WorldWideScience

Sample records for astatine 223

  1. Radiochemistry of astatine

    International Nuclear Information System (INIS)

    Ruth, T.J.; Dombsky, M.; D'Auria, J.M.; Ward, T.E.

    1988-01-01

    This monograph is a review of the literature through 1987 and covers the methods of producing the radioisotopes of astatine and the inorganic, nuclear, and organic chemistry of astatine. The discussion is limited to chemical and physical chemical properties of astatine. The monograph, after the introduction, is divided into chapters titled: production methods, nuclear spectroscopy, chemistry of astatine, separation and isolation (dry and wet), and selected procedures. 209 refs., 15 figs., 7 tabs

  2. Formation and decomposition of astatine molecules

    International Nuclear Information System (INIS)

    Takahashi, Naruto; Ishikuro, Mituhiro; Baba Hiroshi

    1989-01-01

    A method determining the boiling points of elementary astatine and astatine iodide has been developed (K. Otozai and N. Takahashi, Radio. Chim. Acta 31, (1982) 201). Further, it was concluded from the simple rule among the boiling point of elementary halogens and interhalogen compounds that elementary astatine might exist in diatomic molecules as the other halogens. In the present work the reaction mechanisms of elementary astatine with radioactive iodine and organic solvents were studied by means of radiogaschromatography in order to obtain further experimental evidences for diatomic astaine molecules. The following conclusions were obtained by the analysis of reaction kinetics. Two astatine atoms are lost from the elementary astatine fraction per each radioactive decay of astatine. The astatine radical or hot atom liberated by the decay of the complementary astatine atom immediately reacts with iodine or organic solvents. Thus formed astatine compounds decompose in turn due to the decay of astatine

  3. Organic astatine compounds, their preparation and properties

    Energy Technology Data Exchange (ETDEWEB)

    Vasaros, L; Berei, K

    1985-01-01

    Aromatic astatine compounds of possible medical application were prepared by high energy substitutions, by astatine-halogen, and by electrophil astatine-hydrogen substitutions at the Joint Institute of Nuclear Researches, Dubna. Physico-chemical properties of organic astatine compounds such as boiling point and evaporation heat, and the refraction and dissociation energy of carbon-astatine bonds were determined experimentally by gas chromatography. The results are compared with extrapolated data. (V.N.). 41 refs.; 7 figs.; 5 tables.

  4. Bibliography of astatine chemistry and biomedical applications

    International Nuclear Information System (INIS)

    Berei, K.; Vasaros, L.

    1992-02-01

    An overall bibliography is presented on astatine chemistry and on the biomedical applications of its 211 At isotope. The references were grouped in the following chapters: General reviews; Discovery, Natural Occurence; Nuclear Data; Preparation, Handling, Radiation Risk; Physico-chemical Properties; Astatine Compounds and Chemical Reactions; Biological Effects and Applications. Entries are sorted alphabetically by authors name in each chapter, and cross-references to other chapters are provided if appropriate. (R.P.)

  5. Recent advances in the organic chemistry of astatine

    International Nuclear Information System (INIS)

    Berei, K.; Vasaros, L.

    1994-03-01

    Investigation on the chemical behaviour of astatine in the last decade are surveyed. The survey covers the physical and chemical properties of astatine, synthesis and identification of organic astatine compounds, their physicochemical properties. A special chapter is devoted to biomedical applications, including inorganic 211 At species, 211 At-labelled proteins and drugs. An extensive bibliography of the related literature is given. (N.T.) 129 refs.; 12 figs.; 14 tabs

  6. Experimental and computational evidence of halogen bonds involving astatine

    Science.gov (United States)

    Guo, Ning; Maurice, Rémi; Teze, David; Graton, Jérôme; Champion, Julie; Montavon, Gilles; Galland, Nicolas

    2018-03-01

    The importance of halogen bonds—highly directional interactions between an electron-deficient σ-hole moiety in a halogenated compound and an acceptor such as a Lewis base—is being increasingly recognized in a wide variety of fields from biomedicinal chemistry to materials science. The heaviest halogens are known to form stronger halogen bonds, implying that if this trend continues down the periodic table, astatine should exhibit the highest halogen-bond donating ability. This may be mitigated, however, by the relativistic effects undergone by heavy elements, as illustrated by the metallic character of astatine. Here, the occurrence of halogen-bonding interactions involving astatine is experimentally evidenced. The complexation constants of astatine monoiodide with a series of organic ligands in cyclohexane solution were derived from distribution coefficient measurements and supported by relativistic quantum mechanical calculations. Taken together, the results show that astatine indeed behaves as a halogen-bond donor—a stronger one than iodine—owing to its much more electrophilic σ-hole.

