investigated in twenty-four hypercholesterolemia hamsters. Treatment periods lasted for three months. APS significantly lowered plasma total cholesterol by 45.8%, triglycerides by 30%, and low-density lipoprotein-cholesterol by 47.4%, comparable to simvastatin. Further examinations revealed that APS reduced total cholesterol and triglycerides in the liver, increased fecal bile acid and neutral sterol excretion, inhibited cholesterol absorption, and by contrast, increased hepatic cholesterol synthesis and HMG-CoA reductase activity. Plasma total cholesterol or low-density lipoprotein-cholesterol levels were significantly correlated with cholesterol absorption rates. APS up-regulated cholesterol-7α-hydroxylase and LDL-receptor gene expressions. These new findings identify APS as a potential natural cholesterol lowering agent, working through mechanisms distinct from statins.
Gupta, Sonal; Nawaz, Kashif; Parween, Sabiha; Roy, Riti; Sahu, Kamlesh; Kumar Pole, Anil; Khandal, Hitaishi; Srivastava, Rishi; Kumar Parida, Swarup; Chattopadhyay, Debasis
2017-02-01
Cicer reticulatum L. is the wild progenitor of the fourth most important legume crop chickpea (C. arietinum L.). We assembled short-read sequences into 416 Mb draft genome of C. reticulatum and anchored 78% (327 Mb) of this assembly to eight linkage groups. Genome annotation predicted 25,680 protein-coding genes covering more than 90% of predicted gene space. The genome assembly shared a substantial synteny and conservation of gene orders with the genome of the model legume Medicago truncatula. Resistance gene homologs of wild and domesticated chickpeas showed high sequence homology and conserved synteny. Comparison of gene sequences and nucleotide diversity using 66 wild and domesticated chickpea accessions suggested that the desi type chickpea was genetically closer to the wild species than the kabuli type. Comparative analyses predicted gene flow between the wild and the cultivated species during domestication. Molecular diversity and population genetic structure determination using 15,096 genome-wide single nucleotide polymorphisms revealed an admixed domestication pattern among cultivated (desi and kabuli) and wild chickpea accessions belonging to three population groups reflecting significant influence of parentage or geographical origin for their cultivar-specific population classification. The assembly and the polymorphic sequence resources presented here would facilitate the study of chickpea domestication and targeted use of wild Cicer germplasms for agronomic trait improvement in chickpea. © The Author 2016. Published by Oxford University Press on behalf of Kazusa DNA Research Institute.
Gao, Yugang; Zhao, Xueliang; Zang, Pu; Liu, Qun; Wei, Gongqing; Zhang, Lianxue
2014-01-01
The bovine viral diarrhea virus (BVDV), a single-stranded RNA virus, can cause fatal diarrhea syndrome, respiratory problems, and reproductive disorders in herds. Over the past few years, it has become clear that the BVDV infection rates are increasing and it is likely that an effective vaccine for BVDV will be needed. In this study, transgenic Astragalus was used as an alternative productive platform for the expression of glycoprotein E0. The immunogenicity of glycoprotein E0 expressed in tr...
Sharma, Urvashi; Katre, Uma V; Suresh, C G
2015-05-01
Crystal structure of a reported PA2 albumin from Cicer arietinum shows that it belongs to hemopexin fold family, has four beta-propeller motifs and possesses hemagglutination activity, making it different from known legume lectins. A plant albumin (PA2) from Cicer arietinum, presumably a lectin (CAL) owing to its hemagglutination activity which is inhibited by complex sugars as well as glycoproteins such as fetuin, desialylated fetuin and fibrinogen. The three-dimensional structure of this homodimeric protein has been determined using X-ray crystallography at 2.2 Å in two crystal forms: orthorhombic (P21212) and trigonal (P3). The structure determined using molecular replacement method and refined in orthorhombic crystal form reached R-factors R free 22.6 % and R work 18.2 % and in trigonal form had 22.3 and 17.9 % in the resolution range of 20.0-2.2 and 35.3-2.2 Å, respectively. Interestingly, unlike the known legume lectin fold, the structure of this homodimeric hemagglutinin belonged to hemopexin fold that consisted of four-bladed β-propeller architecture. Each subunit has a central cavity forming a channel, inside of which is lined with hydrophobic residues. The channel also bears binding sites for ligands such as calcium, sodium and chloride ions, iodine atom in the case of iodine derivative and water molecules. However, none of these ligands seem important for the sugar recognition. No monosaccharide sugar specificity could be detected using hemagglutination inhibition. Chemical modification studies identified a potential sugar-binding site per subunit molecule. Comparison of C-alpha atom positions in subunit structures showed that the deviations between the two crystal forms were more with respect to blades I and IV. Differences also existed between subunits in two forms in terms of type and site of ligand binding.
International Nuclear Information System (INIS)
Hasan, S.A.; Hayat, S.; Ali, B.; Ahmad, A.
2008-01-01
In the present experiment the seeds of Cicer arietinum (L.) cv. Uday were inoculated with specific Rhizobium grown in sandy loam soil and were allowed to grow for 15 days. At this stage, the seedlings were supplied with 0, 50, 100 or 150 μM of cadmium in the form of cadmium chloride and sprayed with 0.01 μM of 28-homobrassinolide (HBL) at 30-day stage. The data indicated that plant fresh and dry mass, number of nodules, their fresh and dry mass, leghemoglobin content, nitrogen and carbohydrate content in the nodules, leaf chlorophyll content, nitrate reductase and carbonic anhydrase activities decreased proportionately with the increasing concentrations of cadmium but the content of proline and the activities of catalase, peroxidase and superoxide dismutase increased. The ill effect, generated by cadmium, was overcome if the stressed plants were sprayed with HBL. - The cadmium toxicity can be overcome by the foliar application of 28-homobrassinolide
International Nuclear Information System (INIS)
Khan, S.S.; Kazmi, S.A.; Anwar, H
2013-01-01
Cyclic voltammetric study was used to analyze three new saponins (isolated from the seeds of Cicer aritinum) along with a known saponin soyasaponin I and beta sitosterol glycoside isolated saponins as well as glycyrrhizin. These studies were carried out in aqueous medium at Glassy carbon (GCE) electrode vs. AgCl reference electrode. Results revealed that the voltammograms of Fe(III) with isolated saponins are irreversible while that of Fe(III)-glycyrrhizin complex is reversible. Even though precise Eo values of their Fe(III) complex could not be determined, it is clearly indicated that Fe(III) forms complexes with these saponins. The ability to form strong complexes with Fe(III) therefore reduces the availability of Fe(III) by saponins. (author)
Tampakaki, Anastasia P; Fotiadis, Christos T; Ntatsi, Georgia; Savvas, Dimitrios
2017-04-01
Cowpea (Vigna unguiculata) is a promiscuous grain legume, capable of establishing efficient symbiosis with diverse symbiotic bacteria, mainly slow-growing rhizobial species belonging to the genus Bradyrhizobium. Although much research has been done on cowpea-nodulating bacteria in various countries around the world, little is known about the genetic and symbiotic diversity of indigenous cowpea rhizobia in European soils. In the present study, the genetic and symbiotic diversity of indigenous rhizobia isolated from field-grown cowpea nodules in three geographically different Greek regions were studied. Forty-five authenticated strains were subjected to a polyphasic approach. ERIC-PCR based fingerprinting analysis grouped the isolates into seven groups and representative strains of each group were further analyzed. The analysis of the rrs gene showed that the strains belong to different species of the genus Bradyrhizobium. The analysis of the 16S-23S IGS region showed that the strains from each geographic region were characterized by distinct IGS types which may represent novel phylogenetic lineages, closely related to the type species of Bradyrhizobium pachyrhizi, Bradyrhizobium ferriligni and Bradyrhizobium liaoningense. MLSA analysis of three housekeeping genes (recA, glnII, and gyrB) showed the close relatedness of our strains with B. pachyrhizi PAC48 T and B. liaoningense USDA 3622 T and confirmed that the B. liaoningense-related isolate VUEP21 may constitute a novel species within Bradyrhizobium. Moreover, symbiotic gene phylogenies, based on nodC and nifH genes, showed that the B. pachyrhizi-related isolates belonged to symbiovar vignae, whereas the B. liaoningense-related isolates may represent a novel symbiovar. Copyright © 2017 Elsevier GmbH. All rights reserved.
Directory of Open Access Journals (Sweden)
Jansa Jan
2009-06-01
Full Text Available Abstract Background Like other species of the Phaseoleae tribe, common bean (Phaseolus vulgaris L. has the potential to establish symbiosis with rhizobia and to fix the atmospheric dinitrogen (N2 for its N nutrition. Common bean has also the potential to establish symbiosis with arbuscular mycorrhizal fungi (AMF that improves the uptake of low mobile nutrients such as phosphorus, from the soil. Both rhizobial and mycorrhizal symbioses can act synergistically in benefits on plant. Results The tripartite symbiosis of common bean with rhizobia and arbuscular mycorrhizal fungi (AMF was assessed in hydroaeroponic culture with common bean (Phaseolus vulgaris L., by comparing the effects of three fungi spp. on growth, nodulation and mycorrhization of the roots under sufficient versus deficient P supplies, after transfer from initial sand culture. Although Glomus intraradices Schenck & Smith colonized intensely the roots of common bean in both sand and hydroaeroponic cultures, Gigaspora rosea Nicolson & Schenck only established well under sand culture conditions, and no root-colonization was found with Acaulospora mellea Spain & Schenck under either culture conditions. Interestingly, mycorrhization by Glomus was also obtained by contact with mycorrhized Stylosanthes guianensis (Aubl. sw in sand culture under deficient P before transfer into hydroaeroponic culture. The effect of bean genotype on both rhizobial and mycorrhizal symbioses with Glomus was subsequently assessed with the common bean recombinant inbreed line 7, 28, 83, 115 and 147, and the cultivar Flamingo. Significant differences among colonization and nodulation of the roots and growth among genotypes were found. Conclusion The hydroaeroponic culture is a valuable tool for further scrutinizing the physiological interactions and nutrient partitioning within the tripartite symbiosis.
Curnow, Alison; Owen, Sara J
2016-01-01
As lifetime exposure to ultraviolet (UV) radiation has risen, the deleterious effects have also become more apparent. Numerous sunscreen and skincare products have therefore been developed to help reduce the occurrence of sunburn, photoageing, and skin carcinogenesis. This has stimulated research into identifying new natural sources of effective skin protecting compounds. Alkaline single-cell gel electrophoresis (comet assay) was employed to assess aqueous extracts derived from soil or hydroponically glasshouse-grown roots of Althea officinalis (Marshmallow) and Astragalus membranaceus, compared with commercial, field-grown roots. Hydroponically grown root extracts from both plant species were found to significantly reduce UVA-induced DNA damage in cultured human lung and skin fibroblasts, although initial Astragalus experimentation detected some genotoxic effects, indicating that Althea root extracts may be better suited as potential constituents of dermatological formulations. Glasshouse-grown soil and hydroponic Althea root extracts afforded lung fibroblasts with statistically significant protection against UVA irradiation for a greater period of time than the commercial field-grown roots. No significant reduction in DNA damage was observed when total ultraviolet irradiation (including UVB) was employed (data not shown), indicating that the extracted phytochemicals predominantly protected against indirect UVA-induced oxidative stress. Althea phytochemical root extracts may therefore be useful components in dermatological formulations.
Directory of Open Access Journals (Sweden)
Alison Curnow
2016-01-01
Full Text Available As lifetime exposure to ultraviolet (UV radiation has risen, the deleterious effects have also become more apparent. Numerous sunscreen and skincare products have therefore been developed to help reduce the occurrence of sunburn, photoageing, and skin carcinogenesis. This has stimulated research into identifying new natural sources of effective skin protecting compounds. Alkaline single-cell gel electrophoresis (comet assay was employed to assess aqueous extracts derived from soil or hydroponically glasshouse-grown roots of Althea officinalis (Marshmallow and Astragalus membranaceus, compared with commercial, field-grown roots. Hydroponically grown root extracts from both plant species were found to significantly reduce UVA-induced DNA damage in cultured human lung and skin fibroblasts, although initial Astragalus experimentation detected some genotoxic effects, indicating that Althea root extracts may be better suited as potential constituents of dermatological formulations. Glasshouse-grown soil and hydroponic Althea root extracts afforded lung fibroblasts with statistically significant protection against UVA irradiation for a greater period of time than the commercial field-grown roots. No significant reduction in DNA damage was observed when total ultraviolet irradiation (including UVB was employed (data not shown, indicating that the extracted phytochemicals predominantly protected against indirect UVA-induced oxidative stress. Althea phytochemical root extracts may therefore be useful components in dermatological formulations.
Directory of Open Access Journals (Sweden)
An-jun Liu
2017-12-01
Full Text Available The polysaccharides of Astragalus membranaceus have received extensive study and attention, but there have been few reports on the extraction of these polysaccharides using cold water (4 °C. In this study, we fractionated a novel cold-water-soluble polysaccharide (cAMPs-1A from Astragalus membranaceus with a 92.00% carbohydrate content using a DEAE-cellulose 52 anion exchange column and a Sephadex G-100 column. Our UV, Fourier-transform infrared spectroscopy (FTIR, high-performance gel permeation chromatography, and ion chromatography analysis results indicated the monosaccharide composition of cAMPs-1A with 1.23 × 104 Da molecular weight to be fucose, arabinose, galactose, glucose, and xylose, with molar ratios of 0.01:0.06:0.20:1.00:0.06, respectively. The UV spectroscopy detected no protein and nucleic acid in cAMPs-1A. We used FTIR analysis to characterize the α-d-pyranoid configuration in cAMPs-1A. In addition, we performed animal experiments in vivo to evaluate the antitumor and immunomodulatory effects of cAMPs-1A. The results suggested that cAMPs-1A oral administration could significantly inhibit tumor growth with the inhibitory rate of 20.53%, 36.50% and 44.49%, respectively, at the dosage of 75,150, and 300 mg/kg. Moreover, cAMPs-1A treatment could also effectively protect the immune organs, promote macrophage pinocytosis, and improve the percentages of lymphocyte subsets in the peripheral blood of tumor-bearing mice. These findings demonstrate that the polysaccharide cAMPs-1A has an underlying application as natural antitumor agents.
Directory of Open Access Journals (Sweden)
Michael E. Rogers
2006-03-01
Full Text Available The effects of supplemental dietary creatine and a botanical extract consisting of ginseng and astragalus were evaluated in 44 adults aged 55-84 years participating in a 12-week strength-training program. Participants consumed creatine only (Cr, creatine plus botanical extract (CrBE, or placebo (PL, and performed bench press, lat pull down, biceps curl, leg press, knee extension, and knee flexion for 3 sets of 8-12 reps on 3 days per week for 12 weeks. The 1-repetition maximum for each exercise, body composition (full-body DEXA, blood lipids, and mood states were evaluated before and after the intervention. Training improved (p < 0.05 strength and lean mass for all groups, however greater gains were observed with Cr and CrBE compared with placebo (but no difference was found between Cr and CrBE. Only CrBE improved blood lipids and self-reported vigor, and the CrBE group lost significantly more body fat and gained more bench press strength than Cr. These results indicate that strength and lean mass gains achieved by older adults participating in a strength training program can be enhanced with creatine supplementation, and that ginseng and astragalus may provide additional health and psychological benefits. However, these herbs do not appear to have an additive effect on strength and lean mass gains during training
Characterization of chickpea (Cicer arietinum L.) lectin for biological activity.
Gautam, Ajay Kumar; Gupta, Neha; Narvekar, Dakshita T; Bhadkariya, Rajni; Bhagyawant, Sameer S
2018-05-01
Lectins are proteins that are subject of intense investigations. Information on lectin from chickpea ( Cicer arietinum L.) with respect to its biological activities are very limited. In this study, we purified lectin from the seeds of chickpea employing DEAE-cellulose and SP-Sephadex ion exchange chromatography and identified its molecular subunit mass as 35 kDa. The free radical scavenging activity of lectin measured by the DPPH assay has IC 50 of 0.88 µg/mL. Lectin exerted antifungal activity against Candida krusei , Fusarium oxysporium oxysporium , Saccharomyces cerevisiae and Candida albicans , while antibacterial activity against E. coli , B. subtilis , S. marcescens and P. aeruginosa. The minimum inhibitory concentrations were 200, 240, 160 and 140 µg for C. krusei, F. oxysporium , S. cerevisiae and C. albicans respectively. Lectin was further examined for its antiproliferative potential against cancerous cell line. The cell viability assay indicated a high inhibition activity on Ishikawa, HepG2, MCF-7 and MDA-MB-231 with IC 50 value of 46.67, 44.20, 53.58 and 37.46 µg/mL respectively. These results can provide a background for future research into the benefits of chickpea lectin to pharmacological perspective.
Directory of Open Access Journals (Sweden)
Kojo Agyemang
2013-01-01
Full Text Available The disease burden of diabetes mellitus is increasing throughout the world. The need for more potent drugs to complement the present anti-diabetic drugs has become an imperative. Astragalus membranaceus, a key component of most Chinese herbal anti-diabetic formulas, has been an important prospect for lead anti-diabetic compounds. It has been progressively studied for its anti-diabetic properties. Ethnopharmacological studies have established its potential to alleviate diabetes mellitus. Recent studies have sought to relate its chemical constituents to types 1 and 2 diabetes mellitus. Its total polysaccharides, saponins, and flavonoids fractions and several isolated compounds have been the most studied. The total polysaccharides fraction demonstrated activity to both types 1 and 2 diabetes mellitus. This paper discusses the anti-diabetic effects and pharmacological action of the chemical constituents in relation to types 1 and 2 diabetes mellitus.
Partial characterization of amylases of two indigenous Central Amazonian rhizobia strains
Directory of Open Access Journals (Sweden)
Arlem Nascimento de Oliveira
2010-02-01
Full Text Available Amylase production and partial characterization of crude enzyme preparations from two rhizobia strains (R-926 and R-991 were evaluated. For both the strains, maximal amylase activities were achieved during the early-to-mid- exponential growth phase; both were active over a pH range from 4.5 to 8.5 and temperature from 30 to 50 ºC. None of the ions studied (K+, Na+, Ca2+, Hg2+, Mg2+, Mn2+, Cu2+ and Zn2+ was required for the catalytic activity of strain R-926; amylase activity of strain R-991 was stimulated in the presence of K+, Hg2+ and Zn2+. The surfactants SDS, Triton X-100 and Tween-80 did not have a pronounced inhibitory effect on enzyme activities; SDS and Tween-80 caused the highest stimulatory effects. Amylase activities from the rhizobia strains were reduced by up to 30% in the presence of EDTA; amylase activity of R-926 was also inhibited by HgCl2, suggesting that Ca2+and cysteine residues could be important for activity of this strain.A produção e parcial caracterização de extratos brutos de amilase de duas estirpes de rizóbio (R-926 e R-991 foram avaliadas. Para ambas as estirpes, as máximas atividades amilolíticas foram obtidas no início/meio da fase exponencial de crescimento. As amilases rizobiais foram ativas numa variação de pH de 4,5 a 8,5 e temperatura de 30 a 50 ºC. Nenhum dos íons testados (K+, Na+, Ca2+, Hg2+, Mg2+, Mn2+, Cu2+ e Zn2+ foi exigido para a atividade catalítica da estirpe R-926. A amilase produzida pelo R991 foi estimulada na presença de K+, Hg2+ e Zn2+. Os surfactantes SDS, Triton X-100 e Tween-80 não exerceram um pronunciado efeito inibitório sobre as atividades enzimáticas, e SDS e Tween-80 causaram os maiores efeitos estimulatórios. A atividade amilolítica rizobial foi reduzida em até 30% na presença de EDTA; a amilase produzida pela estirpe R-926 também foi inibida pelo HgCl2, sugerindo, ao menos em parte, a importância de Ca2+ e resíduos de cisteína na atividade amilolítica dessa
Zhan, Zhi-Lai; Deng, Ai-Ping; Peng, Hua-Sheng; Zhang, Xiao-Bo; Guo, Lan-Ping; Huang, Lu-Qi
2016-09-01
Basically, Dao-di hers are produced in specific area which has a long history, good quality, good medicine, curative effect. However genuine medicinal material area in history is not static, this makes the establishment of genuine medicinal material origin and the in-depth research be very difficult. This paper has profoundly analyzed the origin of different historical periods taking Astragalus membranaceus and Salvia miltiorrhiza as examples, and then summarized the reasons of herbal origin changes from the humanities, social and natural three aspects. This paper provides a basis for establishment and the further research of high-quality genuine producing area. Copyright© by the Chinese Pharmaceutical Association.
International Nuclear Information System (INIS)
2007-01-01
The effect of gamma radiation on growth, photosynthetic pigments and some of the antioxidant enzymes of chickpea (Cicer arietinum L.) seeds were investigated. After irradiation with different doses of gamma radiation (20 and 40 Gy), seeds were soaked for 24 hours in either GA 3 , NaCl solution or in a mixture of both. NaCl induced reduction in growth as well as decrease in photosynthetic pigment content of the produced seedlings. However, GA 3 caused amelioration in growth inhibition and an increase in the pigment contents. Irradiated chickpea seeds treated with GA 3 evolved defence antioxidant mechanisms to combat the danger of salt stress by increasing the superoxide dismutase (SOD), ascorbate peroxidase (APX), catalase (CAT) and peroxidase (POX) activities while malonaldehyde (MDA) contents were decreased
Molecular analysis of an actin gene, CarACT1, from chickpea (Cicer arietinum L.).
Peng, Hui; Cheng, Huiying; Yu, Xingwang; Shi, Qinghua; Zhang, Hua; Li, Jiangui; Ma, Hao
2010-02-01
Actins are ubiquitous and highly conserved proteins that play key roles in cell formation and cellular activities. In this study, an actin gene was isolated from chickpea for the first time and designated as CarACT1 (for Cicer arietinum L. actin gene 1; Genbank accession no. EU529707). It encoded a putative protein with 377 amino acids and contained five exons and four introns within genomic DNA sequence. CarACT1 was localized in cytoplasm and showed high similarity to other well known actins from various species. Reverse transcription-polymerase chain reaction (RT-PCR) assay proved that CarACT1 transcripts were ubiquitously accumulated in all major organs, such as seedling roots, stems, leaves, flowers, young pods, and seeds, as well as in diverse developmental stages, such as leaf senescence, seed development and germination. Our results suggested that CarACT1 is an actin gene with physiological functions and may be served as a potential reference gene for transcription level of interesting genes in chickpea.
Effect of sodium fluoride and sodium nitroprouside on Cicer arietinum and Pisum sativum
Directory of Open Access Journals (Sweden)
Naba Kumar Mondal
2016-07-01
Full Text Available In present study, the individual and combine effect of sodium fluoride (NaF and sodium nitroprouside (SNP on germination and biochemical parameters (pigments, sugar, protein, amino acid, and phenol of Bengal gram (Cicer arietinum and peas (Pisum sativum has been studied. After three days of NaF treatment, reductions were observed in percentage of seed germination, root and shoot length, and pigment content with increasing concentration of NaF (1 to 4 mg L-1. Seedlings treated with SNP, both alone and in combination of NaF, showed enhancement in seed germination as well as other growth parameters. NaF-treated seedlings were found to accumulate more soluble sugars and phenols, which were further increased by SNP treatment thereby indicating a synergistic effect of the possible reasons for the ameliorative effects of SNP in seedlings of Pisum sativum growing under NaF stress. Results also demonstrated that SNP application did not show any improvement in both morpho-physiologically and biochemically under sodium fluoride stress condition.
DEFF Research Database (Denmark)
Ahmadi Gavlighi, Hassan; Meyer, Anne S.; Abang Zaidel, Dayang Norulfairuz
2013-01-01
Gum tragacanth samples from six species of Iranian Astragalus bush plants (“goat's-horn”) were evaluated for their emulsion stabilizing effects and their detailed chemical composition in order to examine any possible correlation between the make-up and the emulsion stabilizing properties of gum......:50 (A. rahensis, A. microcephalus, A. compactus) or tipped toward higher bassorin than tragacanthin (A. gossypinus). The monosaccharide make-up of the six gums also varied, but all the gums contained relatively high levels of galacturonic acid (∼100–330 mg/g), arabinose (50–360 mg/g), xylose (∼150...
Directory of Open Access Journals (Sweden)
Aloísio Freitas Chagas Junior
2009-09-01
Full Text Available O feijão-caupi (Vigna unguiculata é uma cultura importante na Amazônia Central, mas os rizóbios associados a essa leguminosa são poucos estudados. O objetivo deste estudo foi avaliar a efetividade e caracterizar fenotipicamente os isolados de rizóbio que nodulam feijão-caupi na região. As populações de rizóbio de Novo Ayrão proporcionaram as maiores produções de matéria seca da parte aérea e total, raiz, número de nódulos e peso dos nódulos secos nas plantas de feijão-caupi; porém, não diferiram do tratamento testemunha com N. Com base nos critérios fenotípicos avaliados, foi possível identificar uma ampla diversidade de populações de rizóbios contidos nos solos da Amazônia.Cowpea (Vigna unguiculata is an important legume cultivated in central Amazonia, but its rhizobia have been little studied. The present study aimed to evaluate the effectiveness and to characterize phenotypically the population of indigenous rhizobia that infect cowpea in the region. The rhizobia population from Novo Ayrão soils provided the highest shoot, root and total dry matter yields, number of nodules and nodule dry weights in cowpea plants; however, they were not different from those found for the control treatment with N. Based on phenotypic criteria, it was possible to identify a wide diversity of populations of rhizobia contained in Amazonian soils.
Potential impact of rising atmospheric CO2 on quality of grains in chickpea (Cicer arietinum L.).
Saha, Saurav; Chakraborty, Debashis; Sehgal, Vinay K; Pal, Madan
2015-11-15
Experiments were conducted in open-top chambers to assess the effect of atmospheric CO2 enrichment (E-CO2) on the quality of grains in chickpea (Cicer arietinum L.) crop. Physical attributes of the grains was not affected, but the hydration and swelling capacities of the flour increased. Increase in carbohydrates and reduction in protein made the grains more carbonaceous (higher C:N) under E-CO2. Among other mineral nutrients, K, Ca and Zn concentrations decreased, while P, Mg, Cu, Fe, Mn and B concentrations did not change. The pH, bulk density and cooking time of chickpea flour remained unaffected, although the water absorption capacity of flour increased and oil absorption reduced. Results suggest that E-CO2 could affect the grain quality adversely and nutritional imbalance in grains of chickpea might occur. Copyright © 2015. Published by Elsevier Ltd.
Organ accumulation and subcellular location of Cicer arietinum ST1 protein.
Albornos, Lucía; Cabrera, Javier; Hernández-Nistal, Josefina; Martín, Ignacio; Labrador, Emilia; Dopico, Berta
2014-07-01
The ST (ShooT Specific) proteins are a new family of proteins characterized by a signal peptide, tandem repeats of 25/26 amino acids, and a domain of unknown function (DUF2775), whose presence is limited to a few families of dicotyledonous plants, mainly Fabaceae and Asteraceae. Their function remains unknown, although involvement in plant growth, fruit morphogenesis or in biotic and abiotic interactions have been suggested. This work is focused on ST1, a Cicer arietinum ST protein. We established the protein accumulation in different tissues and organs of chickpea seedlings and plants and its subcellular localization, which could indicate the possible function of ST1. The raising of specific antibodies against ST1 protein revealed that its accumulation in epicotyls and radicles was related to their elongation rate. Its pattern of tissue location in cotyledons during seed formation and early seed germination, as well as its localization in the perivascular fibres of epicotyls and radicles, indicated a possible involvement in seed germination and seedling growth. ST1 protein appears both inside the cell and in the cell wall. This double subcellular localization was found in every organ in which the ST1 protein was detected: seeds, cotyledons and seedling epicotyls and radicles. Copyright © 2014 Elsevier Ireland Ltd. All rights reserved.
DEFF Research Database (Denmark)
Frøkiær, Hanne; Henningsen, Louise; Metzdorff, Stine Broeng
2012-01-01
Many foods and food components boost the immune system, but little data are available regarding the mechanisms by which they do. Bacterial strains have disparate effects in stimulating the immune system. In dendritic cells, the gram-negative bacteria Escherichia coli upregulates proinflammatory......-ß and other cytokines were measured by ELISA and RT-PCR. Endocytosis of fluorescence-labeled dextran and L. acidophilus in the presence of elderberry fruit or astragalus root extract was evaluated in dendritic cells. Our results show that both extracts enhanced L. acidophilus-induced IFN-ß production...
Role of salicylic acid in induction of plant defense system in chickpea (Cicer arietinum L.).
War, Abdul Rashid; Paulraj, Michael Gabriel; War, Mohd Yousf; Ignacimuthu, Savarimuthu
2011-11-01
Salicylic acid (SA), a plant hormone plays an important role in induction of plant defense against a variety of biotic and abiotic stresses through morphological, physiological and biochemical mechanisms. A series of experiments were carried out to evaluate the biochemical response of the chickpea (Cicer arietinum L.) plants to a range of SA concentrations (1, 1.5, and 2 mM). Water treated plants were maintained as control. Activities of peroxidase (POD) and polyphenol oxidase (PPO) were evaluated and amounts of total phenols, hydrogen peroxide (H2O2), and proteins were calculated after 96 h of treatment. Plants responded very quickly to SA at 1.5 mM and showed higher induction of POD and PPO activities, besides the higher accumulation of phenols, H2O2 and proteins. Plants treated with SA at 2 mM showed phytotoxic symptoms. These results suggest that SA at 1.5 mM is safe to these plants and could be utilized for the induction of plant defense.
International Nuclear Information System (INIS)
Winter, P.; Kaemmer, D.; Paff, T.; Geistlinger, J.; Neu, C.; Kahl, G.
2001-01-01
DNA markers of various kinds have found widespread application in many facets of plant breeding and plant pathogen control. Yet another marker type, sequence-tagged microsatellite (STMS) markers, provides the markers of choice for nearly every crop because of their co-dominant nature, reliability, ease of application and high polymorphic information content. We report here on the development of a whole set of STMS markers and the respective, selected primer sequences for two important crops, chickpea (Cicer arietinum L.) and banana (Musa acuminata), and for their most devastating fungal pathogens, Ascochyta rabiei and Mycosphaerella fijiensis, respectively. These markers were generated either by direct screening of size-selected genomic libraries with microsatellite-complementary oligonucleotides, or by enrichment of DNA fragments containing microsatellite sequences. A total of 69 markers for chickpea, 15 markers for M. acuminata, 19 markers for A rabiei and 11 markers for M. fijiensis, selected on the basis of their high information content and ease of use are presented here. These can be applied for mapping of the respective genomes, for various population studies, and cultivar and isolate identification. We further demonstrate that several of these markers can potentially be applied across species boundaries and thus could increase the marker repertoire also for other species of the genus Cicer, Musa and for Ascochyta-type pathogens of bean, and potentially also of lentil and pea. (author)
An advanced draft genome assembly of a desi type chickpea (Cicer arietinum L.).
Parween, Sabiha; Nawaz, Kashif; Roy, Riti; Pole, Anil K; Venkata Suresh, B; Misra, Gopal; Jain, Mukesh; Yadav, Gitanjali; Parida, Swarup K; Tyagi, Akhilesh K; Bhatia, Sabhyata; Chattopadhyay, Debasis
2015-08-11
Chickpea (Cicer arietinum L.) is an important pulse legume crop. We previously reported a draft genome assembly of the desi chickpea cultivar ICC 4958. Here we report an advanced version of the ICC 4958 genome assembly (version 2.0) generated using additional sequence data and an improved genetic map. This resulted in 2.7-fold increase in the length of the pseudomolecules and substantial reduction of sequence gaps. The genome assembly covered more than 94% of the estimated gene space and predicted the presence of 30,257 protein-coding genes including 2230 and 133 genes encoding potential transcription factors (TF) and resistance gene homologs, respectively. Gene expression analysis identified several TF and chickpea-specific genes with tissue-specific expression and displayed functional diversification of the paralogous genes. Pairwise comparison of pseudomolecules in the desi (ICC 4958) and the earlier reported kabuli (CDC Frontier) chickpea assemblies showed an extensive local collinearity with incongruity in the placement of large sequence blocks along the linkage groups, apparently due to use of different genetic maps. Single nucleotide polymorphism (SNP)-based mining of intra-specific polymorphism identified more than four thousand SNPs differentiating a desi group and a kabuli group of chickpea genotypes.
Application of alum and chickpea (cicer arietinum) in removing color from leachate
Zin, N. S. M.; Awang, N. H.; Akbar, N. A.
2018-04-01
Dual coagulant has the potential to improve the coagulation process. In leachate treatment coagulation/flocculation can be used as a main treatment method or as a polishing/tertiary treatment step. Application of natural coagulant as coagulant aids able to increase the formation of floc and the removal ability of the coagulation process. This study was focusing on the ability of dual coagulants made from chemical coagulant (Alum) and natural coagulant (Cicer Arietinum (CA)) in removing colour from leachate. Jar test was carried out to investigate the effect of dose and pH on the removal ability of the dual coagulant. The optimum pH and dose for dual coagulant were obtained at pH 6.0 with dose of Alum at 4 g/L and dose of CA at 0.6 g/L with 94% removal of colour. While the optimum removal of colour for single Alum (4 g/L) and single CA (1.4 g/L) were recorded as 88% and 22%, respectively. The removals obtained using single natural and chemical coagulants were not as good as those obtained by dual coagulant. Thus, addition of CA as a coagulant aid for alum, able to increase the removal of color from leachate and has the potential to be applied as a treatment method for leachate.
Directory of Open Access Journals (Sweden)
Chun-Chung Chen
2012-01-01
Full Text Available We tested the effect of Astragalus membranaceus (AM on acute hemorrhagic stroke. Seventy-eight patients were randomly assigned to Group A (3 g of AM three times/day for 14 days; or Group B (3 g of placebo herb. A total of 68 patients (Group A 36, Group B 32 completed the trial. The increase of functional independence measure scale score between baseline and week 4 was 24.53 ± 23.40, and between baseline and week 12 was 34.69 ± 28.89, in the Group A was greater than 11.97 ± 11.48 and 23.94 ± 14.8 in the Group B (both P≦0.05. The increase of Glasgow outcome scale score between baseline and week 12 was 0.75 ± 0.77 in the Group A was greater than 0.41 ± 0.50 in the Group B (P<0.05. The results are preliminary and need a larger study to assess the efficacy of AM after stroke.
Fayazzadeh, Ehsan; Rahimpour, Sina; Ahmadi, Seyed Mohsen; Farzampour, Shahrokh; Sotoudeh Anvari, Maryam; Boroumand, Mohammad Ali; Ahmadi, Seyed Hossein
2014-01-01
Gum tragacanth is a natural complex mixture of polysaccharides and alkaline minerals extracted from species of Astragalus plant, which is found widely in arid regions of the Middle East. In a pilot experimental study we examined the effects of its topical application on wound healing in ten albino adult male rats. Two similar parasagittal elliptical full-thickness wounds (control vs. test samples) were created on the dorsum of each animal. Test group samples were fully covered by a thin layer of gum tragacanth daily. The extent of wound healing was evaluated by planimetric analysis on multiple occasions during the 10-day study period. On the 7th day of the study, the percent of wound closure was significantly higher in gum tragacanth-treated specimens compared to the control samples (87%±2% vs. 70%±4%, Ptragacanth in acceleration of skin wound contraction and healing. More studies are encouraged to identify the implicating agents and precisely understand the mechanism by which they exert their wound healing effects.
Zhu, Zhen-Yuan; Luo, You; Dong, Guo-Ling; Ren, Yuan-Yuan; Chen, Li-Jing; Guo, Ming-Zhu; Wang, Xiao-Ting; Yang, Xue-Ying; Zhang, Yongmin
2016-06-01
A novel homogeneous polysaccharide fraction (APS) was extracted from Astragalus by hot water and purified by Sephadex G-100 and G-75 column. Its molecular weight was 693kDa. APS and APS with ultra-high pressure treatment exhibited significant inhibitory abilities on a-glucosidase, inhibition rate from high to low in order was 400MPa-APS, 300MPa-APS, 500MPa-APS and APS. The inhibition percentage of 400MPa-APS (1.5mg/mL) was 49% (max.). This suggested that the inhibitory activity of APS on a-glucosidase was improved by ultra-high pressure treatment. FT-IR, SEM, CD spectra, atomic force microscope and Congo red test analysis of APS and 400MPa-APS showed ultra-high pressure treatment didn't change the preliminary structure but had an effect on its advanced structure. Copyright © 2016 Elsevier B.V. All rights reserved.
Canakci, Songül; Dursun, Bahar
2011-09-01
The present study examined the effects of salicylic acid pre-application on the responses of seven-day-old chickpea (Cicer arietinum L.) seedlings to nickel. For this purpose, the plants were treated with 1 mM salicylic acid solution for 6 and 10 hours and then treated with 0.75, 1.5 and 3 mM nickel solutions for 48 hours hydroponically. Following the treatment, changes in seedling length, seedling fresh weight and leaf dry weight (after 10 hours), as well as MDA, proline, protein and pigment contents (after 6 and 10 hours) were examined. Salicylic acid pre-application was found to significantly alleviate the typical harmful effects caused by nickel and 3 mM nickel concentration in particular, on the parameters associated with toxic stress. However, pre-application of salicylic acid for 6 and 10 hours without nickel treatment did not produce any stimulatory or inhibitory effect on the seedlings as compared to the controls.
Climatic Characteristics of the Natural Habitats of Astragalus gossypinus Fisher in Isfahan Province
Directory of Open Access Journals (Sweden)
R. Saboohi
2016-09-01
Full Text Available The relationship between plant species and climatic factors has always been an important subject in plant ecology and the use of multivariate statistical methods might be effective in detecting the relationship between climatic factors and the distribution of plant species. In the present study, climatic characteristics of Astragalus gossypinus Fisher producing tragacanth stretched in a relatively vast area in Isfahan province (approximatley seven percent of natural habitat of Isfahan province to shed lights on determinant climatic factors on distribution of this species were investigated. In this study, 56 climatic variables were evaluated in the months of January, March, and July in the annual interval and to reduce the number of variables and determine the most important factors. Factor analysis was applied using principal components analysis. The results showed that four factors, namely cooling temperature-humidity, precipitation-storm, cloudiness, and windiness account for 39.05%, 32.77%, 11.44%, and 8.63%, and totally 91.88% of the variance of the data, respectively. Also, the cooling temperature-humidity factor has the greatest impact on presence of this species, therefor, in areas where this species can be seen, the cooling temperature-humidity factor is positive and vice versa.
Marco Tulio Cicerón y Domingo Faustino Sarmiento: Expresión de la "Utilitas" política
Directory of Open Access Journals (Sweden)
Nuria de la O Vidal Teruel
2010-01-01
Full Text Available El presente trabajo trata de abordar las posibles similitudes existentes en el pensamiento político de dos personajes aparentemente inconexos y ciertamente significativos en sus respectivos contextos históricos: el romano Marco Tulio Cicerón (Siglo I a.C. y el argentino Domingo Faustino Sarmiento (Siglo XIX d.C.. A través del análisis de dos obras fundamentales dentro de la producción de cada uno de ello, De republica y Facundo o Civilización y Barbarie, respectivamente, es posible encontrar lazos que unen ambas realidades históricas en lo que respecta a su concepción sobre la filosofía de la política y su aplicación práctica (utilitas para la obtención del mejor sistema de gobierno posible.
Directory of Open Access Journals (Sweden)
esmaeil rezaei-chiyaneh
2015-12-01
Full Text Available Study of agronomic characteristics and advantage indices in intercropping of additive series of Chickpea (Cicer arietinum L. and Black Cumin (Nigella sativa L. Abstract In order to evaluate quantitive and qualitive yield of Chickpea (Cicer arietinum L. and Black Cumin (Nigella sativa L. in intercropping of additive series, a field experiment was arranged in a randomized complete block design with three replications in West Azerbaijan province- city Nagadeh, Iran during growing reason of 2012-2013. Treatments included 100% Black Cumin + 10% Chickpea, 100% Black Cumin + 20% Chickpea, 100% Black Cumin + 30% Chickpea, 100% Black Cumin + 40% Chickpea and 100% Black Cumin + 50% Chickpea and sole cropping of Chickpea and Black Cumin. Different Planting Ratio had significant effect on studied traits of Chickpea and Black Cumin (exception Essential oil yield of Black Cumin. Yield and components yield in monoculture of each crop was more than other treatments. The highest grain yield and biological yield of chickpea were achieved in monoculture with 1105 and 14479 kg.ha-1, respectively. The results showed that the maximum seed yield and biological yield of Black Cumin were obtained at monoculture with 750 and 2310 kg.ha-1, respectively. The highest of percentage of grain protein (23% and essential oil percentage (1.47% were related to treatment 100% Black Cumin + 50% Chickpea, respectively. Based on this results, the highest land equivalent ratio (LER=1.74, actual yield loss (AYL=6.45 and intercropping advantage (IA=1.70 were obtained by treatment 100% Black Cumin + 10% Chickpea, respectively. Therefore, it seems that treatment 100% Black Cumin + 10% Chickpea is remarkably effective to increase the economic income and land use efficiency.
Dissecting the Root Nodule Transcriptome of Chickpea (Cicer arietinum L.).
Kant, Chandra; Pradhan, Seema; Bhatia, Sabhyata
2016-01-01
A hallmark trait of chickpea (Cicer arietinum L.), like other legumes, is the capability to convert atmospheric nitrogen (N2) into ammonia (NH3) in symbiotic association with Mesorhizobium ciceri. However, the complexity of molecular networks associated with the dynamics of nodule development in chickpea need to be analyzed in depth. Hence, in order to gain insights into the chickpea nodule development, the transcriptomes of nodules at early, middle and late stages of development were sequenced using the Roche 454 platform. This generated 490.84 Mb sequence data comprising 1,360,251 reads which were assembled into 83,405 unigenes. Transcripts were annotated using Gene Ontology (GO), Cluster of Orthologous Groups (COG) and Kyoto Encyclopedia of Genes and Genomes (KEGG) metabolic pathways analysis. Differential expression analysis revealed that a total of 3760 transcripts were differentially expressed in at least one of three stages, whereas 935, 117 and 2707 transcripts were found to be differentially expressed in the early, middle and late stages of nodule development respectively. MapMan analysis revealed enrichment of metabolic pathways such as transport, protein synthesis, signaling and carbohydrate metabolism during root nodulation. Transcription factors were predicted and analyzed for their differential expression during nodule development. Putative nodule specific transcripts were identified and enriched for GO categories using BiNGO which revealed many categories to be enriched during nodule development, including transcription regulators and transporters. Further, the assembled transcriptome was also used to mine for genic SSR markers. In conclusion, this study will help in enriching the transcriptomic resources implicated in understanding of root nodulation events in chickpea.
Directory of Open Access Journals (Sweden)
Aruna Jyothi Kora
2012-01-01
Full Text Available A simple and ecofriendly procedure have been devised for the green synthesis of silver nanoparticles using the aqueous extract of gum tragacanth (Astragalus gummifer, a renewable, nontoxic natural phyto-exudate. The water soluble components in the gum act as reductants and stabilizers. The generated nanoparticles were analyzed using UV-visible spectroscopy, transmission electron microscopy, X-ray diffraction, Fourier transform-infrared spectroscopy, and Raman spectroscopy. The role of gum concentration and reaction time on the synthesis of nanoparticles was studied. By regulating the reaction conditions, spherical nanoparticles of 13.1±1.0 nm size were produced. Also, the possible functional groups involved in reduction and capping of nanoparticles has been elucidated. The antibacterial activity of the fabricated nanoparticles was tested on model Gram-negative and Gram-positive bacterial strains with well-diffusion method. These nanoparticles exhibited considerable antibacterial activity on both the Gram classes of bacteria, implying their potential biomedical applications.
International Nuclear Information System (INIS)
Kharkwal, M.C.
1998-01-01
A comparative study of frequency and spectrum of chlorophyll mutations induced by two physical (gamma rays, fast neutrons) and two chemical mutagens (NMU, EMS) in relation to the effects in M1 plants and induction of mutations in M2 was made in four chickpea (Cicer arietinum L.) varieties, two desi (G 130 & H 214) one Kabuli (C 104) and one green seeded (L 345). The treatments included three doses each of gamma rays (400, 500 & 600 Gy) and fast neutrons (5, 10 & 15 Gy) and two concentrations with two different durations of two chemical mutagens, NMU [0.01% (20h), & 0.02% (8h)] and EMS [0.1% (20h) & 0.2% (8h)]. The frequencies and spectrum of three different kinds of induced chlorophyll mutations in the order albina (43.5%), chlorina (27.3%) and xantha (24.2%) were recorded. Chemical mutagens were found to be efficient in inducing chlorophyll mutations in chickpea. Highest frequency of mutations was observed in green seeded var. L 345 (83% of M1 families and 19.9/1000 M2 plants). Kabuli var. C 104 was least responsive for chlorophyll mutations
Nutritional quality and health benefits of chickpea (Cicer arietinum L.): a review.
Jukanti, A K; Gaur, P M; Gowda, C L L; Chibbar, R N
2012-08-01
Chickpea (Cicer arietinum L.) is an important pulse crop grown and consumed all over the world, especially in the Afro-Asian countries. It is a good source of carbohydrates and protein, and protein quality is considered to be better than other pulses. Chickpea has significant amounts of all the essential amino acids except sulphur-containing amino acids, which can be complemented by adding cereals to the daily diet. Starch is the major storage carbohydrate followed by dietary fibre, oligosaccharides and simple sugars such as glucose and sucrose. Although lipids are present in low amounts, chickpea is rich in nutritionally important unsaturated fatty acids such as linoleic and oleic acids. β-Sitosterol, campesterol and stigmasterol are important sterols present in chickpea oil. Ca, Mg, P and, especially, K are also present in chickpea seeds. Chickpea is a good source of important vitamins such as riboflavin, niacin, thiamin, folate and the vitamin A precursor β-carotene. As with other pulses, chickpea seeds also contain anti-nutritional factors which can be reduced or eliminated by different cooking techniques. Chickpea has several potential health benefits, and, in combination with other pulses and cereals, it could have beneficial effects on some of the important human diseases such as CVD, type 2 diabetes, digestive diseases and some cancers. Overall, chickpea is an important pulse crop with a diverse array of potential nutritional and health benefits.
Martínez, Agustín
2015-01-01
El presente trabajo de tesis tiene como finalidad evaluar el potencial toxigénico de la planta Astragalus pehuenches en la región sur de la Provincia de Río Negro, Argentina y caracterizar clínica, bioquímica e histopatológicamente la intoxicación producida en cobayos y ovinos. Se cosecharon 110 kg de A. pehuenches en establecimientos cercanos las localidades de Los Menucos, Maquinchao e Ingeniero Jacobacci, determinándose concentraciones del principio activo swainsonina de 0,070 % a 0,097% S...
Wood, Jennifer A; Knights, Edmund J; Campbell, Grant M; Choct, Mingan
2014-05-01
Ease of milling is an important quality trait for chickpeas (Cicer arietinum L.) and involves two separate processes: removal of the seed coat and splitting of cotyledons. Four chickpea genotypes (two desi types, one kabuli type and one interspecific hybrid with 'wild' C. echinospermum parentage) of differing ease of milling were examined to identify associated seed composition differences in the seed coat, cotyledons and their junctions (abaxial and adaxial). Several components in different fractions were associated with ease of milling chickpea seeds: primarily soluble and insoluble non-starch polysaccharides (including pectins) and protein at the seed coat and cotyledon junctions, and the lignin content of the seed coat. This study shows that the chemical composition of chickpea does vary with seed type (desi and kabuli) and within desi genotypes in ways that are consistent with physical explanations of how seed structure and properties relate to milling behaviour. © 2013 Society of Chemical Industry.
Silva, Luis Leopoldo; Duarte, Isabel; Simões, Nuno; Lourenço, Ermelinda; Chaves, Maria Manuela
2011-01-01
O grão de bico (Cicer arietinum L.) é uma das culturas proteaginosas mais importantes do mundo. É cultivado numa grande variedade de climas, principalmente para consumo humano, proporcionando uma importante fonte de proteína, especialmente nos países em desenvolvimento. Nas regiões mediterrânicas, o grão de bico é tradicionalmente cultivado como uma cultura de sequeiro, semeada na Primavera, e por isso muito dependente da precipitação, geralmente escassa e muito variável. Nesta situação, a...