  7. The reaction of astatine with aromatic diazonium compounds

    International Nuclear Information System (INIS)

    Visser, G.W.M.; Diemer, E.L.

    1982-01-01

    Astatine reacts prefrentially with that type of aromatic diazonium salt that decomposes via a radical reaction channel (homolytic breakage of the C-N bond). The dediazonation with p-aminobenzoic acid and p-toluidine as model compounds was investigated through estatin produced in the 209 Bi(α,2n) 211 At reaction. (author)

  8. Measurement of the first ionization potential of astatine by laser ionization spectroscopy

    Science.gov (United States)

    Rothe, S.; Andreyev, A. N.; Antalic, S.; Borschevsky, A.; Capponi, L.; Cocolios, T. E.; De Witte, H.; Eliav, E.; Fedorov, D. V.; Fedosseev, V. N.; Fink, D. A.; Fritzsche, S.; Ghys, L.; Huyse, M.; Imai, N.; Kaldor, U.; Kudryavtsev, Yuri; Köster, U.; Lane, J. F. W.; Lassen, J.; Liberati, V.; Lynch, K. M.; Marsh, B. A.; Nishio, K.; Pauwels, D.; Pershina, V.; Popescu, L.; Procter, T. J.; Radulov, D.; Raeder, S.; Rajabali, M. M.; Rapisarda, E.; Rossel, R. E.; Sandhu, K.; Seliverstov, M. D.; Sjödin, A. M.; Van den Bergh, P.; Van Duppen, P.; Venhart, M.; Wakabayashi, Y.; Wendt, K. D. A.

    2013-01-01

    The radioactive element astatine exists only in trace amounts in nature. Its properties can therefore only be explored by study of the minute quantities of artificially produced isotopes or by performing theoretical calculations. One of the most important properties influencing the chemical behaviour is the energy required to remove one electron from the valence shell, referred to as the ionization potential. Here we use laser spectroscopy to probe the optical spectrum of astatine near the ionization threshold. The observed series of Rydberg states enabled the first determination of the ionization potential of the astatine atom, 9.31751(8) eV. New ab initio calculations are performed to support the experimental result. The measured value serves as a benchmark for quantum chemistry calculations of the properties of astatine as well as for the theoretical prediction of the ionization potential of superheavy element 117, the heaviest homologue of astatine. PMID:23673620

  9. Automated astatination of biomolecules - a stepping stone towards multicenter clinical trials

    DEFF Research Database (Denmark)

    Aneheim, Emma; Albertsson, Per; Bäck, Tom

    2015-01-01

    To facilitate multicentre clinical studies on targeted alpha therapy, it is necessary to develop an automated, on-site procedure for conjugating rare, short-lived, alpha-emitting radionuclides to biomolecules. Astatine-211 is one of the few alpha-emitting nuclides with appropriate chemical...... vector, which can guide the radiation to the cancer cells. Consequently, an appropriate method is required for coupling the nuclide to the vector. To increase the availability of astatine-211 radiopharmaceuticals for targeted alpha therapy, their production should be automated. Here, we present a method...... challenging, alpha-emitting radionuclide. In this work, we describe the process platform, and we demonstrate the production of both astaine-211, for preclinical use, and astatine-211 labelled antibodies....

  10. Synthesis and Evaluation of Astatinated N-[2-(Maleimido)ethyl]-3-(trimethylstannyl)benzamide Immunoconjugates

    DEFF Research Database (Denmark)

    Aneheim, Emma; Gustafsson, Anna; Albertsson, Per

    2016-01-01

    Effective treatment of metastasis is a great challenge in the treatment of different types of cancers. Targeted alpha therapy utilizes the short tissue range (50-100 μm) of α particles, making the method suitable for treatment of disseminated occult cancers in the form of microtumors or even single...... to the antibody arbitrarily on lysine residues. By instead coupling astatine to disulfide bridges in the antibody structure, the immunoreactivity of the antibody conjugates could possibly be increased. Here, the disulfide-based conjugation was performed using a new coupling reagent, maleimidoethyl 3......-(trimethylstannyl)benzamide (MSB), and evaluated for chemical stability in vitro. The immunoconjugates were subsequently astatinated, resulting in both high radiochemical yield and high specific activity. The MSB-conjugate was shown to be stable with a long shelf life prior to the astatination. In a comparison...