International Nuclear Information System (INIS)
Sarwar, M.; Ahmad, N.; Tofique, M.
2012-01-01
Present research was carried out to identify alternatives to synthetic insecticides to control cowpea weevil Callosobruchus analis (F.) population in gram seed (Cicer arietinum L.), during storage. The efficacies of three plant materials such as Nicotiana tabacum, Citrullus colocythis and Aloe vera were assessed to determine their insecticidal activities against survival of bruchid C. analis on seeds of gram varieties viz., CM-98 and Jubiha-1. These plant materials tested reduced weevil infestation and emergence as compared with untreated control seeds. Seeds treatment with A. vera followed by N. tabacum reduced maximum pest damage over C. colocythis, which proved least effective to control C. analis population. Consequently, the tested plant materials should be given due consideration for effective gram protection as a component of integrated pest management approach in storage. (author)
Verecundia, risa y decoro: Cicerón y el arte de insultar
Directory of Open Access Journals (Sweden)
Mas, Salvador
2015-12-01
Full Text Available One can speak about laughter in many ways; one can take, for example, a physiological approach, or a psychological one, or even a third sociological one, which the ancients did not completely disregard. Cicero, however, preferred to focus on the rhetorical possibilities of laughter and humor. The relevance of jest and jokes in order to get an audience’s favor or to ridicule an adversary is undeniable; but, despite their effectiveness and given their effectiveness, that jest and jokes can also exceed the limits of what is acceptable or advisable is also undeniable. An issue that is all the more serious since the orator can and should make joke of matters which, taken in themselves, are not funny. Cicero's rhetoric on laughter raises the issue of, and flows into, the ethics and the tactics that are attentive to the study and possible codification of the guiding principles in using such a powerful resource as humor. It is a resource that should be used in an advisable, appropriate, and dignified manner (for all these manners can be translated the Greek prepon and the latin decorum, which presupposes that it is not always so used, and, with respect to this at the following pages, presupposes that there is laughter that inappropriate, that is almost shameful, and that can result in difficulties for whoever causes the laughter and uses that humor, since it is always dangerous to laugh at the powerful. Undoubtedly, Cicero was an individual who very much insulted others, with wit, humor, and sometimes with extraordinary aggressiveness.Sobre la risa puede hablarse de muchas maneras; cabe, por ejemplo, una aproximación fisiológica, otra psicológica o una tercera sociológica, que los antiguos no desatendieron por completo, si bien Cicerón prefirió investigar sus posibilidades retóricas. A nadie se le oculta la relevancia de chanzas y chistes para disponer a la audiencia de manera favorable o para ridiculizar al adversario; tampoco que esta
Dissecting the Root Nodule Transcriptome of Chickpea (Cicer arietinum L..
Directory of Open Access Journals (Sweden)
Chandra Kant
Full Text Available A hallmark trait of chickpea (Cicer arietinum L., like other legumes, is the capability to convert atmospheric nitrogen (N2 into ammonia (NH3 in symbiotic association with Mesorhizobium ciceri. However, the complexity of molecular networks associated with the dynamics of nodule development in chickpea need to be analyzed in depth. Hence, in order to gain insights into the chickpea nodule development, the transcriptomes of nodules at early, middle and late stages of development were sequenced using the Roche 454 platform. This generated 490.84 Mb sequence data comprising 1,360,251 reads which were assembled into 83,405 unigenes. Transcripts were annotated using Gene Ontology (GO, Cluster of Orthologous Groups (COG and Kyoto Encyclopedia of Genes and Genomes (KEGG metabolic pathways analysis. Differential expression analysis revealed that a total of 3760 transcripts were differentially expressed in at least one of three stages, whereas 935, 117 and 2707 transcripts were found to be differentially expressed in the early, middle and late stages of nodule development respectively. MapMan analysis revealed enrichment of metabolic pathways such as transport, protein synthesis, signaling and carbohydrate metabolism during root nodulation. Transcription factors were predicted and analyzed for their differential expression during nodule development. Putative nodule specific transcripts were identified and enriched for GO categories using BiNGO which revealed many categories to be enriched during nodule development, including transcription regulators and transporters. Further, the assembled transcriptome was also used to mine for genic SSR markers. In conclusion, this study will help in enriching the transcriptomic resources implicated in understanding of root nodulation events in chickpea.
Directory of Open Access Journals (Sweden)
Rafael Goulart Machado
2018-01-01
Full Text Available Rhizobia are able to increase yield of non-leguminous species through production of phyto-stimulating substances. This study aimed to evaluate the inoculation effect of rhizobia UFRGS Lc348 and VP16 on millet and Sudan grass yield and germination, and verify the enrichment effect of culture medium with tryptophan, which leads on the rhizobium/plant interaction. Experiments in vitro and greenhouse conditions were conducted. In millet, the inoculation with VP16 grown in culture medium with or without tryptophan induces greater length of hypocotyl and epicotyl under in vitro conditions. UFRGS Lc348 treatment induces longer hypocotyls of millet under in vitro conditions. No effects were observed with the millet inoculation in greenhouse. In Sudan grass, inoculation with VP16 enriched with tryptophan increased dry matter in shoots of adult plants. In millet seedlings had achieved an increasing in elongation in vitro conditions, which could represent an adaptive advantage in the search for water and nutrients in the rhizospheric environment during the initial growth of millet. Similarly, if verified in field conditions, Sudan grass had achieved an increasing in greenhouse conditions with the inoculation of tryptophan-enriched VP16, which could be correlated with a significant gain in crop yield. Therefore, these relationships between tryptophan-enriched VP16 and Sudan grass should be verified in subsequent studies under field conditions.
International Nuclear Information System (INIS)
Barshile, J.D.; Apparao, B.J.
2006-01-01
Mutagenic effectiveness and efficiency of Ethyl Methane Sulphonate (EMS), Sodium Azide (SA) and gamma radiation on two cultivars of chickpea (Cicer arietinum L), Vijay and Vishwas were evaluated by the biological damages caused by them in M 1 generation and on the basis of frequency of chlorophyll mutations produced in the M 2 generation. All mutagenic treatments of EMS, SA and gamma radiation decreased germination, seedling height, plant survival and pollen fertility in both the cultivars. The extent of effect was dose dependent. LD 50 values of mutagen were found to be helpful for planning experimental mutagenesis in chickpea. Frequency of chlorophyll mutations in M 2 generation was less in Vijay as compared to Vishwas. Mutagenic effectiveness is inversely proportional to the increasing concentrations/doses of mutagens in both the cultivars, except for gamma radiation treatments in the cultivar Vishwas. All three mutagens (except EMS in the Vijay and gamma radiation in the cultivar Vishwas) exhibited gradual decrease in mutagenic efficiency, with an increase in their concentration/dose. (author)
Chemical and rheological properties of exopolysaccharides produced by four isolates of rhizobia.
Moretto, Cristiane; Castellane, Tereza Cristina Luque; Lopes, Erica Mendes; Omori, Wellington Pine; Sacco, Laís Postai; Lemos, Eliana Gertrudes de Macedo
2015-11-01
The rheological, physicochemical properties, emulsification and stability of exopolysaccharides (EPSs) from four rhizobia isolates (LBMP-C01, LBMP-C02, LBMP-C03 and LBMP-C04) were studied. The EPS yields of isolates under these experimental conditions were in the range of 1.5-6.63gL(-1). The LBMP-C04 isolate, which presented the highest EPS production (6.63gL(-1)), was isolated from Arachis pintoi and was identified as a Rhizobium sp. strain that could be explored as a possible potential source for the production of extracellular heteropolysaccharides. All polymers showed a pseudoplastic non-Newtonian fluid behavior or shear thinning property in aqueous solutions. Among the four EPS tested against hydrocarbons, EPS LBMP-C01 was found to be more effective against hexane, olive and soybean oils (89.94%, 82.75% and 81.15%, respectively). Importantly, we found that changes in pH (2-11) and salinity (0-30%) influenced the emulsification of diesel oil by the EPSs. EPSLBMP-C04 presented optimal emulsification capacity at pH 10 (E24=53%) and 30% salinity (E24=27%). These findings contribute to the understanding of the influence of the chemical composition, physical properties and biotechnology applications of rhizobial EPS solutions their bioemulsifying properties. Copyright © 2015 Elsevier B.V. All rights reserved.
International Nuclear Information System (INIS)
Kole, E.T.M.
2014-07-01
Three major investigations were carried out to assess the morphological traits and nodulation potential of thirteen lima bean cultivars as well as the genetic diversity of rhizobia nodulating these lima bean cultivars. Thirteen lima bean cultivars obtained from the CSIR-PGGRI and various market centres in Ghana were used. The experiment was conducted in pots filled with natural topsoil and arranged in a randomised complete block design (RCBD) with three replicates at the Biotechnology and Nuclear Agriculture Research Institute (BNARI) of the Ghana Atomic Energy Commission (GAEC). The study aimed at obtaining some relevant information on the morphological traits of the lima bean to be improved upon, to evaluate their nodulation tendencies and determine similarities and differences of their nodulating rhizobia. Significant differences were obtained in quantitative characters (leaflet length, leaflet width, pod length, pod width, seed length, seed width, seed weight per 10 seeds and days to 50% emergence), contributing to divergence among the lima bean cultivars. Qualitative traits, however, were mostly similar, with few exceptions such as the flower wing colour, growth habit, leaf shape, main stem pigmentation, pod beak shape, seed secondary colour and seed pattern colour showing divergence among the lima bean cultivars. Two major clusters were joined at the similarity distance of 0.69. Majority of the lima bean cultivars were identified to be of the same morphotype with exception in cultivars M4 and A2. There were no significant differences in mean nodule number, mean effective and non-effective nodule counts. The lima bean cultivar GH 17I4 showed superior performance with respect to nodule number counts, effective nodules, fresh shoot weight and fresh root weight. Additionally lima bean cultivars, M5 and A2 indicated superior radiation use efficiency with total shoot dry matter of 731kg/ha and 704kg/ha respectively. A positive and high correlation existed between
Marker-trait association study for protein content in chickpea (Cicer arietinum L.).
Jadhav, A A; Rayate, S J; Mhase, L B; Thudi, M; Chitikineni, A; Harer, P N; Jadhav, A S; Varshney, R K; Kulwal, P L
2015-06-01
Chickpea (Cicer arietinum L.) is the second most important cool season food legume cultivated in arid and semiarid regions of the world. The objective of the present study was to study variation for protein content in chickpea germplasm, and to find markers associated with it. A set of 187 genotypes comprising both international and exotic collections, and representing both desi and kabuli types with protein content ranging from 13.25% to 26.77% was used. Twenty-three SSR markers representing all eight linkage groups (LG) amplifying 153 loci were used for the analysis. Population structure analysis identified three subpopulations, and corresponding Q values of principal components were used to take care of population structure in the analysis which was performed using general linear and mixed linear models. Marker-trait association (MTA) analysis identified nine significant associations representing four QTLs in the entire population. Subpopulation analyses identified ten significant MTAs representing five QTLs, four of which were common with that of the entire population. Two most significant QTLs linked with markers TR26.205 and CaM1068.195 were present on LG3 and LG5. Gene ontology search identified 29 candidate genes in the region of significant MTAs on LG3. The present study will be helpful in concentrating on LG3 and LG5 for identification of closely linked markers for protein content in chickpea and for their use in molecular breeding programme for nutritional quality improvement.
Pandey, Aarti; Chakraborty, Subhra; Datta, Asis; Chakraborty, Niranjan
2008-01-01
Dehydration or water-deficit is one of the most important environmental stress factors that greatly influences plant growth and development and limits crop productivity. Plants respond and adapt to such stress by altering their cellular metabolism and activating various defense machineries. Mechanisms that operate signal perception, transduction, and downstream regulatory events provide valuable information about the underlying pathways involved in environmental stress responses. The nuclear proteins constitute a highly organized, complex network that plays diverse roles during cellular development and other physiological processes. To gain a better understanding of dehydration response in plants, we have developed a comparative nuclear proteome in a food legume, chickpea (Cicer arietinum L.). Three-week-old chickpea seedlings were subjected to progressive dehydration by withdrawing water and the changes in the nuclear proteome were examined using two-dimensional gel electrophoresis. Approximately 205 protein spots were found to be differentially regulated under dehydration. Mass spectrometry analysis allowed the identification of 147 differentially expressed proteins, presumably involved in a variety of functions including gene transcription and replication, molecular chaperones, cell signaling, and chromatin remodeling. The dehydration responsive nuclear proteome of chickpea revealed a coordinated response, which involves both the regulatory as well as the functional proteins. This study, for the first time, provides an insight into the complex metabolic network operating in the nucleus during dehydration.
Directory of Open Access Journals (Sweden)
Tzu-Shao Yeh
2014-03-01
Full Text Available Astragalus membranaceus (AM is a popular “Qi-tonifying” herb with a long history of use as a Traditional Chinese Medicine with multiple biological functions. However, evidence for the effects of AM on exercise performance and physical fatigue is limited. We evaluated the potential beneficial effects of AM on ergogenic and anti-fatigue functions following physiological challenge. Male ICR strain mice were randomly assigned to four groups (n = 10 per group for treatment: (1 sedentary control and vehicle treatment (vehicle control; (2 exercise training with vehicle treatment (exercise control; and (3 exercise training with AM treatment at 0.615 g/kg/day (Ex-AM1 or (4 3.075 g/kg/day (Ex-AM5. Both the vehicle and AM were orally administered for 6 weeks. Exercise performance and anti-fatigue function were evaluated by forelimb grip strength, exhaustive swimming time, and levels of serum lactate, ammonia, glucose, and creatine kinase after 15-min swimming exercise. Exercise training combined with AM supplementation increased endurance exercise capacity and increased hepatic and muscle glycogen content. AM reduced exercise-induced accumulation of the byproducts blood lactate and ammonia with acute exercise challenge. Moreover, we found no deleterious effects from AM treatment. Therefore, AM supplementation improved exercise performance and had anti-fatigue effects in mice. It may be an effective ergogenic aid in exercise training.
A New Flavonol Triglycoside and Other Flavonol Glycosides from Astragalus armatus Willd. (Fabaceae
Directory of Open Access Journals (Sweden)
Assia Khalfallah
2014-01-01
Full Text Available From the aerial parts of Astragalus armatus, a new acylated flavonol triglycoside, isorhamnetin-3-O-(5'''-p-hydroxybenzoyl-β-apiofuranosyl-(1→2[ α -rhamnopyranosyl-(1→6]- β -galactopyranoside (1 which we named astrarmatuside, has been isolated and structurally elucidated together with seven known flavonol glycosides: tamarixetin-3-O- α -apiofuranosyl-(1→2[ α -rhamnopyranosyl-(1→6]- β -galactopyranoside (2 (m illettias p ec oside D , isorhamnetin-3-O-β-apiofuranosyl-(1→2[α-rhamnopyranosyl-(1→6]-β-galacto-pyranoside (3, kaempferol-3-O-α-rhamnopyranosyl-(1→2[α-rhamnopyranosyl-(1→6]-β-glucopyranoside (4, kaempferol-3-O-α-rhamnopyranosyl-(1→2[α-rhamnopyranosyl-(1→6]-β-galactopyranoside (mauritianin (5, isorhamnetin-3-O-α-rhamnopyranosyl-(1→2[α-rhamnopyranosyl-(1→6]-β-galactopyranoside (6, kaempferol-3-O-α-rhamnopyranosyl-(1→6]-β-glucopyranoside (nikotiflorin (7 and isorhamnetin-3-O-α-rhamnopyranosyl-(1→6]-β-glucopyranoside (narcissin (8 . The structures of the isolated compounds were established by means of 2D NMR experiments, HPLC-DADMS, HR-MS and UV spectral analyses. Pivotal role in the structure elucidation and in particular in the determination of sugar sequence, played HSQC-TOCSY and ROESY experiments whereas those of the known compounds (2–8 were established by spectral comparison with those published in the literature.
Sun, Shuqin; Yang, Shuo; Dai, Min; Jia, Xiujuan; Wang, Qiyan; Zhang, Zheng; Mao, Yongjun
2017-06-13
Apoptosis plays a critical role in the progression of diabetic cardiomyopathy (DC). Astragalus polysaccharides (APS), an extract of astragalus membranaceus (AM), is an effective cardioprotectant. Currently, little is known about the detailed mechanisms underlying cardioprotective effects of APS. The aims of this study were to investigate the potential effects and mechanisms of APS on apoptosis employing a model of high glucose induction of apoptosis in H9C2 cells. A model of high glucose induction of H9C2 cell apoptosis was adopted in this research. The cell viabilities were analyzed by MTT assay, and the apoptotic response was quantified by flow cytometry. The expression levels of the apoptosis related proteins were determined by Real-time PCR and western blotting. Incubation of H9C2 cells with various concentrations of glucose (i.e., 5.5, 12.5, 25, 33 and 44 mmol/L) for 24 h revealed that cell viability was reduced by high glucose dose-dependently. Pretreatment of cells with APS could inhibit high glucose-induced H9C2 cell apoptosis by decreasing the expressions of caspases and the release of cytochrome C from mitochondria to cytoplasm. Further experiments also showed that APS could modulate the ratio of Bcl-2 to Bax in mitochondria. APS decreases high glucose-induced H9C2 cell apoptosis by inhibiting the expression of pro-apoptotic proteins of both the extrinsic and intrinsic pathways and modulating the ratio of Bcl-2 to Bax in mitochondria.
Subba, Pratigya; Barua, Pragya; Kumar, Rajiv; Datta, Asis; Soni, Kamlesh Kumar; Chakraborty, Subhra; Chakraborty, Niranjan
2013-11-01
Reversible protein phosphorylation is a ubiquitous regulatory mechanism that plays critical roles in transducing stress signals to bring about coordinated intracellular responses. To gain better understanding of dehydration response in plants, we have developed a differential phosphoproteome in a food legume, chickpea (Cicer arietinum L.). Three-week-old chickpea seedlings were subjected to progressive dehydration by withdrawing water, and the changes in the phosphorylation status of a large repertoire of proteins were monitored. The proteins were resolved by 2-DE and stained with phosphospecific fluorescent Pro-Q Diamond dye. Mass spectrometric analysis led to the identification of 91 putative phosphoproteins, presumably involved in a variety of functions including cell defense and rescue, photosynthesis and photorespiration, molecular chaperones, and ion transport, among others. Multiple sites of phosphorylation were predicted on several key elements, which include both the regulatory as well as the functional proteins. A critical survey of the phosphorylome revealed a DREPP (developmentally regulated plasma membrane protein) plasma membrane polypeptide family protein, henceforth designated CaDREPP1. The transcripts of CaDREPP1 were found to be differentially regulated under dehydration stress, further corroborating the proteomic results. This work provides new insights into the possible phosphorylation events triggered by the conditions of progressive water-deficit in plants.
Ye, Zipeng; Wang, Wei; Yuan, Qingxia; Ye, Hong; Sun, Yi; Zhang, Hongcheng; Zeng, Xiaoxiong
2016-08-20
The optimal extraction conditions with a yield of 5.37±0.15% for extraction of polysaccharides from chickpea (Cicer arietinum L.) hull (CHPS) were determined as extraction temperature 99°C, extraction time 2.8h and ratio of water to raw material 24mL/g. Three fractions of CHPS-1, CHPS-2 and CHPS-3, with average molecular weight of 3.1×10(6), 1.5×10(6) and 7.8×10(5)Da, respectively, were obtained from crude CHPS by chromatography of DEAE Fast Flow and Sephadex G-100. CHPS-1 was composed of mannose, rhamnose, galactose, galacturonic acid, glucose and arabinose, CHPS-2 was composed of mannose, rhamnose, galacturonic acid, galactose, xylose and arabinose, CHPS-3 was composed of galacturonic acid, galactose and rhamnose. CHPS-3 showed the strongest reducing power and protective effect on H2O2-induced oxidative injury in PC12 cells and highest scavenging activities against DPPH and ABTS radicals, while CHPS-2 showed the highest scavenging activity against superoxide anion radical. Copyright © 2016 Elsevier Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
Pramod Mahajan
2011-01-01
Full Text Available The present study demonstrates an effect of nano-ZnO particles on the growth of plant seedlings of mung (Vigna radiate and gram (Cicer arietinum. The study was carried out in plant agar media to prevent precipitation of water-insoluble nanoparticles in the test units. Various concentrations of nano-ZnO particles in suspension form were introduced to the agar media, and their effect on the root and shoot growth of the seedlings was examined. The main experimental approach, using correlative light and scanning electron microscopy provided evidence of adsorption of nanoparticles on the root surface. Absorption of nanoparticles by seedlings root was also detected by inductive coupled plasma/atomic emission spectroscopy (ICP-AES. It was found that at certain optimum concentration, the seedlings displayed good growth over control, and beyond that, retardation in growth was observed.
ЧИСЛА ХРОМОСОМ НЕКОТОРЫХ ВИДОВ ДВУДОЛЬНЫХ РАСТЕНИЙ ЮЖНОЙ СИБИРИ И КАЗАХСТАНА
Directory of Open Access Journals (Sweden)
T. V. An’kova
2015-04-01
Full Text Available Приведены числа хромосом (2n для девяти видов семейств Asteraceae, Caryophyllaceae, Fabaceae, Rosaceae и Scrophulariaceae. Впервые определены числа хромосом Silene cretacea (2n=20 и Oxytropis stenofoliola (2n=48. Впервые для Казахстана и Южной Сибири (Западный Саян, Новосибирская область определены числа хромосом у Jurinea arachnoidea, Tragopogon ruber, Astragalus brachylobus, A. cicer, A. danicus, Verbascum phoeniceum.
A BAC/BIBAC-based physical map of chickpea, Cicer arietinum L
Directory of Open Access Journals (Sweden)
Abbo Shahal
2010-09-01
Full Text Available Abstract Background Chickpea (Cicer arietinum L. is the third most important pulse crop worldwide. Despite its importance, relatively little is known about its genome. The availability of a genome-wide physical map allows rapid fine mapping of QTL, development of high-density genome maps, and sequencing of the entire genome. However, no such a physical map has been developed in chickpea. Results We present a genome-wide, BAC/BIBAC-based physical map of chickpea developed by fingerprint analysis. Four chickpea BAC and BIBAC libraries, two of which were constructed in this study, were used. A total of 67,584 clones were fingerprinted, and 64,211 (~11.7 × of the fingerprints validated and used in the physical map assembly. The physical map consists of 1,945 BAC/BIBAC contigs, with each containing an average of 28.3 clones and having an average physical length of 559 kb. The contigs collectively span approximately 1,088 Mb. By using the physical map, we identified the BAC/BIBAC contigs containing or closely linked to QTL4.1 for resistance to Didymella rabiei (RDR and QTL8 for days to first flower (DTF, thus further verifying the physical map and confirming its utility in fine mapping and cloning of QTL. Conclusion The physical map represents the first genome-wide, BAC/BIBAC-based physical map of chickpea. This map, along with other genomic resources previously developed in the species and the genome sequences of related species (soybean, Medicago and Lotus, will provide a foundation necessary for many areas of advanced genomics research in chickpea and other legume species. The inclusion of transformation-ready BIBACs in the map greatly facilitates its utility in functional analysis of the legume genomes.
Directory of Open Access Journals (Sweden)
M. Saki
2013-03-01
Full Text Available The relationship between plant species and environmental factors has always been a central issue in plant ecology. With rising power of statistical techniques, geo-statistics and geographic information systems (GIS, the development of predictive habitat distribution models of organisms has rapidly increased in ecology. This study aimed to evaluate the ability of Logistic Regression Tree model to create potential habitat map of Astragalus verus. This species produces Tragacanth and has economic value. A stratified- random sampling was applied to 100 sites (50 presence- 50 absence of given species, and produced environmental and edaphic factors maps by using Kriging and Inverse Distance Weighting methods in the ArcGIS software for the whole study area. Relationships between species occurrence and environmental factors were determined by Logistic Regression Tree model and extended to the whole study area. The results indicated species occurrence has strong correlation with environmental factors such as mean daily temperature and clay, EC and organic carbon content of the soil. Species occurrence showed direct relationship with mean daily temperature and clay and organic carbon, and inverse relationship with EC. Model accuracy was evaluated both by Cohen’s kappa statistics (κ and by area under Receiver Operating Characteristics curve based on independent test data set. Their values (kappa=0.9, Auc of ROC=0.96 indicated the high power of LRT to create potential habitat map on local scales. This model, therefore, can be applied to recognize potential sites for rangeland reclamation projects.
Directory of Open Access Journals (Sweden)
Ijaz Mehboob, Zahir Ahmad Zahir, Muhammad Arshad, Muhammad Khalid
2012-05-01
Full Text Available During the last couple of decades, it has been demonstrated that rhizobia can associate with roots of non-legumes also without forming true nodules, and can promote their growth by using one or more of the direct or indirect mechanisms of actions. This work examines the growth and yield responses of maize to inoculation with different species of rhizobia, isolated from the root nodules of chickpea (Cicer arietinum L., lentil (Lens culinaris M. and mung bean (Vigna radiata L. in pots and fields. Twenty isolates of rhizobia were isolated from root nodules each of mung bean, lentil and chickpea and were screened under axenic conditions. On the basis of their promising performance under axenic conditions, nine most efficient isolates (three from each legume host were selected, characterized and further evaluated for their growth promoting activities by conducting pot and field experiments. Results of pot experiment revealed that maximum increase in grain yield, 1000 grain weight, N, P and K uptake (up to 47.89, 54.52, 73.46, 84.66 and 59.19% by CRI28, respectively, over un-inoculated control was produced by the isolate of Mesorhizobium ciceri. Whereas, maximum improvement in rest of the parameters was caused by the isolates of Rhizobium phaseoli (i.e. fresh biomass, straw yield and root length up to 36.30% by A18, 25.46% by S6 and 81.89% by A18, respectively over un-inoculated control. Rhizobium leguminosarum isolates came out to be the least effective among the species tested. Similarly, all the selected isolates improved the growth and yield attributing parameters in fields as well but with varying capacity compared with un-inoculated control. The selected isolates of Mesorhizobium ciceri and Rhizobium phaseoli again remained superior compared to the isolates of Rhizobium leguminosarum under field conditions. The results of this study imply that rhizobium species had potential to promote growth and yield of maize but this technology should be
Kotula, Lukasz; Khan, Hammad A; Quealy, John; Turner, Neil C; Vadez, Vincent; Siddique, Kadambot H M; Clode, Peta L; Colmer, Timothy D
2015-08-01
The reproductive phase in chickpea (Cicer arietinum L.) is affected by salinity, but little is known about the underlying cause. We investigated whether high concentrations of Na(+) and Cl(-) in the reproductive structures influence reproductive processes. Chickpea genotypes contrasting in tolerance were subjected to 0, 35 or 50 mm NaCl applied to soil in pots. Flower production and abortion, pod number, percentage of empty pods, seed number and size were evaluated. The concentrations of Na(+) , K(+) and Cl(-) were measured in various plant tissues and, using X-ray microanalysis, in specific cells of developing reproductive structures. Genotypic variation in reproductive success measured as seed yield in saline conditions was associated with better maintenance of flower production and higher numbers of filled pods (and thus seed number), whereas seed size decreased in all genotypes. Despite the variation in reproductive success, the accumulation of Na(+) and Cl(-) in the early reproductive tissues of developing pods did not differ between a tolerant (Genesis836) and a sensitive (Rupali) genotype. Similarly, salinity tolerance was not associated with the accumulation of salt ions in leaves at the time of reproduction or in seeds at maturity. © 2015 John Wiley & Sons Ltd.
Wood, Corlett W; Stinchcombe, John R
2017-11-01
The maintenance of genetic variation in the benefits provided by mutualists is an evolutionary puzzle (Heath & Stinchcombe, ). Over time, natural selection should favour the benefit strategy that confers the highest fitness, eroding genetic variation in partner quality. Yet abundant genetic variation in partner quality exists in many systems (Heath & Stinchcombe, ). One possible resolution to this puzzle is that the genetic identity of both a host and its partner affects the benefits each mutualist provides to the other, a pattern known as a genotype-by-genotype interaction (Figure ). Mounting evidence suggests that genotype-by-genotype interactions between partners are pervasive at the phenotypic level (Barrett, Zee, Bever, Miller, & Thrall, ; Heath, ; Hoeksema & Thompson, ). Ultimately, however, to link these phenotypic patterns to the maintenance of genetic variation in mutualisms we need to answer two questions: How much variation in mutualism phenotypes is attributable to genotype-by-genotype interactions, and what mutualistic functions are influenced by each partner and by the interaction between their genomes? In this issue of Molecular Ecology, Burghardt et al. (2017) use transcriptomics to address both questions in the legume-rhizobia mutualism. © 2017 John Wiley & Sons Ltd.
Directory of Open Access Journals (Sweden)
Meza-Ramírez Janitzi Yunuén
2016-08-01
Full Text Available Soil polluted by 40000 ppm of waste residual oil (WRO, is a relative high hydrocarbons mix concentration according to Mexican regulation related with as the well know NOM-138-SEMARNAT/SSA1-2003 (NOM-138. Due to cause lost soil´s fertility, inhibiting microbial life and reducing vegetal production. To NOM-138 the highest limit of hydrocarbons mix allowed in soil is equal to 4400 ppm/kg. Aims of this research were: i Biostimulation of soil polluted by 40000 ppm of WRO by vermicompost and/or bovine compost, ii Phytoremediation by Cicer arietinum and Burkholderia cepacia to reduce WRO at below value compared to highest according to NOM-138. Results showed that biostimulation of soil with bovine compost eliminated WRO at 24000 ppm in 49 days. Then phytoremediation by C. arietinum and B. cepacia decreased WRO at 2760 ppm value below to compare to highest concentration allowed to NOM-138. It´s concluded that biore-mediation of soil impacted by relatively high concentration of WRO, the best strategy was to apply both biostimulation/phytoremediation that separate.
Verma, Alok Kumar; Kumar, Sandeep; Tripathi, Anurag; Chaudhari, Bhushan P; Das, Mukul; Dwivedi, Premendra D
2012-04-05
Allergy to chickpea or Garbanzo bean (Cicer arietinum) has been reported in the Indian population. Little information is found regarding allergenic events involved in the chickpea allergy; therefore, chickpea allergenicity assessment was undertaken. In vivo and ex vivo studies were carried out using BALB/c mice. Chickpea skin prick test positive patients have been used to extend this study in humans. Identification of allergens was carried out by simulated gastric fluids assay for pepsin resistant polypeptides and validated by IgE western blotting using chickpea sensitive humans and sensitized mice sera. Our data have shown the occurrence of a systemic anaphylactic reaction resulting in reduced body temperature after challenge along with significantly increased levels of IgE, IgG1, MMCP-1, CCL-2 as well as histamine. Further, increased Th1/Th2 (mixed) cytokine response was observed in spleen cell culture supernatants. Jejunum, lungs and spleen showed prominent histopathological changes specific for allergic inflammation. Immunoblotting with pooled sera of either sensitized mice or human sera recognized seven similar IgE binding polypeptides that may be responsible for chickpea induced hypersensitivity reactions. This study has addressed the allergenic manifestations associated with chickpea consumption and identifies the proteins responsible for allergenicity which may prove useful in diagnosis and management of allergenicity of legumes especially chickpea. Copyright © 2012 Elsevier Ireland Ltd. All rights reserved.
Zahran, Eman; Risha, Engy; Abdelhamid, Fatma; Mahgoub, Hebata Allah; Ibrahim, Tarek
2014-05-01
This work investigated the potential immunomodulatory and growth-promoting effects of Astragalus polysaccharides (APS) in Nile tilapia (Oreochromis niloticus). The dietary supplementation with APS (1500 mg/kg of diet) caused a significant increase in growth parameters (initial and final weight, weight gain (WG), specific growth rate (SGR), feed conversion ratio (FCR) and feed intake (FI), when compared to non-supplemented control basal diet. In addition, APS upregulated the phagocytic activity, the respiratory burst activity, plasma lysozyme, the bactericidal activity, superoxide dismutase (SOD), glutathione peroxidase (GPx), and amylase activity. However, it had no effect on serum nitric oxide (NO) or Malondialdehyde (MDA) levels. While APS had no effect of intestinal histology, a slight increase in the villi length was recorded. Collectively, our results indicate that dietary APS supplementation could improve the growth performance and the immune parameters of cultured tilapia fish. Copyright © 2014 Elsevier Ltd. All rights reserved.
International Nuclear Information System (INIS)
Pandya, G.A.; Sachidanand, S.; Modi, V.V.
1989-01-01
The effects of gamma-irradiated sludge on the growth and yield of chickpea (Cicer arietinum) in pot cultures have been studied. Compared to plants grown only in soil, root length, fresh weight and dry weight of plants grown in soil supplemented with unirradiated sludge were found to be significantly reduced. This inhibition in growth was found to be nullified when plants were grown in soil supplemented with gamma-irradiated sludge, suggesting that gamma radiation induced inactivation of toxic substance(s) in sludge. The protein content of plants grown in soil supplemented with irradiated sludge was also found to be significantly increased compared to those grown with unirradiated or no sludge, after 45 days. There was no significant effect of gamma irradiated sludge on shoot length, total soluble sugars, starch content and yield of chickpea plants. The results obtained suggest that the sludge tested, and obtained from the digester of a conventional domestic sewage treatment plant, is inhibitory to several growth parameters. Gamma irradiation of sewage resulted in removal of this inhibition. This suggests a possibility of beneficial and safe recycling of gamma-irradiated sludge for agricultural uses. (author)
Directory of Open Access Journals (Sweden)
Yonghong Lian
2014-01-01
Full Text Available Objective. To investigate the effects and to analyze the mechanism of the combination of Astragalus polysaccharide (APS and Rhein on apoptosis in rats with chronic renal failure (CRF. Methods. Thirty-seven male Wistar rats were randomly divided into a control group, a model group, a low-dose APS and Rhein combination group, and a high-dose APS and Rhein combination group. CRF was induced by orogastric gavage with adenine. Rats were observed for renal function, electrolyte, and pathological changes for 7 weeks after administration. Renal tubular cell apoptosis was assessed by TUNEL and protein expressions of IRE1 and CHOP were detected by Western-blotting. Results. The combination of APS and Rhein decreased the kidney weight and index, improved renal pathological injury, maintained the stability of serum electrolytes, and reduced SCr and BUN levels in rat models. Moreover, APS and Rhein combination could effectively inhibit the apoptosis and reduce the protein expressions of IRE1and CHOP of renal tubular cells. Conclusions. The combination of APS and Rhein could improve renal function and reduce renal cell apoptosis to protect against further progression of CRF, whose mechanism may be related to alleviate endoplasmic reticulum stress (ERS in the renal cells.
Chang, Yue; Yang, Song; Liu, Zhen-Peng; Ren, Wei-Chao; Liu, Jie; Ma, Wei
2016-04-01
In this study, 454/Roche GS FLX sequencing technology was used to obtain the data of the Astragalus membranaceus. Four hundred and fifty-four Sequencing System Software was applied to carry out the transcription of the group from scratch. Using MISA tools, 9 893 unigenes were selected for the sequence of the genome of A. membranaceus, and the information of SSR locus was analyzed. According to the result, the average length of reads was 413 bp, about 86% of the reads was involved in the splicing, the length of the N50 was 1 205 bp, the number of unigenes was measured by the whole transcript. 1 729 SSR loci in the A. membranaceus transcriptome were searched, the occurrence frequency of SSR was 9.24%, the frequency of SSR in the whole transcriptome was 13.42%, the average length of SSR was 7.97 kb. One hundred and twenty-seven kinds of core repeat sequences were found, the dominant type was TG/AC type of dinucleotide, it appeared to account for 4.25% of the total SSR locus. The results of the sequence of the transcription of the A. membranaceus transcriptome revealed the overall expression, and a large number of unigenessequence was obtained, and the SSR locus in the genome of the A. membranaceus is high, and the type is diverse, and the polymorphism of the gene is high. Copyright© by the Chinese Pharmaceutical Association.
Jiao, Jiao; Gai, Qing-Yan; Wang, Wei; Luo, Meng; Gu, Cheng-Bo; Fu, Yu-Jie; Ma, Wei
2015-09-23
In this work, Astragalus membranaceus hairy root cultures (AMHRCs) were exposed to ultraviolet radiation (UV-A, UV-B, and UV-C) for promoting isoflavonoid accumulation. The optimum enhancement for isoflavonoid production was achieved in 34-day-old AMHRCs elicited by 86.4 kJ/m(2) of UV-B. The resulting isoflavonoid yield was 533.54 ± 13.61 μg/g dry weight (DW), which was 2.29-fold higher relative to control (232.93 ± 3.08 μg/g DW). UV-B up-regulated the transcriptional expressions of all investigated genes involved in isoflavonoid biosynthetic pathway. PAL and C4H were found to be two potential key genes that controlled isoflavonoid biosynthesis. Moreover, a significant increase was noted in antioxidant activity of extracts from UV-B-elicited AMHRCs (IC50 values = 0.85 and 1.08 mg/mL) in comparison with control (1.38 and 1.71 mg/mL). Overall, this study offered a feasible elicitation strategy to enhance isoflavonoid accumulation in AMHRCs and also provided a basis for metabolic engineering of isoflavonoid biosynthesis in the future.
Directory of Open Access Journals (Sweden)
Ling LI
2016-10-01
Full Text Available Objective To investigate the protective effect of Astragalus-Lily Granules on intestinal mucosa and intestinal flora homeostasis in mice under high altitude hypoxia condition. Methods We put mice into high altitude hypoxia cabin to establish high altitude hypoxia model mice. Sixty Kunming mice were randomly divided into control group, model group, Astragalus-Lily particles (ALP low, medium and high dose groups [1.75, 3.5, 7g/(kg•d] respectively. After three days of routine feeding, the ALP mice received drug by intragastric administration, once a day for continuous 17 days,control group and model group were given double distilled water in same volume. From the 15th day, all the mice but control group were exposed to simulated high altitude hypoxia condition for 3 days in a high altitude hypoxia cabin after they were gavaged for half an hour daily. By the 18th day, the fresh mouse feces were collected and smeared to observe the changes of microflora. The pathological changes of intestinal tissues were observed by HE staining and the expression of HIF-1αprotein in intestines was detected by immunohistochemistry. Results The enterococci and gram negative bacteria showed a higher proportion (65.2%±2.4% and 56.7%±3.3%, respectively in the model group compared with the control group (24.7%±1.2%, 23.2%±1.5%, respectively, P<0.05. The pathological score of intestinal mucosal necrosis and edema (3.10±0.99, 3.30±0.67 respectively and inflammatory cell count (15.93±3.30, 16.40±3.97/ HP respectively was higher compared with the model group (0.70±0.67, 0.80±0.78; 4.07±2.12, 4.28±2.16/HP respectively; P<0.05. HIF-1αexpression increased significantly compared with the model group (P<0.05. The enterococci (46.7%±2.0%, 32.0%±2.6% respectively and gram negative bacteria rate (34.2%±1.6%, 38.0%±2.8% respectively in the ALP medium and high dose groups were lower compared with the model group (24.7%±1.2%, 23.2%±1.5% respectively, P<0
Shamsi, Tooba Naz; Parveen, Romana; Sen, Priyankar; Fatima, Sadaf
2017-05-28
The present study describes the purification and physicochemical and biochemical characterization of trypsin-like protease from green-seeded chickpea (Cicer arientum). The crude extract of chickpea trypsin (CpT) was obtained by homogenization followed by differential ammonium sulfate precipitation. The CpT was purified by ion-exchange chromatography on diethylaminoethyl (DEAE) column, pre-equilibrated with 20 mM tris-CaCl 2 buffer (pH 8.2) with a flow rate of 0.5 mL min -1 . The molecular weight and purity of ∼23 kDa of CpT were determined by sodium dodecyl sulfate polyacrylamide gel electrophoresis. Activity of protease was determined using Nα-benzoyl-DL-arginine-p-nitroanilide as chromogenic substrate and CpT purified showed a specific inhibitor activity of 26978.7697 U mg -1 , fold purity of 9.8, and the yield of 70.2%. The characterization was performed for thermal stability, pH profile, and effect of various inhibitors on enzymatic activity. The protein isolated showed stability in the neutral to mild alkaline pH range and thermostability up to 50°C. CpT confirmed its serine nature as it was appreciably inhibited by serine protease inhibitors (maximum 6%), whereas metalloprotease inhibitors barely affected the activity of the enzyme (85%). To the best of our knowledge, it is first reported on purification of protease with trypsin-like properties, from this source.
[Obtaining a fermented chickpea extract (Cicer arietinum L.) and its use as a milk extensor].
Morales de León, J; Cassís Nosthas, M L; Cecin Salomón, P
2000-06-01
Chickpea (Cicer arietinum L) is cultivated in the North part of México and it is considered a good source of vegetal protein of low cost (20% average), nevertheless, the 80% used for the exportation and only the 20% less was used for animal feeding. The main objective in this study is to obtain a fermented chickpea extract for using in dairy extensor. Chickpea water absorbtion kinetics were carried out in e temperature conditions:while the conditions were established, chickpea was grounded and fermented in different amounts with its natural flora, L. casei, L. plantarum and a mixture culture of both microorganism in logarithmic phase. The results showed that the presence of microorganism of chickpea natural flora interferes during the fermentation, so before the inoculation it was necessary treat the chickpea extract (CE) terminally in a dilution 1:4 during 20 min at 7.7 kg/cm2 of pressure. The use of a mixture culture of 5% of L. casei and 5% L. plantarum inoculated in MRS broth was used to decrease fermentation time. Its addition in logarithmic phase to the sterile chickpea extract increased the lactic acid production and decreased the pH value in 6 h which was less time that one obtained with each of lactobacillus. The fermented extract obtained finally, presented similar sensory characteristics to the ones of dairy products. Therefore, chickpea is a good alternative as a extensor for this kind of products.
Dust deposition effects on growth and physiology of the endangered Astragalus jaegerianus (Fabaceae)
Wijayratne, Upekala C.; Scoles-Sciulla, Sara J.; Defalco, Lesley A.
2009-01-01
Human expansion into the Mojave Desert is a significant threat to rare desert plants. While immediate habitat loss is often the greatest concern, rare plants situated near areas where soil surfaces experience frequent disturbance may be indirectly impacted when fine particulate dust accumulates on leaf surfaces. Remaining populations of the federally listed Astragalus jaegerianus (Lane Mountain milkvetch) occur on land open to expanding military activities and on adjacent public land with increasing recreational use. This study was initiated to determine whether dust accumulation could decrease the vigor and fitness of A. jaegerianus through reduced growth. Beginning in early May 2004, plants located on Bureau of Land Management (BLM) land were dusted bimonthly at canopy-level dust concentrations ranging from 0 to 32 g/m2, and physiology and growth were monitored until late June when plants senesced. The maximum experimental dust level simulates dust concentrations of Mojave Desert perennials neighboring military activities at a nearby army training center. Average shoot growth declined with increasing dust accumulation, but seasonal net photosynthesis increased. Further investigation of plants grown in a greenhouse supported similar trends. This pattern of greater net photosynthesis with increasing dust accumulation may be explained by higher leaf temperatures of dusted individuals. Ambient dust deposition measured in traps near field plants (May 2004–July 2004) ranged from 0.04–0.17 g/m2/ d, which was well below the lowest level of dust on experimental plants (3.95 g/m2/d). With this low level of ambient deposition, we expect that A. jaegerianus plants in this population were not greatly affected by the dust they receive at the level of recreational use during the study.
Directory of Open Access Journals (Sweden)
Xiao-Juan Xin
2012-02-01
Full Text Available The current study was performed to investigate mitochondrial protection and anti-aging activity of Astragalus polysaccharides (APS and the potential underlying mechanism. Lipid peroxidation of liver and brain mitochondria was induced by Fe2+–Vit C in vitro. Thiobarbituric acid (TBA colorimetry was used to measure the content of thiobarbituric acid reactive substances (TBARS. Mouse liver mitochondrial permeability transition (PT was induced by calcium overload in vitro and spectrophotometry was used to measure it. The scavenging activities of APS on superoxide anion (O2•- and hydroxyl radical (•OH, which were produced by reduced nicotinamide adenine dinucleotide (NADH—N-Methylphenazonium methyl sulfate (PMS and hydrogen peroxide (H2O2–Fe2+ system respectively, were measured by 4-nitrobluetetrazolium chloride (NBT reduction and Fenton reaction colorimetry respectively. The Na2S2O3 titration method was used to measure the scavenging activities of APS on H2O2. APS could inhibit TBARS production, protect mitochondria from PT, and scavenge O2•-, •OH and H2O2 significantly in a concentration-dependent manner respectively. The back of the neck of mice was injected subcutaneously with D-galactose to induce aging at a dose of 100 mg/kg/d for seven weeks. Moreover, the activities of catalase (CAT, surperoxide dismutase (SOD and glutathione peroxidase (GPx and anti-hydroxyl radical which were assayed by using commercial monitoring kits were increased significantly in vivo by APS. According to this research, APS protects mitochondria by scavenging reactive oxygen species (ROS, inhibiting mitochondrial PT and increasing the activities of antioxidases. Therefore, APS has the effect of promoting health.
Hardion, Laurent; Dumas, Pierre-Jean; Abdel-Samad, Farah; Bou Dagher Kharrat, Magda; Surina, Bostjan; Affre, Laurence; Médail, Frédéric; Bacchetta, Gianluigi; Baumel, Alex
2016-04-01
Understanding the origin and evolution of Mediterranean vascular flora within the long-term context of climate change requires a continuous study of historical biogeography supported by molecular phylogenetic approaches. Here we provide new insights into the fascinating but often overlooked diversification of Mediterranean xerophytic plants. Growing in some of the most stressing Mediterranean environments, i.e. coastal and mountainous opened habitats, the circum-Mediterranean Astragalus L. sect. Tragacantha DC. (Fabaceae) gathers several thorny cushion-like taxa. These have been the subjects of recent taxonomical studies, but they have not yet been investigated within a comprehensive molecular framework. Bayesian phylogenetics applied to rDNA ITS sequences reveal that the diversification of A. sect. Tragacantha has roots dating back to the Pliocene, and the same data also indicate an eastern-western split giving rise to the five main lineages that exist today. In addition, AFLP fingerprinting supports an old east-west pattern of vicariance that completely rules out the possibility of a recent eastern origin for western taxa. The observed network of genetic relationships implies that contrary to what is widely claimed in the taxonomic literature, it is range fragmentation, as opposed to a coastal-to-mountain ecological shift, that is likely the main driver of diversification. Copyright © 2016 Elsevier Inc. All rights reserved.
Directory of Open Access Journals (Sweden)
Donghun Lee
2017-01-01
Full Text Available Astragalus extract mixture HT042 is a standardized ingredient of health functional food approved by Korean FDA with a claim of “height growth of children.” HT042 stimulates bone growth rate and increases local IGF-1 expression in growth plate of rats which can be considered as direct stimulation of GH and its paracrine/autocrine actions. However, it remains unclear whether HT042 stimulates circulatory IGF-1 which also plays a major role to stimulate bone growth. To determine the effects on circulatory IGF-1, IGF-1 and IGFBP-3 expressions and phosphorylation of JAK2/STAT5 were evaluated in the liver after 10 days of HT042 administration. HT042 upregulated liver IGF-1 and IGFBP-3 mRNA expression, IGF-1 protein expression, and phosphorylation of JAK2/STAT5. HT042 also increased bone growth rate and proliferative zonal height in growth plate. In conclusion, HT042 stimulates bone growth rate via increment of proliferative rate by upregulation of liver IGF-1 and IGFBP-3 mRNA followed by IGF-1 protein expression through phosphorylation of JAK2/STAT5, which can be regarded as normal functioning of GH-dependent endocrine pathway.