  11. Some aspects of the organic, biological and inorganic chemistry of astatine

    International Nuclear Information System (INIS)

    Visser, G.W.M.

    1982-01-01

    Astatine has no stable isotopes and the radioactive isotopes with half-lives sufficiently long for chemical experiments ( 209 At, 210 At, 211 At) must be produced artificially with a cyclotron or with a high energy accelerator by spallation of Th. This thesis deals with the synthesis and chemistry of At-compounds and the determination of some of their properties. (C.F.)

  12. Direct astatination of a tumour-binding protein, human epidermal growth factor, using nido-carborane as a prosthetic group

    International Nuclear Information System (INIS)

    Sjoestroem, A.; Carlsson, J.; Lundqvist, H.; Koziorowski, J.

    2003-01-01

    A method for direct astatine labeling of proteins has been investigated. Binding sites for astatine were created by coupling of a nido-carborane derivative to a protein, the human epidermal growth factor (hEGF), using two different conjugation methods - by glutaraldehyde cross-linking or by introduction of sulfohydryl groups by Traut's reagent with subsequent linking of ANC-1 with m-maleimidobenzoyl-N-hydroxysulfosuccinimide ester. The conjugates were astatinated using the Chloramine-T method in high yield. The best labeling was obtained by the glutaraldehyde conjugate with an average yield of 68 ± 9%. In vitro stability tests indicated that the glutaraldehyde conjugated label was as stable as hEGF labeled with astatobenzoate. (author)

  13. Estimation of the chemical form and the boiling point of elementary astatine by radiogas-chromatography

    International Nuclear Information System (INIS)

    Otozai, K.; Takahashi, N.

    1982-01-01

    After astatine (0) was mixed with 131 I 2 containing carrier I 2 , the sample was analyzed by means of radiogaschromatography and the peaks due to I 2 , AtI and At 2 were observed. Further, the boiling points were estimated from the retention volume in terms of the semi-empirical theory on gas chromatography. The boiling points of I 2 , AtI and At 2 were 457 +- 2,486 +- 2 and 503 +- 3K, respectively. The boiling point of At 2 obtained in the present work is far smaller than that expected by the extrapolation of lighter halogens. (orig.)

  14. Direct astatination of a tumour-binding protein, human epidermal growth factor, using nido-carborane as a prosthetic group

    Czech Academy of Sciences Publication Activity Database

    Sjostrom, A.; Tolmachev, V.; Lebeda, Ondřej; Koziorowski, J.; Carlsson, J.; Lundqvist, H.

    2003-01-01

    Roč. 256, č. 7 (2003), s. 191-197 ISSN 0236-5731 R&D Projects: GA AV ČR KSK4055109 Keywords : neutron-capture therapy * astatine-211 Subject RIV: CH - Nuclear ; Quantum Chemistry Impact factor: 0.472, year: 2003

  15. 211At-Rh(16-S4-diol) complex as a precursor for astatine radiopharmaceuticals

    International Nuclear Information System (INIS)

    Pruszynski, M.; Bilewicz, A.

    2006-01-01

    211 At is one of the most promising radionuclides in α-radioimmunotherapy (α-RIT). Unfortunately, biomolecules labeled by direct electrophilic astatination are unstable due to the rapid loss of 211 At under both in vitro and in vivo conditions. The present paper describes the results of our studies on attaching At - to the rhodium(III) complex with thioether ligand: 1,5,9,13-etrathiacyclohexadecane-3,11-diol (16-S4-diol). Rh 3+ was chosen as a moderately soft metal cation which should form very strong bonds with soft At - anions, but first of all because of the kinetic inertness of low spin rhodium(III) d 6 complexes. The 16-S4-diol ligand was selected due to formation of stable complexes with Rh 3+ . The experiments related to optimization of the reaction conditions were performed with the 131 I, basing on a chemical similarity of I - to At - . The experiments with 211 At were then carried out under the conditions found optimal for I - . The preliminary results are promising, and indicate a possibility for astatination of biomolecules by using the 211 At-Rh(16-S4-diol) complex

  16. ORIGINAL ARTICLE 223

    African Journals Online (AJOL)

    boaz

    Level of education of parents, occupation of mothers, sexual relationship and ... This work is licensed under the Creative Commons Attribution 4.0 International License CC-BY. 223 .... Detection of growth was checked daily for T. 224 ...

  17. Complexation study on no-carrier-added astatine with insulin: A candidate radiopharmaceutical

    Energy Technology Data Exchange (ETDEWEB)

    Lahiri, Susanta [Chemical Sciences Division, Saha Institute of Nuclear Physics, 1/AF Bidhannagar, Kolkata 700 064 (India)], E-mail: susanta.lahiri@saha.ac.in; Roy, Kamalika [Chemical Sciences Division, Saha Institute of Nuclear Physics, 1/AF Bidhannagar, Kolkata 700 064 (India); Sen, Souvik [Berhampur Sadar Hospital, Berhampur, Murshidabad 742 101 (India)

    2008-12-15

    No-carrier-added astatine radionuclides produced in the {sup 7}Li-irradiated lead matrix were separated from bulk lead nitrate target by complexing At with insulin, followed by dialysis. The method offers simultaneous separation of At from lead as well as its complexation with insulin. The At-insulin complex might be a potential radiopharmaceutical in the treatment of hepatocellular carcinoma. The stability of At-insulin complex was checked by dialysis against deionized water and Ringer lactate (RL) solution. It has been found that the half-life of At-insulin complex is about {approx}12 h, when dialyzed against deionized water and is only 6 h, when dialyzed against RL solution having the same composition as blood serum. The 6 h half-life of this Insulin-At complex is perfect for killing cancer cells from external cell surfaces as the half-life of internalization of insulin molecule inside the cell is 7-12 h.

  18. Laser photodetachment of radioactive ions: towards the determination of the electronegativity of astatine

    CERN Multimedia

    Rothe, Sebastian; Welander, Jakob Emanuel; Chrysalidis, Katerina; Day Goodacre, Thomas; Fedosseev, Valentine; Fiotakis, Spyridon; Forstner, Oliver; Heinke, Reinhard Matthias; Johnston, Karl; Kron, Tobias; Koester, Ulli; Liu, Yuan; Marsh, Bruce; Ringvall Moberg, Annie; Rossel, Ralf Erik; Seiffert, Christoph; Studer, Dominik; Wendt, Klaus; Hanstorp, Dag

    2017-01-01

    Negatively charged ions are mainly stabilized through the electron correlation effect. A measure of the stability of a negative ion is the electron affinity, which the energy gain by attaching an electron to a neutral atom. This fundamental quantity is, due to the almost general lack of bound excited states, the only atomic property that can be determined with high accuracy for negative ions. We will present the results of the first laser photodetachment studies of radioactive negative ions at CERN-ISOLDE. The photodetachment threshold for the radiogenic iodine isotope 128I was measured successfully, demonstrating the performance of the upgraded GANDALPH experimental beam line. The first detection of photo-detached astatine atoms marks a milestone towards the determination of the EA of this radioactive element.

  19. Thermogravimetric determination of the enthalpy of astatine and radon adsorption on palladium surfaces

    International Nuclear Information System (INIS)

    Eichler, B.; Son Chun, K.

    1985-01-01

    In order to investigate the adsorption of astatine and radon on a palladium surface some on- and off-line thermochromatographic experiments were carried out with 210 At and 220 Rn tracers. The partial molar adsorption enthalpy for zero covering was found to be ΔH/sub a//sup 0, loc./(At) = -(15S +- 10) kJ mole -1 and ΔH/sub a//sup 0, mob./(Rn) = -(37 +- 4) kJ mole -1 . The results are compared with theoretical and experimental values for other elements of the sixth period. The adsorption behaviour of At is in conformity with that of the p-metals on a palladium surface. (author)

  20. Determination of the electron affinity of astatine and polonium by laser photodetachment

    CERN Multimedia

    We propose to conduct the first electron affinity (EA) measurements of the two elements astatine (At) and polonium (Po). Collinear photo-detachment spectroscopy will allow us to measure these quantities with an uncertainty limited only by the spectral line width of the laser. We plan to use negative ion beams of the two radioactive elements At and Po, which are only accessible on-line and at ISOLDE. The feasibility of our proposed method and the functionality of the experimental setup have been demonstrated at ISOLDE in off-line tests by the clear observation of the photo-detachment threshold for stable iodine. This proposal is based on our Letter of Intent I-148.