Zhou, Xing; Liu, Zijing; Long, Tingting; Zhou, Lijng; Bao, Yixi
2018-01-01
This study is to investigate the immunomodulatory effects of the herbal formula of astragalus polysaccharide (APS) and polysaccharopeptide (PSP) in mouse models of immunosuppression and lung cancer. Immune parameters were recorded for these model mice. Peripheral white blood cells (WBC) were detected with the automatic blood cell analyzer. Spleen and thymus indices, and tumor inhibition ratio were obtained. Percentage of peripheral blood CD4 + and CD8 + T lymphocytes were detected by flow cytometry. Serum levels of Th1 (IL-2, TNF, and IFN-γ), Th2 (IL-4, IL-6, and IL-10), and Th17 (IL-17A) were detected with the BD cytometric bead array (CBA) mouseTh1/Th2/Th17 cytokine kit. Compared with the NS group, the PSP and APS herbal formula significantly improved the WBC, thymus index, spleen index, CD4 + /CD8 + ratio, TNF, IFN-γ, IL-2, andIL-17Ainimmunosuppressivemice and lung cancer mice (PAPS herbal formula group (PAPS herbal formula group induced comparable tumor inhibiting effect with the AMD group (23.3% and 24.1%, respectively). The PSP+APS herbal formula have immunomodulatory effects and anti-tumor activity in mice with of lung cancer. Copyright © 2017 Elsevier B.V. All rights reserved.
Directory of Open Access Journals (Sweden)
Yu Li
2018-01-01
Full Text Available The current study aimed at investigating the effects of flavonoids from Astragalus complanatus (FAC on the proliferation, the contents, and gene expression levels of cytokines, secretion of surface stimulating factors, cell cycle, and the expression level of the NF-κB signalling pathway in RAW264.7 cells. Our results revealed that compared with control group, the contents of IL-6, IL-1β, TNF-α, and NO and the mRNA expression levels of IL-6, IL-1β, TNF-α, and iNOS in FAC-treated groups significantly increased (p<0.01. Moreover, FAC induced macrophage activation to release the above-mentioned mediators partly involved in NF-κB/MAPK signalling pathways. Therefore, FAC regulates immune function in RAW264.7 cells via activating the NF-κB signalling pathway. FAC could be applicable for agriculture, drug research, and food industry as a potent immune-modulatory agent.
[Is the Hawkins sign able to predict necrosis in fractures of the neck of the astragalus?].
Rodríguez-Paz, S; Muñoz-Vives, J M; Froufe-Siota, M Á
2013-01-01
To assess if the Hawkins sign can predict whether or not astragalus fractures of the neck will develop avascular necrosis. It is also assessed whether the occurrence of this complication is related to the displacement of the fracture, soft tissue injury, or delay in the reduction or surgery. The results were compared with those found in the literature. A retrospective study was conducted on 23 talar neck fractures recorded over a a period of thirteen years. The following variables were analysed: displacement of the fracture, soft tissue injury, delay and type of treatment, complications, observation of the Hawkins sign, and functional outcome. There were 7 type I Hawkins fractures, 11 type II, and 4 type III and 1 type IV. Four cases developed avascular necrosis (2 Hawkins type II and 2 type III). Hawkins sign was observed in 12 cases, of which none developed necrosis. Four cases with negative Hawkins sign developed necrosis. No statistically significant differences were found when comparing the development of avascular necrosis with the displacement of the fracture, soft tissue injury, or delay in treatment. Differences were found when comparing the development of avascular necrosis with the Hawkins sign (P=.03). A positive Hawkins sign rules out that the fractured talus has developed avascular necrosis, but its absence does not confirm it. © 2013 SECOT. Published by Elsevier Espana. All rights reserved.
Directory of Open Access Journals (Sweden)
Ehsan Fayazzadeh
2014-01-01
Full Text Available Gum tragacanth is a natural complex mixture of polysaccharides and alkaline minerals extracted from species of Astragalus plant, which is found widely in arid regions of the Middle East. In a pilot experimental study we examined the effects of its topical application on wound healing in ten albino adult male rats. Two similar parasagittal elliptical full-thickness wounds (control vs. test samples were created on the dorsum of each animal. Test group samples were fully covered by a thin layer of gum tragacanth daily. The extent of wound healing was evaluated by planimetric analysis on multiple occasions during the 10-day study period. On the 7th day of the study, the percent of wound closure was significantly higher in gum tragacanth-treated specimens compared to the control samples (87%±2% vs. 70%±4%, P<0.001. The majority of wounds in the test group were completely closed by the 10th day of the study. The difference in wound healing index measured by histological examination on day 10 of the study was also statistically meaningful between the two groups (0.624±0.097 vs. 0.255±0.063, P<0.05. The results of this study clearly showed the useful effects of topical application of gum tragacanth in acceleration of skin wound contraction and healing. More studies are encouraged to identify the implicating agents and precisely understand the mechanism by which they exert their wound healing effects.
Rhizobium pusense sp. nov., isolated from the rhizosphere of chickpea (Cicer arietinum L.).
Panday, Digvijay; Schumann, Peter; Das, Subrata K
2011-11-01
A novel bacterial strain, designated NRCPB10(T), was isolated from rhizosphere soil of chickpea (Cicer arietinum L.) in Pusa, New Delhi, India. The 16S rRNA gene sequence of strain NRCPB10(T) showed highest similarity (98.9 %) to that of Rhizobium radiobacter NCPPB 2437(T), followed by Rhizobium larrymoorei AF3-10(T) (97.7 %) and Rhizobium rubi IFO 13261(T) (97.4 %). Phylogenetic analysis of strain NRCPB10(T) based on the housekeeping genes recA and atpD confirmed its position as distinct from recognized Rhizobium species. Levels of DNA-DNA relatedness between strain NRCPB10(T) and R. radiobacter ICMP 5785(T), R. larrymoorei LMG 21410(T) and R. rubi ICMP 6428(T) were 51.0, 32.6 and 27.3 %, respectively. Cellular fatty acids of strain NRCPB10(T) were C(18 : 1)ω7c (58.9 %), C(16 : 0) (15.5 %), C(19 : 0) cyclo ω8c (11.5 %), iso-C(16 : 1) (5.8 %), C(16 : 0) 3-OH (4.5 %), C(16 : 1)ω7c (2.1 %) and C(18 : 0) (1.3 %). The G+C content of the genomic DNA of strain NRCPB10(T) was 59.0 mol%. Strain NRCPB10(T) did not nodulate chickpea plants or induce tumours in tobacco plants. Phenotypic and physiological properties along with SDS-PAGE of whole-cell soluble proteins differentiated strain NRCPB10(T) from its closest phylogenetic neighbours. On the basis of data from the present polyphasic taxonomic study, strain NRCPB10(T) is considered to represent a novel species of the genus Rhizobium, for which the name Rhizobium pusense sp. nov. is proposed. The type strain is NRCPB10(T) ( = LMG 25623(T) = JCM 16209(T) = NCIMB 14639(T)).
Mazinani, Zohreh; Zamani, Marzieh; Sardari, Soroush
2017-01-01
The widespread utilization of antimicrobial compounds has caused emergence of resistant microorganisms in the world. Hence, the research to probe the products with antimicrobial features has led to finding natural habitats and discovering new pharmaceutical products. In this study, an attempt was made to explore the niche of novel habitat to isolate pyllospheric bacteria from the above ground parts (stems and leaves) of Astragalus obtusifolius , Prosopis juliflora , Xanthium strumarium , and Hippocrepis unisiliqousa to evaluate their antimicrobial features. The inhibitory effects of these strains on the growth of two fungi ( Aspergillus niger , Aspergillus fumigatus ), two yeasts ( Saccharomyces cerevisiae , Candida albicans ) and six bacteria ( Escherichia coli , Staphylococcus aureus , Pseudomonas aeruginosa , Bacillus subtilis , Salmonella typhi , Streptococcus pyogenes ) were tested. In total, 113 bacterial strains were isolated. Twenty five bacterial strains (B-1 to B-25) indicated promising antimicrobial (antibacterial and antifungal) activities against aforementioned pathogens. The identification of the bacterial strains was ascertained by morphological, physiological, biochemical tests and two strains with the strongest antimicrobial activities were further characterized based on 16s rRNA sequencing. These two strains were identified as Bacillus amyloliquefaciens . Our results provide evidence that phyllospheric microorganisms are capable of producing some compounds with antimicrobial properties.
Cloning and characterization of a novel NAC family gene CarNAC1 from chickpea (Cicer arietinum L.).
Peng, Hui; Yu, Xingwang; Cheng, Huiying; Shi, Qinghua; Zhang, Hua; Li, Jiangui; Ma, Hao
2010-01-01
The plant-specific NAC (for NAM, ATAF1,2 and CUC2) proteins have been found to play important roles in plant development and stress responses. In this study, a NAC gene CarNAC1 (for Cicer arietinum L. NAC gene 1) was isolated from a cDNA library constructed with chickpea seedling leaves treated by polyethylene glycol. CarNAC1 encoded a putative protein with 239 amino acids and contained 3 exons and 2 introns within genomic DNA sequence. CarNAC1 had a conserved NAC domain in the N-terminus and the CarNAC1:GFP (green fluorescent protein) fusion protein was localized in the nucleus of onion epidermal cells. Additionally, CarNAC1 exhibited the trans-activation activity which was mapped to the C-terminus. The CarNAC1 transcript was detected in many chickpea organs including seedling leaves, stems, roots, flowers, and young pods, but less accumulated in young seeds. CarNAC1 was induced by leaf age and showed changes in expression during seed development and germination. Furthermore, the expression of CarNAC1 was strongly induced by drought, salt, cold, wounding, H(2)O(2), ethephon, salicylic acid, indole-3-acetic acid, and gibberellin. Our results suggest that CarNAC1 encodes a novel NAC-domain protein and may be a transcriptional activator involved in plant development and various stress responses.
International Nuclear Information System (INIS)
Singh, P.; Sri Rama, Y.V.
1989-01-01
Information on the relationship between biomass production, radiation use and water use of chickpea (Cicer arietinum L.) is essential to estimate biomass production in different water regimes. Experiments were conducted during three post-rainy seasons on a Vertisol (a typic pallustert) to study the effect of water deficits on radiation use, radiation use efficiency (RUE), transpiration and transpiration efficiency (TE) of chickpea. Different levels of soil water availability were created, either by having irrigated and non-irrigated plots or using a line source. Biomass production was linearly related to both cumulative intercepted solar radiation and transpiration in both well watered and water deficit treatments. Soil water availability did not affect RUE (total dry matter produced per unit of solar radiation interception) when at least 30% of extractable soil water (ESW) was present in the rooting zone, but below 30% ESW, RUE decreased linearly with the decrease in soil water content. RUE was also significantly correlated (R 2 = 0.61, P < 0.01) with the ratio of actual to potential transpiration (T/Tp) and it declined curvilinearly with the decrease in T/Tp. TE decreased with the increase in saturation deficit (SD) of air. Normalization of TE with SD gave a conservative value of 4.8 g kPa kg −1 . To estimate biomass production of chickpea in different environments, we need to account for the effect of plant water deficits on RUE in a radiation-based model and the effect of SD on TE in a transpiration-based model. (author)
Jiao, Jiao; Gai, Qing-Yan; Niu, Li-Li; Wang, Xi-Qing; Guo, Na; Zang, Yu-Ping; Fu, Yu-Jie
2017-10-18
A cocultivation system of Astragalus membranaceus hairy root cultures (AMHRCs) and immobilized food-grade fungi was established for the enhanced production of calycosin (CA) and formononetin (FO). The highest accumulations of CA (730.88 ± 63.72 μg/g DW) and FO (1119.42 ± 95.85 μg/g DW) were achieved in 34 day-old AMHRCs cocultured with immobilized A. niger (IAN) for 54 h, which were 7.72- and 18.78-fold higher than CA and FO in nontreated control, respectively. IAN deglycosylation could promote the formation of CA and FO by conversion of their glycoside precursors. IAN elicitation could intensify the generation of endogenous signal molecules involved in plant defense response, which contributed to the significantly up-regulated expression of genes in CA and FO biosynthetic pathway. Overall, the coupled culture of IAN and AMHRCs offered a promising and effective in vitro approach to enhance the production of two health-promoting isoflavone aglycones for possible nutraceutical and pharmaceutical uses.
Wood, Jennifer A; Tan, Hwei-Ting; Collins, Helen M; Yap, Kuok; Khor, Shi Fang; Lim, Wai Li; Xing, Xiaohui; Bulone, Vincent; Burton, Rachel A; Fincher, Geoffrey B; Tucker, Matthew R
2018-03-13
Chickpea (Cicer arietinum L.) is an important nutritionally rich legume crop that is consumed worldwide. Prior to cooking, desi chickpea seeds are most often dehulled and cleaved to release the split cotyledons, referred to as dhal. Compositional variation between desi genotypes has a significant impact on nutritional quality and downstream processing, and this has been investigated mainly in terms of starch and protein content. Studies in pulses such as bean and lupin have also implicated cell wall polysaccharides in cooking time variation, but the underlying relationship between desi chickpea cotyledon composition and cooking performance remains unclear. Here, we utilized a variety of chemical and immunohistological assays to examine details of polysaccharide composition, structure, abundance, and location within the desi chickpea cotyledon. Pectic polysaccharides were the most abundant cell wall components, and differences in monosaccharide and glycosidic linkage content suggest both environmental and genetic factors contribute to cotyledon composition. Genotype-specific differences were identified in arabinan structure, pectin methylesterification, and calcium-mediated pectin dimerization. These differences were replicated in distinct field sites and suggest a potentially important role for cell wall polysaccharides and their underlying regulatory machinery in the control of cooking time in chickpea. © 2018 The Authors. Plant, Cell & Environment Published by John Wiley & Sons Ltd.
Jia, Yuying; Gu, Hanyan; Wang, Xiansheng; Chen, Quanjia; Shi, Shubing; Zhang, Jusong; Ma, Lin; Zhang, Hua; Ma, Hao
2012-03-01
F-box protein family has been found to play important roles in plant development and abiotic stress responses via the ubiquitin pathway. In this study, an F-box gene CarF-box1 (for Cicer arietinum F-box gene 1, Genbank accession no. GU247510) was isolated based on a cDNA library constructed with chickpea seedling leaves treated by polyethylene glycol. CarF-box1 encoded a putative protein with 345 amino acids and contained no intron within genomic DNA sequence. CarF-box1 is a KFB-type F-box protein, having a conserved F-box domain in the N-terminus and a Kelch repeat domain in the C-terminus. CarF-box1 was localized in the nucleus. CarF-box1 exhibited organ-specific expression and showed different expression patterns during seed development and germination processes, especially strongly expressed in the blooming flowers. In the leaves, CarF-box1 could be significantly induced by drought stress and slightly induced by IAA treatment, while in the roots, CarF-box1 could be strongly induced by drought, salinity and methyl jasmonate stresses. Our results suggest that CarF-box1 encodes an F-box protein and may be involved in various plant developmental processes and abiotic stress responses.
Barr, W Andrew
2015-11-01
The Shungura Formation in southwestern Ethiopia preserves a long and relatively continuous record of eastern African mammalian and hominin evolution. This study reconstructs habitat preferences of the Shungura Formation bovids from ca. 3.4-1.9 Ma (million years ago), based on the ecomorphology of fossil bovid astragali. Habitat predictions are made using a Discriminant Function Analysis informed by functional analysis of the astragalus that controls for body size and phylogenetic signal. The high abundance of astragali in the Shungura record allows for habitat reconstructions on sub-unit timescales, rather than aggregating samples at the level of geological member. During much of the time period examined, the lower Omo Valley was dominated by relatively mesic habitats in close proximity to the ancestral Omo River. Previous research has suggested that environmental change at ∼ 2.85 Ma caused significant habitat change at Shungura, but the astragalar data do not support major habitat change at this time. However, there are significant fluctuations in inferred habitats, with more open habitats indicated in sub-units C-08 and C-09 (∼ 2.56 Ma), and in unit F-01 (just after 2.36 Ma). The cause of sub-unit fluctuations in habitat signal is difficult to determine, but local factors, including spatial habitat heterogeneity around the river channel and in its floodplain, may play a contributing role. In the light of faunal evidence from elsewhere in the greater Omo-Turkana Basin, hominins in the area likely had access to a variety of heterogeneous habitats. Copyright © 2015 Elsevier Ltd. All rights reserved.
International Nuclear Information System (INIS)
Valdez-González, F.J.; Gutiérrez-Dorado, R.; García-Ulloa, M.; Cuevas-Rodríguez, B.; Rodríguez-González, H.
2018-01-01
Among the most typical feed sources for tilapia, plants represent a low-cost source in substituting for traditional high-cost feed ingredients. Fermentation, hardening and dehulling are common grains processing techniques to make plant nutrients available and more digestible to fish. Apparent digestibility coefficients (ADC) of dry matter and protein, and antinutrients (phytic acid and tannins) in fermented, hardened and dehulled chickpea (Cicer arietinum) meals were determined for juvenile Nile tilapia (Oreochromis niloticus). The highest ADC was obtained with processed (fermented, hardened and dehulled) chickpea meals compared with non-processed. Results indicated that fermentation increased the protein content by 13.1%, decreased the content of ash and phytic acid (47.5 and 45%, respectively), and increased the ingredient apparent digestibility of dry matter (ADM) by 23.2%, and the ingredient apparent digestibility of protein (ADP) by 41.9%. Dehulling meal increased the protein (5.7%) and lipid (6.4%) content of chickpea grains; decreased fiber, ash and tannin content (75.3%, 19.1%, and 84.5%, respectively); and increased ADM by 12.8%, and ADP by 10.4%. We conclude that fermented, hardened and dehulled chickpea meals represent a potential alternative in diets for juvenile O. niloticus.
Oliveira, Rui S; Carvalho, Patrícia; Marques, Guilhermina; Ferreira, Luís; Nunes, Mafalda; Rocha, Inês; Ma, Ying; Carvalho, Maria F; Vosátka, Miroslav; Freitas, Helena
2017-10-01
Chickpea (Cicer arietinum L.) is a widely cropped pulse and an important source of proteins for humans. In Mediterranean regions it is predicted that drought will reduce soil moisture and become a major issue in agricultural practice. Nitrogen (N)-fixing bacteria and arbuscular mycorrhizal (AM) fungi have the potential to improve plant growth and drought tolerance. The aim of the study was to assess the effects of N-fixing bacteria and AM fungi on the growth, grain yield and protein content of chickpea under water deficit. Plants inoculated with Mesorhizobium mediterraneum or Rhizophagus irregularis without water deficit and inoculated with M. mediterraneum under moderate water deficit had significant increases in biomass. Inoculation with microbial symbionts brought no benefits to chickpea under severe water deficit. However, under moderate water deficit grain crude protein was increased by 13%, 17% and 22% in plants inoculated with M. mediterraneum, R. irregularis and M. mediterraneum + R. irregularis, respectively. Inoculation with N-fixing bacteria and AM fungi has the potential to benefit agricultural production of chickpea under water deficit conditions and to contribute to increased grain protein content. © 2017 Society of Chemical Industry. © 2017 Society of Chemical Industry.
Cold stress alters transcription in meiotic anthers of cold tolerant chickpea (Cicer arietinum L.).
Sharma, Kamal Dev; Nayyar, Harsh
2014-10-11
Cold stress at reproductive phase in susceptible chickpea (Cicer arietinum L.) leads to pollen sterility induced flower abortion. The tolerant genotypes, on the other hand, produce viable pollen and set seed under cold stress. Genomic information on pollen development in cold-tolerant chickpea under cold stress is currently unavailable. DDRT-PCR analysis was carried out to identify anther genes involved in cold tolerance in chickpea genotype ICC16349 (cold-tolerant). A total of 9205 EST bands were analyzed. Cold stress altered expression of 127 ESTs (90 up-regulated, 37 down-regulated) in anthers, more than two third (92) of which were novel with unknown protein identity and function. Remaining about one third (35) belonged to several functional categories such as pollen development, signal transduction, ion transport, transcription, carbohydrate metabolism, translation, energy and cell division. The categories with more number of transcripts were carbohydrate/triacylglycerol metabolism, signal transduction, pollen development and transport. All but two transcripts in these categories were up-regulated under cold stress. To identify time of regulation after stress and organ specificity, expression levels of 25 differentially regulated transcripts were also studied in anthers at six time points and in four organs (anthers, gynoecium, leaves and roots) at four time points. Limited number of genes were involved in regulating cold tolerance in chickpea anthers. Moreover, the cold tolerance was manifested by up-regulation of majority of the differentially expressed transcripts. The anthers appeared to employ dual cold tolerance mechanism based on their protection from cold by enhancing triacylglycerol and carbohydrate metabolism; and maintenance of normal pollen development by regulating pollen development genes. Functional characterization of about two third of the novel genes is needed to have precise understanding of the cold tolerance mechanisms in chickpea anthers.
Directory of Open Access Journals (Sweden)
Manish Roorkiwal
Full Text Available To estimate genetic diversity within and between 10 interfertile Cicer species (94 genotypes from the primary, secondary and tertiary gene pool, we analysed 5,257 DArT markers and 651 KASPar SNP markers. Based on successful allele calling in the tertiary gene pool, 2,763 DArT and 624 SNP markers that are polymorphic between genotypes from the gene pools were analyzed further. STRUCTURE analyses were consistent with 3 cultivated populations, representing kabuli, desi and pea-shaped seed types, with substantial admixture among these groups, while two wild populations were observed using DArT markers. AMOVA was used to partition variance among hierarchical sets of landraces and wild species at both the geographical and species level, with 61% of the variation found between species, and 39% within species. Molecular variance among the wild species was high (39% compared to the variation present in cultivated material (10%. Observed heterozygosity was higher in wild species than the cultivated species for each linkage group. Our results support the Fertile Crescent both as the center of domestication and diversification of chickpea. The collection used in the present study covers all the three regions of historical chickpea cultivation, with the highest diversity in the Fertile Crescent region. Shared alleles between different gene pools suggest the possibility of gene flow among these species or incomplete lineage sorting and could indicate complicated patterns of divergence and fusion of wild chickpea taxa in the past.
Calcium binding properties of calcium dependent protein kinase 1 (CaCDPK1) from Cicer arietinum.
Dixit, Ajay Kumar; Jayabaskaran, Chelliah
2015-05-01
Calcium plays a crucial role as a secondary messenger in all aspects of plant growth, development and survival. Calcium dependent protein kinases (CDPKs) are the major calcium decoders, which couple the changes in calcium level to an appropriate physiological response. The mechanism by which calcium regulates CDPK protein is not well understood. In this study, we investigated the interactions of Ca(2+) ions with the CDPK1 isoform of Cicer arietinum (CaCDPK1) using a combination of biophysical tools. CaCDPK1 has four different EF hands as predicted by protein sequence analysis. The fluorescence emission spectrum of CaCDPK1 showed quenching with a 5 nm red shift upon addition of calcium, indicating conformational changes in the tertiary structure. The plot of changes in intensity against calcium concentrations showed a biphasic curve with binding constants of 1.29 μM and 120 μM indicating two kinds of binding sites. Isothermal calorimetric (ITC) titration with CaCl2 also showed a biphasic curve with two binding constants of 0.027 μM and 1.7 μM. Circular dichroism (CD) spectra showed two prominent peaks at 208 and 222 nm indicating that CaCDPK1 is a α-helical rich protein. Calcium binding further increased the α-helical content of CaCDPK1 from 75 to 81%. Addition of calcium to CaCDPK1 also increased fluorescence of 8-anilinonaphthalene-1-sulfonic acid (ANS) indicating exposure of hydrophobic surfaces. Thus, on the whole this study provides evidence for calcium induced conformational changes, exposure of hydrophobic surfaces and heterogeneity of EF hands in CaCDPK1. Copyright © 2015 Elsevier GmbH. All rights reserved.
Diversity of root nodule bacteria from leguminous crops
Directory of Open Access Journals (Sweden)
Agrawal Pooja
2016-01-01
Full Text Available In the present study, a total of 353 nodule-associated bacteria were isolated from 220 legume plant samples belonging to Cicer arietinum (85, Glycine max (74, Vigna radiata (21 and Cajanus cajan (40. A total of 224 bacteria were identified as fast-growing Rhizobium spp. on the basis of differential staining (Gram staining and carbol fuchsin staining and biochemical tests. All the isolates were tested for indole acetic acid production (IAA, phosphate solubilization and siderophore production on plate assay. To examine the effect of volatile organic metabolites (VOM and water soluble soil components (WSSC on nodule bacteria, culture conditions were optimized by observing the effects of various parameters such as pH, salt content and temperatures on the growth of bacteria. Selected rhizobia were subjected to random amplified polymorphic DNA (RAPD and amplified ribosomal DNA restriction analysis (ARDRA analysis to identify their species. On the basis of RAPD and ARDRA, 10 isolates were identified as Rhizobium meliloti. In this study, Rhizobium GO4, G16, G20, G77, S43, S81, M07, M37, A15 and A55 were observed as the best candidates among the tested bacteria and can be further used as potent bioinoculants.
Directory of Open Access Journals (Sweden)
Arlem Nascimento de Oliveira
2007-03-01
Full Text Available As amilases estão entre as mais importantes enzimas industriais e são de grande interesse na biotecnologia atual. Embora elas possam ser derivadas de diversas fontes, as de origem microbiana são geralmente as mais procuradas pelas indústrias. As espécies do gênero Bacillus são consideradas as principais fontes de amilases. Apesar disso, a busca por novas fontes microbianas vem crescendo em todo o mundo. O presente estudo objetivou avaliar a produção de amilase por rizóbios nativos, usando farinha de pupunha como substrato. Neste estudo, foi adotado o delineamento experimental inteiramente casualizado, com três repetições. Foram determinados ainda os coeficientes de correlação de Pearson entre as variáveis pH do meio, proteína extracelular, biomassa celular, diâmetro médio da colônia (DMC, diâmetro médio do halo (DMH, índice enzimático (IE e atividade amilolítica das bactérias selecionadas. Dos 19 isolados com atividade amilolítica em meio YMA modificado, sete (36,8% exibiram "IE" > 2,1, o que permite considerá-los bons produtores de amilase. Os "IE" apresentados pelos isolados INPA R-987, 950 e 915B foram significativamente inferiores (p Amylases are among the most important industrial enzymes and are of great significance in present-day biotechnology. Although they can be derived from various sources, enzymes from microbial sources are generally the most required by industry. Species of the genus Bacillus are considered to be the main sources of amylases, although screening for new microbial sources is increasing all over the world. The objective of the present study was to evaluate the production of amylase by indigenous rhizobia, using peach palm flour as substrate. In this study, a completely randomized experimental design was adopted with three replicates. Pearson's correlation coefficients were calculated for medium pH, extracellular protein, cellular biomass, mean colony diameter (MCD, mean halo diameter (MHD
Directory of Open Access Journals (Sweden)
Arlem Nascimento de Oliveira
2009-12-01
Full Text Available Few are the details concerning the molecular characterization of native rhizobia isolates from Amazonas soils. The aim of the present study was the genetic characterization of rhizobia isolated from nodules of cowpea using the method PCR-RFLP of the ribosome genes 16S rRNA and the restriction enzymes HinfI, MspI, and MboI. The analysis included 20 native isolates and ten reference strains from different origins. The results indicated a great genetic variability with the formation of eight groups in one dendrogram with a varied level of similarity.Poucas são as informações referentes à caracterização molecular de rizóbios nativos isolados de solos no Amazonas. Assim, o objetivo deste trabalho foi a caracterização genética de rizóbios isolados de nódulos de caupi usando o método PCR-RFLP dos genes ribossomais 16S rRNA e as enzimas de restrição HinfI, MspI, e MboI. A análise incluiu 20 isolados nativos e dez estirpes-referência de diferentes origens. Os resultados indicaram uma grande variabilidade genética com a formação de oito grupos em um dendrograma com um nível de similaridade variado.
Directory of Open Access Journals (Sweden)
Mohammadmehdi Hassanzadeh-Taheri
2018-03-01
Full Text Available Background: Oral consumption of Astragalus hamosus L. (AH seedpod has been widely prescribed in traditional medicine system. However, its toxicity evaluation has never been investigated. Hence, the current study was performed to evaluate the toxicological profile of AH seedpod in acute and subacute assessments based on the OECD-guidelines 425 and 407 in male and female Wistar rats. Methods: In the acute study, ethanolic extract of AH at a single dose of 2000 mg/kg was orally administrated to six female rats. In the subacute assay, AH at the three different oral doses (75, 150 and 300 mg/kg were administrated to both male and female rats for 28 consecutive days. Results: No death or behavioural changes were observed in the treated animals. In subacute test, in both sexes, no changes in organ weights observed. Biochemically, compared to the control, AH at the dose of 300 mg/kg slightly increased (p<0.05 uric acid and creatinine and declined total cholesterol levels in both male and female rats. However, there is no statistically difference in other parameters such as albumin, triglyceride, blood urea, aspartate aminotransferase and alanine aminotransferase between AH treated groups and untreated controls. Hematologic parameters showed that AH at the maximum dose decreased red blood cells count only in male rats. Histopathological evaluation of liver and kidney exhibited no noticeable alterations in AH treated animals. Conclusion: It could be concluded that high excessive and long term consumption of AH may lead to renal dysfunction and deficiency in hematopoietic system.
Ravi, R; Ajila, C M; Rao, U J S Prasada
2011-03-01
Proteins play an important role in imparting functional attributes like texture and shape, which determine the sensory quality of the foods. Boondi, a deep fried product from chickpea (Cicer arietinum L.) flour dispersion, is a popular snack food in India. Chickpea dhal (splits) or flour was subjected to various processing conditions like steaming and toasting, to determine their effect on the chickpea flour protein characteristics and on the product quality. Dhal and flour subjected to different heat treatments showed differences in their odor profiles. The SDS-PAGE of sodium phosphate buffer extracts of steamed dhal or flour showed that the high molecular weight (HMW) proteins of 66 to 100 kDa that were present in the untreated dhal were found to be absent in steamed dhal extracts. However, SDS buffer extracts on SDS-PAGE of these steamed samples did not show any difference between untreated and thermally treated dhal samples. Phosphate buffer extracts of the thermally treated flours were subjected to gel filtration chromatography and the results indicated that the HMW protein fraction content decreased significantly in the treated dhal or flour samples compared to control. Boondi prepared from the thermally treated dhal samples resulted in the loss of spherical shape of boondi. Thus, the results indicate that thermal treatment of chickpea dhal and flour influence changes in protein characteristics, the sensory profile and quality of boondi.
Directory of Open Access Journals (Sweden)
Maria Luiza Colognesi de Oliveira Lombardi
2009-08-01
Full Text Available The occurrence of rhizobial communities at four sites under natural vegetation and one site under pasture were examined. Isolates of rhizobia originating from crotalaria (C. junceae, common bean (Phaseolus vulgaris and pigeon pea (Cajanus cajan were studied in relation to population density, host specificity and the interaction between rhizobial occurrence, climatic conditions and soil properties. pH values and potential acidity were the soil properties that most affected rhizobial occurrence. Rhizobia from crotalaria and common bean were evaluated at four sites, and from pigeon pea, at five sites. Common bean was the most specific legume, followed by peanuts, crotalaria and pigeon pea.Foi examinada a ocorrência de comunidades de rizóbios em quatro locais de vegetação natural e um local de pastagem. Isolados de rizóbio originados de crotalária (C. junceae, feijão (Phaseolus vulgaris e guandu (Cajanus cajan foram estudados em relação à densidade populacional, planta hospedeira e interação entre ocorrência de rizóbio, condições climáticas e propriedades do solo. Os valores de pH e potencial de acidez foram as propriedades do solo que mais contribuíram para a ocorrência de rizóbio. A ocorrência de rizóbio em crotalária e feijão foi estudada em quatro locais, e em guandu em cinco locais. O feijão foi mais específico, seguido por crotalária e guandu.
Time-lagged effects of weather on plant demography: drought and Astragalus scaphoides.
Tenhumberg, Brigitte; Crone, Elizabeth E; Ramula, Satu; Tyre, Andrew J
2018-04-01
Temperature and precipitation determine the conditions where plant species can occur. Despite their significance, to date, surprisingly few demographic field studies have considered the effects of abiotic drivers. This is problematic because anticipating the effect of global climate change on plant population viability requires understanding how weather variables affect population dynamics. One possible reason for omitting the effect of weather variables in demographic studies is the difficulty in detecting tight associations between vital rates and environmental drivers. In this paper, we applied Functional Linear Models (FLMs) to long-term demographic data of the perennial wildflower, Astragalus scaphoides, and explored sensitivity of the results to reduced amounts of data. We compared models of the effect of average temperature, total precipitation, or an integrated measure of drought intensity (standardized precipitation evapotranspiration index, SPEI), on plant vital rates. We found that transitions to flowering and recruitment in year t were highest if winter/spring of year t was wet (positive effect of SPEI). Counterintuitively, if the preceding spring of year t - 1 was wet, flowering probabilities were decreased (negative effect of SPEI). Survival of vegetative plants from t - 1 to t was also negatively affected by wet weather in the spring of year t - 1 and, for large plants, even wet weather in the spring of t - 2 had a negative effect. We assessed the integrated effect of all vital rates on life history performance by fitting FLMs to the asymptotic growth rate, log(λt). Log(λt) was highest if dry conditions in year t - 1 were followed by wet conditions in the year t. Overall, the positive effects of wet years exceeded their negative effects, suggesting that increasing frequency of drought conditions would reduce population viability of A. scaphoides. The drought signal weakened when reducing the number of monitoring years. Substituting space for time
Directory of Open Access Journals (Sweden)
Juárez-Cisneros Gladys
2016-08-01
Full Text Available Soil pollution by waste motor oil (WMO is reducing its productivity. An alternative for removing WMO from soil is by biostimulation (BIS applying animal manure and then phytoremediation (PR by legume improving with plant growth promoting bacteria (PGPB to reduce WMO concentration at level below 4400 ppm limit permit for the NOM-138-SEMARNAT/SSA1-2012 (NOM-138. The aims of this re-search were: i to analyze soil biostimulation polluted by 10000 ppm of WMO applying vermicompost, then subsequent soil phytoremediation with Cicer arietinum inoculated by Bacillus cereus and/or Rhizo-bium etli. In soil after applying BS by VC was measured WMO soil concentration and ii for PR was regarded phenology and biomass of C. arietinum and WMO concentration remaining at the end of this step. The results showed that soil biostimulated by VC, WMO was reduced at 1370 ppm, subsequent PR sowing C. arietinum with R. etli, WMR was reduced at 30 ppm concentration both values below to maxi-mum value accepted by NOM-138. Those data indicate that in soil polluted by WMO the best way to biorecovery soil was to integrate strategy BS/PR the last one improved by genus of PGPB.
Directory of Open Access Journals (Sweden)
Wei Chen
Full Text Available BACKGROUND: Obesity-related diabetes mellitus leads to increased myocardial uptake and oxidation of fatty acids, resulting in a form of cardiac dysfunction referred to as lipotoxic cardiomyopathy. We have shown previously that Astragalus polysaccharides (APS administration was sufficient to improve the systemic metabolic disorder and cardiac dysfunction in diabetic models. METHODOLOGY/PRINCIPAL FINDINGS: To investigate the precise role of APS therapy in the pathogenesis of myocardial lipotoxity in diabetes, db/db diabetic mice and myosin heavy chain (MHC- peroxisome proliferator-activated receptor (PPAR α mice were characterized and administrated with or without APS with C57 wide- type mice as normal control. APS treatment strikingly improved the myocyte triacylglyceride accumulation and cardiac dysfunction in both db/db mice and MHC-PPARα mice, with the normalization of energy metabolic derangements in both db/db diabetic hearts and MHC-PPARα hearts. Consistently, the activation of PPARα target genes involved in myocardial fatty acid uptake and oxidation in both db/db diabetic hearts and MHC-PPARα hearts was reciprocally repressed by APS administration, while PPARα-mediated suppression of genes involved in glucose utilization of both diabetic hearts and MHC-PPARα hearts was reversed by treatment with APS. CONCLUSIONS: We conclude that APS therapy could prevent the development of diabetic cardiomyopathy through a mechanism mainly dependent on the cardiac PPARα-mediated regulatory pathways.
Directory of Open Access Journals (Sweden)
Julio Peñas
2016-01-01
Full Text Available Astragalus edulis (Fabaceae is an endangered annual species from the western Mediterranean region that colonized the SE Iberian Peninsula, NE and SW Morocco, and the easternmost Macaronesian islands (Lanzarote and Fuerteventura. Although in Spain some conservation measures have been adopted, it is still necessary to develop an appropriate management plan to preserve genetic diversity across the entire distribution area of the species. Our main objective was to use population genetics as well as ecological and phylogeographic data to select Relevant Genetic Units for Conservation (RGUCs as the first step in designing conservation plans for A. edulis. We identified six RGUCs for in situ conservation, based on estimations of population genetic structure and probabilities of loss of rare alleles. Additionally, further population parameters, i.e. occupation area, population size, vulnerability, legal status of the population areas, and the historical haplotype distribution, were considered in order to establish which populations deserve conservation priority. Three populations from the Iberian Peninsula, two from Morocco, and one from the Canary Islands represent the total genetic diversity of the species and the rarest allelic variation. Ex situ conservation is recommended to complement the preservation of A. edulis, given that effective in situ population protection is not feasible in all cases. The consideration of complementary phylogeographic and ecological data is useful for management efforts to preserve the evolutionary potential of the species.
Peñas, Julio; Barrios, Sara; Bobo-Pinilla, Javier; Lorite, Juan; Martínez-Ortega, M Montserrat
2016-01-01
Astragalus edulis (Fabaceae) is an endangered annual species from the western Mediterranean region that colonized the SE Iberian Peninsula, NE and SW Morocco, and the easternmost Macaronesian islands (Lanzarote and Fuerteventura). Although in Spain some conservation measures have been adopted, it is still necessary to develop an appropriate management plan to preserve genetic diversity across the entire distribution area of the species. Our main objective was to use population genetics as well as ecological and phylogeographic data to select Relevant Genetic Units for Conservation (RGUCs) as the first step in designing conservation plans for A. edulis. We identified six RGUCs for in situ conservation, based on estimations of population genetic structure and probabilities of loss of rare alleles. Additionally, further population parameters, i.e. occupation area, population size, vulnerability, legal status of the population areas, and the historical haplotype distribution, were considered in order to establish which populations deserve conservation priority. Three populations from the Iberian Peninsula, two from Morocco, and one from the Canary Islands represent the total genetic diversity of the species and the rarest allelic variation. Ex situ conservation is recommended to complement the preservation of A. edulis, given that effective in situ population protection is not feasible in all cases. The consideration of complementary phylogeographic and ecological data is useful for management efforts to preserve the evolutionary potential of the species.
Directory of Open Access Journals (Sweden)
Min Liu
2013-01-01
Full Text Available Objective. The antidiabetes drug astragalus polysaccharide (APS is capable of increasing insulin sensitivity in skeletal muscle and improving whole-body glucose homeostasis. Recent studies suggest that skeletal muscle secreted growth factor myostatin plays an important role in regulating insulin signaling and insulin resistance. We hypothesized that regulation of skeletal muscle myostatin expression may be involved in the improvement of insulin sensitivity by APS. Methods. APS was administered to 13-week-old diabetic KKAy and nondiabetic C57BL/6J mice for 8 weeks. Complementary studies examined APS effects on the saturated acid palmitate-induced insulin resistance and myostatin expression in C2C12 cells. Results. APS treatment ameliorated hyperglycemia, hyperlipidemia, and insulin resistance and decreased the elevation of myostatin expression and malondialdehyde production in skeletal muscle of noninsulin-dependent diabetic KKAy mice. In C2C12 cells in vitro, saturated acid palmitate-induced impaired glucose uptake, overproduction of ROS, activation of extracellular regulated protein kinases (ERK, and NF-κB were partially restored by APS treatment. The protective effects of APS were mimicked by ERK and NF-κB inhibitors, respectively. Conclusion. Our study demonstrates elevated myostatin expression in skeletal muscle of type 2 diabetic KKAy mice and in cultured C2C12 cells exposed to palmitate. APS is capable of improving insulin sensitivity and decreasing myostatin expression in skeletal muscle through downregulating ROS-ERK-NF-κB pathway.
Sharma, Manorma; Sharma, Vinay; Tripathi, Bhumi Nath
2016-05-01
The present study demonstrates the comparative response of two contrasting genotypes (aluminum (Al) tolerant and Al sensitive) of chick pea (Cicer arietinum) against Al stress. The Al-tolerant genotype (RSG 974) showed lesser inhibition of root growth as well as lower oxidative damages, measured in terms of the accumulation of H2O2 and lipid peroxidation compared to the Al-sensitive genotype (RSG 945). The accumulation of Al by roots of both genotypes was almost equal at 96 and 144 h after Al treatment; however, it was higher in Al-tolerant than Al-sensitive genotype at 48 h after Al treatment. Further, the Al-mediated induction of superoxide dismutase (SOD) activity was significantly higher in Al-tolerant than Al-sensitive genotype. Ascorbate peroxidase (APX) activity was almost similar in both genotypes. Al treatment promptly activated catalase activity in Al-tolerant genotype, and it was remarkably higher than that of Al-sensitive genotype. As another important Al detoxification mechanism, citrate efflux was almost equal in both genotypes except at 1000 μM Al treatment for 96 and 144 h. Further, citrate carrier and anion channel inhibitor experiment confirmed the contribution of citrate efflux in conferring Al tolerance in Al-tolerant genotype. Based on the available data, the present study concludes that rapid activation of catalase (also SOD) activity followed by citrate efflux effectively improves Al tolerance in chick pea.
Lin, Shi-Mei; Jiang, Yu; Chen, Yong-Jun; Luo, Li; Doolgindachbaporn, Sompong; Yuangsoi, Bundit
2017-11-01
The effects of oral administration of Astragalus polysaccharides (APS) and chitooligosaccharides (COS), single or combined, on the growth performance, immunity and disease resistance of M. salmoides were investigated. Largemouth bass juvenile were divided into 4 groups and each group was fed with diets supplemented with or without immunostimulant for 8 weeks. After 8 weeks of feeding trial, five fish per tank were sampled for immunity determination, ten fish per tank were challenged by A. hydrophila. The results showed that the largemouth bass fed with two immunostimulants alone or in combination significantly enhanced the final weight and specific growth rate (SGR), decreased feed conversion ratio (FCR) (P APS. In addition, both COS and APS upregulated respiratory burst activity (RBA), phagocytic activity (PA), lysozyme activity and superoxide dismutase (SOD) activity. Meanwhile, COS also exhibited a increase in total leukocyte count, nitric oxide (NO) content and inducible nitric oxide synthase (iNOS) activity compared to the control. When challenged with A. hydrophila, the mortality of groups fed with COS and/or APS was lower than the control (P APS and COS had a synergistic effect on lysozme activity, iNOS activity, NO content and disease resistance of fish (P < 0.05). Copyright © 2017 Elsevier Ltd. All rights reserved.
Mridha, Nilimesh; Chattaraj, Sudipta; Chakraborty, Debashis; Anand, Anjali; Aggarwal, Pramila; Nagarajan, Shantha
2016-09-01
Soil moisture stress during pod filling is a major constraint in production of chickpea (Cicer arietinum L.), a fundamentally dry land crop. We investigated effect of pre-sowing seed priming with static magnetic field (SMF) on alleviation of stress through improvement in radiation and water use efficiencies. Experiments were conducted under greenhouse and open field conditions with desi and kabuli genotypes. Seeds exposed to SMF (strength: 100 mT, exposure: 1 h) led to increase in root volume and surface area by 70% and 65%, respectively. This enabled the crop to utilize 60% higher moisture during the active growth period (78-118 days after sowing), when soil moisture became limiting. Both genotypes from treated seeds had better water utilization, biomass, and radiation use efficiencies (17%, 40%, and 26% over control). Seed pre-treatment with SMF could, therefore, be a viable option for chickpea to alleviate soil moisture stress in arid and semi-arid regions, helping in augmenting its production. It could be a viable option to improve growth and yield of chickpea under deficit soil moisture condition, as the selection and breeding program takes a decade before a tolerant variety is released. Bioelectromagnetics. 37:400-408, 2016. © 2016 Wiley Periodicals, Inc. © 2016 Wiley Periodicals, Inc.
Genome-Wide Analysis of the Aquaporin Gene Family in Chickpea (Cicer arietinum L.).
Deokar, Amit A; Tar'an, Bunyamin
2016-01-01
Aquaporins (AQPs) are essential membrane proteins that play critical role in the transport of water and many other solutes across cell membranes. In this study, a comprehensive genome-wide analysis identified 40 AQP genes in chickpea ( Cicer arietinum L.). A complete overview of the chickpea AQP (CaAQP) gene family is presented, including their chromosomal locations, gene structure, phylogeny, gene duplication, conserved functional motifs, gene expression, and conserved promoter motifs. To understand AQP's evolution, a comparative analysis of chickpea AQPs with AQP orthologs from soybean, Medicago, common bean, and Arabidopsis was performed. The chickpea AQP genes were found on all of the chickpea chromosomes, except chromosome 7, with a maximum of six genes on chromosome 6, and a minimum of one gene on chromosome 5. Gene duplication analysis indicated that the expansion of chickpea AQP gene family might have been due to segmental and tandem duplications. CaAQPs were grouped into four subfamilies including 15 NOD26-like intrinsic proteins (NIPs), 13 tonoplast intrinsic proteins (TIPs), eight plasma membrane intrinsic proteins (PIPs), and four small basic intrinsic proteins (SIPs) based on sequence similarities and phylogenetic position. Gene structure analysis revealed a highly conserved exon-intron pattern within CaAQP subfamilies supporting the CaAQP family classification. Functional prediction based on conserved Ar/R selectivity filters, Froger's residues, and specificity-determining positions suggested wide differences in substrate specificity among the subfamilies of CaAQPs. Expression analysis of the AQP genes indicated that some of the genes are tissue-specific, whereas few other AQP genes showed differential expression in response to biotic and abiotic stresses. Promoter profiling of CaAQP genes for conserved cis -acting regulatory elements revealed enrichment of cis -elements involved in circadian control, light response, defense and stress responsiveness
Kulkarni, Anuja; Ananthanarayan, Laxmi; Raman, Karthik
2013-12-01
Allergy has become a key cause of morbidity worldwide. Although many legumes (plants in the Fabaceae family) are healthy foods, they may have a number of allergenic proteins. A number of allergens have been identified and characterized in Fabaceae family, such as soybean and peanut, on the basis of biochemical and molecular biological approaches. However, our understanding of the allergens from chickpea (Cicer arietinum L.), belonging to this family, is very limited. In this study, we aimed to identify putative and cross-reactive allergens from Chickpea (C. arietinum) by means of in silico analysis of the chickpea protein sequences and allergens sequences from Fabaceae family. We retrieved known allergen sequences in Fabaceae family from the IUIS Allergen Nomenclature Database. We performed a protein BLAST (BLASTp) on these sequences to retrieve the similar sequences from chickpea. We further analyzed the retrieved chickpea sequences using a combination of in silico tools, to assess them for their allergenicity potential. Following this, we built structure models using FUGUE: Sequence-structure homology; these models generated by the recognition tool were viewed in Swiss-PDB viewer. Through this in silico approach, we identified seven novel putative allergens from chickpea proteome sequences on the basis of similarity of sequence, structure and physicochemical properties with the known reported legume allergens. Four out of seven putative allergens may also show cross reactivity with reported allergens since potential allergens had common sequence and structural features with the reported allergens. The in silico proteomic identification of the allergen proteins in chickpea provides a basis for future research on developing hypoallergenic foods containing chickpea. Such bioinformatics approaches, combined with experimental methodology, will help delineate an efficient and comprehensive approach to assess allergenicity and pave the way for a better understanding of
Gai, Qing-Yan; Jiao, Jiao; Luo, Meng; Wang, Wei; Yao, Li-Ping; Fu, Yu-Jie
2017-03-01
A novel biotechnology approach by combining deacetylation biocatalysis with elicitation of immobilized Penicillium canescens (IPC) in Astragalus membranaceus hairy root cultures (AMHRCs) was proposed for the elevated production of astragaloside IV (AG IV). The highest AG IV accumulation was achieved in 36-day-old AMHRCs co-cultured with IPC for 60 h, which resulted in the enhanced production of AG IV by 14.59-fold in comparison with that in control (0.193 ± 0.007 mg/g DW). Meanwhile, AG IV precursors were almost transformed to AG IV by IPC deacetylation. Moreover, expression of genes involved in AG IV biosynthetic pathway was significantly up-regulated in response to IPC elicitation. Also, FTIR and SEM showed that cell wall lignification was enhanced following IPC treatment and root surface was likely to be IPC deacetylation site. Overall, dual roles of IPC (biocatalyst and elicitor) offered an effective and sustainable way for the mass production of AG IV in AMHRCs. © 2016 The Authors. Plant Biotechnology Journal published by Society for Experimental Biology and The Association of Applied Biologists and John Wiley & Sons Ltd.
International Nuclear Information System (INIS)
Kharkwal, M.C.
1998-01-01
Mutagenic effectiveness usually means the rate of mutation as related to dose. Mutagenic efficiency refers to the mutation rate in relation to damage. Studies on comparative mutagenic effectiveness and efficiency of two physical (gamma rays and fast neutrons) and two chemical mutagens (NMU and EMS) on two desi (G 130 & H 214), one kabuli (C 104) and one green seeded (L 345) chickpea (Cicer arietinum L.) have been reported. The treatments included three doses each of gamma rays (400, 500 and 600 Gy) and fast neutrons (5, 10 and 15 Gy) and two concentrations with two different durations of two chemical mutagens, NMU 0.01% 20h and 0.02% 8h) and EMS (0.1% 20h and 0.2% 8h). Results indicated that chemical mutagens, particularly NMU are not only more effective but also efficient than physical mutagens in inducing mutations in chickpea. Mutagenic effectiveness and efficiency showed differential behaviour depending upon mutagen and varietal type. Chemical mutagens were more efficient than physical in inducing cholorophyll as well as viable and total number of mutations. Among the mutagens NMU was the most potent, while in the physical, gamma rays were more effective. Out of four mutagens, NMU was the most effective and efficient in inducing a high frequency and wide spectrum of chlorophyll mutations in the M2 followed by fast neutrons. While gamma rays showed least effectiveness, EMS was least efficient mutagens. Major differences in the mutagenic response of the four cultivars were observed. The varieties of desi type were more resistant towards mutagenic treatment than kabuli and green seeded type
Directory of Open Access Journals (Sweden)
Camille E Granada
2014-06-01
Full Text Available This work aimed to evaluate the symbiotic compatibility and nodulation efficiency of rhizobia isolated from Desmodium incanum, Lotus corniculatus, L. subbiflorus, L. uliginosus and L. glaber plants by cross-inoculation. Twelve reference strains and 21 native isolates of rhizobia were genetically analyzed by the BOX-PCR technique, which showed a high genetic diversity among the rhizobia studied. The isolates were also characterized based on their production of indolic compounds and siderophores, as well as on their tolerance to salinity. Fifteen of the 33 rhizobia analyzed were able to produce indolic compounds, whereas 13 produced siderophores. All the tested rhizobia were sensitive to high salinity, although some were able to grow in solutions of up to 2% NaCl. Most of the native rhizobia isolated from L. uliginosus were able to induce nodulation in all plant species studied. In a greenhouse experiment using both D. incanum and L. corniculatus plants, the rhizobia isolate UFRGS Lu2 promoted the greatest plant growth. The results demonstrate that there are native rhizobia in the soils of southern Brazil that have low host specificity and are able to induce nodulation and form active nodules in several plant species.
Peng, Hui; Cheng, Hui-Ying; Yu, Xin-Wang; Shi, Qing-Hua; Zhang, Hua; Li, Jian-Gui; Ma, Hao
2009-01-01
It has been documented that the plant-specific NAC (for NAM, ATAF1,2 and CUC2) transcription factors play an important role in plant development and stress responses. In this study, a chickpea NAC gene CarNAC5 (for Cicer arietinum L. NAC gene 5) was isolated from a cDNA library from chickpea leaves treated by polyethylene glycol (PEG). CarNAC5, as a single/low copy gene, contained three exons and two introns within genomic DNA sequence and encoded a polypeptide with 291 amino acids. CarNAC5 protein had a conserved NAC domain in the N-terminus and showed high similarity to other NACs, especially ATAF subgroup members. The CarNAC5:GFP fusion protein was localized in the nucleus of onion epidermal cells. Furthermore, CarNAC5 protein activated the reporter genes LacZ and HIS3 in yeast. The transactivation activity was mapped to the C-terminal region. The transcripts of CarNAC5 appeared in many chickpea tissues including seedling leaves, stems, roots, flowers, seeds and pods, but mostly accumulated in flowers. Meanwhile, CarNAC5 was strongly expressed during seed maturation and in embryos of the early germinating seeds. It was also significantly induced by drought, heat, wounding, salicylic acid (SA), and indole-3-acetic acid (IAA) treatments. Our results suggest that CarNAC5 encodes a novel NAC-domain protein and acts as a transcriptional activator involved in plant developmental regulation and various stress responses.
Pang, Jiayin; Turner, Neil C; Khan, Tanveer; Du, Yan-Lei; Xiong, Jun-Lan; Colmer, Timothy D; Devilla, Rosangela; Stefanova, Katia; Siddique, Kadambot H M
2017-04-01
Flower and pod production and seed set of chickpea (Cicer arietinum L.) are sensitive to drought stress. A 2-fold range in seed yield was found among a large number of chickpea genotypes grown at three dryland field sites in south-western Australia. Leaf water potential, photosynthetic characteristics, and reproductive development of two chickpea genotypes with contrasting yields in the field were compared when subjected to terminal drought in 106kg containers of soil in a glasshouse. The terminal drought imposed from early podding reduced biomass, reproductive growth, harvest index, and seed yield of both genotypes. Terminal drought at least doubled the percentage of flower abortion, pod abscission, and number of empty pods. Pollen viability and germination decreased when the fraction of transpirable soil water (FTSW) decreased below 0.18 (82% of the plant-available soil water had been transpired); however, at least one pollen tube in each flower reached the ovary. The young pods which developed from flowers produced when the FTSW was 0.50 had viable embryos, but contained higher abscisic acid (ABA) concentrations than those of the well-watered plants; all pods ultimately aborted in the drought treatment. Cessation of seed set at the same soil water content at which stomata began to close and ABA increased strongly suggested a role for ABA signalling in the failure to set seed either directly through abscission of developing pods or seeds or indirectly through the reduction of photosynthesis and assimilate supply to the seeds. © The Author 2016. Published by Oxford University Press on behalf of the Society for Experimental Biology.
Amin, A A; Gharib, F A; Abouziena, H F; Dawood, Mona G
2013-12-15
The response of chickpea (Cicer arientinum L. cv. Giza 3) to treatment with two plant growth regulators putrescine (Put) and Indole-3-butyric acid (IBA) at 25, 50 and 100 mg L(-1) applied either alone or in combinations was studied. Spraying of Put and IBA either individually or in combination significantly increased the plant height, number and dry weight of branches, leaves and pods/plant and leaf area/plant at the two growth stages. Total photosynthetic pigments in fresh leaves were significantly promoted as a result of application of Put or IBA. Generally, application of Put and/or IBA at 100 mg L(-1) produced the highest numbers of pods which resulted in substantially the highest seed yield. Put and IBA increased the seed yield by 21.3 and 19.2%, respectively, while the combination of Put at 100 mgL(-1) and IBA at 50 mgL(-1) increased it by 27.4%. Greatest increases in straw and biological yield/fed (38.3 and 30.4%, respectively) were noted with the combination treatment of IBA 100 mg L(-1) plus Put at 100 mg L(-1). Put and IBA significantly increased the nitrogen, phosphorus, potassium, total soluble sugars and total free amino acids in chickpea seeds over control, but the effects were less marked than those of their combination. This response was greater following treatment with IBA than with Put. It could be conclude that spraying Put or/and IBA on chickpea plants have promotion effects on the seeds yield criteria which have promising potential as sources of low-cost protein and minerals for possible use as food/feed supplements.
Mehrotra, Meenakshi; Sanyal, Indraneel; Amla, D V
2011-09-01
To develop an efficient genetic transformation system of chickpea (Cicer arietinum L.), callus derived from mature embryonic axes of variety P-362 was transformed with Agrobacterium tumefaciens strain LBA4404 harboring p35SGUS-INT plasmid containing the uidA gene encoding β-glucuronidase (GUS) and the nptII gene for kanamycin selection. Various factors affecting transformation efficiency were optimized; as Agrobacterium suspension at OD(600) 0.3 with 48 h of co-cultivation period at 20°C was found optimal for transforming 10-day-old MEA-derived callus. Inclusion of 200 μM acetosyringone, sonication for 4 s with vacuum infiltration for 6 min improved the number of GUS foci per responding explant from 1.0 to 38.6, as determined by histochemical GUS assay. For introducing the insect-resistant trait into chickpea, binary vector pRD400-cry1Ac was also transformed under optimized conditions and 18 T(0) transgenic plants were generated, representing 3.6% transformation frequency. T(0) transgenic plants reflected Mendelian inheritance pattern of transgene segregation in T(1) progeny. PCR, RT-PCR, and Southern hybridization analysis of T(0) and T(1) transgenic plants confirmed stable integration of transgenes into the chickpea genome. The expression level of Bt-Cry protein in T(0) and T(1) transgenic chickpea plants was achieved maximum up to 116 ng mg(-1) of soluble protein, which efficiently causes 100% mortality to second instar larvae of Helicoverpa armigera as analyzed by an insect mortality bioassay. Our results demonstrate an efficient and rapid transformation system of chickpea for producing non-chimeric transgenic plants with high frequency. These findings will certainly accelerate the development of chickpea plants with novel traits.
Astragalar Morphology of Selected Giraffidae.
Directory of Open Access Journals (Sweden)
Nikos Solounias
Full Text Available The artiodactyl astragalus has been modified to exhibit two trochleae, creating a double pullied structure allowing for significant dorso-plantar motion, and limited mediolateral motion. The astragalus structure is partly influenced by environmental substrates, and correspondingly, morphometric studies can yield paleohabitat information. The present study establishes terminology and describes detailed morphological features on giraffid astragali. Each giraffid astragalus exhibits a unique combination of anatomical characteristics. The giraffid astragalar morphologies reinforce previously established phylogenetic relationships. We find that the enlargement of the navicular head is a feature shared by all giraffids, and that the primitive giraffids possess exceptionally tall astragalar heads in relation to the total astragalar height. The sivatheres and the okapi share a reduced notch on the lateral edge of the astragalus. We find that Samotherium is more primitive in astragalar morphologies than Palaeotragus, which is reinforced by tooth characteristics and ossicone position. Diagnostic anatomical characters on the astragalus allow for giraffid species identifications and a better understanding of Giraffidae.
Directory of Open Access Journals (Sweden)
Francisco Javier Andrés Santos
2013-06-01
Full Text Available La obra de Cicerón suele presentarse como el mejor ejemplo del republicanismo clásico, incorporando un proyecto modélico de “constitución mixta” que fue recuperado a partir de la Baja Edad Media por el humanismo cívico. Sin embargo, una lectura más detallada de las principales aportaciones filosófico-políticas del autor pone en cuestión esta visión tópica y despierta dudas en cuanto a la verdadera naturaleza del republicanismo del gran orador romano. The work of Cicero is used to be depicted as the best example of the classical republicanism with a model of “mixed constitution”, which was to be taken on by the civic humanism from the late Middle Ages on. However, a more accurate reading of the main contributions of the author to political philosophy questions this commonplace interpretation and casts doubts about the very nature of Cicero’s real republicanism.
Directory of Open Access Journals (Sweden)
M. Jankju
2016-04-01
Full Text Available Studying the autecology of range plants provides the basic information on their ecological requirements, cultivation methods and the interactions with the prevailing environment. Such information is necessary for a proper range management. Some ecological characteristics of Astragalus arpilobus Kar. & Kir., were studied in the winter rangelands of Northern Khorasan province. It was naturally growing in Jargalan, Bojnourd, where the altitudinal range varied 500-600 a.s.l, slope 20-100%, and the average annual rainfall 236.85 mm. Soil properties were: loamy texture, average organic matter, low fertility, pH 7.32 and EC 2.30 ds.m-1. A. aripilobus started vegetative growth at the early March, flowering during early May, seed production during June, and terminated its yearly growth at early July. The highest nutritive values and forage quality were at the beginning of growth, which was gradually decreased towards the end of growth season. Crude protein (CP, and ash were decreased whereas acid detergent fiber (ADF, natural detergent fiber (NDF, and dry matter (DM increased by the growing season. Seeds were easily established within pots; however, seed germination rate was low (24%, which by sand paper scarification was increased up to 51%. In conclusion, feasibility of seedling establishment, high nutritive value, and concurrence of plant phenology with the time of maximum need to fodder, by livestocks, propose A. arpilobus as a promising forage plant species for restoration of the winter rangelands in Northern Khorasan province.
He, Honghua; Dong, Zhigang; Pang, Jiayin; Wu, Gao-Lin; Zheng, Jiyong; Zhang, Xingchang
2018-07-15
Coal fly ash (CFA) is an industrial waste generated in huge amounts worldwide, and the management of CFA has become an environmental concern. Recovery of valuable metals from CFA is one of the beneficial reuse options of CFA. Rhenium (Re) is one of the rarest metals in the Earth's crust and one of the most expensive metals of strategic significance in the world market. A CFA at the Jungar Thermal Power Plant, Inner Mongolia, China, contains more Re than two alkaline soils in the surrounding region. Pot experiments were undertaken to grow lucerne (Medicago sativa) and erect milkvetch (Astragalus adsurgens) in a loessial soil and an aeolian sandy soil amended with different rates (5%, 10%, 20%, and 40%) of CFA. The results show that plant growth was considerably enhanced and Re concentration in plants was significantly increased when CFA was applied to the alkaline soils at rates of ≤20%; while in some cases plant growth was also markedly enhanced by the 40% CFA treatment, which increased plant Re concentration the most of all treatments. Both lucerne and erect milkvetch showed potential for phytoextracting Re from CFA-amended alkaline soils. Using CFA for soil amendment not only offers a potential solution for the waste disposal problem of CFA, but the phytoextraction of Re by both lucerne and erect milkvetch may also bring an economic profit in the future. Copyright © 2018 Elsevier B.V. All rights reserved.
Legumes form symbiotic association with soil-dwelling bacteria collectively called rhizobia. This association results in the formation of nodules, unique plant-derived organs, within which the rhizobia are housed. Rhizobia encoded-nitrogenase facilitates the conversation of atmospheric nitrogen int...
Kudapa, Himabindu; Garg, Vanika; Chitikineni, Annapurna; Varshney, Rajeev K
2018-04-10
Chickpea is one of the world's largest cultivated food legume and is an excellent source of high-quality protein to the human diet. Plant growth and development are controlled by programmed expression of a suite of genes at the given time, stage and tissue. Understanding how the underlying genome sequence translates into specific plant phenotypes at key developmental stages, information on gene expression patterns is crucial. Here we present a comprehensive Cicer arietinum Gene Expression Atlas (CaGEA) across the plant developmental stages and organs covering the entire life cycle of chickpea. One of the widely used drought tolerant cultivar, ICC 4958 has been used to generate RNA-Seq data from 27 samples at five major developmental stages of the plant. A total of 816 million raw reads were generated and of these, 794 million filtered reads after QC were subjected to downstream analysis. A total of 15,947 unique number of differentially expressed genes across different pairwise tissue combinations were identified. Significant differences in gene expression patterns contributing in the process of flowering, nodulation, seed and root development were inferred in this study. Furthermore, differentially expressed candidate genes from "QTL-hotspot" region associated with drought stress response in chickpea were validated. This article is protected by copyright. All rights reserved.
Zurdo-Piñeiro, José Luis; García-Fraile, Paula; Rivas, Raúl; Peix, Alvaro; León-Barrios, Milagros; Willems, Anne; Mateos, Pedro Francisco; Martínez-Molina, Eustoquio; Velázquez, Encarna; van Berkum, Peter
2009-01-01
The stable, low-molecular-weight (LMW) RNA fractions of several rhizobial isolates of Phaseolus vulgaris grown in the soil of Lanzarote, an island of the Canary Islands, were identical to a less-common pattern found within Sinorhizobium meliloti (assigned to group II) obtained from nodules of alfalfa and alfalfa-related legumes grown in northern Spain. The P. vulgaris isolates and the group II LMW RNA S. meliloti isolates also were distinguishable in that both had two conserved inserts of 20 and 46 bp in the 16S-23S internal transcribed spacer region that were not present in other strains of S. meliloti. The isolates from P. vulgaris nodulated bean but not Medicago sativa, while those recovered from Medicago, Melilotus, and Trigonella spp. nodulated both host legumes. The bean isolates also were distinguished from those of Medicago, Melilotus, and Trigonella spp. by nodC sequence analysis. The nodC sequences of the bean isolates were most similar to those reported for S. meliloti bv. mediterranense and Sinorhizobium fredii bv. mediterranense (GenBank accession numbers DQ333891 and AF217267, respectively). None of the evidence placed the bean isolates from Lanzarote in the genus Rhizobium, which perhaps is inconsistent with seed-borne transmission of Rhizobium etli from the Americas to the Canaries as an explanation for the presence of bean-nodulating rhizobia in soils of Lanzarote. PMID:19218416
Zurdo-Piñeiro, José Luis; García-Fraile, Paula; Rivas, Raúl; Peix, Alvaro; León-Barrios, Milagros; Willems, Anne; Mateos, Pedro Francisco; Martínez-Molina, Eustoquio; Velázquez, Encarna; van Berkum, Peter
2009-04-01
The stable, low-molecular-weight (LMW) RNA fractions of several rhizobial isolates of Phaseolus vulgaris grown in the soil of Lanzarote, an island of the Canary Islands, were identical to a less-common pattern found within Sinorhizobium meliloti (assigned to group II) obtained from nodules of alfalfa and alfalfa-related legumes grown in northern Spain. The P. vulgaris isolates and the group II LMW RNA S. meliloti isolates also were distinguishable in that both had two conserved inserts of 20 and 46 bp in the 16S-23S internal transcribed spacer region that were not present in other strains of S. meliloti. The isolates from P. vulgaris nodulated bean but not Medicago sativa, while those recovered from Medicago, Melilotus, and Trigonella spp. nodulated both host legumes. The bean isolates also were distinguished from those of Medicago, Melilotus, and Trigonella spp. by nodC sequence analysis. The nodC sequences of the bean isolates were most similar to those reported for S. meliloti bv. mediterranense and Sinorhizobium fredii bv. mediterranense (GenBank accession numbers DQ333891 and AF217267, respectively). None of the evidence placed the bean isolates from Lanzarote in the genus Rhizobium, which perhaps is inconsistent with seed-borne transmission of Rhizobium etli from the Americas to the Canaries as an explanation for the presence of bean-nodulating rhizobia in soils of Lanzarote.
Directory of Open Access Journals (Sweden)
Junkun Lu
2017-11-01
Full Text Available Rhizobia induce root nodules and fix atmospheric N2 for most legume species in exchange for carbon. However, the diverse endophytic non-rhizobial bacteria in legume nodules that co-exist with rhizobia are often ignored because they are difficult to cultivate using routine cultivation approaches. To enhance our understanding of the incidence and diversity of legume–bacteria associations, a high-throughput sequencing analysis of bacterial 16S rRNA genes was used to examine the bacterial community in the rhizospheres and root nodules of Dalbergia odorifera seedlings that were uninoculated or inoculated with Bradyrhizobium elkanii H255, Rhizobium multihospitium–like HT221, or Burkholderia pyrrocinia–like H022238, in two growth media (nitrogen [N]-supplied soil or N-omitted potting mix. Seedlings inoculated with Bradyrhizobium had significantly more nodules than seedlings in the other inoculation conditions, regardless of growth media. Using the 15N natural abundance method, it was shown that the inoculated plants had significantly higher N2 fixation efficiency (48–57% and specific nodule activity [269–313 μg N mg−1 of dry weight (dwt nodule] compared to the uninoculated plants (203 μg N mg−1 dwt nodule. The 16S rRNA gene analysis showed that there was generally a higher bacterial diversity in the rhizosphere than in the nodules in the corresponding condition. Both rhizobial inoculation and media status significantly altered the bacterial communities in the rhizospheres and nodules (P < 0.05, with the exception of the inoculated soil rhizospheres. Regarding non-rhizobial bacteria, three genera, i.e., Lactococcus, Bacillus, and Pseudomonas, were consistently enriched in the rhizosphere and Bradyrhizobium, Chloroplast norank (which belongs to Cyanobacteria, and Lactococcus were commonly found in the nodules. In contrast, common rhizobial genera (including Rhizobium, Mesorhizobium, and Burkholderia were only present in the nodules at low
Li, Yanan; Zeng, Xiaobo; Zhou, Xuejuan; Li, Youguo
2016-12-04
Lipid transfer protein superfamily is involved in lipid transport and metabolism. This study aimed to construct mutants of three lipid transfer protein encoding genes in Mesorhizobium huakuii 7653R, and to study the phenotypes and function of mutations during symbiosis with Astragalus sinicus. We used bioinformatics to predict structure characteristics and biological functions of lipid transfer proteins, and conducted semi-quantitative and fluorescent quantitative real-time PCR to analyze the expression levels of target genes in free-living and symbiotic conditions. Using pK19mob insertion mutagenesis to construct mutants, we carried out pot plant experiments to observe symbiotic phenotypes. MCHK-5577, MCHK-2172 and MCHK-2779 genes encoding proteins belonged to START/RHO alpha_C/PITP/Bet_v1/CoxG/CalC (SRPBCC) superfamily, involved in lipid transport or metabolism, and were identical to M. loti at 95% level. Gene relative transcription level of the three genes all increased compared to free-living condition. We obtained three mutants. Compared with wild-type 7653R, above-ground biomass of plants and nodulenitrogenase activity induced by the three mutants significantly decreased. Results indicated that lipid transfer protein encoding genes of Mesorhizobium huakuii 7653R may play important roles in symbiotic nitrogen fixation, and the mutations significantly affected the symbiotic phenotypes. The present work provided a basis to study further symbiotic function mechanism associated with lipid transfer proteins from rhizobia.
Tripathi, Pratibha; Singh, Poonam C; Mishra, Aradhana; Tripathi, Rudra D; Nautiyal, Chandra S
2015-07-01
Trichoderma reesei is an industrially important fungi which also imparts stress tolerance and plant growth promotion in various crops. Arsenic (As) contamination of field soils is one of the challenging problems in agriculture, posing potential threats for both human health and the environment. Plants in association with microbes are a liable method to improve metal tolerance and enhance crop productivity. Chickpea (Cicer arietinum L.), is an important grain legume providing cheap source of protein in semi-arid regions including As affected areas. In this study we report the role of T. reesei NBRI 0716 (NBRI 0716) in supporting chickpea growth and improving soil quality in As simulated conditions. NBRI 0716 modulated the As speciation and its availability to improve grain yield and quality (amino acids and mineral content) in chickpea (C. arietinum L.) plants grown in As spiked soil (100 mg As kg(-1) soil). Arsenic accumulation and speciation results indicate that arsenate [As(V)] was the dominant species in chickpea seeds and rhizosphere soil. The Trichoderma reduced total grain inorganic As (Asi) by 66% and enhanced dimethylarsonic acid (DMA) and monomethylarsinic acid (MMA) content of seed and rhizosphere soil. The results indicate a probable role of NBRI 0716 in As methylation as the possible mechanism for maneuvering As stress in chickpea. Analysis of functional diversity using carbon source utilization (Biolog) showed significant difference in diversity and evenness indices among the soil microbial rhizosphere communities. Microbial diversity loss caused by As were prevented in the presence of Trichoderma NBRI 0716. Copyright © 2015. Published by Elsevier Inc.
Directory of Open Access Journals (Sweden)
Wonnam Kim
2016-07-01
Full Text Available Astragalus membranaceus BUNGE (AM; 黃芪 huáng qí has been widely used as a medicinal herb for different kinds of diseases. AM treatment in vitro enhance sperm motility and ameliorates testicular toxicity, it has demonstrated the ability as a potential treatment for male infertility. In order to gain further insights on the molecular understanding of how AM enhances spermatogenesis, this study investigated whether AM has an affect on sperm parameters associated with cAMP response element modulator (CREM and activator of CREM in testis (ACT expression. Five-week-old male ICR mice were divided into four groups; control group and three different concentrations of AM treated groups. Each group was treated for 5 days a week for 5 weeks. Testis samples were collected for real time quantitative PCR and western blot analysis. Epididymis was taken out and used for sperm analysis using the computer assisted semen analysis (CASA system. To facilitate expression of genes required for spermatogenesis, it is controlled by fine-tuning of CREM and its coactivator, ACT. AM treatment promotes CREM and ACT mRNA expression and also protein expression compared to control. AM enhances sperm values such as sperm count and motility compared to control. Overall, the study highlights, the ability of AM to increases CREM and ACT expression to facilitate sperm development and semen quality.
Differences between strains of Rhizobium in sensitivity to canavanine
Energy Technology Data Exchange (ETDEWEB)
Weaks, T E [Marshall Univ., Huntingdon, West Virginia (USA). Dept. of Biological Sciences
1977-11-01
Four strains of rhizobia that nodulate canavanine-synthesizing legumes and four strains that nodulate noncanavanine-synthesizing legumes were tested for sensitivity to L-canavanine. The effect of canavanine on growth depends upon the strain of Rhizobium tested rather than the canavanine synthesizing capability of the host legume. In both groups of rhizobia, some strains were inhibited in growth by canavanine. Canavanine enhancement of growth was observed in rhizobia that nodulate noncanavanine-synthesizing legumes. Canavanine was found to enhance the incorporation of /sup 3/H-uridine and /sup 3/H-L-leucine into trichloroacetic acid insoluble fractions of starved cells of two strains of rhizobia tested. This demonstrated that under certain conditions, some rhizobia can detoxify canavanine and utilize it in synthetic processes.
Singh, Jogendra; Singh, Vijayata; Sharma, P C
2018-05-01
The growth of chickpea ( Cicer arietinum L.) is extremely hampered by salt stress. Understanding of physio-biochemical and molecular attributes along with morphological traits contributing to the salinity tolerance is important for developing salt tolerant chickpea varieties. To explore these facts, two genotypes CSG8962 and HC5 with contrasting salt tolerance were evaluated in the salinity stress (Control and 120 mM NaCl) conditions. CSG8962 maintained lower Na/K ratio in root and shoot, trammeled Na translocation to the shoots from roots compared to HC5 which ascribed to better exclusion of salt from its roots and compartmentation in the shoot. In chickpea, salt stress specifically induced genes/sequences involved at several levels in the salt stress signaling pathway. Higher induction of trehalose 6 phosphate synthase and protein kinase genes pertaining to the osmotic and signaling modules, respectively, were evident in CSG8962 compared to HC5. Further transcripts of late embryogenesis abundant, non-specific lipid transfer protein, HI and 219 genes/sequences were also highly induced in CSG8962 compared to HC5 which emphasizes the better protection of cellular membranous network and membrane-bound macromolecules under salt stress. This further suppressed the stress enhanced electrolyte leakage, loss of turgidity, promoted the higher compatible solute accumulation and maintained better cellular ion homoeostasis in CSG8962 compared to HC5. Our study further adds to the importance of these genes in salt tolerance by comparing their behavior in contrasting chickpea genotypes.
Zhang, Ke-Sheng; Chen, Ling-Bo; Huang, Xiao-Ping; Deng, Chang-Qing
2017-11-01
The aim is to study the effect and its mechanism of Astragalus Radix combined with Angelicae Sinensis Radix on the proliferation of hematopoietic stem cells(HSCs) in senescence model. After drug-containing plasma of rats was prepared via intragastric administration, HSCs of mice were cultured in vitro, and then they were divided into blank control group, model group, blank plasma group, Astragalus Radix + Angelicae Sinensis Radix 1∶1 group and 10∶1 group, Angelicae Sinensis Radix plasma group, and Astragalus Radix plasma group. HSCs senescence model was induced by using tert-butyl hydrogen peroxide(t-BHP), and intervened by drug-containing plasma. Cells senescence rate was tested by SA-β-galactosidase staining method; cell cycle distribution was determined by flow cytometry; Cyclin D1, P21, and P53 mRNA were measured with RT-PCR, and Cyclin D1 protein expression was measured by Western blot. Results showed that after being induced by t-BHP, senescence rate of HSCs was increased; cell proliferation ability was decreased; count of G₀/G₁ phase cells was increased; count of G₂/M+S phase cells was reduced; Cyclin D1 expression was down-regulated while P53, P21 expression was up-regulated, which were reversed by Astragalus Radix + Angelicae Sinensis Radix 1∶1 and 10∶1, single Angelicae Sinensis Radix, and single Astragalus Radix plasma. Furthermore, the above effects were most obvious in Astragalus Radix+Angelicae Sinensis Radix 1∶1 group. These results suggested that t-BHP can promote HSCs senescence and reduce cell proliferation ability. Angelicae Sinensis Radix, Astragalus Radix and their combinations can inhibit HSCs senescence, promote HSCs proliferation as well as cell cycle conversion; moreover, the effects of 1∶1 Astragalus Radix+Angelicae Sinensis Radix were strongest. The mechanisms may be related to up-regulating the expression of cell cycle positive regulator, down-regulating the expression of cell cycle negative regulator, thus promoting
Directory of Open Access Journals (Sweden)
Adem Mohammed
2017-01-01
Full Text Available Chickpea (Cicer arietinum L. is one of the important cool season food legumes in the semi-arid north-eastern Ethiopia. Climate change is projected to alter the growing conditions of chickpea in this region and there would be substantial reduction in grain yield of the crop due to drought. The overall objectives of the study were to identify crop management and genetic options that could increase rain-fed chickpea productivity. For this, a simulation study has been conducted using CROPGRO-model in two sites (Sirinka and Chefa found in the semi-arid north-eastern Ethiopia. Change in planting date and cultivars having different maturity have been tested for their effectiveness to increase chickpea productivity. According to the prediction result, short duration cultivar is found to increase grain yield at Sirinka by about 11%, 10% and 11% in the baseline, 2030 s and 2050 s, respectively whereas long duration cultivar is found to decrease grain yield by about 6%, 9% and 11% as compared to the standard cultivar (control. On the other hand, short duration cultivar is found to decrease grain yield at Chefa by about 9%, 4% and 5% whereas long duration cultivar is found to increase grain yield by about 1%, 2% and 4% across the respective time periods. Early sowing (SSD − 20 days is found to significantly increase grain yield of short duration cultivar at Sirinka by about 48%, 48% and 54% and that of long duration cultivar by 31%, 33% and 39% in the baseline, 2030 s and 2050 s, respectively. Early sowing (SSD − 20 days is also found to increase grain yield of short duration cultivar at Chefa by about 26%, 27% and −1% and that of long duration cultivar by 37%, 32% and −2% across the respective time periods. However, the highest increase in chickpea grain yield can be achieved through combined application of early sowing and suitable cultivars. On the other hand, delayed sowing is found to significantly decrease chickpea grain yield in the
Park, Yun Ji; Thwe, Aye Aye; Li, Xiaohua; Kim, Yeon Jeong; Kim, Jae Kwang; Arasu, Mariadhas Valan; Al-Dhabi, Naif Abdullah; Park, Sang Un
2015-10-14
Astragalus membranaceus is an important traditional Chinese herb with various medical applications. Astragalosides (ASTs), calycosin, and calycosin-7-O-β-d-glucoside (CG) are the primary metabolic components in A. membranaceus roots. The dried roots of A. membranaceus have various medicinal properties. The present study aimed to investigate the expression levels of genes related to the biosynthetic pathways of ASTs, calycosin, and CG to investigate the differences between seedling roots (SRs), adventitious roots (ARs), and hairy roots (HRs) using quantitative real-time polymerase chain reaction (qRT-PCR). qRT-PCR study revealed that the transcription level of genes involved in the AST biosynthetic pathway was lowest in ARs and showed similar patterns in HRs and SRs. Moreover, most genes involved in the synthesis of calycosin and CG exhibited the highest expression levels in SRs. High-performance liquid chromatography (HPLC) analysis indicated that the expression level of the genes correlated with the content of ASTs, calycosin, and CG in the three different types of roots. ASTs were the most abundant in SRs. CG accumulation was greater than calycosin accumulation in ARs and HRs, whereas the opposite was true in SRs. Additionally, 40 metabolites were identified using gas chromatography-time-of-flight mass spectrometry (GC-TOF-MS). Principal component analysis (PCA) documented the differences among SRs, ARs, and HRs. PCA comparatively differentiated among the three samples. The results of PCA showed that HRs were distinct from ARs and SRs on the basis of the dominant amounts of sugars and clusters derived from closely similar biochemical pathways. Also, ARs had a higher concentration of phenylalanine, a precursor for the phenylpropanoid biosynthetic pathway, as well as CG. TCA cycle intermediates levels including succinic acid and citric acid indicated a higher amount in SRs than in the others.
Directory of Open Access Journals (Sweden)
Vikas Srivastava
Full Text Available The eukaryotic lineage-specific LIM protein (LIN11, ISL1, and MEC3 family play pivotal role in modulation of actin dynamics and transcriptional regulation. The systematic investigation of this family has not been carried in detail and rare in legumes. Current study involves the mining of Cicer arietinum genome for the genes coding for LIM domain proteins and displayed significant homology with LIM genes of other species. The analysis led to the identification of 15 members, which were positioned on chickpea chromosomes. The phylogenetic and motif analysis suggested their categorization into two sub-families i.e., Ca-2LIMs and Ca-DA1/DAR, which comprised of nine and six candidates, respectively. Further sub-categories of Ca-2LIMs were recognised as αLIM, βLIM, δLIM and γLIM. The LIM genes within their sub-families displayed conserved genomic and motif organization. The expression pattern of Ca-2LIMs across developmental and reproductive tissues demonstrated strong correlation with established consensus. The Ca-2LIM belongs to PLIM and GLIM (XLIM was found highly expressed in floral tissue. Others showed ubiquitous expression pattern with their dominance in stem. Under hormonal and pathogenic conditions these LIMs were found to up-regulate during salicylic acid, abscisic acid and Ascochyta rabiei treatment or infection; and down-regulated in response to jasmonic acid treatment. The findings of this work, particularly in terms of modulation of LIM genes under biotic stress will open up the way to further explore and establish the role of chickpea LIMs in plant defense response.
Srivastava, Vikas; Verma, Praveen Kumar
2015-01-01
The eukaryotic lineage-specific LIM protein (LIN11, ISL1, and MEC3) family play pivotal role in modulation of actin dynamics and transcriptional regulation. The systematic investigation of this family has not been carried in detail and rare in legumes. Current study involves the mining of Cicer arietinum genome for the genes coding for LIM domain proteins and displayed significant homology with LIM genes of other species. The analysis led to the identification of 15 members, which were positioned on chickpea chromosomes. The phylogenetic and motif analysis suggested their categorization into two sub-families i.e., Ca-2LIMs and Ca-DA1/DAR, which comprised of nine and six candidates, respectively. Further sub-categories of Ca-2LIMs were recognised as αLIM, βLIM, δLIM and γLIM. The LIM genes within their sub-families displayed conserved genomic and motif organization. The expression pattern of Ca-2LIMs across developmental and reproductive tissues demonstrated strong correlation with established consensus. The Ca-2LIM belongs to PLIM and GLIM (XLIM) was found highly expressed in floral tissue. Others showed ubiquitous expression pattern with their dominance in stem. Under hormonal and pathogenic conditions these LIMs were found to up-regulate during salicylic acid, abscisic acid and Ascochyta rabiei treatment or infection; and down-regulated in response to jasmonic acid treatment. The findings of this work, particularly in terms of modulation of LIM genes under biotic stress will open up the way to further explore and establish the role of chickpea LIMs in plant defense response. PMID:26418014
Enhanced phytoremediation of soils contaminated with PAHs by arbuscular mycorrhiza and rhizobium.
Ren, Cheng-Gang; Kong, Cun-Cui; Bian, Bian; Liu, Wei; Li, Yan; Luo, Yong-Ming; Xie, Zhi-Hong
2017-09-02
Greenhouse experiment was conducted to evaluate the potential effectiveness of a legume (Sesbania cannabina), arbuscular mycorrhizal fungi (AMF) (Glomus mosseae), and rhizobia (Ensifer sp.) symbiosis for remediation of Polycyclic aromatic hydrocarbons (PAHs) in spiked soil. AMF and rhizobia had a beneficial impact on each other in the triple symbiosis. AMF and/or rhizobia significantly increased plant biomass and PAHs accumulation in plants. The highest PAHs dissipation was observed in plant + AMF + rhizobia treated soil, in which >97 and 85-87% of phenanthrene and pyrene, respectively, had been degraded, whereas 81-85 and 72-75% had been degraded in plant-treated soil. During the experiment, a relatively large amount of water-soluble phenolic compounds was detected in soils of AMF and/or rhizobia treatment. It matches well with the high microbial activity and soil enzymes activity. These results suggest that the mutual interactions in the triple symbiosis enhanced PAHs degradation via stimulating both microbial development and soil enzyme activity. The mutual interactions between rhizobia and AMF help to improve phytoremediation efficiency of PAHs by S. cannabina.
77 FR 16252 - Endangered and Threatened Wildlife and Plants; Recovery Permit Applications
2012-03-20
..., you may use one of the following methods to request hard copies or a CD-ROM of the documents. Please... barnebyi (Barneby reed-mustard). Lepidium barnebyanum (Barneby ridge-cress). Astragalus holmgreniorum... cactus). Astragalus ampullarioides (Shivwitz milk-vetch). Schoenocrambe suffrutescens (Shrubby reed...
Effects of Geven root extract on proliferation of HeLa cells and bcl-2 ...
African Journals Online (AJOL)
Yomi
2012-03-01
, Turkey. 3Research ... Geven (Astragalus L.) root extract is used for asthma, diarrhea, and cancer therapy in Chinese ... 0.1 mg/ml concentrations of Astragalus root extract were applied to HeLa cell cultures for 24, 48 and 72 h.
Directory of Open Access Journals (Sweden)
Maria Luiza Ribeiro Bastos da Silva
2007-09-01
Full Text Available
The evaluation of native rhizobia strains potential as related to efficiency, competitiveness, and adaptation in regions subjected to high temperature is important to the study of nitrogen symbiotic fixation. The objective of this research was the morphologic characterization of rhizobia isolated from samples of a red yellow argisol of Serra Talhada municipality, Pernambuco State, Brazil, and selection for high temperature and kanamicina and nalidixic acid antibiotics resistance. The study was carried out at Institute of Agricultural Research of Pernambuco (IPA. The isolates were cultivated in YMA media to evaluate colonie characteristics as acidity or alkalinity production, growing velocity, color, shape and transparency, elevation, and mucus production. All isolates were compared to the standard strain Bradyrhizobium sp. 6145, recommended for cowpea. The morphological and physiological diversity of the isolates enabled the identification of distinct groups. The isolates 1, 2 and 4 presented higher resistance to high temperature and adaptation to survive in regions subjected to thermal stress periods. The isolate 1 showed the highest resistance to tested antibiotics.
KEY-WORDS: Rhizobia; morphologic characteristics; high temperature.
A avaliação do potencial de estirpes nativas de rizóbio em relação à eficiência, competitividade e adaptação às regiões sujeitas à alta temperatura é importante no estudo da fixação simbiótica de nitrogênio. O objetivo do trabalho foi efetuar a caracterização morfológica de isolados de rizóbios a partir de amostras de um argissolo vermelho amarelo do Município de Serra Talhada (PE, e selecioná-los quanto a resistente a alta temperatura e aos antibióticos kanamicina e ácido nalidíxico. O estudo foi conduzido na Empresa Pernambucana de
Verma, Alok Kumar; Sharma, Akanksha; Kumar, Sandeep; Gupta, Rinkesh Kumar; Kumar, Dinesh; Gupta, Kriti; Giridhar, B H; Das, Mukul; Dwivedi, Premendra D
2016-06-01
Chickpea (CP), a legume of the family Fabaceae, is an important nutrient-rich food providing protein, essential amino acids, vitamins, dietary fibre, and minerals. Unfortunately, several IgE-binding proteins in CP have been detected that are responsible for allergic manifestations in sensitized population. Therefore, the prevalence of CP induced allergy prompted us towards purification, characterization and allergenicity assessment of a major ∼26kDa protein from chickpea crude protein extract (CP-CPE). Purification of CP 26kDa protein was done using a combination of fractionation and anion exchange chromatography. This protein was further characterized as "Chain A, crystal structure of a plant albumin" from Cicer arietinum with Mol wt 25.8kDa by Liquid chromatography-tandem mass spectrometry (LC-MS/MS) analysis. Further, allergenic potential of purified 25.8kDa protein was assessed using in vivo and in vitro model. Purified protein showed IgE-binding capacity with sensitized BALB/c mice and CP allergic patient's sera. Enhanced levels of specific and total IgE, MCP-1, MCPT-1, myeloperoxidase, histamine, prostaglandin D2, and cysteinyl leukotriene were found in sera of mice treated with CP ∼26kDa protein. Further, expressions of Th2 cytokines (i.e. IL-4, IL-5, IL-13), transcription factors (i.e. GATA-3, STAT-6, SOCS-3) and mast cell signaling proteins (Lyn, cFgr, Syk, PLC-γ2, PI-3K, PKC) were also found increased at mRNA and protein levels in the intestines of mice treated with CP ∼26kDa protein. In addition, enhanced release of β-hexosaminidase, histamine, cysteinyl leukotriene and prostaglandin D2 were observed in RBL2H3 cell line when treated (125μg) with CP 26kDa protein. Conclusively, in vivo and in vitro studies revealed the allergenic potential of purified CP 26kDa protein. Being a potential allergen, plant albumin may play a pivotal role in CP induced allergenicity. Current study will be helpful for better development of therapeutic approaches to
Antibiotics Resistance in Rhizobium: Type, Process, Mechanism and Benefit for Agriculture.
Naamala, Judith; Jaiswal, Sanjay K; Dakora, Felix D
2016-06-01
The use of high-quality rhizobial inoculants on agricultural legumes has contributed substantially to the N economy of farming systems through inputs from biological nitrogen fixation (BNF). Large populations of symbiotically effective rhizobia should be available in the rhizosphere for symbiotic BNF with host plants. The rhizobial populations should also be able to compete and infect host plants. However, the rhizosphere comprises large populations of different microorganisms. Some of these microorganisms naturally produce antibiotics which are lethal to susceptible rhizobial populations in the soil. Therefore, intrinsic resistance to antibiotics is a desirable trait for the rhizobial population. It increases the rhizobia's chances of growth, multiplication and persistence in the soil. With a large population of rhizobia in the soil, infectivity of host plants and the subsequent BNF efficiency can be guaranteed. This review, therefore, puts together findings by various researchers on antibiotic resistance in bacteria with the main emphasis on rhizobia. It describes the different modes of action of different antibiotics, the types of antibiotic resistance exhibited by rhizobia, the mechanisms of acquisition of antibiotic resistance in rhizobia and the levels of tolerance of different rhizobial species to different antibiotics.
Energy Technology Data Exchange (ETDEWEB)
Stopka, Sylwia A.; Agtuca, Beverly J.; Koppenaal, David W.; Pasa Tolic, Ljiljana; Stacey, Gary; Vertes, Akos; Anderton, Christopher R.
2017-05-23
Technologies enabling in situ metabolic profiling of living plant systems are invaluable for understanding physiological processes and could be used for rapid phenotypic screening (e.g., to produce plants with superior biological nitrogen fixing ability). The symbiotic interaction between legumes and nitrogen-fixing soil bacteria results in a specialized plant organ (i.e., root nodule), where the exchange of nutrients between host and endosymbiont occurs. Laser ablation electrospray ionization mass spectrometry (LAESI-MS) is a method that can be performed under ambient conditions requiring minimal sample preparation. Here, we employed LAESI-MS to explore the well-characterized symbiosis between soybean (Glycine max L. Merr.) and its compatible symbiont, Bradyrhizobium japonicum. The utilization of ion mobility separation (IMS) improved the molecular coverage, selectivity, and identification of the detected biomolecules. Specifically, incorporation of IMS resulted in an increase of 153 detected metabolites in the nodule samples. The data presented demonstrates the advantages of using LAESI-IMS-MS for the rapid analysis of intact root nodules, uninfected root segments, and free-living rhizobia. Untargeted pathway analysis revealed several metabolic processes within the nodule (e.g., zeatin, riboflavin, and purine synthesis). Compounds specific to the uninfected root and bacteria were also detected. Lastly, we performed depth-profiling of intact nodules to reveal the location of metabolites to the cortex and inside the infected region, and lateral profiling of sectioned nodules confirmed these molecular distributions. Our results established the feasibility of LAESI-IMS-MS for the analysis and spatial mapping of plant tissues, with its specific demonstration to improve our understanding of the soybean-rhizobial symbiosis.
Directory of Open Access Journals (Sweden)
Himabindu Kudapa
Full Text Available A comprehensive transcriptome assembly of chickpea has been developed using 134.95 million Illumina single-end reads, 7.12 million single-end FLX/454 reads and 139,214 Sanger expressed sequence tags (ESTs from >17 genotypes. This hybrid transcriptome assembly, referred to as Cicer arietinumTranscriptome Assembly version 2 (CaTA v2, available at http://data.comparative-legumes.org/transcriptomes/cicar/lista_cicar-201201, comprising 46,369 transcript assembly contigs (TACs has an N50 length of 1,726 bp and a maximum contig size of 15,644 bp. Putative functions were determined for 32,869 (70.8% of the TACs and gene ontology assignments were determined for 21,471 (46.3%. The new transcriptome assembly was compared with the previously available chickpea transcriptome assemblies as well as to the chickpea genome. Comparative analysis of CaTA v2 against transcriptomes of three legumes - Medicago, soybean and common bean, resulted in 27,771 TACs common to all three legumes indicating strong conservation of genes across legumes. CaTA v2 was also used for identification of simple sequence repeats (SSRs and intron spanning regions (ISRs for developing molecular markers. ISRs were identified by aligning TACs to the Medicago genome, and their putative mapping positions at chromosomal level were identified using transcript map of chickpea. Primer pairs were designed for 4,990 ISRs, each representing a single contig for which predicted positions are inferred and distributed across eight linkage groups. A subset of randomly selected ISRs representing all eight chickpea linkage groups were validated on five chickpea genotypes and showed 20% polymorphism with average polymorphic information content (PIC of 0.27. In summary, the hybrid transcriptome assembly developed and novel markers identified can be used for a variety of applications such as gene discovery, marker-trait association, diversity analysis etc., to advance genetics research and breeding
Energy Technology Data Exchange (ETDEWEB)
Shaw, W H; Anderson, J W
1974-01-01
ATP sulfurylases were partially purified (20-40-fold) from leaf tissue of Astragalus bisulcatus, Astragalus racemosus (selenium-accumulator species) and Astragalus hamosus and Astragalus sinicus (non-accumulator species). Activity was measured by sulfate-dependent PP/sub 1/-ATP exchange. The enzymes were separated from pyrophosphatase and adenosine triphosphatase activities. The properties of the Astragalus ATP sulfurylases were similar to the spinach enzyme. The ATP sulfurylases from both selenium-accumulator and non-accumulator species catalyzed selenate-dependent PP/sub 1/-ATP exchange; selenate competed with sulfate. The ratio of V(selenate)/V(sulfate) and K/sub m/ (selenate)/K/sub m/(sulfate) was approximately the same for the enzyme from each species. Sulfate-dependent PP/sub 1/-ATP exchange was inhibited by ADP, chlorate and nitrate. The kinetics of the inhibition for each enzyme were consistent with an ordered reaction mechanisms, in which ATP is the first substrate to react with the enzyme and PP/sub 1/ is the first product released. Synthesis of adenosine 5'-(/sup 35/S)sulfatophosphate from (/sup 35/S)sulfate was demonstrated by coupling the Astrgalus ATP sulfurylases with Mg/sup 2 +/-dependent pyrophosphatase; the reaction was inhibited by selenate. An analogous reaction using (/sup 75/Se)selenate as substrate could not be demonstrated.