  1. Complexation study on no-carrier-added astatine with insulin: A candidate radiopharmaceutical

    International Nuclear Information System (INIS)

    Lahiri, Susanta; Roy, Kamalika; Sen, Souvik

    2008-01-01

    No-carrier-added astatine radionuclides produced in the 7 Li-irradiated lead matrix were separated from bulk lead nitrate target by complexing At with insulin, followed by dialysis. The method offers simultaneous separation of At from lead as well as its complexation with insulin. The At-insulin complex might be a potential radiopharmaceutical in the treatment of hepatocellular carcinoma. The stability of At-insulin complex was checked by dialysis against deionized water and Ringer lactate (RL) solution. It has been found that the half-life of At-insulin complex is about ∼12 h, when dialyzed against deionized water and is only 6 h, when dialyzed against RL solution having the same composition as blood serum. The 6 h half-life of this Insulin-At complex is perfect for killing cancer cells from external cell surfaces as the half-life of internalization of insulin molecule inside the cell is 7-12 h

  2. Comment: 223 [Taxonomy Icon

    Lifescience Database Archive (English)

    Full Text Available 223.png Shinobu Okamoto (Kazusa DNA Research Institute ) licensed under CC Attribution2.1 Japan シアノバクテリア 電子顕微鏡写真 撮影:岡本忍(かずさDNA研究所) bando 2009/11/05 18:33:52 2010/02/16 10:25:27 ...

  3. Astatine-211 Radiochemistry: The Development Of Methodologies For High Activity Level Radiosynthesis

    International Nuclear Information System (INIS)

    Zalutsky, Michael R.

    2012-01-01

    Targeted radionuclide therapy is emerging as a viable approach for cancer treatment because of its potential for delivering curative doses of radiation to malignant cell populations while sparing normal tissues. Alpha particles such as those emitted by 211At are particularly attractive for this purpose because of their short path length in tissue and high energy, making them highly effective in killing cancer cells. The current impact of targeted radiotherapy in the clinical domain remains limited despite the fact that in many cases, potentially useful molecular targets and labeled compounds have already been identified. Unfortunately, putting these concepts into practice has been impeded by limitations in radiochemistry methodologies. A critical problem is that the synthesis of therapeutic radiopharmaceuticals provides additional challenges in comparison to diagnostic reagents because of the need to perform radio-synthesis at high levels of radioactivity. This is particularly important for α-particle emitters such as 211At because they deposit large amounts of energy in a highly focal manner. The overall objective of this project is to develop convenient and reproducible radiochemical methodologies for the radiohalogenation of molecules with the α-particle emitter 211At at the radioactivity levels needed for clinical studies. Our goal is to address two problems in astatine radiochemistry: First, a well known characteristic of 211At chemistry is that yields for electrophilic astatination reactions decline as the time interval after radionuclide isolation from the cyclotron target increases. This is a critical problem that must be addressed if cyclotrons are to be able to efficiently supply 211At to remote users. And second, when the preparation of high levels of 211At-labeled compounds is attempted, the radiochemical yields can be considerably lower than those encountered at tracer dose. For these reasons, clinical evaluation of promising 211At-labeled targeted

  4. ASTATINE-211 RADIOCHEMISTRY: THE DEVELOPMENT OF METHODOLOGIES FOR HIGH ACTIVITY LEVEL RADIOSYNTHESIS

    Energy Technology Data Exchange (ETDEWEB)

    MICHAEL R. ZALUTSKY

    2012-08-08

    Targeted radionuclide therapy is emerging as a viable approach for cancer treatment because of its potential for delivering curative doses of radiation to malignant cell populations while sparing normal tissues. Alpha particles such as those emitted by 211At are particularly attractive for this purpose because of their short path length in tissue and high energy, making them highly effective in killing cancer cells. The current impact of targeted radiotherapy in the clinical domain remains limited despite the fact that in many cases, potentially useful molecular targets and labeled compounds have already been identified. Unfortunately, putting these concepts into practice has been impeded by limitations in radiochemistry methodologies. A critical problem is that the synthesis of therapeutic radiopharmaceuticals provides additional challenges in comparison to diagnostic reagents because of the need to perform radio-synthesis at high levels of radioactivity. This is particularly important for {alpha}-particle emitters such as 211At because they deposit large amounts of energy in a highly focal manner. The overall objective of this project is to develop convenient and reproducible radiochemical methodologies for the radiohalogenation of molecules with the {alpha}-particle emitter 211At at the radioactivity levels needed for clinical studies. Our goal is to address two problems in astatine radiochemistry: First, a well known characteristic of 211At chemistry is that yields for electrophilic astatination reactions decline as the time interval after radionuclide isolation from the cyclotron target increases. This is a critical problem that must be addressed if cyclotrons are to be able to efficiently supply 211At to remote users. And second, when the preparation of high levels of 211At-labeled compounds is attempted, the radiochemical yields can be considerably lower than those encountered at tracer dose. For these reasons, clinical evaluation of promising 211At