Thudi, Mahendar; Khan, Aamir W; Kumar, Vinay; Gaur, Pooran M; Katta, Krishnamohan; Garg, Vanika; Roorkiwal, Manish; Samineni, Srinivasan; Varshney, Rajeev K
2016-01-27
Chickpea (Cicer arietinum L.) is the second most important grain legume cultivated by resource poor farmers in South Asia and Sub-Saharan Africa. In order to harness the untapped genetic potential available for chickpea improvement, we re-sequenced 35 chickpea genotypes representing parental lines of 16 mapping populations segregating for abiotic (drought, heat, salinity), biotic stresses (Fusarium wilt, Ascochyta blight, Botrytis grey mould, Helicoverpa armigera) and nutritionally important (protein content) traits using whole genome re-sequencing approach. A total of 192.19 Gb data, generated on 35 genotypes of chickpea, comprising 973.13 million reads, with an average sequencing depth of ~10 X for each line. On an average 92.18 % reads from each genotype were aligned to the chickpea reference genome with 82.17 % coverage. A total of 2,058,566 unique single nucleotide polymorphisms (SNPs) and 292,588 Indels were detected while comparing with the reference chickpea genome. Highest number of SNPs were identified on the Ca4 pseudomolecule. In addition, copy number variations (CNVs) such as gene deletions and duplications were identified across the chickpea parental genotypes, which were minimum in PI 489777 (1 gene deletion) and maximum in JG 74 (1,497). A total of 164,856 line specific variations (144,888 SNPs and 19,968 Indels) with the highest percentage were identified in coding regions in ICC 1496 (21 %) followed by ICCV 97105 (12 %). Of 539 miscellaneous variations, 339, 138 and 62 were inter-chromosomal variations (CTX), intra-chromosomal variations (ITX) and inversions (INV) respectively. Genome-wide SNPs, Indels, CNVs, PAVs, and miscellaneous variations identified in different mapping populations are a valuable resource in genetic research and helpful in locating genes/genomic segments responsible for economically important traits. Further, the genome-wide variations identified in the present study can be used for developing high density SNP arrays for
Directory of Open Access Journals (Sweden)
Ali Namvar
2013-09-01
Full Text Available The effects of organic and inorganic nitrogen fertilization on some physiological and agronomical traits of chickpea (Cicer arietinum L. cv. ILC 482, investigated at the Experimental Farm of the Agriculture Faculty, University of Mohaghegh Ardabili. The trial was laid out in spilt plot design based on randomized complete block with four replications. Experimental factors were mineral nitrogen fertilizer at four levels (0, 50, 75 and 100 kg urea/ha in the main plots, and two levels of inoculation with Rhizobium bacteria (with and without inoculation as sub plots. N application and Rh. inoculation showed positive effects on physiological and agronomical traits of chickpea. The highest value of leaf RWC recorded in 50 kg urea/ha that was statistically in par with 75 kg urea/ha application while, usage of 75 kg urea/ha showed the maximum stem RWC. The maximum CMS obtained form application of 75 kg urea/ha. Chlorophyll content, leaf area index and grains protein content showed their maximum values in the highest level of nitrogen usage (100 kg urea/ha. Moreover, inoculated plants had the highest magnitudes of all physiological traits. In the case of agronomical traits, the highest values of plant height, number of primary and secondary branches, number of pods per plant, number of grains per plant, grain and biological yield were obtained from the highest level of nitrogen fertilizer (100 kg urea/ha and Rh. inoculation. Application of 75 kg urea/ha was statistically in par with 100 kg urea/ha in all of these traits. The results pointed out that some N fertilization (i.e. between 50 and 75 kg urea/ha as starter can be beneficial to improve growth, development, physiological traits and total yield of inoculated chickpea.
De Meyer, Sofie E; Briscoe, Leah; Martínez-Hidalgo, Pilar; Agapakis, Christina M; de-Los Santos, Paulina Estrada; Seshadri, Rekha; Reeve, Wayne; Weinstock, George; O'Hara, Graham; Howieson, John G; Hirsch, Ann M
2016-08-01
Genome analysis of fourteen mimosoid and four papilionoid beta-rhizobia together with fourteen reference alpha-rhizobia for both nodulation (nod) and nitrogen-fixing (nif/fix) genes has shown phylogenetic congruence between 16S rRNA/MLSA (combined 16S rRNA gene sequencing and multilocus sequence analysis) and nif/fix genes, indicating a free-living diazotrophic ancestry of the beta-rhizobia. However, deeper genomic analysis revealed a complex symbiosis acquisition history in the beta-rhizobia that clearly separates the mimosoid and papilionoid nodulating groups. Mimosoid-nodulating beta-rhizobia have nod genes tightly clustered in the nodBCIJHASU operon, whereas papilionoid-nodulating Burkholderia have nodUSDABC and nodIJ genes, although their arrangement is not canonical because the nod genes are subdivided by the insertion of nif and other genes. Furthermore, the papilionoid Burkholderia spp. contain duplications of several nod and nif genes. The Burkholderia nifHDKEN and fixABC genes are very closely related to those found in free-living diazotrophs. In contrast, nifA is highly divergent between both groups, but the papilionoid species nifA is more similar to alpha-rhizobia nifA than to other groups. Surprisingly, for all Burkholderia, the fixNOQP and fixGHIS genes required for cbb3 cytochrome oxidase production and assembly are missing. In contrast, symbiotic Cupriavidus strains have fixNOQPGHIS genes, revealing a divergence in the evolution of two distinct electron transport chains required for nitrogen fixation within the beta-rhizobia.
Short-term fertilizer application alters phenotypic traits of symbiotic nitrogen fixing bacteria.
Simonsen, Anna K; Han, Shery; Rekret, Phil; Rentschler, Christine S; Heath, Katy D; Stinchcombe, John R
2015-01-01
Fertilizer application is a common anthropogenic alteration to terrestrial systems. Increased nutrient input can impact soil microbial diversity or function directly through altered soil environments, or indirectly through plant-microbe feedbacks, with potentially important effects on ecologically-important plant-associated mutualists. We investigated the impacts of plant fertilizer, containing all common macro and micronutrients on symbiotic nitrogen-fixing bacteria (rhizobia), a group of bacteria that are important for plant productivity and ecosystem function. We collected rhizobia nodule isolates from natural field soil that was treated with slow-release plant fertilizer over a single growing season and compared phenotypic traits related to free-living growth and host partner quality in these isolates to those of rhizobia from unfertilized soils. Through a series of single inoculation assays in controlled glasshouse conditions, we found that isolates from fertilized field soil provided legume hosts with higher mutualistic benefits. Through growth assays on media containing variable plant fertilizer concentrations, we found that plant fertilizer was generally beneficial for rhizobia growth. Rhizobia isolated from fertilized field soil had higher growth rates in the presence of plant fertilizer compared to isolates from unfertilized field soil, indicating that plant fertilizer application favoured rhizobia isolates with higher abilities to utilize fertilizer for free-living growth. We found a positive correlation between growth responses to fertilizer and mutualism benefits among isolates from fertilized field soil, demonstrating that variable plant fertilizer induces context-dependent genetic correlations, potentially changing the evolutionary trajectory of either trait through increased trait dependencies. Our study shows that short-term application is sufficient to alter the composition of rhizobia isolates in the population or community, either directly
Short-term fertilizer application alters phenotypic traits of symbiotic nitrogen fixing bacteria
Directory of Open Access Journals (Sweden)
Anna K. Simonsen
2015-10-01
Full Text Available Fertilizer application is a common anthropogenic alteration to terrestrial systems. Increased nutrient input can impact soil microbial diversity or function directly through altered soil environments, or indirectly through plant-microbe feedbacks, with potentially important effects on ecologically-important plant-associated mutualists. We investigated the impacts of plant fertilizer, containing all common macro and micronutrients on symbiotic nitrogen-fixing bacteria (rhizobia, a group of bacteria that are important for plant productivity and ecosystem function. We collected rhizobia nodule isolates from natural field soil that was treated with slow-release plant fertilizer over a single growing season and compared phenotypic traits related to free-living growth and host partner quality in these isolates to those of rhizobia from unfertilized soils. Through a series of single inoculation assays in controlled glasshouse conditions, we found that isolates from fertilized field soil provided legume hosts with higher mutualistic benefits. Through growth assays on media containing variable plant fertilizer concentrations, we found that plant fertilizer was generally beneficial for rhizobia growth. Rhizobia isolated from fertilized field soil had higher growth rates in the presence of plant fertilizer compared to isolates from unfertilized field soil, indicating that plant fertilizer application favoured rhizobia isolates with higher abilities to utilize fertilizer for free-living growth. We found a positive correlation between growth responses to fertilizer and mutualism benefits among isolates from fertilized field soil, demonstrating that variable plant fertilizer induces context-dependent genetic correlations, potentially changing the evolutionary trajectory of either trait through increased trait dependencies. Our study shows that short-term application is sufficient to alter the composition of rhizobia isolates in the population or community
Are common symbiosis genes required for endophytic rice-rhizobial interactions?
Chen, Caiyan; Zhu, Hongyan
2013-09-01
Legume plants are able to establish root nodule symbioses with nitrogen-fixing bacteria, called rhizobia. Recent studies revealed that the root nodule symbiosis has co-opted the signaling pathway that mediates the ancestral mycorrhizal symbiosis that occurs in most land plants. Despite being unable to induce nodulation, rhizobia have been shown to be able to infect and colonize the roots of non-legumes such as rice. One fascinating question is whether establishment of such associations requires the common symbiosis (Sym) genes that are essential for infection of plant cells by mycorrhizal fungi and rhizobia in legumes. Here, we demonstrated that the common Sym genes are not required for endophytic colonization of rice roots by nitrogen-fixing rhizobia.
... Events Multimedia (Video, Images, and Audio) NCCIH Clinical Digest A monthly newsletter with evidence-based information on ... require a viewer such as the free Adobe Reader . NCCIH Publication No.: D384 Updated: September 2016 Print ...
Herbivory eliminates fitness costs of mutualism exploiters.
Simonsen, Anna K; Stinchcombe, John R
2014-04-01
A common empirical observation in mutualistic interactions is the persistence of variation in partner quality and, in particular, the persistence of exploitative phenotypes. For mutualisms between hosts and symbionts, most mutualism theory assumes that exploiters always impose fitness costs on their host. We exposed legume hosts to mutualistic (nitrogen-fixing) and exploitative (non-nitrogen-fixing) symbiotic rhizobia in field conditions, and manipulated the presence or absence of insect herbivory to determine if the costly fitness effects of exploitative rhizobia are context-dependent. Exploitative rhizobia predictably reduced host fitness when herbivores were excluded. However, insects caused greater damage on hosts associating with mutualistic rhizobia, as a consequence of feeding preferences related to leaf nitrogen content, resulting in the elimination of fitness costs imposed on hosts by exploitative rhizobia. Our experiment shows that herbivory is potentially an important factor in influencing the evolutionary dynamic between legumes and rhizobia. Partner choice and host sanctioning are theoretically predicted to stabilize mutualisms by reducing the frequency of exploitative symbionts. We argue that herbivore pressure may actually weaken selection on choice and sanction mechanisms, thus providing one explanation of why host-based discrimination mechanisms may not be completely effective in eliminating nonbeneficial partners. © 2014 The Authors. New Phytologist © 2014 New Phytologist Trust.
Pinnipedia belonging to collection of Department of Paleontology of the Science Faculty
International Nuclear Information System (INIS)
Perez Garcia, M.
1998-01-01
Pinnipedia belonging to collection of Department of Paleontology, Facultad de Ciencias, are shown. They are an astragalus and partial humerus, found the former in the coast of Departamento of San Jose and the latter in Rocha Department. The astragalus is assigned to Arctocephalus (southern fur seal) and humerus to Phocidae. (author)
Foudah et al., Afr J Tradit Complement Altern Med., (2017) 14 (5): 31 ...
African Journals Online (AJOL)
phenolic and flavonoid content of Astragalus squarrosus Bunge. Afr. J. Biotechnol., 10: 19176-19180. 2. Bagheri, S., L. Keyhani, M. Heydari and H. Dashti, 2015. Antinociceptive activity of Astragalus gummifer gum. (gum tragacanth) through the adrenergic system: An in vivo study in mice. J. Ayurveda Integr. Med., 6: 19-23.
Expression and purification of Nod factor receptors - Initial characterization of ligand binding
DEFF Research Database (Denmark)
Broghammer, Angelique
Carbohydrate signals have been shown to regulate defence, growth and development in plants. Decorated chitin molecules, lipochitooligosaccharides, synthesized and secreted by rhizobia are the major signal molecules initiating the plant processes establishing legume-rhizobia symbiosis. Lipochitool......Carbohydrate signals have been shown to regulate defence, growth and development in plants. Decorated chitin molecules, lipochitooligosaccharides, synthesized and secreted by rhizobia are the major signal molecules initiating the plant processes establishing legume-rhizobia symbiosis...... and LjNFR5 ectodomains were glycosylated; 3) LjNFR1 retained its in vitro kinase activity and 4) LjNFR1 and LjNFR5 were localized to the plasma membrane. In depth mass spectroscopy analysis of the N-glycan structure of LjNFR5 resulted in identification of two different glycan structures with identical...
Effects of Geven root extract on proliferation of HeLa cells and bcl-2 ...
African Journals Online (AJOL)
Geven (Astragalus L.) root extract is used for asthma, diarrhea, and cancer therapy in Chinese Medicine. Liquid Astragalus root extracts are traditionally used in Anatolia for leukemia and wound healing. 439 species of this plant, which has 3000 species in the world, grow in Turkey and 204 of these are endemic. In this study ...
Hasan, Md Anayet; Mannan, Adnan; Alam, Rashel; Islam, Md Taohidul; Amin, Mohammad Al; Khan, Md Sarowar Jahan; Islam, Md Ashraful; Muzahid, Nazmul Hasan
2012-01-01
The issue of balanced nutrition is of great concern to human. Meat and fish are the best sources of protein. The affordability of these resources for people in developing countries is less. Thus, there is an increasing interest in pulses and its derivates as an alternative to fish and meat. Lectin and histone H1 are the most common proteins in various pulses and our interest is in identifying the dominant essential amino acids in them for use as supplements. However, actin and lectin are common among Oryza Sativa and cicer arietinum. We describe the amount of lectin and histone H1 in cicer arietinum, Lens culinaris and Pisum sativum in a comparative manner. cicer arietinum was found to contain more essential amino acids than Lens culinaris and Pisum sativum. The secondary structures of lectin and histone H1 protein were analyzed to gain functional inferences in these species. The comparative study shows the relatively poor presence of the amino acid methionine in most pulses. However, Oryza Sativa was found to contain sufficient methionine. The study shows that pulses (especially cicer arietinum) were a suitable alternative source to meat and fish for Lectin and Histone H1 balance. Hence, pulses could be suggested with rice for balanced protein diet.
Directory of Open Access Journals (Sweden)
Eli Sidney Lopes
1986-01-01
Full Text Available A adição de vinhaça na cultura canavieira tem sido praticada em áreas próximas às usinas de cana. Seria de interesse a avaliação do efeito da vinhaça no Rhizobium presente no solo (autóctone, uma vez que leguminosas têm sido indicadas para cultivo intercalar com a cana. Um experimento foi conduzido em casa de vegetação, com o objetivo de verificar a influência da aplicação contínua, durante três anos, de concentrações crescentes de vinhaça (0, 100 e 1.000 m³/ha/ano, com intervalos de seis meses entre aplicações, na população autóctone de Rhizobium que nodula amendoim, soja, feijão e crotalária. Em cada cultura, foram usados controle com solo sem adição da vinhaça e um tratamento inoculado com uma estirpe de Rhizobium de conhecida eficiência, recomendada para a cultura. Uma análise do efeito de uma dose adicional de 1,5 ppm do herbicida 2,4-D no tratamento com 100 m³/ha/ano foi também efetuada. Apesar de os resultados serem variados entre as culturas, ocorreram efeitos da vinhaça sobre a população de Rhizobium, causando aumentos de nodulação na crotalária e diminuição no amendoim. Não foram observados efeitos na nodulação do feijoeiro em nenhum dos tratamentos com a vinhaça, nem na soja, que nodulou somente com a dose mais elevada, sugerindo que o Rhizobium japonicum no solo estudado estava presente em baixo número. O tratamento com herbicida mostrou tendência de favorecer a nodulação e, conseqüentemente, a fixação biológica de N2, medida através do N na planta.The addition of vinasse on sugar cane plantations nearby alcohol fermentation plants is a common practice. Legumes are recommended to be intercropped with sugar cane. A greenhouse experiment was carried out with the objective of verifying the influence of continuous application of vinasse (0; 100 and 1000 m³/ha/year at six month interval during three years on soil rhizobia which nodulate peanuts, soybeans, dry-beans and crotalaria
Yadav, Reena; Mehrotra, Meenakshi; Singh, Aditya K; Niranjan, Abhishek; Singh, Rani; Sanyal, Indraneel; Lehri, Alok; Pande, Veena; Amla, D V
2017-01-01
Agrobacterium-mediated transformation of chickpea (Cicer arietinum L.) has been performed using cotyledonary node explants (CNs), which release phenolics upon excision that are detrimental to the viability of Agrobacterium tumefaciens and result in low transformation frequency. Twelve low molecular weight phenolic compounds and salicylic acid were identified in the exudates released upon excision during the preparation of cotyledonary nodes by reverse phase high-performance liquid chromatography (RP-HPLC). Zone inhibition assays performed with the explant exudates released at periodic intervals after excision showed the inhibition of A. tumefaciens. Agroinoculation of freshly excised cotyledonary nodes of chickpea showed 98-99 % inhibition of colony forming units (cfu). Osmium tetraoxide fixation of excised tissues showed enhanced accumulation of phenolics in the sub-epidermal regions causing enzymatic browning, affecting the viability and performance of A. tumefaciens for T-DNA delivery. The periodic analysis of exudates released from excised CNs showed enhanced levels of gallic acid (0.2945 ± 0.014 μg/g), chlorogenic acid (0.0978 ± 0.0046 μg/g), and quercetin (0.0971 ± 0.0046 μg/g) fresh weight, which were detrimental to A. tumefaciens. Quantitative assays and the elution profile showed the maximum leaching of phenolics, flavonoids, and salicylic acid immediately after the excision of explants and continued till 4 to 8 h post-excision. Pre-treatment of excised explants with inhibitors of polyphenol oxidase like L-cysteine, DTT, and sodium thiosulfate before co-cultivation showed the recovery of A. tumefaciens cfu, decreased the accumulation of phenolics, and improved transformation frequency. Our results show the hypersensitive response of excision stress for the expression of defense response-related genes and synthesis of metabolites in grain legume chickpea against pathogen infestation including Agrobacterium.
Deokar, Amit A; Kondawar, Vishwajith; Kohli, Deshika; Aslam, Mohammad; Jain, Pradeep K; Karuppayil, S Mohan; Varshney, Rajeev K; Srinivasan, Ramamurthy
2015-01-01
The AP2/ERF family is one of the largest transcription factor gene families that are involved in various plant processes, especially in response to biotic and abiotic stresses. Complete genome sequences of one of the world's most important pulse crops chickpea (Cicer arietinum L.), has provided an important opportunity to identify and characterize genome-wide ERF genes. In this study, we identified 120 putative ERF genes from chickpea. The genomic organization of the chickpea ERF genes suggested that the gene family might have been expanded through the segmental duplications. The 120 member ERF family was classified into eleven distinct groups (I-X and VI-L). Transcriptional factor CarERF116, which is differentially expressed between drought tolerant and susceptible chickpea cultivar under terminal drought stress has been identified and functionally characterized. The CarERF116 encodes a putative protein of 241 amino acids and classified into group IX of ERF family. An in vitro CarERF116 protein-DNA binding assay demonstrated that CarERF116 protein specifically interacts with GCC box. We demonstrate that CarERF116 is capable of transactivation activity of and show that the functional transcriptional domain lies at the C-terminal region of the CarERF116. In transgenic Arabidopsis plants overexpressing CarERF116, significant up-regulation of several stress related genes were observed. These plants also exhibit resistance to osmotic stress and reduced sensitivity to ABA during seed germination. Based on these findings, we conclude that CarERF116 is an abiotic stress responsive gene, which plays an important role in stress tolerance. In addition, the present study leads to genome-wide identification and evolutionary analyses of chickpea ERF gene family, which will facilitate further research on this important group of genes and provides valuable resources for comparative genomics among the grain legumes.
Nasr Esfahani, Maryam; Sulieman, Saad; Schulze, Joachim; Yamaguchi-Shinozaki, Kazuko; Shinozaki, Kazuo; Tran, Lam-Son Phan
2014-09-01
Drought negatively impacts symbiotic nitrogen fixation (SNF) in Cicer arietinum L. (chickpea), thereby limiting yield potential. Understanding how drought affects chickpea nodulation will enable the development of strategies to biotechnologically engineer chickpea varieties with enhanced SNF under drought conditions. By analyzing carbon and nitrogen metabolism, we studied the mechanisms of physiological adjustment of nitrogen fixation in chickpea plants nodulated with Mesorhizobium ciceri during both drought stress and subsequent recovery. The nitrogenase activity, levels of several key carbon (in nodules) and nitrogen (in both nodules and leaves) metabolites and antioxidant compounds, as well as the activity of related nodule enzymes were examined in M. ciceri-inoculated chickpea plants under early drought stress and subsequent recovery. Results indicated that drought reduced nitrogenase activity, and that this was associated with a reduced expression of the nifK gene. Furthermore, drought stress promoted an accumulation of amino acids, mainly asparagine in nodules (but not in leaves), and caused a cell redox imbalance in nodules. An accumulation of organic acids, especially malate, in nodules, which coincided with the decline of nodulated root respiration, was also observed under drought stress. Taken together, our findings indicate that reduced nitrogenase activity occurring at early stages of drought stress involves, at least, the inhibition of respiration, nitrogen accumulation and an imbalance in cell redox status in nodules. The results of this study demonstrate the potential that the genetic engineering-based improvement of SNF efficiency could be applied to reduce the impact of drought on the productivity of chickpea, and perhaps other legume crops. © 2014 The Authors The Plant Journal © 2014 John Wiley & Sons Ltd.
Wu, Jun; Wang, Jing; Su, Qiang; Ding, Wei; Li, Teng; Yu, Junxian; Cao, Bangwei
2018-01-01
Traditional chemotherapy and molecular targeted therapy have shown modest effects on the survival of patients with pancreatic cancer. The current study aimed to investigate the antitumor effects of apatinib, Astragalus polysaccharide (APS), and the combination of both the drugs in pancreatic cancer cells and further explore the molecular mechanisms in vitro. Expression of vascular endothelial growth factor receptor-2 (VEGFR-2) in human pancreatic cancer cell lines ASPC-1, PANC-1, and SW1990 was detected by Western blotting. Cell proliferation was measured by MTS, and migration and invasion were detected by wound-healing and Transwell assays, respectively. Cell apoptosis rate was determined by flow cytometry and cellular autophagy level affected by apatinib, and APS was analyzed by Western blotting. Human pancreatic cancer cell lines ASPC-1 and PANC-1 expressed VEGFR-2, but VEGFR-2 was not detected in SW1990. Either apatinib or APS inhibited cell proliferation in a dose-dependent manner in ASPC-1 and PANC-1. APS in combination with apatinib showed enhanced inhibitory effects on cell migration and invasion compared with apatinib monotherapy in ASPC-1 and PANC-1. Meanwhile, APS combined with apatinib strongly increased cell apoptosis percentage. Western blotting showed that the combination of APS and apatinib significantly enhanced the downregulation of phosphorylated protein kinase B (AKT) and extracellular signal-regulated kinase (ERK) (p-AKT and p-ERK) as well as matrix metalloproteinases-9 (MMP-9) expression. In addition, both apatinib and APS induced cellular autophagy. However, the expression of autophagy-related proteins was not further elevated in the combination group. The study first demonstrated that apatinib showed potentially inhibitory effects in pancreatic cancer cells and that APS enhanced the antitumor effects of apatinib through further downregulating the expression of phosphorylation of AKT and ERK as well as MMP-9.
Energy Technology Data Exchange (ETDEWEB)
Smyth, C.R.
1997-05-01
Transplant survivorship, growth, and reproductive performance of several indigenous high-elevation legume species grown in unamended spoil were studied at three coal mines in the Canadian Rocky Mountains. Survivorship varied with species but was highest for Astragalus aboriginum (62%), Astragalus alpinus (73-57%), Astragalus vexilliflexus var. nubilus (73-63%), and Oxytropis sericea (77-62%). Mortality was greatest during the first two years for most species. The causes of transplant mortality are considered to be drought stress, deep-seated `frost-popping`/root exposure, and damage, for example, root exposure and destruction of meristematic tissues by foraging mammals such as bighorn sheep, mountain goats, grizzly bears, and marmots. Survivorship, growth, and reproductive activity were greatest at the two subalpine disturbances. Growth varied with species, but the greatest growth increments (height and diameter) were recorded during the first and second years. Reproductive activity for the Astragalus species began during the first year at one location but, in general, flowering and seed set did not begin until the second or third years. Recruitment from seed was small ({lt} 10/year). Several of these species appear to be suitable for revegetation of subalpine and alpine surface mine disturbances.
Directory of Open Access Journals (Sweden)
Juan Manuel Sánchez-Yáñez
2014-01-01
Full Text Available ResumenEl cultivo de garbanzo “Cicer arietinumL.” demanda fertilizante nitrogenado (FN, que aplicado en excesoprovoca pérdida de fertilidad del suelo y contaminación ambiental. Una alternativa para este problema es lareducción y optimización de la dosis de FN, con inoculantes a base de bacteriaspromotoras de crecimientovegetal (BPCV.Así, el objetivo de este trabajo fue analizar la respuesta del garbanzo a la inoculación conAzotobactervinelandiiyBurkholderiacepaciaa la dosis 50% del FN. Para ello se utilizó un diseñoexperimental de bloques al azar. Con nitrato de amonio (NO3NH4 como FN a las dosis 100% (10g/L y 50 %(5g/L para el garbanzo inoculado con las BPCV; con las variables/respuesta en su semilla: por ciento (% degerminación; luego su fenotípia y biomasa aérea y radical, los datos experimentales se analizaron por ANOVAy Tukey. Los resultados indicaron una respuesta positiva de la semilla de garbanzo a la doble inoculación conambas BPCV, al igual que aplántula y floración, donde el garbanzo alcanzo un peso seco total (PST de 0,82g, valor estadísticamente diferente y significativo, comparado con los 0,71g de PST del garbanzo sin inocularcon el FN al 100% o control relativo (CR. Lo anterior sugiereuna respuesta positiva del garbanzo queoptimizó la dosis 50% del FN, por una acción sinérgica de los dos géneros de BPCV en sus raíces, lo quepodría evitar en parte la perdida de fertilidad del suelo y la contaminación ambiental, por la aplicación enexceso del FN.
Directory of Open Access Journals (Sweden)
GUO Tao
2014-04-01
Full Text Available ObjectiveTo observe the pharmacodynamic characteristics of Danggui Buxue decoction (containing Angelica sinensis and its separated recipes in treating liver fibrosis and angiogenesis. MethodsForty-eight Wistar rats were randomly divided into 6 groups: normal group, model group, Danggui Buxue decoction group, Astragalus membranaceus group, Angelica sinensis group, and sorafenib control group. In all groups except normal group, a rat model of liver fibrosis was established using carbon tetrachloride combined with high-fat and low-protein diet. Liver tissue inflammation was observed by HE staining, while collagen deposition by Sirius red staining. Serum levels of alanine aminotransferase (ALT, aspartate aminotransferase (AST, and albumin (Alb and the malondialdehyde (MDA content, superoxide dismutase (SOD activity, nitric oxide (NO content, and nitricoxide synthase (NOS activity in liver tissue were determined by a test kit. The hydroxyproline (Hyp content in liver tissue was determined by hydrochloric acid hydrolysis. Sinusoidal endothelial fenestrae were observed by scanning electron microscope, and liver capillaries by synchrotron radiation X-ray two-dimensional imaging. Comparisons between groups were made by one-way analysis of variance; the least significant difference test was used when variances were equal, and the Tamhane′s T2 test was used when variances were unequal. ResultsThe Danggui Buxue decoction group, Astragalus membranaceus group, and Angelica sinensis group had significantly increased serum Alb levels (P<0.05 and significantly decreased serum AST levels (P<0.05; the Danggui Buxue decoction group and Astragalus membranaceus group had significantly decreased serum ALT levels (P<005. All treatment groups had significantly decreased liver hydroxyproline content (P<0.05. In the liver tissues of all treatment groups, the vascular texture was reduced, and the number of sinusoidal endothelial fenestrae was increased . The
Reduction of Turbidity of Water Using Locally Available Natural Coagulants
Asrafuzzaman, Md.; Fakhruddin, A. N. M.; Hossain, Md. Alamgir
2011-01-01
Turbidity imparts a great problem in water treatment. Moringa oleifera, Cicer arietinum, and Dolichos lablab were used as locally available natural coagulants in this study to reduce turbidity of synthetic water. The tests were carried out, using artificial turbid water with conventional jar test apparatus. Optimum mixing intensity and duration were determined. After dosing water-soluble extracts of Moringa oleifera, Cicer arietinum, and Dolichos lablab reduced turbidity to 5.9, 3.9, and 11.1 nephelometric turbidity unit (NTU), respectively, from 100 NTU and 5, 3.3, and 9.5, NTU, respectively, after dosing and filtration. Natural coagulants worked better with high, turbid, water compare to medium, or low, turbid, water. Highest turbidity reduction efficiency (95.89%) was found with Cicer arietinum. About 89 to 96% total coliform reduction were also found with natural coagulant treatment of turbid water. Using locally available natural coagulants, suitable, easier, and environment friendly options for water treatment were observed. PMID:23724307
Protein (Viridiplantae): 653337 [PGDBj - Ortholog DB
Lifescience Database Archive (English)
Full Text Available ed factor 2N-like Cicer arietinum MDDGLSPDRGYGLSPDMGYGLSPDRGYGLSPDRGYGLSPDRGDGLSPNRGDVLSPDRGDGLSPDRG...YGLSPDRGYGISPDRGYGISPDRGYGLSPDRRYRLSHNRRYMLSHNRRYRLSPDRRYGLSLDRRYRLSPNRRQHLSGDRR
Strain identification in Rhizobium by starch gel electrophoresis of isoenzymes
DEFF Research Database (Denmark)
Engvild, Kjeld Christensen; Nielsen, G.
1985-01-01
Sonieated extracts of rhizobia, especiaUy Rhizobium leguminosarum from pea and vetch, were run in horizontal starch gel electrophoresis in the cold. The rhizobia were grown on agar on a slime suppressing substrate of tryptone-yeast extract-CaCl2 with small amounts of mannitol, sorbitol...
Salian, Rupa; Wani, Suhas; Reddy, Ramamohan; Patil, Mukund
2018-03-01
Brewing industry releases large quantities of wastewater after product generation. Brewery wastewater contains organic compounds which are biodegradable in nature. These biodegradable wastes can be recycled and reused and hence considered as suitable products for agriculture. But before using wastewater for agriculture, it is better to evaluate the phytotoxic effects of wastewater on crops. Hence, the main objective of this study is to evaluate the effects of brewery effluent on seed germination and growth parameters of selected crop species like chickpea (Cicer arietinum), maize (Zea mays), and pigeon pea (Cajanus cajan). Study comprised seven types of water treatments-tap water as control, diluted UASBR effluent (50% effluent + 50% distilled water): UASBR50, undiluted UASBR effluent: UASBR100, diluted TC effluent (50% effluent + 50% distilled water): ETP50,TC effluent without dilution: ETP100, 10% diluted reverse osmosis (RO10) reject (10% RO reject + 90% distilled water), and 25% diluted reverse osmosis(RO25) reject (25% RO reject + 75% distilled water) with three replications in completely randomized design. Germination test was performed in petri plates for 5 days. Parameters like germination percentage, germination rate index, seedling length, phytotoxicity index, seed vigor index, and biomass were calculated. All parameters decreased with increase in respective effluent concentration. Among all treatments, RO25 showed highest inhibitory effect on all three crops. Even though undiluted effluent of UASBR and ETP effluent showed positive effect on germination, seedling growth of three crops was promoted to the maximum by UASBR50 and ETP50. Hence, from the study, it was concluded that dilution of brewery effluent can be recommended before using it for irrigational purpose.
Le Roux, Johannes J; Hui, Cang; Keet, Jan-Hendrik; Ellis, Allan G
2017-09-01
Contents 1354 I. 1354 II. 1355 III. 1357 IV. 1357 V. 1359 1359 References 1359 SUMMARY: Interactions between non-native plants and their mutualists are often disrupted upon introduction to new environments. Using legume-rhizobium mutualistic interactions as an example, we discuss two pathways that can influence symbiotic associations in such situations: co-introduction of coevolved rhizobia; and utilization of, and adaptation to, resident rhizobia, hereafter referred to as 'ecological fitting'. Co-introduction and ecological fitting have distinct implications for successful legume invasions and their impacts. Under ecological fitting, initial impacts may be less severe and will accrue over longer periods as novel symbiotic associations and/or adaptations may require fine-tuning over time. Co-introduction will have more profound impacts that will accrue more rapidly as a result of positive feedbacks between densities of non-native rhizobia and their coevolved host plants, in turn enhancing competition between native and non-native rhizobia. Co-introduction can further impact invasion outcomes by the exchange of genetic material between native and non-native rhizobia, potentially resulting in decreased fitness of native legumes. A better understanding of the roles of these two pathways in the invasion dynamics of non-native legumes is much needed, and we highlight some of the exciting research avenues it presents. © 2017 The Authors. New Phytologist © 2017 New Phytologist Trust.
A Dicarboxylate Transporter, LjALMT4, Mainly Expressed in Nodules of Lotus japonicus.
Takanashi, Kojiro; Sasaki, Takayuki; Kan, Tomohiro; Saida, Yuka; Sugiyama, Akifumi; Yamamoto, Yoko; Yazaki, Kazufumi
2016-07-01
Legume plants can establish symbiosis with soil bacteria called rhizobia to obtain nitrogen as a nutrient directly from atmospheric N2 via symbiotic nitrogen fixation. Legumes and rhizobia form nodules, symbiotic organs in which fixed-nitrogen and photosynthetic products are exchanged between rhizobia and plant cells. The photosynthetic products supplied to rhizobia are thought to be dicarboxylates but little is known about the movement of dicarboxylates in the nodules. In terms of dicarboxylate transporters, an aluminum-activated malate transporter (ALMT) family is a strong candidate responsible for the membrane transport of carboxylates in nodules. Among the seven ALMT genes in the Lotus japonicus genome, only one, LjALMT4, shows a high expression in the nodules. LjALMT4 showed transport activity in a Xenopus oocyte system, with LjALMT4 mediating the efflux of dicarboxylates including malate, succinate, and fumarate, but not tricarboxylates such as citrate. LjALMT4 also mediated the influx of several inorganic anions. Organ-specific gene expression analysis showed LjALMT4 mRNA mainly in the parenchyma cells of nodule vascular bundles. These results suggest that LjALMT4 may not be involved in the direct supply of dicarboxylates to rhizobia in infected cells but is responsible for supplying malate as well as several anions necessary for symbiotic nitrogen fixation, via nodule vasculatures.
Diversity and Efficiency of Rhizobia Communities from Iron Mining Areas Using Cowpea as a Trap Plant
Directory of Open Access Journals (Sweden)
Jordana Luísa de Castro
2017-08-01
Full Text Available ABSTRACT Mining is an important economic activity. However, its impact on environment must be accessed, mainly on relevant processes for their sustainability. The objective of this study was to evaluate the diversity and efficiency of symbiotic nitrogen fixing bacterial communities in soils under different types of vegetation in the Quadrilátero Ferrífero: ironstone outcrops, Atlantic Forest, neotropical savanna, and a rehabilitated area revegetated with grass. Suspensions of soil samples collected under each type of vegetation were made in a saline solution to capture rhizobia communities that were then inoculated on cowpea [Vigna unguiculata (L. Walp.], which was used as a trap plant. The symbiotic efficiency of the communities was evaluated in a greenhouse experiment and the data obtained were correlated to the chemical and physical properties of the soils under each type of vegetation. At the end of the experiment, the bacteria present in the nodules were isolated to evaluate their diversity. The highest numbers of nodules occurred in the treatment inoculated with soil samples from rehabilitated area revegetated with grass and neotropical savanna vegetation, and the lowest numbers were observed in the treatment inoculated with soil samples from ironstone outcrops and Atlantic Forest. In relation to root dry matter, the treatment inoculated with soil samples from Neotropical savanah was superior to those inoculated with soil samples from the other areas; already, in relation to the shoot dry matter, no significant difference among the treatments was observed. The soil properties with the greatest influence on the microbial communities were Al3+ content, considered as high in the Atlantic Forest and neotropical savanna vegetation, as intermediate in the iron outcrops, and as very low in the rehabilitated area revegetated with grass; organic matter, considered as very high in the ironstone outcrops and neotropical savanna, as high in the
Withana-Gamage, Thushan S; Wanasundara, Janitha P D; Pietrasik, Zeb; Shand, Phyllis J
2011-04-01
Chickpea (Cicer arietinum L.) seeds are a good source of protein that has potential applications in new product formulation and fortification. The main objectives of this study were to analyse the physicochemical, thermal and functional properties of chickpea protein isolates (CPIs) and compare them with those of soy (SPI) and pea (PPI) protein isolates. Extracted CPIs had mean protein contents of 728-853 g kg(-1) (dry weight basis). Analysis of their deconvoluted Fourier transform infrared spectra gave secondary structure estimates of 25.6-32.7% α-helices, 32.5-40.4% β-sheets, 13.8-18.9% turns and 16.3-19.2% disordered structures. CPIs from CDC Xena, among Kabuli varieties, and Myles, among Desi varieties, as well as SPI had the highest water-holding and oil absorption capacities. The emulsifying properties of Kabuli CPIs were superior to those of PPI and Desi CPIs and as good as those of SPI. The heat-induced gelation properties of CPIs showed a minimum protein concentration required to form a gel structure ranging from 100 to 140 g L(-1) . Denaturation temperatures and enthalpies of CPIs ranged from 89.0 to 92.0 °C and from 2.4 to 4.0 J g(-1) respectively. The results suggest that most physicochemical, thermal and functional properties of CPIs compare favourably with those of SPI and are better than those of PPI. Hence CPI may be suitable as a high-quality substitute for SPI in food applications. Copyright © 2011 Society of Chemical Industry.
Rahman, Md Mahbubur; Kim, Hyun-Kyu; Kim, Seong-Eun; Kim, Myung-Jin; Kim, Do-Hyung; Lee, Hak Sung
2018-03-15
The aim of this study was to investigate the chondroprotective effect of a standardized extract (KBH-JP-040) of the Korean traditional herbs Kalopanax pictus Castor-Aralia, Hericium erinaceus (Bull.) Persoon, and Astragalus membranaceus Schischkin on in vivo and in vitro osteoarthritis (OA) models. Cultured rat chondrocytes were pre-treated with KBH-JP-040 (50, 100 and 200 μg/mL) for 1 h, then recombinant human IL-1α (rhIL-1α) for 24 h. For the in vivo model, rabbits ( n = 60) were equally divided into experimental groups: normal control (NC), a collagenase-induced OA group, and OA groups treated with KBH-JP-040 (75, 100, and 150 mg/kg body weight) and celecoxib (Cx, 100 mg/kg) orally for 28 days. Treatment with KBH-JP-040 significantly attenuated inflammatory cytokines and matrix metalloproteinases (MMPs), suppressed the expression of IκBα, NF-κB, and JNK/p38 mitogen-activated protein (MAP) kinase, and upregulated aggrecan and collagen type-II expression in rhIL-1α-stimulated chondrocytes. Furthermore, the serum and synovial levels of inflammatory cytokines of rabbits also decreased in the treatment groups when compared with the OA group. Improved magnetic resonance imaging and histopathological findings further confirmed the therapeutic efficacy of KBH-JP-040 against OA. In conclusion, these results indicate that KBH-JP-040 possesses chondroprotective effects, suppressing inflammation and MMPs, and downregulating IκBα, NF-κB, and JNK/p38 MAP kinase-signaling pathways. This might be a potential therapeutic candidate for OA treatment.
Directory of Open Access Journals (Sweden)
Md. Mahbubur Rahman
2018-03-01
Full Text Available The aim of this study was to investigate the chondroprotective effect of a standardized extract (KBH-JP-040 of the Korean traditional herbs Kalopanax pictus Castor-Aralia, Hericium erinaceus (Bull. Persoon, and Astragalus membranaceus Schischkin on in vivo and in vitro osteoarthritis (OA models. Cultured rat chondrocytes were pre-treated with KBH-JP-040 (50, 100 and 200 μg/mL for 1 h, then recombinant human IL-1α (rhIL-1α for 24 h. For the in vivo model, rabbits (n = 60 were equally divided into experimental groups: normal control (NC, a collagenase-induced OA group, and OA groups treated with KBH-JP-040 (75, 100, and 150 mg/kg body weight and celecoxib (Cx, 100 mg/kg orally for 28 days. Treatment with KBH-JP-040 significantly attenuated inflammatory cytokines and matrix metalloproteinases (MMPs, suppressed the expression of IκBα, NF-κB, and JNK/p38 mitogen-activated protein (MAP kinase, and upregulated aggrecan and collagen type-II expression in rhIL-1α-stimulated chondrocytes. Furthermore, the serum and synovial levels of inflammatory cytokines of rabbits also decreased in the treatment groups when compared with the OA group. Improved magnetic resonance imaging and histopathological findings further confirmed the therapeutic efficacy of KBH-JP-040 against OA. In conclusion, these results indicate that KBH-JP-040 possesses chondroprotective effects, suppressing inflammation and MMPs, and downregulating IκBα, NF-κB, and JNK/p38 MAP kinase-signaling pathways. This might be a potential therapeutic candidate for OA treatment.
Kumar, Kamal; Srivastava, Vikas; Purayannur, Savithri; Kaladhar, V Chandra; Cheruvu, Purnima Jaiswal; Verma, Praveen Kumar
2016-06-01
The WRKY genes have been identified as important transcriptional modulators predominantly during the environmental stresses, but they also play critical role at various stages of plant life cycle. We report the identification of WRKY domain (WD)-encoding genes from galegoid clade legumes chickpea (Cicer arietinum L.) and barrel medic (Medicago truncatula). In total, 78 and 98 WD-encoding genes were found in chickpea and barrel medic, respectively. Comparative analysis suggests the presence of both conserved and unique WRKYs, and expansion of WRKY family in M. truncatula primarily by tandem duplication. Exclusively found in galegoid legumes, CaWRKY16 and its orthologues encode for a novel protein having a transmembrane and partial Exo70 domains flanking a group-III WD. Genomic region of galegoids, having CaWRKY16, is more dynamic when compared with millettioids. In onion cells, fused CaWRKY16-EYFP showed punctate fluorescent signals in cytoplasm. The chickpea WRKY group-III genes were further characterized for their transcript level modulation during pathogenic stress and treatments of abscisic acid, jasmonic acid, and salicylic acid (SA) by real-time PCR. Differential regulation of genes was observed during Ascochyta rabiei infection and SA treatment. Characterization of A. rabiei and SA inducible gene CaWRKY50 showed that it localizes to plant nucleus, binds to W-box, and have a C-terminal transactivation domain. Overexpression of CaWRKY50 in tobacco plants resulted in early flowering and senescence. The in-depth comparative account presented here for two legume WRKY genes will be of great utility in hastening functional characterization of crop legume WRKYs and will also help in characterization of Exo70Js. © The Author 2016. Published by Oxford University Press on behalf of Kazusa DNA Research Institute.
Zhuang, Mengjie; Liu, Dan; Chen, Yanwen; Ming, Haixia; Li, Yang
2017-04-01
Objective To observe the effect of Astragalus polysaccharides (APS) combined with cisplatin (DDP) on the expressions of cytochrome C (CytC) and high temperature required serine protease A2 (Omi/HtrA2) in the mice with Lewis lung carcinoma (LLC) transplantated tumors. Methods Ninty C57BL/6J mice were randomly divided into normal control group, model group, and (50, 100, 200) μg/mL APS groups, 6 mg/kg DDP group, 3 mg/kg DDP combined with (50, 100, 200) μg/mL APS groups. Each group included 10 mice. Except the mice in the normal group, the rest mice were inoculated subcutaneously with LLC cells (1×10 7 mL) at the right fore axillary fossa to establish tumor-bearing mouse models. In the second day of building models, the mice in the treatment group were given intraperitoneal injection of 0.3 mL of the drug. DDP was given once a week, and the other drugs once a day. The mice in the normal group and the model group were administrated the same amount of saline injection for continuous 20 days. All mice were killed at the 21st day. The pathological changes of tumor tissues were observed by HE staining. The expressions and location of CytC and Omi/HtrA2 proteins in the transplanted tumor tissues were detected by immunohistochemical staining and image analysis. Results The mass of tumor decreased in the mice of (100, 200) μg/mL APS group and 3 mg/kg DDP combined with (100, 200) μg/mL APS group. Compared with the model group, the necrosis of tumor tissues in 200 μg/mL APS combined with 3 mg/kg DDP group was the most obvious. The expressions of CytC and Omi/HtrA2 increased in the treatment groups, and the increase was the most remarkable in 200 μg/mL APS combined with 3 mg/kg DDP group. Conclusion APS and APS combined with DDP can restrain the growth of Lewis Lung cancer in C57BL/6J mice, which may be related to the increased expressions of CytC and Omi/HtrA2.
Directory of Open Access Journals (Sweden)
Qin-she Liu
Full Text Available Both total astragalus saponins (AST and it's main component astragaloside IV (ASIV have been used in China as cardiovascular protective medicines. However, the anti-inflammatory activities that are beneficial for cardiovascular health have never been compared directly and the molecular mechanisms remain unresolved. This study was conducted to compare the inhibitory effects of these drugs on TNFα-induced cell responses, related signaling pathways, and the underlying mechanisms in mouse arterial endothelial cells.Real-time qRT-PCR was performed to determine the expression of cell adhesion molecule (CAM genes. Immunofluorescent staining was used to detect the nuclear translocation of transcription factor NF-κB-p65. Western Blot analysis was used to identify TNFα-induced NF-κB-p65 phosphorylation, IκBα degradation, and caspase-3 cleavage. Cell surface proteins were isolated and TNFα receptor-1(TNFR1 expression was determined. The results suggest that both AST and ASIV attenuate TNFα-induced up-regulation of CAMs mRNA and upstream nuclear translocation and phosphorylation of NF-κB-p65. However, TNFR1-mediated IκBα degradation, cleavage of caspase-3 and apoptosis were inhibited only by AST. These differences in the actions of AST and ASIV could be explained by the presence of other components in AST, such as ASII and ASIII, which also had an inhibitory effect on TNFR1-induced IκBα degradation. Moreover, AST, but not ASIV, was able to reduce TNFR1 protein level on the cell surface. Furthermore, mechanistic investigation demonstrated that TNFR1-mediated IκBα degradation was reversed by the use of TAPI-0, an inhibitor of TNFα converting enzyme (TACE, suggesting the involvement of TACE in the modulation of surface TNFR1 level by AST.ASIV was not a better inhibitor than AST, at least on the inhibition of TNFα-induced inflammatory responses and TNFR1-mediated signaling pathways in AECs. The inhibitory effect of AST was caused by the
Directory of Open Access Journals (Sweden)
Elena A. Dolgikh
2017-12-01
Full Text Available Background. Rhizobial Nod factors (NFs, the key regulators of legume-rhizobia symbiosis, act in low concentrations and their biological activity depends on structural features, that suggests the presence of specific receptors in plants. Putative receptors, LysM-receptor-like kinases (LysM-RLKs, were found in model legumes L. japonicus and M. truncatula. However, binding capacity with NFs was only studied for L. japonicus LysM-RLKs. In pea a few candidates for NF receptors like Sym10, Sym37 and K1 were found. Analysis of mutants revealed the importance of these proteins for symbiosis development. However, the biochemical function of these receptors has not been studied. Materials and methods. Sequences encoding extracellular domains (ECDs of LysM-RLKs Sym10, Sym37, and K1 were cloned in the pRSETa vector. Constructs were introduced in E. coli strain C41 to produce proteins with His6 residues on either the amino or carboxyl terminus. Protein purification was carried out using metal chelate affinity chromatography. The binding capacity with ligand was evaluated using ProteonXPR36 biosensor. Results. To study binding capacity with NFs, we have developed approaches for the synthesis of LysM-RLK Sym10, Sym37 and K1 in soluble form in heterologous system. The high level of protein synthesis was achieved at +28 °C using 0,5 mM IPTG in 2-16 hours. Analysis of binding capacity of ECDs with NFs revealed the low affinity using the surface plasmon resonance. Conclusion. The possibility of recombinant receptor synthesis in soluble state in E. coli at high level was demonstrated. Analysis of binding capacity with NFs showed the potential interaction, but with low affinity.