  5. Part I: $\\beta$-delayed fission, laser spectroscopy and shape-coexistence studies with astatine beams; Part II: Delineating the island of deformation in the light gold isotopes by means of laser spectroscopy

    CERN Document Server

    Andreyev, Andrei

    2013-01-01

    Part I: $\\beta$-delayed fission, laser spectroscopy and shape-coexistence studies with astatine beams; Part II: Delineating the island of deformation in the light gold isotopes by means of laser spectroscopy

  6. In vitro evaluation of the astatinated chimeric monoclonal antibody U36, a potential candidate for treatment of head and neck squamous cell carcinoma

    Energy Technology Data Exchange (ETDEWEB)

    Nestor, M.; Anniko, M. [Uppsala University, Unit of Otolaryngology and Head and Neck Surgery, Department of Surgical Sciences, Uppsala (Sweden); Persson, M. [Uppsala University, Unit of Urology, Department of Surgical Sciences, Uppsala (Sweden); Uppsala University, Unit of Biomedical Radiation Science, Department of Oncology, Radiology and Clinical Immunology, Uppsala (Sweden); Dongen, G.A.M.S. van [Vrije Universiteit Medical Center, Department of Otolaryngology/Head and Neck Surgery, Amsterdam (Netherlands); Jensen, H.J. [Righshospitalet, PET and Cyclotron Unit, Department of Clinical Physiology and Nuclear Medicine, Copenhagen (Denmark); Lundqvist, H.; Tolmachev, V. [Uppsala University, Unit of Biomedical Radiation Science, Department of Oncology, Radiology and Clinical Immunology, Uppsala (Sweden)

    2005-11-01

    The purpose of this study was to analyse the properties of the astatinated chimeric MAb (cMAb) U36 as a conjugate to selectively target and eradicate head and neck squamous cell carcinoma (HNSCC). cMAb U36 was labelled with {sup 211}At via the linker N-succinimidyl 4-(trimethylstannyl)benzoate (SPMB). The quality of the conjugate was extensively evaluated for binding and internalisation capacity, and compared with {sup 125}I-SPMB-cMAb U36. The cellular toxicity of the astatinated conjugate was assessed in two types of in vitro growth assay and compared with {sup 131}I-labelled cMAb U36 (directly labelled). Comparisons between {sup 211}At-cMAb U36 and {sup 125}I-cMAb U36 demonstrated an optimal functional capacity of the labelled products. Immunoreactivity and affinity assays showed high immunoreactive fractions (>93%), and an affinity in good agreement between the astatinated and iodinated antibodies. For both conjugates, specific binding to HNSCC cells could be demonstrated, as well as some internalisation. Retention of the astatinated conjugate was just slightly lower than for the iodinated conjugate and still reasonable for therapeutic use (31{+-}2% vs 42.6{+-}1.0% at 22 h), demonstrating no adverse effects from astatination of the antibody. Studies on cellular toxicity demonstrated a dose-dependent and antigen-specific cellular toxicity for {sup 211}At-cMAb U36, with about 10% cell survival at 50 decays per cell. The {sup 131}I-labelled conjugate was not as efficient, with a surviving cell fraction of about 50% at 55 decays per cell. (orig.)

  7. In vitro evaluation of the astatinated chimeric monoclonal antibody U36, a potential candidate for treatment of head and neck squamous cell carcinoma

    International Nuclear Information System (INIS)

    Nestor, M.; Anniko, M.; Persson, M.; Dongen, G.A.M.S. van; Jensen, H.J.; Lundqvist, H.; Tolmachev, V.