African Journals Online (AJOL)
Insaf
2013-04-24
Apr 24, 2013 ... Ghab4 varieties were more tolerant, to cold temperature, than the other varieties. ... induced by PEG 4000 had significant effects on seeds germination. ... Key words: Chickpea, thermal stress, drought stress, germination.
Directory of Open Access Journals (Sweden)
Parvaiz eAhmad
2016-04-01
Full Text Available The present work was conducted to examine the role of exogenously applied calcium (Ca; 50 mM and potassium (K; 10 mM (alone and in combination in alleviating the negative effects of cadmium (Cd; 200 μM on growth, biochemical attributes, secondary metabolites and yield of chickpea (Cicer arietinum L.. Cd stress significantly decreased length and fresh and dry weight of shoot and root, and number of pods and seed yield (vs. control. Exhibition of decreases in chlorophyll (Chl a, Chl b, and total Chl was also observed with Cd-exposure when compared to control. However, Cd-exposure led to an increase in the content of carotenoid. In contrast, the exogenous application of Ca and K individually as well as in combination minimized the extent of Cd-impact on previous traits. C. arietinum seedlings subjected to Cd treatment exhibited increased contents of organic solute (proline, Pro and total protein; whereas, Ca and K-supplementation further enhanced the Pro and total protein content. Additionally, compared to control, Cd-exposure also caused elevation in the contents of oxidative stress markers (hydrogen peroxidase, H2O2; malondialdehyde, MDA and in the activity of antioxidant defense enzymes (superoxide dismutase, SOD; catalase, CAT; ascorbate peroxidase, APX; glutathione reductase, GR. Ca, K and Ca + K supplementation caused further enhancements in the activity of these enzymes but significantly decreased contents of H2O2 and MDA, also that of Cd in shoot and root. The contents of total phenol, flavonoid and mineral elements (S, Mn, Mg, Ca and K that were also suppressed in Cd stressed plants in both shoot and root were restored to appreciable levels with Ca- and K-supplementation. However, the combination of Ca + K supplementation was more effective in bringing the positive response as compared to individual effect of Ca and K on Cd-exposed C. arietinum. Overall, this investigation suggests that application of Ca and/or K can efficiently minimize
Domonkos, Ágota; Kovács, Szilárd; Gombár, Anikó; Kiss, Ernő; Horváth, Beatrix; Kováts, Gyöngyi Z.; Farkas, Attila; Tóth, Mónika T.; Ayaydin, Ferhan; Bóka, Károly; Fodor, Lili; Endre, Gabriella; Kaló, Péter
2017-01-01
Legumes form endosymbiotic interaction with host compatible rhizobia, resulting in the development of nitrogen-fixing root nodules. Within symbiotic nodules, rhizobia are intracellularly accommodated in plant-derived membrane compartments, termed symbiosomes. In mature nodule, the massively colonized cells tolerate the existence of rhizobia without manifestation of visible defense responses, indicating the suppression of plant immunity in the nodule in the favur of the symbiotic partner. Medicago truncatula DNF2 (defective in nitrogen fixation 2) and NAD1 (nodules with activated defense 1) genes are essential for the control of plant defense during the colonization of the nitrogen-fixing nodule and are required for bacteroid persistence. The previously identified nodule-specific NAD1 gene encodes a protein of unknown function. Herein, we present the analysis of novel NAD1 mutant alleles to better understand the function of NAD1 in the repression of immune responses in symbiotic nodules. By exploiting the advantage of plant double and rhizobial mutants defective in establishing nitrogen-fixing symbiotic interaction, we show that NAD1 functions following the release of rhizobia from the infection threads and colonization of nodule cells. The suppression of plant defense is self-dependent of the differentiation status of the rhizobia. The corresponding phenotype of nad1 and dnf2 mutants and the similarity in the induction of defense-associated genes in both mutants suggest that NAD1 and DNF2 operate close together in the same pathway controlling defense responses in symbiotic nodules. PMID:29240711
Directory of Open Access Journals (Sweden)
Ágota Domonkos
2017-12-01
Full Text Available Legumes form endosymbiotic interaction with host compatible rhizobia, resulting in the development of nitrogen-fixing root nodules. Within symbiotic nodules, rhizobia are intracellularly accommodated in plant-derived membrane compartments, termed symbiosomes. In mature nodule, the massively colonized cells tolerate the existence of rhizobia without manifestation of visible defense responses, indicating the suppression of plant immunity in the nodule in the favur of the symbiotic partner. Medicago truncatula DNF2 (defective in nitrogen fixation 2 and NAD1 (nodules with activated defense 1 genes are essential for the control of plant defense during the colonization of the nitrogen-fixing nodule and are required for bacteroid persistence. The previously identified nodule-specific NAD1 gene encodes a protein of unknown function. Herein, we present the analysis of novel NAD1 mutant alleles to better understand the function of NAD1 in the repression of immune responses in symbiotic nodules. By exploiting the advantage of plant double and rhizobial mutants defective in establishing nitrogen-fixing symbiotic interaction, we show that NAD1 functions following the release of rhizobia from the infection threads and colonization of nodule cells. The suppression of plant defense is self-dependent of the differentiation status of the rhizobia. The corresponding phenotype of nad1 and dnf2 mutants and the similarity in the induction of defense-associated genes in both mutants suggest that NAD1 and DNF2 operate close together in the same pathway controlling defense responses in symbiotic nodules.
Domonkos, Ágota; Kovács, Szilárd; Gombár, Anikó; Kiss, Ernő; Horváth, Beatrix; Kováts, Gyöngyi Z; Farkas, Attila; Tóth, Mónika T; Ayaydin, Ferhan; Bóka, Károly; Fodor, Lili; Ratet, Pascal; Kereszt, Attila; Endre, Gabriella; Kaló, Péter
2017-12-14
Legumes form endosymbiotic interaction with host compatible rhizobia, resulting in the development of nitrogen-fixing root nodules. Within symbiotic nodules, rhizobia are intracellularly accommodated in plant-derived membrane compartments, termed symbiosomes. In mature nodule, the massively colonized cells tolerate the existence of rhizobia without manifestation of visible defense responses, indicating the suppression of plant immunity in the nodule in the favur of the symbiotic partner. Medicago truncatula DNF2 (defective in nitrogen fixation 2) and NAD1 (nodules with activated defense 1) genes are essential for the control of plant defense during the colonization of the nitrogen-fixing nodule and are required for bacteroid persistence. The previously identified nodule-specific NAD1 gene encodes a protein of unknown function. Herein, we present the analysis of novel NAD1 mutant alleles to better understand the function of NAD1 in the repression of immune responses in symbiotic nodules. By exploiting the advantage of plant double and rhizobial mutants defective in establishing nitrogen-fixing symbiotic interaction, we show that NAD1 functions following the release of rhizobia from the infection threads and colonization of nodule cells. The suppression of plant defense is self-dependent of the differentiation status of the rhizobia. The corresponding phenotype of nad1 and dnf2 mutants and the similarity in the induction of defense-associated genes in both mutants suggest that NAD1 and DNF2 operate close together in the same pathway controlling defense responses in symbiotic nodules.
Directory of Open Access Journals (Sweden)
Erping Xu
2017-05-01
Full Text Available Our purpose is to study the effect of different component ratio of Astragalus Total Saponins (ATS and Verbena Total Glycosides (VTG on the cerebral infarction area and the serum biochemical indicators in the focal cerebral ischemia-reperfusion rat model. Compared with the model group, different component ratio of ATS and VTG could significantly improve the neurological deficit scores to the focal cerebral ischemia-reperfusion rat model, and the group of 7:3, 6:4, 5:5 got the best results; it could reduce the mortality of rat model to a certain extent, and the group of 5:5 group got the best results; it can significantly reduce the cerebral infarction area, and the group of 7:3, 5:5, 4:6 got the best results; it could significantly reduce the content of TNF-α, and the group of 8:2, 6:4 got the best results; it could significantly reduce the content of NO, and the group of 7:3, 5:5 got the best results; it could significantly increase the content of SOD, and the group of 6:4, 5:5 got the best results. This indicates that different component ratio of ATS and VTG may protect the damage of focal cerebral ischemia-reperfusion rat model to a certain extent, which are compared using the comprehensive weight method and the ratio of 5:5 was proved to be the optimal active ratio.
Directory of Open Access Journals (Sweden)
Akbar Shabani
2018-06-01
Full Text Available Introduction Chickpea (Cicer arietinum L. is an annual grain legume or “pulse crop” that is 2th legume after soybean in the world and was cultivated in 60 country. Legume, spatially chickpea is the most important tolerant crop in arid and semi-arid country in western of Asia such as Iran. Chickpea can growth in poor soil and undesirable environment conditions. Drought is an important factors that influencing chickpea production and quality. As area of cultivation is in dryland conditions thus aim of researches is reach to tolerant genotypes. The objective of current study was to evaluate the genetic variation and drought resistance advanced genotypes in chickpea Materials and methods For investigation of genetic variation and drought resistance, 64 advanced genotypes were evaluated in a simple latis (LD with two replications under normal and drought stress conditions in deputy of Dryland Agricultural Research Institute of Kermanshah during 2013-2014 cropping season. Plant spacing was as plots with four rows in 4 m in length, 30 cm apart. The seed were sowed in row with 10 cm distance and the seeding rate was 33 seeds per m2 for all plots. At maturity stage after separation of border effects from each plot, grain yield was measured. Statistical analysis was performed using SAS, SPSS and STATISTICA packages. some drought resistance indices such as mean productivity (MP, geometric mean productivity (GMP, harmonic mean (HAM, stress tolerance index (STI, stress susceptibility index (SSI, yield index (YI, K1 and K2 were measured based on yield in both conditions. Also we used stress tolerance score (STS method for selection genotypes according to all indices. Results and discussion Study on correlation between Yp, Ys and drought resistance indices showed that Yp and Ys had positive and significant correlated with MP, GMP, STI, YI, HAM, K1 and K2 thus these indices were the most suitable drought tolerance criteria for screening of chickpea
Directory of Open Access Journals (Sweden)
Ashok Kumar Tiwari
2013-01-01
Full Text Available Introduction: Consumption of highly processed calories dense diet leads abrupt increase in postprandial blood glucose level, which in turn induces immediate oxidative stress. Postprandial hyperglycemia (PPHG and resultant oxidative stress is one of the earliest detectable abnormalities in diabetes prone individuals, independent risk factor for development of cardiovascular disorders (CVD, a major pathophysiological link between diabetes and CVD and an important contributing factor in atherogenesis even in non-diabetic individuals. Therefore, dietary supplements mitigating PPHG spikes along with potent antioxidant activities may help decrease development of PPHG and oxidative stress induced pathogenesis. Objectives: The study evaluated free radicals scavenging, antioxidant properties and intestinal α-glucosidase inhibitory activity in methanol extract of two varieties of Cicer arietinum Linn viz. Bengal gram and Kabuli chana and green gram (Vigna radiata Linn. Wilczek raw grains and their sprouts and studied their influence on starch-induced postprandial glycemic excursion in rats. Materials and Methods: Healthy grains were procured from local markets. Free radicals scavenging antioxidant and glucose-induced hemoglobin (Hb-glycation inhibition activities were analyzed using standard in vitro procedures. In vitro antihyperglycemic activity was evaluated by assessing rat intestinal α-glucosidase inhibitory activity. Influence on starch-induced postprandial glycemic excursion in rats was studied by pre-treatment of rats with extracts. Results: Compared with raw seeds increase in total polyphenol and flavonoids concentration in green gram sprouts and Kabuli chana sprouts (KCs were observed. Total protein concentrations in sprouts did not differ from non-sprouted grains. 2,2′- Azinobis (3-ethyl benzthiazoline-6-sulphonic acid cation scavenging activity was more than twice in Bengal gram sprouts of (BGs and KCs than their raw seeds. 2,2-diphenyl-1
Tatsukami, Yohei; Nambu, Mami; Morisaka, Hironobu; Kuroda, Kouichi; Ueda, Mitsuyoshi
2013-07-31
Rhizobia are symbiotic nitrogen-fixing soil bacteria that show a symbiotic relationship with their host legume. Rhizobia have 2 different physiological conditions: a free-living condition in soil, and a symbiotic nitrogen-fixing condition in the nodule. The lifestyle of rhizobia remains largely unknown, although genome and transcriptome analyses have been carried out. To clarify the lifestyle of bacteria, proteome analysis is necessary because the protein profile directly reflects in vivo reactions of the organisms. In proteome analysis, high separation performance is required to analyze complex biological samples. Therefore, we used a liquid chromatography-tandem mass spectrometry system, equipped with a long monolithic silica capillary column, which is superior to conventional columns. In this study, we compared the protein profile of Mesorhizobium loti MAFF303099 under free-living condition to that of symbiotic conditions by using small amounts of crude extracts. We identified 1,533 and 847 proteins for M. loti under free-living and symbiotic conditions, respectively. Pathway analysis by Kyoto Encyclopedia of Genes and Genomes (KEGG) revealed that many of the enzymes involved in the central carbon metabolic pathway were commonly detected under both conditions. The proteins encoded in the symbiosis island, the transmissible chromosomal region that includes the genes that are highly upregulated under the symbiotic condition, were uniquely detected under the symbiotic condition. The features of the symbiotic condition that have been reported by transcriptome analysis were confirmed at the protein level by proteome analysis. In addition, the genes of the proteins involved in cell surface structure were repressed under the symbiotic nitrogen-fixing condition. Furthermore, farnesyl pyrophosphate (FPP) was found to be biosynthesized only in rhizobia under the symbiotic condition. The obtained protein profile appeared to reflect the difference in phenotypes under the
Garg, Neera; Bhandari, Purnima
2016-09-01
Salinity is the major environmental constraint that affects legume productivity by inducing oxidative stress. Individually, both silicon (Si) nutrition and mycorrhization have been reported to alleviate salt stress. However, the mechanisms adopted by both in mediating stress responses are poorly understood. Thus, pot trials were undertaken to evaluate comparative as well as interactive effects of Si and/or arbuscular mycorrhiza (AM) in alleviating NaCl toxicity in modulating oxidative stress and antioxidant defence mechanisms in two Cicer arietinum L. (chickpea) genotypes-HC 3 (salt-tolerant) and CSG 9505 (salt-sensitive). Plants subjected to different NaCl concentrations (0-100 mM) recorded a substantial increase in the rate of superoxide radical (O2 (·-)), H2O2, lipoxygenase (LOX) activity and malondialdehyde (MDA) content, which induced leakage of ions and disturbed Ca(2+)/Na(+) ratio in roots and leaves. Individually, Si and AM reduced oxidative burst by strengthening antioxidant enzymatic activities (superoxide dismutase (SOD), catalase (CAT) and guaiacol peroxidase (GPOX)). Si was relatively more efficient in reducing accumulation of stress metabolites, while mycorrhization significantly up-regulated antioxidant machinery and modulated ascorbate-glutathione (ASA-GSH) cycle. Combined applications of Si and AM complemented each other in reducing reactive oxygen species (ROS) build-up by further enhancing the antioxidant defence responses. Magnitude of ROS-mediated oxidative burden was lower in HC 3 which correlated strongly with more effective AM symbiosis, better capacity to accumulate Si and stronger defence response when compared with CSG 9505. Study indicated that Si and/or AM fungal amendments upgraded salt tolerance through a dynamic shift from oxidative destruction towards favourable antioxidant defence system in stressed chickpea plants.
Protein (Viridiplantae): 128879 [PGDBj - Ortholog DB
Lifescience Database Archive (English)
Full Text Available 5:248 3803:248 ... 3814:248 ... 163722:3689 ... 3826:3689 ... 3827:3689 ... PREDICTED: uncharacterized protein LOC101515541 Cicer arietinum MNSSTI...CSLFLGLILISQSANAKGHGGGLVVTICKGATDRAACENILGSNSEISHAKSFSQL
A novel symbiovar (aegeanense) of the genus Ensifer nodulates Vigna unguiculata.
Tampakaki, Anastasia P; Fotiadis, Christos T; Ntatsi, Georgia; Savvas, Dimitrios
2017-10-01
Cowpea (Vigna unguiculata) forms nitrogen-fixing root nodules with diverse symbiotic bacteria, mainly slow-growing rhizobial species belonging to the genus Bradyrhizobium, although a few studies have reported the isolation of fast-growing rhizobia under laboratory and field conditions. Although much research has been done on cowpea-nodulating bacteria in various countries around the world, very limited information is available on cowpea rhizobia in European soils. The aim of this study was to study the genetic and phenotypic diversity of indigenous cowpea-nodulating rhizobia in Greece. The genetic diversity of indigenous rhizobia associated with cowpea was investigated through a polyphasic approach. ERIC-PCR based fingerprinting analysis grouped the isolates into three groups. Based on the analysis of the 16S rRNA genes, IGS and on the concatenation of six housekeeping genes (recA, glnII, gyrB, truA, thrA and SMc00019), rhizobial isolates were classified within the species Ensifer fredii. However, symbiotic gene phylogenies, based on nodC, nifH and rhcRST genes, showed that the Ensifer isolates are markedly diverged from type and reference strains of E. fredii and formed one clearly separate cluster. The E. fredii strains were able to nodulate and fix nitrogen in cowpea but not in soybean and common bean. The present study showed that cowpea is nodulated under field conditions by fast-growing rhizobia belonging to the species E. fredii. Based on the phylogenies, similarity levels of symbiotic genes and the host range, the Ensifer isolates may constitute a new symbiovar for which the name 'aegeanense' is proposed. © 2017 Society of Chemical Industry. © 2017 Society of Chemical Industry.
Melkonian, Rémy; Moulin, Lionel; Béna, Gilles; Tisseyre, Pierre; Chaintreuil, Clémence; Heulin, Karine; Rezkallah, Naïma; Klonowska, Agnieszka; Gonzalez, Sophie; Simon, Marcelo; Chen, Wen-Ming; James, Euan K; Laguerre, Gisèle
2014-07-01
Variations in the patterns of diversity of symbionts have been described worldwide on Mimosa pudica, a pan-tropical invasive species that interacts with both α and β-rhizobia. In this study, we investigated if symbiont competitiveness can explain these variations and the apparent prevalence of β- over α-rhizobia. We developed an indirect method to measure the proportion of nodulation against a GFP reference strain and tested its reproducibility and efficiency. We estimated the competitiveness of 54 strains belonging to four species of β-rhizobia and four of α-rhizobia, and the influence of the host genotype on their competitiveness. Our results were compared with biogeographical patterns of symbionts and host varieties. We found: (i) a strong strain effect on competitiveness largely explained by the rhizobial species, with Burkholderia phymatum being the most competitive species, followed by B. tuberum, whereas all other species shared similar and reduced levels of competitiveness; (ii) plant genotype can increase the competitiveness of Cupriavidus taiwanensis. The latter data support the likelihood of the strong adaptation of C. taiwanensis with the M. pudica var. unijuga and help explain its prevalence as a symbiont of this variety over Burkholderia species in some environments, most notably in Taiwan. © 2013 Society for Applied Microbiology and John Wiley & Sons Ltd.
Sene, Godar; Thiao, Mansour; Samba-Mbaye, Ramatoulaye; Khasa, Damase; Kane, Aboubacry; Mbaye, Mame Samba; Beaulieu, Marie-Ève; Manga, Anicet; Sylla, Samba Ndao
2013-01-01
Several fast-growing and multipurpose tree species have been widely used in West Africa to both reverse the tendency of land degradation and restore soil productivity. Although beneficial effects have been reported on soil stabilization, there still remains a lack of information about their impact on soil microorganisms. Our investigation has been carried out in exotic and native tree plantations of 28 years and aimed to survey and compare the abundance and genetic diversity of natural legume-nodulating rhizobia (LNR). The study of LNR is supported by the phylogenetic analysis which clustered the isolates into three genera: Bradyrhizobium, Mesorhizobium, and Sinorhizobium. The results showed close positive correlations between the sizes of LNR populations estimated both in the dry and rainy seasons and the presence of legume tree hosts. There were significant increases in Rhizobium spp. population densities in response to planting with Acacia spp., and high genetic diversities and richness of genotypes were fittest in these tree plantations. This suggests that enrichment of soil Rhizobium spp. populations is host specific. The results indicated also that species of genera Mesorhizobium and Sinorhizobium were lacking in plantations of non-host species. By contrast, there was a widespread distribution of Bradyrhizobium spp. strains across the tree plantations, with no evident specialization in regard to plantation type. Finally, the study provides information about the LNR communities associated with a range of old tree plantations and some aspects of their relationships to soil factors, which may facilitate the management of man-made forest systems that target ecosystem rehabilitation and preservation of soil biota.
Directory of Open Access Journals (Sweden)
Shokeen Bhumika
2011-02-01
Full Text Available Abstract Background Chickpea (Cicer arietinum L. is an economically important cool season grain legume crop that is valued for its nutritive seeds having high protein content. However, several biotic and abiotic stresses and the low genetic variability in the chickpea genome have continuously hindered the chickpea molecular breeding programs. STMS (Sequence Tagged Microsatellite Sites markers which are preferred for the construction of saturated linkage maps in several crop species, have also emerged as the most efficient and reliable source for detecting allelic diversity in chickpea. However, the number of STMS markers reported in chickpea is still limited and moreover exhibit low rates of both inter and intraspecific polymorphism, thereby limiting the positions of the SSR markers especially on the intraspecific linkage maps of chickpea. Hence, this study was undertaken with the aim of developing additional STMS markers and utilizing them for advancing the genetic linkage map of chickpea which would have applications in QTL identification, MAS and for de novo assembly of high throughput whole genome sequence data. Results A microsatellite enriched library of chickpea (enriched for (GT/CAn and (GA/CTn repeats was constructed from which 387 putative microsatellite containing clones were identified. From these, 254 STMS primers were designed of which 181 were developed as functional markers. An intraspecific mapping population of chickpea, [ICCV-2 (single podded × JG-62 (double podded] and comprising of 126 RILs, was genotyped for mapping. Of the 522 chickpea STMS markers (including the double-podding trait, screened for parental polymorphism, 226 (43.3% were polymorphic in the parents and were used to genotype the RILs. At a LOD score of 3.5, eight linkage groups defining the position of 138 markers were obtained that spanned 630.9 cM with an average marker density of 4.57 cM. Further, based on the common loci present between the current map
Gaur, Rashmi; Sethy, Niroj K; Choudhary, Shalu; Shokeen, Bhumika; Gupta, Varsha; Bhatia, Sabhyata
2011-02-17
Chickpea (Cicer arietinum L.) is an economically important cool season grain legume crop that is valued for its nutritive seeds having high protein content. However, several biotic and abiotic stresses and the low genetic variability in the chickpea genome have continuously hindered the chickpea molecular breeding programs. STMS (Sequence Tagged Microsatellite Sites) markers which are preferred for the construction of saturated linkage maps in several crop species, have also emerged as the most efficient and reliable source for detecting allelic diversity in chickpea. However, the number of STMS markers reported in chickpea is still limited and moreover exhibit low rates of both inter and intraspecific polymorphism, thereby limiting the positions of the SSR markers especially on the intraspecific linkage maps of chickpea. Hence, this study was undertaken with the aim of developing additional STMS markers and utilizing them for advancing the genetic linkage map of chickpea which would have applications in QTL identification, MAS and for de novo assembly of high throughput whole genome sequence data. A microsatellite enriched library of chickpea (enriched for (GT/CA)n and (GA/CT)n repeats) was constructed from which 387 putative microsatellite containing clones were identified. From these, 254 STMS primers were designed of which 181 were developed as functional markers. An intraspecific mapping population of chickpea, [ICCV-2 (single podded) × JG-62 (double podded)] and comprising of 126 RILs, was genotyped for mapping. Of the 522 chickpea STMS markers (including the double-podding trait, screened for parental polymorphism, 226 (43.3%) were polymorphic in the parents and were used to genotype the RILs. At a LOD score of 3.5, eight linkage groups defining the position of 138 markers were obtained that spanned 630.9 cM with an average marker density of 4.57 cM. Further, based on the common loci present between the current map and the previously published chickpea
Directory of Open Access Journals (Sweden)
parviz rezvani moghadam
2009-06-01
Full Text Available In order to study the effect of different sowing dates and different irrigation regimes on morphological characteristics and grain yield of chickpea (cultivar 3279 ILC (Cicer arietinum L., an experiment was conducted at Agricultural Research-Education Station of Shahid Rejaee, Neyshaboor during 2001-2002. Four irrigation regimes (without irrigation, one time irrigation (at early flowering, two times irrigation (at early flowering and 50% flowering and control (irrigation every 10 days and Four sowing dates early planting (autumn, Entezari, and late planting (spring and delayed were compared in a spilt plot layout based on randomized complete block design with four replications per treatment. The results showed that all chickpea plants with delayed sowing date on combination of without irrigation, one time irrigation (at early flowering and two times irrigation (at early flowering and 50% flowering were dead. By delaying sowing date, duration between the time of starting flowering and maturity became shorter. Plant height, distance of the first pod from earth surface, distance between nods, number of nods per plant, number of stems per plant, number of pods per plant, number of pods with one, two and with no seed per plant, number of seeds per plant, seed weight per plant, 100 seed weight and grain yield were increased when the number of irrigation increased. By increasing the growing season, plant height, distance of the first pod from earth surface, number of nods per plant, number of stems per plant, number of pods per plant, number of pods with two and without seeds per plant, number of seeds per plant and seed weight per plant were increased. The autumn sowing date had the highest and the spring date had the lowest grain yield. The highest plant height, number of nods per plant, number of stems per plant, number of pods per plant, number of pods with one and with no seed per plant, number of seeds per plant and grain yield were obtained at
Increased genetic variability for symbiotic nitrogen fixation in green gram (Vigna radiata L.)
International Nuclear Information System (INIS)
Rosaiah, G.; Kumari, D.S.; Satyanarayana, A.; Seenaiah, P.
1989-01-01
Full text: When green gram is planted after rice in Andhra Pradesh, its nitrogen fixation relies upon local rhizobia that have been able to survive the stress of 5-6 months submergence. No rhizobia strain isolated elsewhere was found superior to native rhizobia. Thus improvement of the host may be the only practicable way to improve nitrogen fixation. 15 mutants obtained from gamma irradiated green gram variety 'LGG 127' were tested along with the parent and the cultivar 'Pant Mung 2'. Nodule no. per plant was higher in the mutants. There was also considerable variation in dry weight of nodules per plant and in seed yield. However the number of nodules per plant showed no correlation with seed yield, nodule size may be more relevant. The N content of the shoots at anthesis was positively correlated with dry weight of nodules, seed protein % and seed yield per plant. (author)
Indian Academy of Sciences (India)
Division of Genetics, Indian Agricultural Research Institute, Pusa, New Delhi 110 012, India ..... Both arms in the radial tree between these two subclus- ters are quite ... lines are used, when we use land races and genetic stocks as done in this ...
Ng, Jason Liang Pin; Hassan, Samira; Truong, Thy T.; Hocart, Charles H.; Laffont, Carole; Frugier, Florian; Mathesius, Ulrike
2015-01-01
Initiation of symbiotic nodules in legumes requires cytokinin signaling, but its mechanism of action is largely unknown. Here, we tested whether the failure to initiate nodules in the Medicago truncatula cytokinin perception mutant cre1 (cytokinin response1) is due to its altered ability to regulate auxin transport, auxin accumulation, and induction of flavonoids. We found that in the cre1 mutant, symbiotic rhizobia cannot locally alter acro- and basipetal auxin transport during nodule initiation and that these mutants show reduced auxin (indole-3-acetic acid) accumulation and auxin responses compared with the wild type. Quantification of flavonoids, which can act as endogenous auxin transport inhibitors, showed a deficiency in the induction of free naringenin, isoliquiritigenin, quercetin, and hesperetin in cre1 roots compared with wild-type roots 24 h after inoculation with rhizobia. Coinoculation of roots with rhizobia and the flavonoids naringenin, isoliquiritigenin, and kaempferol, or with the synthetic auxin transport inhibitor 2,3,5,-triiodobenzoic acid, rescued nodulation efficiency in cre1 mutants and allowed auxin transport control in response to rhizobia. Our results suggest that CRE1-dependent cytokinin signaling leads to nodule initiation through the regulation of flavonoid accumulation required for local alteration of polar auxin transport and subsequent auxin accumulation in cortical cells during the early stages of nodulation. PMID:26253705
Chatterjee, Moniya; Gupta, Sumanti; Bhar, Anirban; Chakraborti, Dipankar; Basu, Debabrata; Das, Sampa
2014-11-03
Vascular wilt caused by Fusarium oxysporum f. sp. ciceri Race 1 (Foc1) is a serious disease of chickpea (Cicer arietinum L.) accounting for approximately 10-15% annual crop loss. The fungus invades the plant via roots, colonizes the xylem vessels and prevents the upward translocation of water and nutrients, finally resulting in wilting of the entire plant. Although comparative transcriptomic profiling have highlighted some important signaling molecules, but proteomic studies involving chickpea-Foc1 are limited. The present study focuses on comparative root proteomics of susceptible (JG62) and resistant (WR315) chickpea genotypes infected with Foc1, to understand the mechanistic basis of susceptibility and/or resistance. The differential and unique proteins of both genotypes were identified at 48 h, 72 h, and 96 h post Foc1 inoculation. 2D PAGE analyses followed by MALDI-TOF MS and MS/MS identified 100 differentially (>1.5 foldproteins. These proteins were further categorized into 10 functional classes and grouped into GO (gene ontology) categories. Network analyses of identified proteins revealed intra and inter relationship of these proteins with their neighbors as well as their association with different defense signaling pathways. qRT-PCR analyses were performed to correlate the mRNA and protein levels of some proteins of representative classes. The differential and unique proteins identified indicate their involvement in early defense signaling of the host. Comparative analyses of expression profiles of obtained proteins suggest that albeit some common components participate in early defense signaling in both susceptible and resistant genotypes, but their roles and regulation differ in case of compatible and/or incompatible interactions. Thus, functional characterization of identified PR proteins (PR1, BGL2, TLP), Trypsin protease inhibitor, ABA responsive protein, cysteine protease, protein disulphide isomerase, ripening related protein and albumins are
African Journal of Biotechnology - Vol 7, No 8 (2008)
African Journals Online (AJOL)
Analysis and optimization of DNA delivery into chickpea (Cicer arietinum L.) seedlings ... using ISSR-PCR markers and its relatedness with podophyllotoxin content ... Biological hardening and genetic fidelity testing of micro-cloned progeny of ...
Xiong, Qiyan; Wei, Yanna; Xie, Haidong; Feng, Zhixin; Gan, Yuan; Wang, Chunlai; Liu, Maojun; Bai, Fangfang; Xie, Fang; Shao, Guoqing
2014-06-05
Mycoplasma hyopneumoniae (M. hyopneumoniae) vaccine strain 168 is an intrapulmonically injected attenuated live vaccine that is available in the Chinese market. The aim of this study was to develop suitable adjuvants for this live vaccine to provide effective protection after intramuscular inoculation. Several adjuvant components were screened to assess their toxicity for the live vaccine, and various adjuvant formulations were then designed and prepared. Vaccines supplemented with these adjuvants were used to immunize mice intramuscularly to assess the capacity of the adjuvants to induce a specific immune response. The screened formulations were then evaluated in pigs. Seven of the eight adjuvant components did not affect the viability of the live vaccine, and seven different adjuvant formulations were then designed. In mice, the ISCOM-matrix adjuvant and the levamisole-chitosan mixture adjuvant significantly enhanced serum IgG responses against M. hyopneumoniae, while lymphocyte proliferation was enhanced by the ISCOM-matrix adjuvant, the carbomer-astragalus polysaccharide mixture adjuvant and an oil-in-water emulsion adjuvant. These four adjuvants were evaluated in pigs. Enhancement of specific lymphocyte proliferation responses was observed in the groups vaccinated with the ISCOM-matrix adjuvant and the carbomer-astragalus polysaccharide mixture adjuvant. Significant enhancement of serum IgG antibody production was observed before challenge in pigs vaccinated with the carbomer-astragalus polysaccharide mixture adjuvant and the levamisole-chitosan mixture adjuvant, while after challenge, all of the animals that received vaccines containing adjuvants had higher antibody concentrations against M. hyopneumoniae than unvaccinated animals. Animals inoculated with a vaccine containing the ISCOM-matrix adjuvant (median score 3.57) or the carbomer-astragalus polysaccharide mixture adjuvant (median score 5.28) had reduced lesion scores compared to unvaccinated animals
Management of Fusarium Wilt using mycolytic enzymes produced by ...
African Journals Online (AJOL)
Aghomotsegin
Trichoderma strain to manage the Fusarium wilt disease of Cicer aritenum under in vitro conditions. We also studied ... antibiosis, competition, parasitism and cell lysis can ideally be ... hydrolytic enzymes associated with fungal cell wall lysis,.
Antioxidant activity and total phenolic and flavonoid content of ...
African Journals Online (AJOL)
ajl yemi
2011-12-19
Dec 19, 2011 ... Key words: Astragalus squarrosus, antioxidant, phenolics, flavonoids. INTRODUCTION ... Phenolic and flavonoid compounds are widely distri- buted plant constituents. ..... Antioxidant effects of some ginger constituents.
DEVELOPMENT AND CROSS-SPECIES AMPLIFICATION OF ...
African Journals Online (AJOL)
ACSS
In this study, publicly available grass pea (Lathyrus sativus) EST sequences were used to develop 21 ... which are important food legumes, with whom it could share genes ... (Pisum saivum), faba bean (Vicia faba), chickpea. (Cicer arietinum) ...
Klonowska, Agnieszka; Melkonian, Rémy; Miché, Lucie; Tisseyre, Pierre; Moulin, Lionel
2018-01-30
Rhizobial symbionts belong to the classes Alphaproteobacteria and Betaproteobacteria (called "alpha" and "beta"-rhizobia). Most knowledge on the genetic basis of symbiosis is based on model strains belonging to alpha-rhizobia. Mimosa pudica is a legume that offers an excellent opportunity to study the adaptation toward symbiotic nitrogen fixation in beta-rhizobia compared to alpha-rhizobia. In a previous study (Melkonian et al., Environ Microbiol 16:2099-111, 2014) we described the symbiotic competitiveness of M. pudica symbionts belonging to Burkholderia, Cupriavidus and Rhizobium species. In this article we present a comparative analysis of the transcriptomes (by RNAseq) of B. phymatum STM815 (BP), C. taiwanensis LMG19424 (CT) and R. mesoamericanum STM3625 (RM) in conditions mimicking the early steps of symbiosis (i.e. perception of root exudates). BP exhibited the strongest transcriptome shift both quantitatively and qualitatively, which mirrors its high competitiveness in the early steps of symbiosis and its ancient evolutionary history as a symbiont, while CT had a minimal response which correlates with its status as a younger symbiont (probably via acquisition of symbiotic genes from a Burkholderia ancestor) and RM had a typical response of Alphaproteobacterial rhizospheric bacteria. Interestingly, the upregulation of nodulation genes was the only common response among the three strains; the exception was an up-regulated gene encoding a putative fatty acid hydroxylase, which appears to be a novel symbiotic gene specific to Mimosa symbionts. The transcriptional response to root exudates was correlated to each strain nodulation competitiveness, with Burkholderia phymatum appearing as the best specialised symbiont of Mimosa pudica.
Tillard, Guyléne; van Ham, Robert; Ballard, Ross; Farquharson, Elizabeth; Gerard, Emily; Geurts, Rene; Brown, Matthew; Ridgway, Hayley; O’Callaghan, Maureen
2018-01-01
Biological nitrogen fixation through the legume-rhizobia symbiosis is important for sustainable pastoral production. In New Zealand, the most widespread and valuable symbiosis occurs between white clover (Trifolium repens L.) and Rhizobium leguminosarum bv. trifolii (Rlt). As variation in the population size (determined by most probable number assays; MPN) and effectiveness of N-fixation (symbiotic potential; SP) of Rlt in soils may affect white clover performance, the extent in variation in these properties was examined at three different spatial scales: (1) From 26 sites across New Zealand, (2) at farm-wide scale, and (3) within single fields. Overall, Rlt populations ranged from 95 to >1 x 108 per g soil, with variation similar at the three spatial scales assessed. For almost all samples, there was no relationship between rhizobia population size and ability of the population to fix N during legume symbiosis (SP). When compared with the commercial inoculant strain, the SP of soils ranged between 14 to 143% efficacy. The N-fixing ability of rhizobia populations varied more between samples collected from within a single hill country field (0.8 ha) than between 26 samples collected from diverse locations across New Zealand. Correlations between SP and calcium and aluminium content were found in all sites, except within a dairy farm field. Given the general lack of association between SP and MPN, and high spatial variability of SP at single field scale, provision of advice for treating legume seed with rhizobia based on field-average MPN counts needs to be carefully considered. PMID:29489845
DEFF Research Database (Denmark)
Ahmadi Gavlighi, Hassan; Michalak, Malwina; Meyer, Anne S.
2013-01-01
Gum tragacanth derived from the plant “goat’s horn” (Astragalus sp.) has a long history of use as a stabilizing, viscosity-enhancing agent in food emulsions. The gum contains pectinaceous arabinogalactans and fucose-substituted xylogalacturonans. In this work, gum tragacanth from Astragalus...... and galactose content. The growth-stimulating potential of the three enzymatically produced gum tragacanth fractions was evaluated via growth assessment on seven different probiotic strains in single culture fermentations on: Bifidobacterium longum subsp. longum (2 strains), B. longum subsp. infantis (3 strains...... that on galactan (control). HAG3 completely inhibited the growth of the Cl. perfringens strain. Tragacanth gum is thus a potential source of prebiotic carbohydrates that exert no viscosity effects and which may find use as natural functional food ingredients....
1983-06-17
a c . 9.. a. 0 GIOV 0’ 0" u4 1% 1’ 0 01 0% 01 0" -A < a) 0 C6 CN 0 t 0 -4 C, 1 ol El4 c4- 0 (n 1 0 en 01 (14 0 Q *- ou x --- -14 La.) C)X V) z...clearly related to the initial concentration of viable cells in the inoculant. Determinations of the ability of viable Rhizobia to infect and nodulate...temperatures after 28 days storage have been planted. The extent of nodule formation will be determined. 354 ._ _ ~ Figuire 1. Viable Rhizobia cells
DEFF Research Database (Denmark)
Yánez-Ruiz, David R; Martin-Garcia, Antonio I; Weisbjerg, Martin Riis
2009-01-01
The potential of different legume seeds species, including recently new developed varieties (Vicia faba: a commercial variety and varieties Alameda, Palacio and Baraka; Lupinus angustifolius; Pisum sativum and Cicer arietinum: varieties Fardon and Zegr ) as protein supplements to low quality...
Viruses involved in chickpea stunt
Horn, N.M.
1994-01-01
Chickpea stunt is the most important virus disease of chickpea ( Cicer arietinum L). This disease is characterized by leaf chlorosis or leaf reddening (depending on the chickpea cultivar), plant stunting, internode shortening, reduction in size of
Omura, Yoshiaki; Henoch, Avraham; Shimotsuura, Yasuhira; Duvvi, Harsha; Kawashima, Hiroshi; Ohki, Motomu
2009-01-01
When the window of an Asbestos-contaminated room from a broken ceiling was opened wide, A 73 year-old male physician of Oriental origin, who was sitting in the next room, suddenly developed a severe asthma attack, which did not stop by the use of a hand-held Albuterol inhaler. Temporary relief was obtained only by using a Compressor-Nebulizer (Inspiration 626 with Albuterol Sulfate Inhalation Solution 0.083%). During the attack, abnormal areas were discovered at the upper lobes of both lungs, where Thromboxane B2 (TXB2) was markedly increased to 500 ng (BDORT units) (the rest of the lung had about 2.5 ng), 2 types of Asbestos (Chrysotile and Crocidolite) were abnormally increased to 0.120-0.135 mg, (BDORT units) Acetylcholine was markedly reduced to 0.5 ng (the rest of the lung was low, about 100 ng), DHEA was extremely reduced to 1 ng (the rest of the lung had about 52 ng), and telomere was less than 1 yg (= 10(-24) g). Bacterial & viral infections were also present in these abnormal areas, but no antibiotics entered the abnormal parts of the lungs. Therefore, one optimal dose of Astragalus was given once, which resulted in a rapid continuous excretion of large amounts of the above 2 types of Asbestos & TXB2 in urine & sputum, and Asthma symptoms reduced slightly in severity. Additional acupuncture & shiatsu given on all the known acupuncture points for lung disease only created slight, temporary improvement. Then, the respiratory & cardiac center of the Medulla Oblongata was found to have similar abnormalities as the lungs. Therefore, 100 mW output of Light Emitting Diode of red spectra (650 nm center spectrum) was projected on the abnormal area of the medulla oblongata on the back of the head. This resulted drug uptake of on and off and significantly reduced difficulty of breathing. Additional application of the EMF Neutralizer on the abnormal area of the Medulla Oblongata for 3 hours resulted in continuous drug uptake and complete disappearance of asthma. As a
(Phaseolus vulgaris L.): Rhizobia symbiosis
African Journals Online (AJOL)
Yomi
2012-03-06
Mar 6, 2012 ... especially in acidic and basic soils, where it is greatly combined with Al, Fe and Ca ions hydroxide. In ... factors for plants (CIAT, 1992) including common bean .... estimated based on the Foline-Ciocalteu method adapted from.
DEFF Research Database (Denmark)
Lisanework N.; Michelsen, Anders
1993-01-01
The potential allelopathic effect ofCupressus lusitanica, Eucalyptus globulus, E. camaldulensis andE. saligna on seed germination, radicle and seedling growth was investigated with four crops:Cicer arietinum (chickpea),Zea mays (maize),Pisum sativum (pea) andEragrostis tef (teff). Aqueous leaf ex...
African Journal of Biotechnology - Vol 11, No 47 (2012)
African Journals Online (AJOL)
Nutritional paradigm of vermicompost enhances tolerance to endosulfan in Cicer arietinum · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. AK Sharan, K Dileep Singh, V Chandra, GD Sharma, Shellu Kumari, C Jee, 10692-10702 ...
Indian Academy of Sciences (India)
1985-01-01
Jan 1, 1985 ... January 1985 No.9 Newsletter of the Indian Academy of Sciences. Golden ... ray research and cosmic ray physicists over the past fifty years in ...... some qualitative characters in chickpea (Cicer anetmum Ll;. N K Rao, R B 5 ...
Directory of Open Access Journals (Sweden)
Zheng-Yuan Su
2013-04-01
Full Text Available The antihepatoma activity and liver protective function of the fermentation products (5 L fermenator of Ganoderma lucidum (GL; 靈芝 Ling Zhi cultivated in a medium containing black soybean (BS; 黑豆 Hēi Dòu and Astragalus membranaceus (AM; 生黃耆 Shēng Huáng Qí at different fermentation temperatures were investigated in this study. Hep 3B cells pretreated with lovastatin were used to study the antihepatoma activity, and possible active components were analyzed by reverse-phase high-performance liquid chromatography. Carbon tetrachloride (CCl4-induced primary rat hepatocyte injury was further used to evaluate the liver protective activity of the fermentation products. While all the GL broth filtrates do not inhibit the growth of Hep 3B cells, the ethanolic extract from GL-2 mycelia (GL-2-mE, cultivated in the medium containing BS (50 g/L and AM (20 g/L at 24 °C for 11 days showed the best antihepatoma activity (IC50 26.6 μg/mL than the other ethanolic extracts from GL mycelia, GL fruiting body, BS, and AM did. The antihepatoma activities were correlated with some unknown active components in these samples. Furthermore, GL-2-mE (100 μg/mL without harmful effect on the growth of normal primary rat hepatocytes significantly maintained cell viability, reduced lactate dehydrogenase leakage, lowered lipid peroxidation, and increased glutathione peroxidase and glutathione S-transferase activities in the CCl4-induced damaged primary rat hepatocytes.
... cautions, and resources for more information. Acai Aloe Vera Asian Ginseng Astragalus Bilberry Bitter Orange Black Cohosh ... app today. Subscribe Get dietary supplement updates by e-mail Email Address This page last modified June ...
Growth conditions determine the DNF2 requirement for symbiosis.
Directory of Open Access Journals (Sweden)
Fathi Berrabah
Full Text Available Rhizobia and legumes are able to interact in a symbiotic way leading to the development of root nodules. Within nodules, rhizobia fix nitrogen for the benefit of the plant. These interactions are efficient because spectacularly high densities of nitrogen fixing rhizobia are maintained in the plant cells. DNF2, a Medicago truncatula gene has been described as required for nitrogen fixation, bacteroid's persistence and to prevent defense-like reactions in the nodules. This manuscript shows that a Rhizobium mutant unable to differentiate is not sufficient to trigger defense-like reactions in this organ. Furthermore, we show that the requirement of DNF2 for effective symbiosis can be overcome by permissive growth conditions. The dnf2 knockout mutants grown in vitro on agarose or Phytagel as gelling agents are able to produce nodules fixing nitrogen with the same efficiency as the wild-type. However, when agarose medium is supplemented with the plant defense elicitor ulvan, the dnf2 mutant recovers the fix- phenotype. Together, our data show that plant growth conditions impact the gene requirement for symbiotic nitrogen fixation and suggest that they influence the symbiotic suppression of defense reactions in nodules.
The Role of Plant Innate Immunity in the Legume-Rhizobium Symbiosis.
Cao, Yangrong; Halane, Morgan K; Gassmann, Walter; Stacey, Gary
2017-04-28
A classic view of the evolution of mutualism is that it derives from a pathogenic relationship that attenuated over time to a situation in which both partners can benefit. If this is the case for rhizobia, then one might uncover features of the symbiosis that reflect this earlier pathogenic state. For example, as with plant pathogens, it is now generally assumed that rhizobia actively suppress the host immune response to allow infection and symbiosis establishment. Likewise, the host has retained mechanisms to control the nutrient supply to the symbionts and the number of nodules so that they do not become too burdensome. The open question is whether such events are strictly ancillary to the central symbiotic nodulation factor signaling pathway or are essential for rhizobial host infection. Subsequent to these early infection events, plant immune responses can also be induced inside nodules and likely play a role in, for example, nodule senescence. Thus, a balanced regulation of innate immunity is likely required throughout rhizobial infection, symbiotic establishment, and maintenance. In this review, we discuss the significance of plant immune responses in the regulation of symbiotic associations with rhizobia, as well as rhizobial evasion of the host immune system.
Uromyces ciceris-arietini, the cause of chickpea rust: new hosts in the Trifolieae, Fabaceae
Plants of Medicago polymorpha in Riverside and San Diego, California were collected with severe rust caused by Uromyces ciceris-arietini. Reported hosts of U. ciceris-arietini are Cicer arietinum (chickpea) and Medicago polyceratia. To confirm the potential new host range, a monouredinial isolate RM...
African Journal of Biotechnology - Vol 9, No 25 (2010)
African Journals Online (AJOL)
Effect of sowing dates and seed treatments on yield, some yield parameters and protein content of chickpea (Cicer arietinum L.) EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. M Kaya, A Sanli, M Tonguç, 3833-3839 ...
Androgenesis in chickpea: Anther culture and expressed sequence tags derived annotation
DEFF Research Database (Denmark)
Panchangam, Sameera Sastry; Mallikarjuna, Nalini; Gaur, Pooran M.
2014-01-01
Double haploid technique is not routinely used in legume breeding programs, though recent publications report haploid plants via anther culture in chickpea (Cicer arietinum L.). The focus of this study was to develop an efficient and reproducible protocol for the production of double haploids wit...
Salt tolerance analysis of chickpea, faba bean and durum wheat varieties. I. Chickpea and faba bean
Katerji, N.; Hoorn, van J.W.; Hamdy, A.; Mastrorilli, M.; Oweis, T.
2005-01-01
Two varieties of chickpea (Cicer arietinum L.) and faba bean (Vicia faba), differing in drought tolerance according to the classification of the International Center for Agronomic Research in Dry Areas (ICARDA), were irrigated with waters of three different salinity levels in a lysimeter experiment
Co-inoculation effects of Bradyrhizobium japonicum and ...
African Journals Online (AJOL)
Co-inoculation effects of Bradyrhizobium japonicum and Azospirillum sp. on competitive nodulation and rhizosphere eubacterial community structures of soybean under rhizobia-established soil conditions.
Advances in genetics and molecular breeding of three legume crops ...
Indian Academy of Sciences (India)
Molecular markers are the most powerful genomic tools to increase the efficiency and precision of breeding practices for crop improvement. Progress in the development of genomic resources in the leading legume crops of the semi-arid tropics (SAT), namely, chickpea (Cicer arietinum), pigeonpea (Cajanus cajan) and ...
Callus induction via different growth regulators from cotyledon ...
African Journals Online (AJOL)
Cicer arietinum L.) cultivars KK-1 and Hassan-2K on MS and B5 media containing different combinations and concentrations of growth regulators. Different MS and B5 callusing media containing varying level of 2, 4-D (2 and 4 mg/l), NAA (0.50 ...
Phenotypic diversity and plant growth promoting characteristics of ...
African Journals Online (AJOL)
Chickpea (Cicer arietinum L.) is one of the major sources of dietary protein for majority of Ethiopian population. It also maintains soil fertility through its symbiotic nitrogen-fixation in association with Mesorhizobium species. Therefore, this study was aimed at isolation, characterization and selection of symbiotically effective ...
Hrátky s kostmi. Astragaly jako doklady her v mladém pravěku
Czech Academy of Sciences Publication Activity Database
Nývltová Fišáková, Miriam; Parma, D.
2014-01-01
Roč. 19, č. 1 (2014), s. 113-122 ISSN 1805-918X Institutional support: RVO:68081758 Keywords : Bronze Age * astragalus * games Subject RIV: AC - Archeology, Anthropology, Ethnology http://digilib.phil.muni.cz/handle/11222.digilib/129974
Directory of Open Access Journals (Sweden)
V. A. NEVES
2009-03-01
Full Text Available
As leguminosas caracterizam-se por apresentar alto teor protéico que na sua grande totalidade são globulinas de reserva,e cujas caracterÃsticas moleculares influenciam algumas de suas propriedades com destaque para sua hidrólise frente à s enzimas digestivas. As frações 7 e 11S, apesar de certa homologia estrutural, surgem como determinantes das propriedades nutritivas e funcionais das globulinas. Nesse trabalho a globulina principal de grão-de-bico (tipo legumina, 11S foi isolada e purificada, verificando-se o efeito da exposição a diferentes fatores na hidrólise in vitro com as enzimas tripsina e quimotripsina. Comparada à caseÃna, a globulina principal na forma nativa, e na presença de NaCl 0,3 M, mostrou-se menos susceptÃvel à hidrólise pelas enzimas. A exposição a pHs ácidos extremos revela a retirada desse efeito protetor observado com o sal. As maiores alterações ocorreram pela exposição ao pH 1,0, temperatura de 121°C/15 min e presença de NaCl, no entanto ainda inferiores aos obtidos com a caseÃna e para ambas enzimas. O tratamento alcalino apesar de aumentar a susceptibilidade à s enzimas mostrou valores de hidrólise inferiores à caseÃna. A exposição a diferentes concentrações dos desnaturantes uréia e hidrocloreto de guanidÃnio revelou que apenas o segundo teve pequeno efeito sobre a hidrólise pelas enzimas e, mesmo assim, em concentração tão alta como 8M. PALAVRAS-CHAVE: Grão-de-bico; Cicer arietinum L; globulina principal; hidrólise in vitro.
Directory of Open Access Journals (Sweden)
Felix Dapare Dakora
2015-09-01
Full Text Available Lumichrome and riboflavin are novel molecules from rhizobial exudates that stimulate plant growth. Developmental changes elicited by lumichrome at very low nanomolar concentrations (5 nM include early initiation of trifoliate leaves, expansion of unifoliate and trifoliate leaves, increased stem elongation and leaf area, and consequently greater biomass accumulation in monocots and dicots. However, higher lumichrome concentration (50 nM depressed root development and reduced growth of unifoliate and second trifoliate leaves. Applying either 10 nM lumichrome, 10 nM ABA, or 10 ml of infective rhizobial cells (0.2 OD600 to roots of monocots and dicots for 44 h produced identical effects, which included decreased stomatal conductance and leaf transpiration in Bambara groundnut, soybean and maize, increased stomatal conductance and transpiration in cowpea and lupin, and elevated root respiration in maize (19% by rhizobia and 20% by lumichrome. Extracellular exudation of lumichrome, riboflavin and IAA was greater in N2-fixing rhizobia than non-fixing bacteria, indicating their role as symbiotic signals. Xylem concentration of lumichrome in cowpea and soybean was greater in plants inoculated with infective rhizobia and treated with lumichrome (61.2 µmol lumichrome.ml-1 sap, followed by uninoculated plants receiving lumichrome (41.12 µmol lumichrome.ml-1 sap, and lowest in uninoculated, lumichrome-free plants (26.8 µmol lumichrome.ml-1 sap. Overall, soybean showed greater xylem concentration of lumichrome and a correspondingly increased accumulation in leaves relative to cowpea. As a result, soybean exhibited dramatic developmental changes than cowpea. Taken together, lumichrome and riboflavin secreted by soil rhizobia function as environmental cues for sensing stress. The fact that exogenous application of ABA to plant roots caused the same effect as lumichrome on stomatal functioning suggests molecular cross-talk in plant response to environmental
Directory of Open Access Journals (Sweden)
Pedro Antonio Arraes Pereira
2002-06-01
Full Text Available The objective of this study was to determine if trehalose can effectively enhance the viability and storage lifetime of Rhizobium tropici and Rhizobium etli after lyophilization as compared to the traditional protective combination of sucrose and peptone. Two strains of bean-nodulating rhizobia were effectively preserved in the lyophilized state by 100 mM trehalose, and survived for at least 12 days, even when stored under non-ideal conditions. Trehalose provided better protection than the sucrose/peptone combination. When protective excipients were introduced inside the cells, strain CFN 42 was more sensitive to the type of additive used than strain CIAT 899, probably because CIAT 899 produces beta (1-2 glucan, which may have a protective effect. beta (1-2 glucan combined with sucrose protected better than trehalose against leakage from freeze-dried liposomes, but by itself it had no protective capability. There was a high level of unfrozen water associated with the hydrated glucan, in addition to a thermal event at approximately 70ºC, corresponding to an observed gel-sol transition in the glucan. These findings may shed light on the mechanism by which the glucan contributes to the protection of dried cells and liposomes, and may lead to further improvements in rhizobial inoculants.O objetivo deste estudo foi determinar se a trealose pode aumentar a viabilidade e o tempo de preservação de estirpes de Rhizobium tropici e Rhizobium etli após a liofilização, comparada com a proteção proporcionada pela combinação tradicional de sacarose e peptona. Duas estirpes de rizóbio para feijão foram preservadas liofilizadas com 100 mM de trealose e sobreviveram por pelo menos 12 dias, mesmo quando armazenadas sob condições não-ideais. A trealose proporcionou uma proteção superior à combinação de sacarose peptona. Quando agentes protetores foram introduzidos dentro da célula, a estirpe CFN 42 foi mais sensível em relação ao tipo de
Digital Repository Service at National Institute of Oceanography (India)
Kerkar, S.; Raiker, L.; Tiwari, A.; Mayilraj, S.; Dastager, S.
solubilizers. There was enhancement in the growth of Cicer arietinum (length of the shoot and root) under axenic conditions and of biofilm mats (r = 0.9, p < 0.001; r = 0.8, p < 0.05 and r = 0.946, p < 0.01, respectively). This is, according to our knowledge...
Beans (Phaseolus vulgaris L.) are one of the most economically and nutritionally important crops world-wide. They are the most important legume for direct human consumption with more than 23 million metric tons produced in 2013; more than twice that of the next most important legume, chickpea (Cicer...
Growth promotion and protection against Orobanche foetida of ...
African Journals Online (AJOL)
Fetid broomrape (Orobanche foetida Poir.) is a chlorophyll lacking holoparasite that subsists on the roots of plants and causes significant damage to the culture of leguminous plants particularly chickpea (Cicer aerietinum L.). The investigation was done about potential of Rhizobium strains for biological control of O. foetida ...
Phyto-agglutinin, total proteins and amino assimilating enzymatic ...
African Journals Online (AJOL)
Biochemical studies were carried out with in vitro micropropagated plantlets of two indigenous cultivars of chickpea (Cicer arietinum L.), KK-1 and Hassan-2K, where extract from shoots, leaves, roots, and reproductive organs were determined for human erythrocyte agglutination (by mixing the lectin containing extract 1:1 ...
Sharman, Murray; Kehoe, Monica; Coutts, Brenda; van Leur, Joop; Filardo, Fiona; Thomas, John
2016-01-01
We present here the complete genome sequences of a novel polerovirus from Trifolium subterraneum (subterranean clover) and Cicer arietinum (chickpea) and compare these to a partial viral genome sequence obtained from Macroptilium lathyroides (phasey bean). We propose the name phasey bean mild yellows virus for this novel polerovirus.
Lifescience Database Archive (English)
Full Text Available root [DR:D06739], Cnidium rhizome [DR:D06748], Rehmannia root [DR:D06736], Uncaria hook [DR:D06762], Astraga...lus root [DR:D06687], Phellodendron bark [DR:D06689] ... Therapeutic category: 5200 ... PubChem: 51091318 ...
Directory of Open Access Journals (Sweden)
Leandro Hahn
Full Text Available ABSTRACT Rhizobia and associative bacteria promote growth in rice plants (Oryza sativa L. through a series of mechanisms, but most studies on inoculation have been performed based on inoculation with these bacteria in a separate or singular manner. The objective of this study was to assess the efficiency of single/isolated inoculation and inoculation combined with symbiotic rhizobia from forage legume and with Azospirillum brasilense on promoting growth and the root colonization process in wetland rice. Two rhizobia among four isolates from a greenhouse and a laboratory experiment were selected that efficiently promoted seed germination and rice plant growth in a sterilized substrate and in soil. The two most efficient isolates (UFRGS Vp16 and UFRGS Lc348 were inoculated alone or in combination with a commercial product containing A. brasilense in two field experiments using two wetland rice cultivars over two growing seasons. In the field experiments, these isolates coinoculated with A. brasilense promoted larger increases in the agronomic variables of wetland rice compared to the control without inoculation. Confocal laser microscopy confirmed the presence of inoculated bacteria tagged with gfp (UFRGS Vp16, UFRGS Lc348, and A. brasilense colonizing the root surface of the rice seedlings, mainly in the root hairs and lateral roots.
Afkhami, Michelle E; Stinchcombe, John R
2016-10-01
While all species interact with multiple mutualists, the fitness consequences and molecular mechanisms underlying these interactions remain largely unknown. We combined factorial ecological experiments with genomewide expression analyses to examine the phenotypic and transcriptomic responses of model legume Medicago truncatula to rhizobia and mycorrhizal fungi. We found synergistic effects of these mutualists on plant performance and examined unique features of plant gene expression responses to multiple mutualists. There were genomewide signatures of mutualists and multiple mutualists on expression, with partners often affecting unique sets of genes. Mycorrhizal fungi had stronger effects on plant expression than rhizobia, with 70% of differentially expressed genes affected by fungi. Fungal and bacterial mutualists had joint effects on 10% of differentially expressed genes, including unexpected, nonadditive effects on some genes with important functions such as nutrient metabolism. For a subset of genes, interacting with multiple mutualists even led to reversals in the direction of expression (shifts from up to downregulation) compared to interacting with single mutualists. Rhizobia also affected the expression of several mycorrhizal genes, including those involved in nutrient transfer to host plants, indicating that partner species can also impact each other's molecular phenotypes. Collectively, these data illustrate the diverse molecular mechanisms and transcriptional responses associated with the synergistic benefits of multiple mutualists. © 2016 John Wiley & Sons Ltd.
Dall'Agnol, Rebeca Fuzinatto; Bournaud, Caroline; de Faria, Sérgio Miana; Béna, Gilles; Moulin, Lionel; Hungria, Mariangela
2017-04-01
Some species of the genus Paraburkholderia that are able to nodulate and fix nitrogen in symbiosis with legumes are called β-rhizobia and represent a group of ecological and biotechnological importance. We used Mimosa pudica and Phaseolus vulgaris to trap 427 rhizobial isolates from rhizospheric soil of Mimoseae trees in the Brazilian Atlantic Forest. Eighty-four representative strains were selected according to the 16S rRNA haplotypes and taxonomically characterized using a concatenated 16S rRNA-recA phylogeny. Most strains were assembled in the genus Paraburkholderia, including Paraburkholderia sabiae and Pa. nodosa. Mesorhizobium (α-rhizobia) and Cupriavidus (β-rhizobia) were also isolated, but in smaller proportions. Multilocus sequence analysis and BOX-PCR analyses indicated that six clusters of Paraburkholderia represent potential new species. In the phylogenetic analysis of the nodC gene, the majority of the strains were positioned in the same groups as in the 16S rRNA-recA tree, indicative of stability and vertical inheritance, but we also identified horizontal transfer of nodC in Pa. sabiae. All α- and β-rhizobial species were trapped by both legumes, although preferences of the host plants for specific rhizobial species have been observed. © FEMS 2017. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.
Extraction-condition Optimization of Baicalein and Schisandrin from ...
African Journals Online (AJOL)
effects of individual factors on extraction rates of baicalein and schisandrin determined by high performance liquid ..... Huang HL, Wang YJ, Zhang QY, Liu B, Wang FY, Li JJ,. Zhu RZ. ... Liu C, Zhao X, Fan Y, Han G, Nguyen T. Astragalus.
Enzymatic production of polysaccharides from gum tragacanth
DEFF Research Database (Denmark)
2014-01-01
Plant polysaccharides, relating to the field of natural probiotic components, can comprise structures similar to human milk oligosaccharides. A method for enzymatic hydrolysis of gum tragacanth from the bush-like legumes of the genus Astragalus, using a combination of pectin hydrolases...
Chickpea (Cicer arietieum) is a widely cultivated food legume and one of the Neolitic founder crops domesticated in the Fertile Crescent. Cultivated chickpea is classified into two types, a ‘desi’ type with smaller and darker seed coats, and a light-colored large-seeded ‘kabuli’ type, with the two t...
Chickpea (Cicer arietinum L.) is an important food legume crop and Fusarium wilt caused by Fusarium oxysporum f. sp. ciceris is one of the most important diseases of chickpea in Turkey. Fusarium redolens is known to cause wilt-like disease of chickpea in other countries, but has not been reported fr...
Molecular Reassessment Of Relationships Within Vicieae Using ...
African Journals Online (AJOL)
Serologically, the legumins of V. faba and L. esculentum gave a total identity with P. sativum legumin antiserum under non-reducing conditions, whereas the ... et albumines des protéines des graines de petit pois (Pisum sativum), haricot (Vicia faba), lentille (Lens esculentum) et culin (Cicer arientinum) pour limiter les ...
Bao et al., Afr J Tradit Complement Altern Med. (2012) 9(4):548-552
African Journals Online (AJOL)
AJTCAM
The Chinese herbal formula consisting of Astragalus membranaceus, Epimedium brevicornum,. Paeoniae Alba Radix and Radix Ophiopogonis in proper proportions were adopted in order to investigate the immunoenhancing properties of the herbal formula. Fifty ICR mice were randomly divided into 5 groups (NS,.
78 FR 37564 - Endangered and Threatened Wildlife and Plants; Recovery Permit Applications
2013-06-21
.... Alternatively, you may use one of the following methods to request hard copies or a CD-ROM of the documents...) Barneby ridge-cress (Lepidium barnebyanum), Barney reed-mustard (Schoenocrambe barnebyi), Holmgren milk... (Pediocactus despainii), Shivwitz milk-vetch (Astragalus ampullarioides), shrubby reed-mustard (Schoenocrambe...
Guo, F.; Williams, B.A.; Kwakkel, R.P.; Li, H.S.; Li, X.P.; Luo, J.Y.; Li, W.K.; Verstegen, M.W.A.
2004-01-01
An in vivo experiment was conducted to study the potential prebiotic effects of mushroom and herb polysaccharide extracts, Lentinus edodes extract (LenE), Tremella fuciformis extract, and Astragalus membranaceus Radix extract, on chicken growth and the cecal microbial ecosystem, as compared with the
Directory of Open Access Journals (Sweden)
H. Ebrahimzadeh F. Mighani
1997-08-01
Full Text Available From the point of gum production, Fabaceae is one of the most richest plant families. Tragacanth is one of the most important gums and has medicianl, industrial and food applications. The soluble and insoloble fractions are 40 and 60% in white gum and 70 and 30% in yellow gum, respectively. These fractions do not show considerable seasonal variations. Total sugar in white gum and yellow gum are 70% and 90% , respectively; monosaccharides in both kind of tragacanths include galacturonic acid, galactose, glucose, arabinose, xylose, fucose, and rhamnose and the amount of xylose in the composition is higher than that of others. Insoluble fraction of white gum, the amount of xylose is more than that of arabinose pJus fucose while in yellow gum its amount is lower than that of arabinose plus fucose. fln insoluble fraction of both kind of tragacanths, the amount of arabinose plus fucose is high. The quality of white gum, in comparison to yellow gum, is better due to the higher in soluble fraction and arabinose plus fucose to xylose in this fraction . The gum tragacartti of both species has a xylan backbone.
Energy inputs and outputs in a chickpea production system in ...
African Journals Online (AJOL)
Chickpea (Cicer arietinum L.) is one of the most important grain legumes which traditionally cultivated in marginal areas and saline soils. In this study, chickpea production in Kurdistan, Iran and the energy equivalences of input used in production were investigated. The aims of this study were to determine the amount of ...
PGPRs and nitrogen-fixing legumes: a perfect team for efficient Cd phytoremediation?
Directory of Open Access Journals (Sweden)
María Teresa eGómez-Sagasti
2015-02-01
Full Text Available Cadmium (Cd is a toxic, biologically non-essential and highly mobile metal that has become an increasingly important environmental hazard to both wildlife and humans. In contrast to conventional remediation technologies, phytoremediation based on rhizobia-legume symbiosis has emerged as an inexpensive decontamination alternative which also revitalize contaminated soils due to the role of legumes in nitrogen cycling. In recent years, there is growing interest in understanding symbiotic rhizobia-legume relationship and its interactions with Cd. The aim of the present review is to provide a comprehensive picture of the main effects of Cd in N2-fixing leguminous plants and the benefits of exploiting this symbiosis together with plant growth promoting rhizobacteria (PGPRs to boost an efficient reclamation of Cd-contaminated soils.
Li, Jin Hua; Jiao, Shu Mei; Gao, Rong Qing; Bardgett, Richard D.
2012-12-01
Plant-soil interactions are known to influence a wide range of ecosystem-level functions. Moreover, the recovery of these functions is of importance for the successful restoration of soils that have been degraded through intensive and/or inappropriate land use. Here, we assessed the effect of planting treatments commonly used to accelerate rates of grassland restoration, namely introduction of different legume species Medicago sativa, Astragalus adsurgens, Melilotus suaveolens, on the recovery of soil microbial communities and carbon and nitrogen contents in abandoned fields of the Loess Plateau, China. The results showed effects were species-specific, and either positive, neutral or negative depending on the measure and time-scale. All legumes increased basal respiration and metabolic quotient and had a positive effect on activity and functional diversity of the soil microbial community, measured using Biolog EcoPlate. However, soil under Astragalus adsurgens had the highest activity and functional diversity relative to the other treatments. Soil carbon and nitrogen content and microbial biomass were effectively restored in 3-5 years by introducing Medicago sativa and Astragalus adsurgens into early abandoned fields. Soil carbon and nitrogen content were retarded in 3-5 years and microbial biomass was retarded in the fifth year by introducing Melilotus suaveolens. Overall, the restoration practices of planting legumes can significantly affect soil carbon and nitrogen contents, and the biomass, activity, and functional diversity of soil microbial community. Therefore, we propose certain legume species could be used to accelerate ecological restoration of degraded soils, hence assist in the protection and preservation of the environment.
Antioxidant activity and total phenolic and flavonoid content of ...
African Journals Online (AJOL)
The antioxidant capacity of the flowering aerial parts of Astragalus squarrosus was determined by 1,1- diphenyl-2-picrylhydrazyl (DPPH) radical scavenging and ferric thiocyanate methods. The phenolic and flavonoid content was also measured. A. squarrosus showed weak free radical scavenging activity with the DPPH ...
Guo, F.; Williams, B.A.; Kwakkel, R.P.; Verstegen, M.W.A.
2003-01-01
In vitro fermentabilities of two mushrooms (Lentinus edodes - LenS; Tremella fuciformis - TreS), an herb (Astragalus membranaceus - AstS), and their polysaccharide fractions (LenE, TreE, and AstE) were investigated using microflora from chicken ceca. Polysaccharides were extracted using the hot
Effect of different hydropriming times on the quantitative and ...
African Journals Online (AJOL)
ajl yemi
2011-10-26
Oct 26, 2011 ... characteristics and percentage of protein of chickpea (Cicer arietinum L.) were examined in a randomized complete block design with three replicates in 2010. Seeds of chickpea were exposed at six different hydropriming times (2 h, 4 h, 6 h, 8 h, 10 h and control). The results of this experiment showed.
Sharman, Murray; Kehoe, Monica; Coutts, Brenda; van Leur, Joop; Filardo, Fiona; Thomas, John
2016-02-04
We present here the complete genome sequences of a novel polerovirus from Trifolium subterraneum (subterranean clover) and Cicer arietinum (chickpea) and compare these to a partial viral genome sequence obtained from Macroptilium lathyroides (phasey bean). We propose the name phasey bean mild yellows virus for this novel polerovirus. Copyright © 2016 Sharman et al.
La Ciudad de Dios desde la perspectiva de la razón: la cuarta politeia de la antigüedad
Directory of Open Access Journals (Sweden)
Óscar Velásquez
2011-01-01
Full Text Available Este artículo reflexiona acerca de la relación entre los conceptos de politeia, res publica y civitas en cuatro grandes obras: República de Platón, Política de Aristóteles, República de Cicerón y Ciudad de Dios de san Agustín, poniendo especial atención en esta última, en la medida en que se inserta en una tradición en la que Cicerón ocupa un lugar privilegiado de enlace con el pensamiento griego, y que, en fin, tuvo profundas repercusiones en la visión de mundo en occidente.This article reflects on the relationship between the concepts of politeia, res publica and civitas in four major works: The Republic by Plato, Politics by Aristotle, Republic by Cicero and City of God by Saint Augustine, with special attention on the latter, insofar as it is inserted in a tradition in which Cicero occupies a privileged position of a link with Greek thought, and which, in the end, had profound repercussions on the Western world view.
The ability of rhizobacteria to solubilize phosphate and synthesize of indoleacetic acid in cowpea
Directory of Open Access Journals (Sweden)
Weslany Silva Rocha
2018-01-01
Full Text Available The Cerrado comprises a vast ecoregion in central Brazil where plants show both growth and nitrogen fixation deficiencies due to low soil fertility. Farmers may overcome such problem using species of microorganisms capable of improving soil fertility such as the Rhizobia bacteria. This work aimed to assess the ability of phosphate solubilization and synthesis of indoleacetic acid (IAA of Rhizobium isolates obtained from Cerrado soils in the state of Tocantins, Brazil, evaluating their symbiotic efficiency in cowpea (Vigna unguiculata L. Walp. plants. We used a total of 32 isolates (or strains of Rhizobium and a reference species of Bradyrhizobium. The capacity of phosphate solubilization and synthesis of IAA was evaluated in vitro, while the symbiotic function of rhizobia isolates and the effect on cowpea biomass was assessed in a greenhouse. Only eight strains were able to solubilize calcium phosphate, while all isolates produced IAA. The rhizobia inoculation caused a significant increase in biomass and nodulation of cowpea. The isolates UFT R122 and UFT R124 stood out with the highest values for the studied parameters, showing rises above 33% of relative efficiency in comparison to the treatment with nitrogen fertilization. By associating the results of phosphate solubilization capacity, IAA synthesis, symbiotic ability, and nodulation, we conclude that the isolates that showed good performance are potential inoculants for cowpea in Cerrado soils.
Directory of Open Access Journals (Sweden)
Sumitha Nallu
Full Text Available Root nodules are the symbiotic organ of legumes that house nitrogen-fixing bacteria. Many genes are specifically induced in nodules during the interactions between the host plant and symbiotic rhizobia. Information regarding the regulation of expression for most of these genes is lacking. One of the largest gene families expressed in the nodules of the model legume Medicago truncatula is the nodule cysteine-rich (NCR group of defensin-like (DEFL genes. We used a custom Affymetrix microarray to catalog the expression changes of 566 NCRs at different stages of nodule development. Additionally, bacterial mutants were used to understand the importance of the rhizobial partners in induction of NCRs. Expression of early NCRs was detected during the initial infection of rhizobia in nodules and expression continued as nodules became mature. Late NCRs were induced concomitantly with bacteroid development in the nodules. The induction of early and late NCRs was correlated with the number and morphology of rhizobia in the nodule. Conserved 41 to 50 bp motifs identified in the upstream 1,000 bp promoter regions of NCRs were required for promoter activity. These cis-element motifs were found to be unique to the NCR family among all annotated genes in the M. truncatula genome, although they contain sub-regions with clear similarity to known regulatory motifs involved in nodule-specific expression and temporal gene regulation.
No evidence for adaptation to local rhizobial mutualists in the legume Medicago lupulina.
Harrison, Tia L; Wood, Corlett W; Borges, Isabela L; Stinchcombe, John R
2017-06-01
Local adaptation is a common but not ubiquitous feature of species interactions, and understanding the circumstances under which it evolves illuminates the factors that influence adaptive population divergence. Antagonistic species interactions dominate the local adaptation literature relative to mutualistic ones, preventing an overall assessment of adaptation within interspecific interactions. Here, we tested whether the legume Medicago lupulina is adapted to the locally abundant species of mutualistic nitrogen-fixing rhizobial bacteria that vary in frequency across its eastern North American range. We reciprocally inoculated northern and southern M. lupulina genotypes with the northern ( Ensifer medicae ) or southern bacterium ( E. meliloti ) in a greenhouse experiment. Despite producing different numbers of root nodules (the structures in which the plants house the bacteria), neither northern nor southern plants produced more seeds, flowered earlier, or were more likely to flower when inoculated with their local rhizobia. We then used a pre-existing dataset to perform a genome scan for loci that showed elevated differentiation between field-collected plants that hosted different bacteria. None of the loci we identified belonged to the well-characterized suite of legume-rhizobia symbiosis genes, suggesting that the rhizobia do not drive genetic divergence between M. lupulina populations. Our results demonstrate that symbiont local adaptation has not evolved in this mutualism despite large-scale geographic variation in the identity of the interacting species.
Protection of Chinese herbs against Adenine-induced chronic renal ...
African Journals Online (AJOL)
The aim of the study is to evaluate the efficacy of Chinese herbs (Angelica sinensis, Ligusticum wallichii, Salvia miltiorrhiza, Rhizoma dioscoreae, Rhodiola crenilata, Astragalus membranaceus and Angelica sinensis) on adenine-induced chronic renal failure in rats. 30 age-matched male Wistar rats were divided into three ...
Guo, F.C.; Kwakkel, R.P.; Williams, B.A.; Parmentier, H.K.; Li, W.K.; Yang, Z.Q.; Verstegen, M.W.A.
2004-01-01
We investigated the effects of polysaccharide extracts from 2 mushrooms, Lentinus edodes (LenE) and Tremella fuciformis (TreE), and an herb, Astragalus membranaceus (AstE), on cellular and humoral immune responses of Eimeria tenella-infected chickens. A total of 150 broiler chicks were assigned to 5
Guo, F.C.; Kwakkel, R.P.; Williams, B.A.; Suo, X.; Li, W.K.; Verstegen, M.W.A.
2005-01-01
An experiment was conducted to investigate the effects of polysaccharide extracts (E) of two mushrooms, Lentinus edodes (LenE) and Tremella fuciformis (TreE), and an herb, Astragalus membranaceus (AstE), on the immune responses of chickens infected with Eimeria tenella. A total of 180 broiler
Bird embryos uncover homology and evolution of the dinosaur ankle.
Ossa-Fuentes, Luis; Mpodozis, Jorge; Vargas, Alexander O
2015-11-13
The anklebone (astragalus) of dinosaurs presents a characteristic upward projection, the 'ascending process' (ASC). The ASC is present in modern birds, but develops a separate ossification centre, and projects from the calcaneum in most species. These differences have been argued to make it non-comparable to dinosaurs. We studied ASC development in six different orders of birds using traditional techniques and spin-disc microscopy for whole-mount immunofluorescence. Unexpectedly, we found the ASC derives from the embryonic intermedium, an ancient element of the tetrapod ankle. In some birds it comes in contact with the astragalus, and, in others, with the calcaneum. The fact that the intermedium fails to fuse early with the tibiale and develops an ossification centre is unlike any other amniotes, yet resembles basal, amphibian-grade tetrapods. The ASC originated in early dinosaurs along changes to upright posture and locomotion, revealing an intriguing combination of functional innovation and reversion in its evolution.
Fornasero, Laura Viviana; Del Papa, María Florencia; López, José Luis; Albicoro, Francisco Javier; Zabala, Juan Marcelo; Toniutti, María Antonieta; Pensiero, José Francisco; Lagares, Antonio
2014-01-01
Desmanthus paspalaceus (Lindm.) Burkart belongs to the D. virgatus complex, subfamily Mimosoidae. The known potential as livestock fodder of several of these legumes prompted us to undertake a phenotypic, molecular, and symbiotic characterization of the D. paspalaceus symbionts in the Santa Fe province, Argentina. The rhizobia collected—containing isolates with different abiotic-stress tolerances—showed a remarkable genetic diversity by PCR fingerprinting, with 11 different amplification profiles present among 20 isolates. In selected isolates 16S-rDNA sequencing detected mesorhizobia (60%) and rhizobia (40%) within the collection, in contrast to the genus of the original inoculant strain CB3126—previously isolated from Leucaena leucocephala—that we typified here through its 16S rDNA as Sinorhizobium terangae. The results revealed the establishment by diverse bacterial genera -rhizobia, sinorhizobia, and mesorhizobia- of full N2-fixing symbiotic associations with D. paspalaceus. This diversity was paralleled by the presence of at least two different nodC allelic variants. The identical nodC alleles of the Mesorhizobia sp. 10.L.4.2 and 10.L.5.3 notably failed to group within any of the currently described rhizo-/brady-/azorhizobial nodC clades. Interestingly, the nodC from S. terangae CB3126 clustered close to homologs from common bean nodulating rhizobia, but not with the nodC from S. terangae WSM1721 that nodulates Acacia. No previous data were available on nod-gene phylogeny for Desmanthus symbionts. A field assay indicated that inoculation of D. paspalaceus with the local Rhizobium sp. 10L.11.4 produced higher aerial-plant dry weights compared to S. teranga CB3126–inoculated plants. Neither the mesorhizobia 10.L.4.2 or 10.L.5.3 nor the rhizobium 10L.11.4 induced root nodules in L. leucocephala or P. vulgaris. The results show that some of the local isolates have remarkable tolerances to several abiotic stresses including acidity, salt, and temperature
Yield and biological nitrogen fixation of cowpea varieties in the semi-arid region of Brazil
International Nuclear Information System (INIS)
Santiago de Freitas, Ana Dolores; Fernandes Silva, Acácia; Valadares de Sá Barretto Sampaio, Everardo
2012-01-01
Cowpea is an important crop in small properties of the Brazilian semi-arid region, where it is cultivated without fertilizer application. In spite of the fundamental role played by biological Nitrogen fixation (BNF), little is known of the symbiosis between cowpea varieties and native rhizobia or recommended rhizobia strains. A field experiment was conducted aiming to estimate BNF and productivities of local varieties, in association with two previously described bradyrhizobial inoculant strains and native rhizobia (no inoculation). The plants received 20 kg ha −1 of enriched 15 N fertilizer to allow the use of the isotopic dilution method. After harvest (80 days) straw and grain biomass was determined. The varieties differed in grain and straw productivity and in N and N derived from atmosphere (%Ndfa). Corujinha had the highest grain productivity (1147 kg ha −1 ), followed by Sempre Verde (920 kg ha −1 ), Azul (912 kg ha −1 ) and Cariri (889 kg ha −1 ). Costela de Vaca had the highest straw productivity (2258 kg ha −1 ), highest N content in the straw (28 g ha −1 ) and highest BNF (79 %Ndfa, corresponding to 45 kg ha −1 of N for total aboveground biomass and 39 kg ha −1 for the straw), but the lowest grain productivity (381 kg ha −1 ) and the lowest harvest index (0.14). The inoculations did not significantly alter productivities, N contents or %Ndfa but there was a tendency of lower grain productivities in the non-inoculated plants, which was reflected in lower total and biologically fixed N quantities, indicating that the native strains may be slightly less efficient. -- Highlights: ► We estimate N fixation and productivities of local cowpea varieties in Brazil. ► Plants were inoculated or not with two recommended rhizobia strains. ► All local varieties had high proportions of their N derived from the air (%Ndfa). ► They differed in BNF in grain and straw productivity. ► Inoculation did not alter productivities or %Ndfa but
Effect of electric field (at different temperatures) on germination of ...
African Journals Online (AJOL)
Chickpea (Cicer arietinum) seeds were exposed to electric field from zero to 1300 V for 15 min at three different temperatures (13, 16 and 19°C). It was found that the exposure of chickpea seeds to the electric field caused a change in water uptake capacity (and its coefficient) as compared to control. A new theoretical model ...
Effect of Phosphorus Fertilizer on Nitrogen Fixation by Some Grain ...
African Journals Online (AJOL)
acer
Sahelian region of North-eastern Nigeria, low phosphorus content of the soil may restrict rhizobia population ... kgNha-1 in northern Guinea savanna zone of ... significant difference between treatments were ..... communities of southern Borno.
STECH, 3(3), S/NO 12, SEPTEMBER, 2014
African Journals Online (AJOL)
DR Nneka
2014-09-12
Sep 12, 2014 ... in fixing nitrogen through the nodules in association with rhizobia. Indigenous legumes have ..... The role of biological nitrogen fixation in agroforestry. ... Soil fertility management researches for the maize cropping systems of ...
Effects of drought and salt stress on seed germination of three ...
African Journals Online (AJOL)
The seeds of Medicago sativa (L.), Astragalus adsurgens (Pall.) and Coronilla varia (L.) were evaluated at germination for tolerance to salt (NaCl) and drought conditions induced by polyethylene glycol (PEG) in an experiment of orthogonal design. The results reveal that the germination percentages of M. sativa and A.
Guo, F.C.; Kwakkel, R.P.; Williams, B.A.; Li, W.K.; Li, H.S.; Luo, J.Y.; Li, X.P.; Wei, Y.X.; Yan, Z.T.; Verstegen, M.W.A.
2004-01-01
1. This in vivo trial was conducted to study the effects of polysaccharide extracts of two mushrooms, Lentinus edodes (LenE) and Tremella fuciformis (TreE), and a herb, Astragalus membranaceus (AstE) on growth performance, and the weights of organs and the gastrointestinal tract (GIT) of broiler
The Effects on Germination and Growth of Bean and Chickpea of Boron Waste
Directory of Open Access Journals (Sweden)
Mehmet Onaran
2013-06-01
Full Text Available Abstract: In this study, the effects of two different boron concentrator wastes (A and B on germination and growth of bean (Phaseolus vulgaris L. and chickpea (Cicer arietinum L. were investigated. For this purpose, the species seeds were shown in the petri dishes containing pure water (control and the varied concentrations of two different wastes with three replications. The root and shoot lengths, fresh and dry weights of one week seedlings grown from the germinated seeds at the end of three days were measured. An inhibitor effect of boron waste on germination of species seeds was not determined. In addition, it was found out that 600 ppm and over concentrations of both boron wastes decreased the root and shoot lengths, fresh and dry weights of seedlings. Key words: Boron concentrator waste, Phaseolus vulgaris L.(bean, Cicer arietinum L.(chickpea, germination, growth. Bor Atığının Fasulye ve Nohutun Çimlenme ve Büyümesi Üzerine Etkileri Özet: Bu araştırmada, fasulye (Phaseolus vulgaris L. ve nohutun (Cicer arietinum L. çimlenme ve büyümesi üzerine iki farklı bor konsantrator atığının (A ve B etkisi araştırılmıştır. Bu amaçla, tür tohumları saf su (kontrol ve bu iki farklı atığın farklı konsantrasyonlarını içeren petri kaplarına üç tekerrürlü olarak ekilmiştir. Üç gün sonunda çimlenen tohumlardan gelişen bir haftalık fidelerin kök ve gövde boyları ile taze ve kuru ağırlıkları ölçülmüştür. İlgili türlere ait tohumların çimlenmesi üzerine bor atığının bir inhibitor etkiye sahip olmadığı belirlenmiştir. Ayrıca, her iki bor atığının 600 ppm ve üstü konsantrasyonlarında fidanların kök ve gövde boyları ile taze ve kuru ağırlıklarını azalttığı ortaya çıkmıştır. Anahtar kelimeler: Bor konsantrator atığı, Phaseolus vulgaris L.(fasulye, Cicer arietinum L.(nohut, çimlenme, büyüme.
Yin, Gang; Tang, Decai; Dai, Jianguo; Liu, Min; Wu, Mianhua; Sun, Y U; Yang, Zhijian; Hoffman, Robert M; Li, Lin; Zhang, Shuo; Guo, Xiuxia
2015-06-01
The present study determined the efficacy of extracts of Astragalus membranaceus (AM) and Curcuma wenyujin (CW), a traditional Chinese medicine herbal mixture, at different tumor stages of an orthotopic nude mouse model of human ovarian cancer expressing red fluorescent protein. The tumor-bearing mice were treated with cisplatinum (CDDP), AM, CW, or a combination of AM and CW in each of three tumor stages, using the same regimen. Group 1 received saline as negative control. Group 2 received CDDP i.p. as positive control with a dose of 2 mg/kg, every three days. Group 3 received AM daily via oral gavage, at a dose of 9120 mg/kg. Group 4 received CW daily via oral gavage, at a dose of 4560 mg/kg. Groups 5, 6 and 7 received combinations of AM and CW daily via oral gavage at low (AM, 2280 mg/kg; CW, 1140 mg/kg), medium (AM, 4560 mg/kg; CW 2280 mg/kg), and high (AM, 9120 mg/kg; CW, 4560 mg/kg) doses. The expression of angiogenesis- and apoptosis-related genes in the tumors were analyzed by immunohistochemistry for matrix metalloproteinase 2 (MMP-2), vascular endothelial growth factor (VEGF) fibroblast growth factor 2 (FGF-2), B-cell lymphoma 2 (Bcl-2) and cyclooxygenase 2 (Cox-2), and by polymerase chain reaction for MMP-2, FGF-2 and Bcl-2. CDDP, AM, and its combination with CW-induced significant growth inhibition of Stage I tumors. Strong efficacy of the combination of AM and CW at high dose was observed. Monotherapy with CDDP, AM, CW, and the combination treatments did not significantly inhibit Stage II and III tumors. The expression of MMP-2, VEGF, FGF-2, and Cox-2 was significantly reduced in Stage I tumors treated with AM, CW, and their combination, suggesting a possible role of these angiogenesis- and apoptosis-related genes in the observed efficacy of the agents tested. This study is the first report on the efficacy of anticancer agents at different stages of ovarian cancer in an orthotopic mouse model. As the tumor progressed, it became treatment
The phenomenon of microscale flow and mass transfer in medicinal herb materials
Energy Technology Data Exchange (ETDEWEB)
Yang, J.H.; Di, Q.Q.; Sun, M.D. [Tianjin Univ., Tianjin (China). School of Mechanical Engineering; Zhang, T.J.; Gong, S.X. [Tianjin Inst. of Pharmaceutical Research, Tianjin (China)
2008-07-01
Microwave assisted extraction (MAE) is a combination of a microwave technique and conventional solvent extraction used in the modernization of traditional Chinese medicine. The effective component of medicinal herbs is mostly cellular material which can be released via solvent extraction. The material is diffused to solvents via the porous membrane wall. The structure of herb morphology and characteristics of the solute's molecular weight play an important role in the extraction process of target compounds. Astragalus pieces were chosen for this study in which an ultra-filtration membrane method was used to determine the molecular weight distribution characteristics of Astragalus water extraction liquid in the process of MAE. The fine structure of matrix materials was also characterized by scanning election microscopy (SEM). The phenomenon of mass flow and mass transfer in the plant porous media was discussed along with the enhancement mechanism of microwave field on medicinal plant solvent extraction. The results showed that the water-soluble components in the parenchyma cells of Astragalus pieces pass through the plasmodesma with a diameter of 10 nm to adjacent cell, then through an aperture with a diameter of 0.1 {mu}m to 1 {mu}m into a trachea with a diameter of about 10 {mu}m. The water-soluble components then come onto the surface of matrix material and the main solution via the trachea. The main mass transfer occurs by the trachea and its aperture. It was concluded that in order to promote the dissolution of effective components in medicinal herb in the extraction process, a suitable extraction technology is needed to maintain the permeability of transportation tissue and parenchyma in materials. 11 refs., 1 tab., 3 figs.
African Journals Online (AJOL)
resource of natural germplasm to screen for desired characteristics present in ... The effect of indigenous rhizobia on nodulation and growth of faba bean ... nodule fresh weights, nodule color, shoots height and leaf colors (yellow, green) were.
The phytochemicals 3-nitro-1-propionic acid (NPA) and 3-nitro-1-propanol (NPOH) are produced by a wide variety of leguminous plants, including over 150 different species and varieties of Astragalus. These compounds are toxic to naive grazing animals, but can be safely fed to cattle and sheep that h...
Evidence of Possible Evolutionary Divergence in Plant Genera Based on Antioxidant Properties
Asai, Elizabeth; Cao, Sharon
2009-01-01
The purpose of this investigation was to determine if three Western species of the Panax, Lycium, and Astragalus genera had antibacterial and/or antioxidant properties, and how their properties compared to Eastern herbs in the same genera. The group hypothesized that when compared, the corresponding herbs would have identical antibacterial and…
Conditions Affecting Shelf-Life of Inoculated Legume Seed
Directory of Open Access Journals (Sweden)
Greg Gemell
2012-02-01
Full Text Available Microbial inoculants are becoming more available as sustainable alternatives to fertilizers and other agrichemicals in broad-acre cropping. However, with the exception of legume inoculants little is understood about effective delivery and survival of the inoculum. Legume inoculants are applied to both seed and soil but seed inoculation is the most economical technique. Large quantities of pasture seed in Australia are inoculated by commercial seed coating companies, but the long-term survival of seed-applied inoculum is variable and monitoring of viability requires specialist microbiology skills and facilities. The aim of our research was to define optimum storage conditions for survival of rhizobia on legume seed and evaluate water activity as a means of monitoring shelf-life. The relationship between survival and water activity varied according to seed species, inoculum preparation, coating ingredients, initial water activity and time suggesting that storage conditions would need to be defined for each different combination. Although drying seeds after coating significantly reduced viable numbers of rhizobia, survival of rhizobia on dried commercially coated lucerne seed after 11 weeks was less variable than seeds that had not been dried. The highest numbers were maintained when seeds remained dry with water activities of between 0.47 and 0.38. The quality of inoculated seed could be improved by reducing the death rate of inoculum during preparation and providing optimum storage conditions for long-term survival.
Directory of Open Access Journals (Sweden)
Chiara Santi
2017-12-01
Full Text Available Plant lipid-transfer proteins (LTPs are small basic secreted proteins, which are characterized by lipid-binding capacity and are putatively involved in lipid trafficking. LTPs play a role in several biological processes, including the root nodule symbiosis. In this regard, the Medicago truncatula nodulin 5 (MtN5 LTP has been proved to positively regulate the nodulation capacity, controlling rhizobial infection and nodule primordia invasion. To better define the lipid transfer protein MtN5 function during the symbiosis, we produced MtN5-downregulated and -overexpressing plants, and we analysed the transcriptomic changes occurring in the roots at an early stage of Sinorhizobium meliloti infection. We also carried out the lipid profile analysis of wild type (WT and MtN5-overexpressing roots after rhizobia infection. The downregulation of MtN5 increased the root hair curling, an early event of rhizobia infection, and concomitantly induced changes in the expression of defence-related genes. On the other hand, MtN5 overexpression favoured the invasion of the nodules by rhizobia and determined in the roots the modulation of genes that are involved in lipid transport and metabolism as well as an increased content of lipids, especially galactolipids that characterize the symbiosome membranes. Our findings suggest the potential participation of LTPs in the synthesis and rearrangement of membranes occurring during the formation of the infection threads and the symbiosome membrane.
Structure and function of complex carbohydrates active in regulating plant-microbe interactions
Energy Technology Data Exchange (ETDEWEB)
Albersheim, P; Darvill, A G; McNeil, M
1981-01-01
A key regulatory role of complex carbohydrates in the interactions between plants and microbes has been established. The complex carbohydrates act as regulatory molecules or hormones in that the carbohydrates induce de novo protein synthesis in receptive cells. The first complex carbohydrate recognized to possess such regulatory properties is a polysaccharide (PS) present in the walls of fungi. Hormonal concentrations of this PS elicit plant cells to accumulate phytoalexins (antibiotics). More recently we have recognized that a PS in the walls of growing plant cells also elicits phytoalexin accumulation; microbes and viruses may cause the release of active fragments of this endogenous elicitor. Another PS in plant cell walls is the Proteinase Inhibitor Inducing Factor (PIIF). This hormone appears to protect plants by inducing synthesis in plants of proteins which specifically inhibit digestive enzymes of insects and bacteria. Glycoproteins secreted by incompatible races (races that do not infect the plant) of a fungal pathogen of soybeans protect seedlings from attack by compatible races. Glycoproteins from compatible races do not protect the seedlings. The acidic PS secreted by the nitrogen-fixing rhizobia appear to function in the infection of legumes by the rhizobia. W.D. Bauer and his co-workers have evidence that these PS are required for the development of root hairs capable of being infected by symbiont rhizobia. Current knowledge of the structures of these biologically active complex carbohydrates will be presented.
Huang, Cuilan; Zhan, Jianhua; Luo, Jinhua
2015-02-01
To observe the effects of astragalus polysaccharide (AP) on the intestinal mucosal morphology, level of secretory IgA (s-IgA) in intestinal mucus, and distribution of T lymphocyte subsets in Peyer's patch in rats with severe scald injury. One hundred and thirty SD rats were divided into sham injury group (SI, sham injured, n = 10), scald group (S, n = 30), low dosage group (LD, n = 30), moderate dosage group (MD, n = 30), and high dosage group (HD, n = 30) according to the random number table. Rats in the latter 4 groups were inflicted with 30% TBSA full-thickness scald on the back. From post injury hour 2, rats in groups LD, MD, and HD were intraperitoneally injected with 0.5 mL AP solution with the dosage of 100, 200, and 300 mg/kg each day respectively, and rats in group S were injected with 0.5 mL normal saline instead. Ten rats from group SI immediately after injury and 10 rats from each of the latter 4 groups on post injury day (PID) 3, 7, 14 were sacrificed, and their intestines were harvested. The morphology of ileal mucosa was examined after HE staining; the level of s-IgA in ileal mucus was determined with double-antibody sandwich ELISA method; the proportions of CD3⁺, CD4⁺, CD8⁺ T lymphocytes in Peyer's patches of intestine were determined with flow cytometer, and the proportion of CD4⁺ to CD8⁺ was calculated. Data were processed with one-way analysis of variance, analysis of variance of factorial design, and SNK test. (1) Villi in normal form and intact villus epithelial cells were observed in rats of group SI immediately after injury, while edema of villi and necrosis and desquamation of an enormous amount of villi were observed in groups with scalded rats on PID 3, with significant infiltration of inflammatory cells. On PID 7, no obvious improvement in intestinal mucosal lesion was observed in groups with scalded rats. On PID 14, the pathology in intestinal mucosa of rats remained nearly the same in group S, and it was alleviated obviously
Radioactive elements found in plants contaminated by radioactive rain
Energy Technology Data Exchange (ETDEWEB)
Tanidazawa, M; Ishihara, T
1954-01-01
Ashes obtained from contaminated trifolium repens, astragalus sinicus, and rumex japonicus were studied. The precipitate obtained by treating the acidic solution of the ash with H/sub 2/S followed by Fe/sup + +/ in the presence of NH/sub 3/ and NH/sub 4/Cl contained Y, Sr, and the rare earth elements.
Ming-Li Zhang; Yun Kang; Yang Zhong; Stewart C. Sanderson
2012-01-01
Phyllolobium, a recently established genus from subgenus Pogonophace of Astragalus, contains about 20 species and four sections, mostly endemic to the Qinghai-Tibetan Plateau (QTP). The uplift of the QTP undoubtedly affected organismic evolution in the region, but further molecular dating in a phylogenetic context is required to test whether diversification is linked...
2013-10-24
... al. 2002, p. 6074; Cook et al. 2004, p. 1015). We recognize that critical habitat designated at a... oviposit (lay eggs) on broadleaf plants such as Astragalus spp. (McCabe 1981, p. 180) and grasses such as... available in close proximity to areas suitable for oviposition and larval feeding. Dakota skippers lay eggs...
Pietraszewska-Bogiel, A.
2012-01-01
Anna Pietraszewska-Bogiel wilde weten waarom rhizobia-bacteriën ervoor zorgen dat vlinderbloemige plantensoorten, waartoe ook peulvruchtsoorten als bonen, erwten en soja behoren, op stikstofarme grond kunnen groeien. Daarvoor onderzocht ze het moleculaire mechanisme achter de interactie tussen
Characterization and monitoring of selected rhizobial strains ...
African Journals Online (AJOL)
SERVER
2007-06-18
Jun 18, 2007 ... Fax: +66-44-216345. fixing symbiosis with bacteria known as rhizobia. ... Rhizobial strains were cultured on Yeast-Malt extract agar contain- ing bromthymol blue ... Colony form-ing was observed every day as well as the ...
Preliminary characterization of slow growing rhizobial strains ...
African Journals Online (AJOL)
COMPAQ
2016-05-18
May 18, 2016 ... number of nodules was equal to 5.6 nodules per plant for the strain RMB1 from Bousfer site. The intrinsic .... The salt tolerance of rhizobia was tested on YMA plates containing ..... through deep explorations searching for an.
Bisseling, T.; Dangl, J.L.; Schulze-Lefert, P.
2009-01-01
In the past decade, there have been major advances in our understanding of the molecular interplay between plants and various classes of microbial pathogens (bacteria, fungi, oomycetes, viruses, and nematodes) and microbial symbionts (rhizobia or mycorrhizal fungi). These fundamental insights,
Lefebvre, B.; Klaus-Heisen, D.; Pietraszewska-Bogiel, A.; Hervé, M.; Camut, S.; Auriac, M.C.; Gasciolli, V.; Nurisso, A.; Gadella, T.W.; Cullimore, J.
2012-01-01
The lysin motif receptor like kinase, NFP, is a key protein in the legume Medicago truncatula for the perception of lipochitooligosaccharidic Nod Factors, which are secreted bacterial signals essential for establishing the nitrogen-fixing legume-rhizobia symbiosis. Predicted structural and genetic
Gavrin, A.Y.; Fedorova, E.
2015-01-01
Legumes are able to form endosymbiotic interactions with nitrogen-fixing rhizobia. Endosymbiosis takes shape in formation of a symbiotic organ, the root nodule. Medicago truncatula (M. truncatula) nodules contain several zones representing subsequent stages of development. The apical part of the
Legumes affect alpine tundra community composition via multiple biotic interactions
Soudzilovskaia, N.A.; Aksenova, A.A.; Makarov, M.I.; Onipchenko, V.G.; Logvinenko, O.A.; Braak, ter C.J.F.; Cornelissen, J.H.C.
2012-01-01
The soil engineering function of legumes in natural ecosystems is paramount but associated solely with soil nitrogen (N) subsidies, ignoring concomitant biotic interactions such as competitive or inhibitory effects and exchange between mycorrhizas and rhizobia. We aim to (1) disentangle legume
THE PERSPECTIVE OF CULTIVATION AND UTILIZATION OF THE NEW LEGUMINOUS GRASSES SPECIES IN MOLDOVA
Directory of Open Access Journals (Sweden)
Alexandru TELEUŢĂ
2015-10-01
Full Text Available The development and modernization of our country’s agriculture is related to the revitalization of the animal breeding sector along with the implementation of new genotypes of animals and diversification of fodder production, balanced in terms of quantity and quality throughout the year, suitable for the physiological requirements of animals, and qualitative products as required in the market. Scientific research conducted in the Botanical Garden (Institute of the ASM over decades was aimed at mobilization, improvement and implementation of new non-traditional plant species that use efficiently photosynthetic active radiation and land resources to obtain fodder with a high level of vegetable protein, the fodder leguminous grasses (fam. Fabaceae Lindl. play an important role. We have studied the biological peculiarities, productivity, chemical composition and nutritional value of new fodder leguminous plant species Astragalus galegiformis, Onobrychis inermis and Medicago tianschanica of the collection of non-traditional fodder plants of the Botanical Garden (Institute of the ASM, the traditional forage crop alfalfa served as control variant. The nutritional value of fresh mass accounts: the Astragalus galegiformis - 0.27 nutritive units, 3.26 MJ metabolizable energy and 146g digestible protein/nutritive unit; Onobrychis inermis - 0.25 nutritive units, 2.56 MJ metabolizable energy and 154 g digestible protein/nutritive unit; Medicago tianschanica - 0.24 nutritive units, 2.86 MJ metabolizable energy and 173 g digestible protein/nutritive unit and alfalfa - 0.21 nutritive units, 2.28 MJ metabolizable energy and 164 g digestible protein/nutritive unit. Due to the productivity and high and stable quality of fodder, use of the plantation for a long period of time, capacity of fixing atmospheric nitrogen, the new fodder leguminous species Astragalus galegiformis, Onobrychis inermis and Medicago tianschanica can serve as initial material for enriching
Lead contamination in soil and vegetation of areas surrounding ...
African Journals Online (AJOL)
The results show significant negative correlation between waste pH and Pb in industrial waste, plant and soil. Also the results show that Acantholimon sp. and Astragalus glancanthus were dominant plant in two mines upon floristic quantities assay. Lead concentration was 15.8 mg/kg DW and 1.61 mg/kg DW in Ghanat ...
International Nuclear Information System (INIS)
Bi, F.; Iqbal, S.
2000-01-01
Disease response of plants in terms of induced browning and phytoalexin (induced secondary metabolites) production were recorded in the tissues of Cicer arietinum (Chick pea) treated with the High Molecular Crude Elicitor Preparations, HMWCEP 'Polysaccharides' of Hypnea musciformis (red algae), Padina tetrastromatica (brown algae) and Ulva lactulus (green algae). A UV-visible spectrophotometric method has been developed for the quantification of induced secondary metabolites with time. (author)
Tarsal morphology of the pleuraspidotheriid mammal Hilalia from the middle Eocene of Turkey
Directory of Open Access Journals (Sweden)
Gregoire Metais
2017-03-01
Full Text Available Pleuraspidotheriids are a group of primitive ungulate mammals that, until recently, were thought to be restricted to the late Paleocene of Western Europe. It has been hypothesized that this family actually survived in Central Anatolia until at least the middle Eocene. However, these anachronistically young Anatolian “survivors”, including the genus Hilalia, were previously documented mainly by dental remains. Here, we describe the previously unknown astragalus of Hilalia saribeya, which confirms the pleuraspidotheriid affinities of the genus, and supports phylogenetic reconstructions that place Hilalia as the sister group of Pleuraspidotherium. The morphology of the astragalus suggests sub-cursorial plantigrade locomotion for H. saribeya, although its tarsal morphology remains generalized enough that scansorial capabilities cannot be ruled out. The evolution of Hilalia is addressed in the context of the apparent geographic isolation of Central Anatolia during the Eocene. The endemic character of the mammalian fauna of Central Anatolia during the middle Eocene emphasizes how the complex paleogeography of the northern margin of Neotethys impacted local biotas in a region situated at the crossroads of very distinctive biogeographic zones.
Directory of Open Access Journals (Sweden)
Kelly Alexsandra Souza Menezes
Full Text Available ABSTRACT Legume-rhizobia symbiosis is a cross-kingdom association that results in large amounts of nitrogen incorporated in food webs. For the Brazilian semi-arid region, data on genetic variability and symbiotic efficiency of Papilionoidae rhizobial communities are very scarce. The aim of this study was to evaluate the genetic variability and the symbiotic efficiency of eight rhizobial isolates obtained from “mulungu” (Erythrina velutina Willd. nodules. For 16S rRNA gene sequencing, the genomic DNA was extracted using a commercial kit, amplified with universal primers, and subjected to sequencing reactions. For the isolate ESA 71, PCR amplifications for nodC and nodA genes were attempted. Rhizobial efficiency was assessed by two greenhouse experiments. The first assay was carried out under gnotobiotic conditions, with sterile sand as a substrate; the second experiment was conducted in a non-sterile soil. For both experiments, the inoculation treatments consisted of a single inoculation of each isolate, in addition to a treatment with Bradyrhizobium elkanii BR 5609 as a reference strain. Furthermore, two non-inoculated control treatments, supplied and not supplied with mineral N, were also evaluated. Bacterial identification indicated that both α and β-rhizobia could be found in “mulungu” root nodules. Three isolates where classified within the Rhizobium genus, four bacteria belonged to Bradyrhizobium and one isolate clustered with Burkholderia. Positive amplification of an intragenic fragment of the nodA gene using a primer set to β-rhizobia could be found for ESA 71 (Burkholderia. All bacterial isolates were effective in colonizing “mulungu” roots. In the first experiment, all inoculated treatments and N fertilization increased the N concentration in “mulungu” shoot tissues. For total N in the shoots, the isolates ESA 70, ESA 72, and ESA 75 stood out. In the non-sterile substrate experiment, the isolates ESA 70, ESA 71, ESA
Inherent Soil Fertility as Affected by Rhizobium Inoculation and ...
African Journals Online (AJOL)
else
biomass yield at Babillae, Fedis, Haramaya and Hirna sites was 3648.1 kg ha-1 ... from the soil and the high sensitivity of common bean-rhizobia symbiosis to soil ...... Pakistan. Biol. Fertil. Soils 12:107-111. Buttery BR, SJ Park and WI Findlay.
Mita, De S.; Santoni, S.; Ronfort, J.; Bataillon, T.
2007-01-01
The NODULATION RECEPTOR KINASE (NORK) gene encodes a Leucine-Rich Repeat (LRR)-containing receptor-like protein and controls the infection by symbiotic rhizobia and endomycorrhizal fungi in Legumes. The occurrence of numerous amino acid changes driven by directional selection has been reported in
African Journals Online (AJOL)
home
2014-05-25
May 25, 2014 ... from highly acidic soil (4.8- 5.2) and the acid sensitive strain was isolated from neutral soil. A positive .... The pots were irrigated with nitrogen free plant nutrient solution ..... relate to a better adaptation of these rhizobia to their.
Energy Technology Data Exchange (ETDEWEB)
Gonzalez-Paredes, Y.; Ferrera-Cerrato, R.; Alarcon, A.
2009-07-01
Polycyclic aromatic hydrocarbons (PAH) are ubiquitous organic pollutants that are considered toxic and carcinogenic compounds to living organisms. There us scarce information about the effect of PAH on symbiotic systems such as Azolla-Anabaena, arbuscular mycorrhizal fungi-plants, or legume-rhizobia. (Author)
Molecular evolution and positive selection of the symbiotic gene NORK in Medicago truncatula
DEFF Research Database (Denmark)
De Mita, Stephane; Santoni, Sylvain; Hochu, Isabelle
2006-01-01
. The membrane-anchored receptor NORK (nodulation receptor kinase) of the legume Medicago truncatula controls early steps of root infection by two symbiotic microorganisms: nitrogen-fixing bacteria (rhizobia) and endomycorrhizal fungi (Glomales). We analyzed the diversity of the gene NORK by sequencing 4...
Appels, M.A.
1989-01-01
Bacteria of the genus Rhizobium can form a symbiosis with plants of the family Leguminosae. Both bacteria and plant show considerable biochemical and morphological changes in order to develop and carry out the symbiosis. The Rhizobia
Rhizobial infection in Adesmia bicolor (Fabaceae) roots.
Bianco, Luciana
2014-09-01
The native legume Adesmia bicolor shows nitrogen fixation efficiency via symbiosis with soil rhizobia. The infection mechanism by means of which rhizobia infect their roots has not been fully elucidated to date. Therefore, the purpose of the present study was to identify the infection mechanism in Adesmia bicolor roots. To this end, inoculated roots were processed following conventional methods as part of our root anatomy study, and the shape and distribution of root nodules were analyzed as well. Neither root hairs nor infection threads were observed in the root system, whereas infection sites-later forming nodules-were observed in the longitudinal sections. Nodules were found to form between the main root and the lateral roots. It can be concluded that in Adesmia bicolor, a bacterial crack entry infection mechanism prevails and that such mechanism could be an adaptive strategy of this species which is typical of arid environments.
Directory of Open Access Journals (Sweden)
Paula García-Fraile
Full Text Available The biofertilization of crops with plant-growth-promoting microorganisms is currently considered as a healthy alternative to chemical fertilization. However, only microorganisms safe for humans can be used as biofertilizers, particularly in vegetables that are raw consumed, in order to avoid sanitary problems derived from the presence of pathogenic bacteria in the final products. In the present work we showed that Rhizobium strains colonize the roots of tomato and pepper plants promoting their growth in different production stages increasing yield and quality of seedlings and fruits. Our results confirmed those obtained in cereals and alimentary oil producing plants extending the number of non-legumes susceptible to be biofertilized with rhizobia to those whose fruits are raw consumed. This is a relevant conclusion since safety of rhizobia for human health has been demonstrated after several decades of legume inoculation ensuring that they are optimal bacteria for biofertilization.
Study of the variability of rhizobium strains efficient for bean outcomes by radiomutagenese
International Nuclear Information System (INIS)
Saoudi, Aicha; Hmida, Chayma
2010-01-01
In Tunisia salinity, drought and lack of fertilizer are unfavorable factors for crop legumes. The unavailability of Rhizobia strains tolerant to harsh conditions will exacerbate this situation. The possibility of experimentally producing heritable variations is thus a goal of great importance. This work was conducted to assess the effect of using gamma rays to obtain new strains of Rhizobia nodulating beans, and adapted to stress conditions. All strains of the collection obtained after irradiation of a parent strain is infective to plants of bean. A wide tolerance to high concentrations of NaCl was observed for seven strains of the collection. Analysis by PCR-RFLP showed a high level of molecular polymorphism between isolates selected for their tolerance to salinity. We were able to identify, on the basis potential nitrogen-fixing and tolerance to salinity, high-performing candidates that will be used in field inoculations.
Khanjani, Mohammad; Hoseini, Mohammad Ahmad; Amini, Fatemeh
2014-09-12
Two new species of the genus Anoplocheylus Berlese, 1910 are described: Anoplocheylus marivaniensis sp. nov. collected from soil and rotten leaves under oak trees and Anoplocheylus qorvehiensis sp. nov. from soil under Astragalus sp. bushes in Kurdistan province, Iran. A key to females of all known species of Anoplocheylus is provided, based on original descriptions and other literature.
New records and new host plants of powdery mildews (Erysiphales) from Idaho and Oregon (USA)
Uwe Braun; S. Krishna Mohan
2013-01-01
In the course of routine examinations of powdery mildews collected in Idaho and Oregon, USA, some of the identified species proved to be new to North America, in some cases on new host plants. Leveillula papilionacearum and L. picridis are first records from the USA. Astragalus filipes, Dalea ornata and D. searlsiae are new hosts for Leveillula papilionacearum....
Directory of Open Access Journals (Sweden)
Gaurav Sablok
2017-07-01
Full Text Available The prominent feature of rhizobia is their molecular dialogue with plant hosts. Such interaction is enabled by the presence of a series of symbiotic genes encoding for the synthesis and export of signals triggering organogenetic and physiological responses in the plant. The genome of the Rhizobium sullae type strain IS123T nodulating the legume Hedysarum coronarium, was sequenced and resulted in 317 scaffolds for a total assembled size of 7,889,576 bp. Its features were compared with those of genomes from rhizobia representing an increasing gradient of taxonomical distance, from a conspecific isolate (Rhizobium sullae WSM1592, to two congeneric cases (Rhizobium leguminosarum bv. viciae and Rhizobium etli and up to different genera within the legume-nodulating taxa. The host plant is of agricultural importance, but, unlike the majority of other domesticated plant species, it is able to survive quite well in the wild. Data showed that that the type strain of R. sullae, isolated from a wild host specimen, is endowed with a richer array of symbiotic genes in comparison to other strains, species or genera of rhizobia that were rescued from domesticated plant ecotypes. The analysis revealed that the bacterium by itself is incapable of surviving in the extreme conditions that its host plant can tolerate. When exposed to drought or alkaline condition, the bacterium depends on its host to survive. Data are consistent with the view of the plant phenotype as the primary factor enabling symbiotic nitrogen fixing bacteria to survive in otherwise limiting environments.
Characterization of rhizobial isolates nodulating Millettia pinnata in India.
Rasul, Abdul; Amalraj, E Leo Daniel; Praveen Kumar, G; Grover, Minakshi; Venkateswarlu, B
2012-11-01
Millettia pinnata (Synonym Pongamia pinnata) is a viable source of oil for the mushrooming biofuel industry, source for agroforestry, urban landscaping, and the bio-amelioration of degraded lands. It also helps in maintaining soil fertility through symbiotic nitrogen fixation. However, not much work is reported on classification and characterization of the rhizobia associated with this plant. In the present study, an attempt was made to isolate rhizobial strains nodulating Millettia from soils collected from southern regions of India. The isolates were characterized using numerical taxonomy, 16S rRNA gene sequencing, and cross nodulation ability. The results showed high phenotypic and genetic diversity among the rhizobia symbiotic with Millattia pinnata. The isolates formed five clusters at similarity level of 0.82 based on the results of numerical taxonomy. Results on 16S rRNA gene sequence analysis revealed that most microsymbionts of M. pinnata belonged to Rhizobium and Bradyrhizobium, which are closely related to Rhizobium sp., B. elkanii and B. yuanmingense. Among these isolates, some isolates could grow in a pH range of 4.0-10.0, some could tolerate a high salt concentration (3% NaCl) and could grow at a maximum temperature between 35 and 45 °C. M. pinnata formed nodules with diverse rhizobia in Indian soils. These results offered the first systematic information about the microsymbionts of M. pinnata grown in the soils from southern part of India. © 2012 Federation of European Microbiological Societies. Published by Blackwell Publishing Ltd. All rights reserved.
Bournaud, Caroline; de Faria, Sergio Miana; dos Santos, José Miguel Ferreira; Tisseyre, Pierre; Silva, Michele; Chaintreuil, Clémence; Gross, Eduardo; James, Euan K.; Prin, Yves; Moulin, Lionel
2013-01-01
Burkholderia legume symbionts (also called α-rhizobia) are ancient in origin and are the main nitrogen-fixing symbionts of species belonging to the large genus Mimosa in Brazil. We investigated the extent of the affinity between Burkholderia and species in the tribe Mimoseae by studying symbionts of the genera Piptadenia (P.), Parapiptadenia (Pp.), Pseudopiptadenia (Ps.), Pityrocarpa (Py.), Anadenanthera (A.) and Microlobius (Mi.), all of which are native to Brazil and are phylogenetically close to Mimosa, and which together with Mimosa comprise the “Piptadenia group”. We characterized 196 strains sampled from 18 species from 17 locations in Brazil using two neutral markers and two symbiotic genes in order to assess their species affiliations and the evolution of their symbiosis genes. We found that Burkholderia are common and highly diversified symbionts of species in the Piptadenia group, comprising nine Burkholderia species, of which three are new ones and one was never reported as symbiotic (B. phenoliruptrix). However, α-rhizobia were also detected and were occasionally dominant on a few species. A strong sampling site effect on the rhizobial nature of symbionts was detected, with the symbiont pattern of the same legume species changing drastically from location to location, even switching from β to α-rhizobia. Coinoculation assays showed a strong affinity of all the Piptadenia group species towards Burkholderia genotypes, with the exception of Mi. foetidus. Phylogenetic analyses of neutral and symbiotic markers showed that symbiosis genes in Burkholderia from the Piptadenia group have evolved mainly through vertical transfer, but also by horizontal transfer in two species. PMID:23691052
Rhizobium as a crop enhancer and biofertilizer for increased cereal ...
African Journals Online (AJOL)
OHWESIRI IBUJE
2010-09-13
Sep 13, 2010 ... INTRODUCTION. The United Nations Food and Agriculture Organization ... new insights into recent development of rhizobia-cereal interaction. .... which caused changes in root morphology and physiology that resulted in .... Andrews M, James EK, Cummings SP, Zavalin AA, Vinogradova LV,. McKenzie BA ...
Effect of eucalyptus ( Eucalyptus camaldulensis ) and maize (Zea ...
African Journals Online (AJOL)
However eucalyptus plantations produce large amounts of litter, which impact on groundnut has not been clearly elucidated yet. In order to investigate litter accumulation effect on growth, development, and groundnut root infection by arbuscular mycorrhizal fungi (AMF) and rhizobia, a greenhouse experiment was performed ...
African Journal of Environmental Science and Technology - Vol 9 ...
African Journals Online (AJOL)
Nutritional, eco-physiological and symbiotic characteristics of rhizobia nodulating faba bean (Vicia faba L.) collected from acidic soils of Ethiopia · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. D Tsegaye, F Assefa, H Gebrekidan, G Keneni, 646-654.
Short Communication: Significance for pasture production in the ...
African Journals Online (AJOL)
Short Communication: Significance for pasture production in the southern Cape coastal region of naturalized rhizobia nodulating the strain specific Medicago ... The significance of naturalized strains of M. polymorpha in the production of medic pastures in some soils of the southern Cape coastal region is discussed.
Gavrin, A.Y.; Kaiser, B.N.; Geiger, D.; Tyerman, S.D.; Wen, Z.; Bisseling, T.; Fedorova, E.E.
2014-01-01
In legume–rhizobia symbioses, the bacteria in infected cells are enclosed in a plant membrane, forming organelle-like compartments called symbiosomes. Symbiosomes remain as individual units and avoid fusion with lytic vacuoles of host cells. We observed changes in the vacuole volume of infected
VEGETABLE PEELS: A PROMISING FEED RESOURCE FOR LIVESTOCK
Md. Emran HOSSAIN; Syeda Ayesha SULTANA; Mohammad Hasanul KARIM; Md. Imran AHMED
2016-01-01
The study was undertaken to find out the chemical composition of different vegetable peels available in Rangunia, Chittagong, Bangladesh. Total 10 different vegetable peels i.e., Banana blossom (Musa sapientum), Bottle gourd peel (Lagenaria siceraria), Brinjal peel (Solanum melongena), Gram husk (Cicer arietinum), Green banana peel (Musa sapieutum), Green coconut peel (Cocos nucifera), Pea husk (Pisum sativum), Potato peel (Solanum tuberosum), Pumpkin peel (Cucurbita maxima), Ripe banana peel...
Actinorhizal, mycorhizal and rhizobial symbioses: how much do we ...
African Journals Online (AJOL)
In this review, we discuss the recent progress in research on symbiotic association of rhizobia, Frankia and fungi with plant roots. We compare infection processes of symbiotic establishment; structure, functioning and molecular biology of the symbiotic organ including the regulation of genes implicated in rhizobial, ...
Persistence of Rhizobium Inoculants originating from Leucaena ...
African Journals Online (AJOL)
TonukariJ
8.0 x 104 and 9.0 x 104 rhizobia/g of soil were recovered respectively in spite of the 10-year fallow period. Biomass ... isotope subplots (6 m2) containing the 4 central trees, .... water and rain water enhanced motility of rhizobial cells from L.
Kohlen, W.; Ng, Jason Liang Pin; Deinum, E.E.; Mathesius, Ulrike
2018-01-01
Most legumes can form a unique type of lateral organ on their roots: root nodules. These structures host symbiotic nitrogen-fixing bacteria called rhizobia. Several different types of nodules can be found in nature, but the two best-studied types are called indeterminate and determinate nodules.
Phosphorus use efficiency in common bean ( Phaseolus vulgaris L ...
African Journals Online (AJOL)
The tripartite symbiosis of common bean (Phaseolus vulgaris L.) recombinant inbred line (RIL) 147 with rhizobia and arbuscular mycorrhizal fungi (AMF) was assessed in sand culture by comparing the effects of three AMF species on the mycorrhizal root colonization, rhizobial nodulation, plant growth and phosphorus use ...
Mechanisms of Neuronal Apoptosis In Vivo
2004-02-01
nitroproplonic acid, a compound from plants striatal tyrosine hydroxylase immunoperoxidase staining. Brain Res in the genus Astragalus. Arch Inst Cardiol...neurotransmitters stereotypic movements, and self-injurious behavior, in certain brain areas to environmental factors. There Furthermore, as adults, these...characterized by abnormal conduct such as repetitive may be related to similar abnormal behaviors of or stereotyped movements, poor skills in communica
Directory of Open Access Journals (Sweden)
Oreste Risi
2017-12-01
Full Text Available Objectives: To assess any beneficial effect on quality of life of a daily treatment with a phytotherapic product containing astragalus, thyme, lavender, hop, equisetum, red clover, cypress and agrimonia at titrated concentrations in a cohort of female patients complaining mild stress urinary incontinence (SUI or mixed urinary incontinence (MUI. Materials and methods: 42 non-consecutive female out-patients with mild SUI or mild MUI were assessed with a clinical evaluation, International Consultation on Incontinence Questionnaire Short Form (ICIQ-SF and Patients’ Perception of Intensity of Urgency Scale (PPIUS at baseline the start of the study and after two months of therapy with the phytotherapic product. At the end of the therapy the patients also compiled Patient Global Impression of Improvement (PGI-I. Results: After the completion of the study there was a trend towards better results in each item of ICIQ-SF, but without any statistical significance with an average score in ICIQ-SF-1 of 3.12 ± 0.981 versus 3.21 ± 0.914 (p = 0.556, in ICIQ-SF-2 of 3.69 ± 1.422 versus 3.79 ± 1.372 (p = 0.68 and in ICIQ-SF-3 of 5.95 ± 1.618 versus 6.14 ± 1.670 (p = 0.462. The average reduction of PPIUS was of 0.09 (1.26 ± 1.481 versus 1.357 ± 1.509, p = 0.705. There was a reduction of average consumption of pads/die from 1.69 ± 0.636 to 1.54 ± 0.543 (p = 0.101. In relation to the PGI score, 23/42 patients (54.7% reported no changes after the completion of the therapy, 13/42 (30.9% reported a slight improvement, 5/42 (11.9% were much improved and 1/42 (2.3% was slightly worsened. Only 2/42 (4.7% patients discontinued the treatment before of the completion of the study. We did not observe any adverse effects during the period of the study. Conclusions: The phytotherapic product seems to cause a slight improvement of the symptoms in a good rate of patients. Moreover it has a low rate of withdrawal, due to the lack of adverse events.
Risi, Oreste; Manica, Michele; Lisanti, Rocca Carmela; Manfredi, Antonio; Tecci, Giuseppe Romeo
2017-12-31
To assess any beneficial effect on quality of life of a daily treatment with a phytotherapic product containing astragalus, thyme, lavender, hop, equisetum, red clover, cypress and agrimonia at titrated concentrations in a cohort of female patients complaining mild stress urinary incontinence (SUI) or mixed urinary incontinence (MUI). 42 non-consecutive female out-patients with mild SUI or mild MUI were assessed with a clinical evaluation, International Consultation on Incontinence Questionnaire Short Form (ICIQ-SF) and Patients' Perception of Intensity of Urgency Scale (PPIUS) at baseline the start of the study and after two months of therapy with the phytotherapic product. At the end of the therapy the patients also compiled Patient Global Impression of Improvement (PGI-I). After the completion of the study there was a trend towards better results in each item of ICIQ-SF, but without any statistical significance with an average score in ICIQ-SF-1 of 3.12 ± 0.981 versus 3.21 ± 0.914 (p = 0.556), in ICIQ-SF-2 of 3.69 ± 1.422 versus 3.79 ± 1.372 (p = 0.68) and in ICIQ-SF-3 of 5.95 ± 1.618 versus 6.14 ± 1.670 (p = 0.462). The average reduction of PPIUS was of 0.09 (1.26 ± 1.481 versus 1.357 ± 1.509, p = 0.705). There was a reduction of average consumption of pads/die from 1.69 ± 0.636 to 1.54 ± 0.543 (p = 0.101). In relation to the PGI score, 23/42 patients (54.7%) reported no changes after the completion of the therapy, 13/42 (30.9%) reported a slight improvement, 5/42 (11.9%) were much improved and 1/42 (2.3%) was slightly worsened. Only 2/42 (4.7%) patients discontinued the treatment before of the completion of the study. We did not observe any adverse effects during the period of the study. The phytotherapic product seems to cause a slight improvement of the symptoms in a good rate of patients. Moreover it has a low rate of withdrawal, due to the lack of adverse events.
Journal of Biosciences | Indian Academy of Sciences
Indian Academy of Sciences (India)
In general, there were no considerable mycotoxin effects of the fungal exudates on the bradyrhizobial strain used, instead the rhizobial strain utilized the exudates as a source of nutrition. This study indicates that the present microbial association with biofilm formation has important implications in the survival of rhizobia ...
Enhancing the biological nitrogen fixation of leguminous crops ...
African Journals Online (AJOL)
Legumes have the ability to establish a symbiotic interaction with soil bacteria, collectively termed as rhizobia. These bacteria can enhance growth and development of associated crops by transferring atmospheric nitrogen into a form that is available for plant growth or by improving nutrient uptake through modulation of ...
Loureiro, M.D.; Kaschuk, G.; Alberton, O.; Hungria, M.
2007-01-01
In this study, soybean nodules were collected from 12 sites in the State of Mato Grosso, in the Brazilian Cerrados, where both exotic soybean [Glycine max (L.) Merrill] and bradyrhizobial strains have been introduced from 1 to 18 years before. All soils were originally devoid of rhizobia capable of
Plant-released flavonoids induce the transcription of symbiotic genes in rhizobia and one of the first bacterial responses is the synthesis of so called Nod factors. They are responsible for the initial root hair curling during onset of root nodule development. This signal exchange is believed to be...
A proteomic network for symbiotic nitrogen fixation efficiency in Bradyrhizobium elkanii
Rhizobia bacteroids colonize legumes and reduce N2 to NH3 in root nodules. The current model is that bacteroids avoid assimilating this NH3. Instead, the legume forms glutamine from it, the nitrogen of which is returned to the bacteroid as leucine, isoleucine, valine, dicarboxylates, and peptides. I...
de Oliveira, VM; Manfio, GP; Coutinho, HLD; Keijzer-Wolters, AC; van Elsas, JD
A direct molecular method for assessing the diversity of specific populations of rhizobia in soil, based on nested PCR amplification of 16S-23S ribosomal RNA gene (rDNA) intergenic spacer (IGS) sequences, was developed. Initial generic amplification of bacterial rDNA IGS sequences from soil DNA was
Oliveira, de V.M.; Manfio, G.P.; Coutinho, H.L.D.; Keijzer-Wolters, A.C.; Elsas, van J.D.
2006-01-01
A direct molecular method for assessing the diversity of specific populations of rhizobia in soil, based on nested PCR amplification of 16S-23S ribosomal RNA gene (rDNA) intergenic spacer (IGS) sequences, was developed. Initial generic amplification of bacterial rDNA IGS sequences from soil DNA was
Cocking, Edward C; Stone, Philip J; Davey, Michael R
2005-09-01
It has been forecast that the challenge of meeting increased food demand and protecting environmental quality will be won or lost in maize, rice and wheat cropping systems, and that the problem of environmental nitrogen enrichment is most likely to be solved by substituting synthetic nitrogen fertilizers by the creation of cereal crops that are able to fix nitrogen symbiotically as legumes do. In legumes, rhizobia present intracellularly in membrane-bound vesicular compartments in the cytoplasm of nodule cells fix nitrogen endosymbiotically. Within these symbiosomes, membrane-bound vesicular compartments, rhizobia are supplied with energy derived from plant photosynthates and in return supply the plant with biologically fixed nitrogen, usually as ammonia. This minimizes or eliminates the need for inputs of synthetic nitrogen fertilizers. Recently we have demonstrated, using novel inoculation conditions with very low numbers of bacteria, that cells of root meristems of maize, rice, wheat and other major non-legume crops, such as oilseed rape and tomato, can be intracellularly colonized by the non-rhizobial, non-nodulating, nitrogen fixing bacterium,Gluconacetobacter diazotrophicus that naturally occurs in sugarcane.G. diazotrophicus expressing nitrogen fixing (nifH) genes is present in symbiosome-like compartments in the cytoplasm of cells of the root meristems of the target cereals and non-legume crop species, somewhat similar to the intracellular symbiosome colonization of legume nodule cells by rhizobia. To obtain an indication of the likelihood of adequate growth and yield, of maize for example, with reduced inputs of synthetic nitrogen fertilizers, we are currently determining the extent to which nitrogen fixation, as assessed using various methods, is correlated with the extent of systemic intracellular colonization byG. diazotrophicus, with minimal or zero inputs.
The impact of using chickpea flour and dried carp fish powder on pizza quality
El-Beltagi, Hossam S.; El-Senousi, Naglaa A.; Ali, Zeinab A.; Omran, Azza A.
2017-01-01
Pizza being the most popular food worldwide, quality and sensory appeal are important considerations during its modification effort. This study was aimed to evaluate the quality of pizza made using two different sources of proteins, chickpea (Cicer arietinum) flour and dried carp fish powder (Cyprinus carpio). Analysis indicated nutrients richness specificity of chickpea flour (higher fiber, energy, iron, zinc, linoleic acid and total nonessential amino acids) and dried carp fish powder (high...
Improving competitive ability of chickpea with sowthistle
Cici, S.-Z.-H.; Kristiansen, P.; Sindel, B.M.
2005-01-01
An experiment was conducted to examine the extent of root and canopy interference of chickpea (Cicer arietinum L.) with sowthistle (Sonchus oleraceus L.). Sowthistle was surrounded with either two or eight chickpea plants. There were different types of competition: no competition, shoot competition, root competition and full competition (root and shoot). The performance of sowthistle grown in full competition with two chickpea plants was the same as that grown with root competition only. Al...
Historia de la investigación en la simbiosis leguminosa-bacteria: una perspectiva didáctica
Directory of Open Access Journals (Sweden)
Ramírez-Bahena, Marta Helena
2016-06-01
Full Text Available After cereals, legumes constitute the second most important family of crops for human and animal consumption. However, in contrast to the former, legumes are capable of growing in arid soils of low fertility, due to their ability to establish symbiotic associations with soil bacteria called rhizobia. These microorganisms form special organs in the roots of legumes called nodules, where atmospheric dinitrogen (N2 is transformed into ammonium that is exported to the plant for growth. Since their discovery in legume nodules until today, knowledge of the bacteria capable of establishing symbiosis with these plants has advanced in many aspects. Especially, advances in molecular techniques for bacterial identification and access to unexplored places have confirmed that the interaction of legumes with rhizobia is older, and that N2-fixing bacteria are more abundant and diverse, than considered previously. Here, we attempt to relate the history of an association whose development is key in the history of mankind as we know it now.Después de los cereales, las leguminosas constituyen la segunda familia en importancia para la alimentación humana y animal. Sin embargo, en contraste con ellos, las leguminosas son capaces de crecer en suelos áridos, de escasa fertilidad, lo que se debe a su capacidad para establecer asociaciones simbióticas con bacterias del suelo llamadas rhizobia. Estos microorganismos forman unos órganos especiales en las raíces de las leguminosas, los nódulos, donde el dinitrógeno (N2 atmosférico se transforma en amonio que se exporta a la planta para su crecimiento. Desde su descubrimiento en los nódulos de las leguminosas hasta nuestros días, el conocimiento de las bacterias capaces de establecer simbiosis con estas plantas ha avanzado en múltiples aspectos. Sobre todo, los avances en las técnicas moleculares de identificación bacteriana y el acceso a lugares inexplorados ha permitido confirmar que la interacción de las
Towards a better understanding of the role of reactive oxygen species in legume root nodules
Ramos Escribano, J.
2004-01-01
Biological N2 fixation is carried out exclusively by prokaryotes, either in the free-living form or in mutualistic symbioses with green algae, legumes and actinorhizal plants. The most agronomica1ly relevant symbiosis is, by fàr, that formed between soil rhizobia and legume roots. In addition, the
African Journals Online (AJOL)
komla
seven soils: Yucatan (from Mexico), San Isidro or low; shape as flat or raised; and colour as. (Costa Rica), Itabela ..... (Mexico) soil, isolates did not form clusters either according to host or geographical origin. Isolates obtained ... Biodiversity of rhizobia which nodulate fast-growing tree legumes in tropical soils. PhD thesis,.
FIXING ABILITY OF COWPEA (Vigna unguiculata (L) Walp)
African Journals Online (AJOL)
sys01
2011-09-03
Sep 3, 2011 ... mixture and later thinned to two plants per stand at two weeks after planting (2 WAP).,This gave a total population of about 80, 000 plants per ... nitrogen requirement from the atmosphere. Root nodules formed by soil rhizobia ..... solar radiation requirements on growth and nitrogen fixation of soybean,.
Applied bioinformatics: Genome annotation and transcriptome analysis
DEFF Research Database (Denmark)
Gupta, Vikas
agricultural and biological importance. Its capacity to form symbiotic relationships with rhizobia and microrrhizal fungi has fascinated researchers for years. Lotus has a small genome of approximately 470 Mb and a short life cycle of 2 to 3 months, which has made Lotus a model legume plant for many molecular...
smallholder farmers' use and profitability of legume inoculants
African Journals Online (AJOL)
ACSS
Rhizobia inoculant, a product of Kenya, and its profitability in smallholder farms. Data were collected from ... of the inoculants use and gross margin analysis to examine profitability. The area under the .... the effects of various factors on the extent of. BIOFIX® use. ..... little information, resulting in reduced adoption of legume ...
Directory of Open Access Journals (Sweden)
Alexandre Matsuda
2002-03-01
Full Text Available Sessenta estirpes/isolados dos gêneros Bradyrhizobium, Rhizobium, Sinorhizobium, Mesorhizobium e Azorhizobium, procedentes de diferentes locais (Mata Atlântica, Amazônia, culturas agrícolas e experimentos com metais pesados e de espécies hospedeiras pertencentes às subfamílias Papilionoideae, Mimosoideae e Caesalpinoideae, foram avaliadas quanto à tolerância a Zn, Cu e Cd em meio YMA modificado pela adição de tampões biológicos (HEPES e MES e suplementados com Cu (0 a 60 mg L-1, Cd (0 a 60 mg L-1 e Zn (0 a 1.000 mg L-1. Mediante padrões de crescimento atribuídos às culturas nas diferentes concentrações dos metais, avaliaram-se as concentrações máximas toleradas e as doses tóxicas destes metais para redução de crescimento em 25% (DT25 e 50% (DT50. Não houve influência da procedência na concentração máxima de metal tolerada. A ordem de sensibilidade aos metais, considerando-se as concentrações máximas toleradas, foi Azorhizobium > Rhizobium = Mesorhizobium = Sinorhizobium > Bradyrhizobium. A DT25 e a DT50 foram úteis para diferenciarem estirpes/isolados de um mesmo gênero, que atingiram a mesma concentração máxima tolerada a Zn, Cu e Cd. A ordem de toxicidade dos metais estudados foi Cu > Cd > Zn.Sixty strains/isolates of the genera Bradyrhizobium, Rhizobium, Sinorhizobium, Mesorhizobium and Azorhizobium, isolated from different hosts (legume subfamilies: Papilionoideae, Mimosoideae and Caesalpinoideae and location (Atlantic Forest, Amazon region, crop plantings and heavy metal experiments, were evaluated for Zn, Cu and Cd tolerance in YMA medium modified by the addition of biological buffers (HEPES and MES and supplemented with Cu (0 to 60 mg L-1, Cd (0 to 60 mg L-1, and Zn (0 to 1,000 mg L-1sulphates. Growth standards were applied to evaluate rhizobia cultures growth at different metal concentrations, allowing evaluation of highest tolerated concentrations of Zn, Cu, and Cd and the toxic doses
Environmental Assessment for a Global Reach Deployment Center and Ancillary Facilities
2005-07-07
akali milkvetch (Astragalus tener var. tener), Contra Costa goldfields (Lasthenia conjugens), and the San Joaquin spearscale (Atriplex joaquiniana... Costa goldfields (Lasthenia conjugens), a federally listed plant species. Building the Center at this site would also involve building within the land...AFB. Contra Costa goldfields is listed as federally endangered. Vernal pools are found throughout the Base. These sites vary in size from 1 acre
Anti-osteoporosis activity of Astragalus membranaceus Bunge ...
African Journals Online (AJOL)
Method: Female Sprague-Dawley rats were randomly divided into six groups: control group, ovariectomy (OVX) with vehicle group, OVX with 17β-estradiol (E2, 25 μg/kg/day) group, and OVX with AMBE doses (60, 120 ... Conclusion: The findings of this study indicate that AMBE prevents OVX-induced osteoporosis in rats.
C:\\Users\\HP Pro 2000\\Desktop\\FOSSOU K. R..xps
African Journals Online (AJOL)
HP Pro 2000
La diversité génétique a été étudiée par PCR-RFLP du gène codant l'ARNr 16S des bactéries. ... genetic diversity of rhizobia nodulating a pigeon pea field in Yamoussoukro (Center Ivory Coast). One ..... growing cowpea Rhizobium strain with.
African Journals Online (AJOL)
Megueni, C. Vol 3, No 5 (2009) - Articles Study on the isolation and characterization of rhizobia strains as biofertilizer tools for growth improvement of four grain legumes in Ngaoundéré-Cameroon Abstract PDF. ISSN: 1997-342X. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians ...
Phylogenetic diversity of Mesorhizobium in chickpea
Indian Academy of Sciences (India)
2014-04-29
Apr 29, 2014 ... uniform flowering/fruiting and seed maturation, etc., hap- pened several ... partnered with legume plants that were found to be ineffective nitrogen fixers ..... vides a rich resource for development of functional markers. PLoS ONE 7 ... Amarger N 2001 Classification of rhizobia based on nodC and. nifH gene ...
Roest, H.P.; Goosen-de Roo, L.; Wijffelman, C.A.; Maagd, de R.A.; Lugtenberg, B.J.J.
1995-01-01
The outer membrane of bacteroids contains largely decreased levels of protein antigen groups II and III in comparison with that of free-living rhizobia (R. A. de Maagd, R. de Rijk, I. H. M. Mulders, and B. J, J. Lugtenberg, J.Bacteriol, 171:1136-1142, 1989). Since we intend to study the molecular
Czech Academy of Sciences Publication Activity Database
Blavet, Nicolas; Uřinovská, J.; Jeřábková, Hana; Chamrád, I.; Vrána, Jan; Lenobel, R.; Beinhauer, D.; Šebela, M.; Doležel, Jaroslav; Petrovská, Beáta
2017-01-01
Roč. 8, č. 1 (2017), s. 70-80 ISSN 1949-1034 R&D Projects: GA ČR(CZ) GA14-28443S; GA MŠk(CZ) LO1204 Institutional support: RVO:61389030 Keywords : cicer-arietinum l. * rice oryza-sativa * chromatin-associated protein s * proteomic analysis * mitotic chromosomes * dehydration * localization * chickpea * network * phosphoproteome * barley * cell cycle * database * flow-cytometry * localization * mass spectrometry * nuclear proteome * nucleus Subject RIV: CE - Biochemistry OBOR OECD: Cell biology Impact factor: 2.387, year: 2016
Symbiotic effectiveness of pea-rhizobia associations and the ...
African Journals Online (AJOL)
Selected strains were isolated from the root nodules of pea (Pisum sativum L.), broad bean (Vicia faba L.) and lentil (Lens culinaris L.) plants in the Loess Plateau of China. Analyses focused on the nodule number, nodule dry weight, plant dry weight, nitrogenase activity, total N accumulation of per plant and seed yield.
Ames, Peter; Bergman, Kostia
1981-01-01
The effect of motility on the competitive success of Rhizobium meliloti in nodule production was investigated. A motile strain formed more nodules than expected when mixed at various unfavorable ratios with either flagellated or nonflagellated nonmotile derivatives. We conclude that motility confers a selective advantage on rhizobia when competing with nonmotile strains. PMID:7298580
Potential use of rhizobial bacteria as promoters of plant growth for ...
African Journals Online (AJOL)
Rhizobia form root nodules that fix nitrogen (N2) in symbiotic legumes. Extending the ability of these bacteria to fix N2 in non-legumes such as cereals would be a useful technology for increased crop yields among resource-poor farmers. Although some inoculation attempts have resulted in nodule formation in cereal plants, ...
Environmental Assessment: Military Family Housing Revitalization Travis Air Force Base, California
2007-05-01
area that, with the San Joaquin Valley to the south, forms the Great Central Valley of California. The Coast Ranges bound the valley to the west. In...Endangered Species Common Name Scientific Name Federal Status State Status Plants Colusa grass Neostapfia colusana T E Contra Costa goldfields...federally listed species, Contra Costa goldfields, vernal pool fairy shrimp, California tiger salamander, and alkali milk-vetch (Astragalus tener var. tener
The leguminous species Anthyllis vulneraria as a Zn-hyperaccumulator and eco-Zn catalyst resources.
Grison, Claire M; Mazel, Marine; Sellini, Amandine; Escande, Vincent; Biton, Jacques; Grison, Claude
2015-04-01
Anthyllis vulneraria was highlighted here as a Zn-hyperaccumulator for the development of a pilot phytoextraction process in the mine site of Les Avinières in the district of Saint-Laurent-Le-Minier. A. vulneraria appeared to hyperaccumulate the highest concentration of Zn in shoots with a better metal selectivity relative to Cd and Pb than the reference Zn-hyperaccumulator Noccea caerulescens. A bigger biomass production associated to a higher Zn concentration conducted A. vulneraria to the highest total zinc gain per hectare per year. As a legume, A. vulneraria was infected by rhizobia symbionts. Inoculation of A. vulneraria seeds showed a positive impact on Zn hyperaccumulation. A large-scale culture process of symbiotic rhizobia of A. vulneraria was investigated and optimized to allow large-scale inoculation process. Contaminated shoots of A. vulneraria were not considered as wastes and were recovered as Eco-Zn catalyst in particular, examples of organic synthesis, electrophilic aromatic substitution. Eco-Zn catalyst was much more efficient than conventional catalysts and allowed greener chemical processes.
Land use and vegetation cover on native symbionts and interactions with cowpea
Directory of Open Access Journals (Sweden)
Beatriz C. F. Rocha
Full Text Available ABSTRACT Arbuscular mycorrhizal fungi and rhizobia are important components of agroecosystems and they respond to human interference. The objective of this study was to investigate native communities of those microorganisms in soil collected under the native forest, four pastures (Brachiaria brizantha, Panicum maximum, Arachis pintoi and Stylosanthes guianensis and a fallow soil after maize cultivation, in interaction with cowpea (Vigna unguculata. The cowpea grew in a greenhouse until flowering. They were randomly distributed depending on soil, in five replications. The lowest mycorrhizal fungi sporulation and mycorrhizal root colonization occurred under the Panicum and forest soil. In the soils under forest and Stylosanthes, the cowpea did not exhibit nodules and grew less. Among the anthropized areas, the effect was variable, with stimulus to the multiplication and symbiosis of these microorganisms, except in areas of Panicum and Stylosanthes. When the native vegetation is substituted by pasture or farming, the mycorrhizal fungi and rhizobia proliferation predominate. However, the effect and its magnitude depends on the grown plant species, with reflects on the plant species in succession, such as the cowpea.