    2005-01-01

    The purpose of this study was to analyse the properties of the astatinated chimeric MAb (cMAb) U36 as a conjugate to selectively target and eradicate head and neck squamous cell carcinoma (HNSCC). cMAb U36 was labelled with 211 At via the linker N-succinimidyl 4-(trimethylstannyl)benzoate (SPMB). The quality of the conjugate was extensively evaluated for binding and internalisation capacity, and compared with 125 I-SPMB-cMAb U36. The cellular toxicity of the astatinated conjugate was assessed in two types of in vitro growth assay and compared with 131 I-labelled cMAb U36 (directly labelled). Comparisons between 211 At-cMAb U36 and 125 I-cMAb U36 demonstrated an optimal functional capacity of the labelled products. Immunoreactivity and affinity assays showed high immunoreactive fractions (>93%), and an affinity in good agreement between the astatinated and iodinated antibodies. For both conjugates, specific binding to HNSCC cells could be demonstrated, as well as some internalisation. Retention of the astatinated conjugate was just slightly lower than for the iodinated conjugate and still reasonable for therapeutic use (31±2% vs 42.6±1.0% at 22 h), demonstrating no adverse effects from astatination of the antibody. Studies on cellular toxicity demonstrated a dose-dependent and antigen-specific cellular toxicity for 211 At-cMAb U36, with about 10% cell survival at 50 decays per cell. The 131 I-labelled conjugate was not as efficient, with a surviving cell fraction of about 50% at 55 decays per cell. (orig.)

  8. High-efficiency astatination of antibodies using N-iodosuccinimide as the oxidising agent in labelling of N-succinimidyl 3-(trimethylstannyl)benzoate

    International Nuclear Information System (INIS)

    Lindegren, S.; Andersson, H.; Baeck, T.; Jacobsson, L.; Karlsson, B.; Skarnemark, G.

    2001-01-01

    Monoclonal antibodies C215, reactive with colorectal carcinomas, and MOv18, reactive with most of the ovarian carcinomas, were radiohalogenated with [ 211 At]astatine. The radiohalogen was conjugate coupled to antibodies via the intermediate labelling reagent N-succinimidyl-3-(trimethylstannyl)benzoate (m-MeATE) in a two-step, single-pot reaction. Optimisation of the labelling of the reagent was achieved using N-iodosuccinimide, NIS, as the oxidising agent. The yields ranged from 69-95% in the labelling of 0.1-1.0 nmole of the m-MeATE precursor. Subsequent conjugation to antibodies resulted in yields of 58±7%. In vitro binding to tumour cells showed that the immunoreactivity of both antibodies was retained after astatine labelling

  9. An all-solid state laser system for the laser ion source RILIS and in-source laser spectroscopy of astatine at ISOLDE, CERN

    CERN Document Server

    Rothe, Sebastian; Nörtershäuser, W

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at ISOLDE, CERN, by the addition of an all-solid state tuneable titanium: sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE, CERN, and at ISAC, TRIUMF, radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.

  10. An all-solid state laser system for the laser ion sources RILIS and in-source laser spectroscopy of astatine at ISOLDE/CERN

    International Nuclear Information System (INIS)

    Rothe, Sebastian

    2012-01-01

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at CERN/ISOLDE by the addition of an all-solid state tunable titanium:sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE/CERN and at ISAC/TRIUMF radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.

  11. An all-solid state laser system for the laser ion sources RILIS and in-source laser spectroscopy of astatine at ISOLDE/CERN

    Energy Technology Data Exchange (ETDEWEB)

    Rothe, Sebastian

    2012-09-24

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at CERN/ISOLDE by the addition of an all-solid state tunable titanium:sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE/CERN and at ISAC/TRIUMF radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.

  12. Radiobiological Effects of Alpha-Particles from Astatine-211: From DNA Damage to Cell Death

    Energy Technology Data Exchange (ETDEWEB)

    Claesson, Kristina

    2011-05-15

    In recent years, the use of high linear energy transfer (LET) radiation for radiotherapeutic applications has gained increased interest. Astatine-211 (211At) is an alpha-particle emitting radionuclide, promising for targeted radioimmunotherapy of isolated tumor cells and microscopic clusters. To improve development of safe radiotherapy using 211At it is important to increase our knowledge of the radiobiological effects in cells. During radiotherapy, both tumors and adjacent normal tissue will be irradiated and therefore, it is of importance to understand differences in the radio response between proliferating and resting cells. The aim of this thesis was to investigate effects in fibroblasts with different proliferation status after irradiation with alpha-particles from 211At or X-rays, from inflicted DNA damage, to cellular responses and biological consequences. Throughout this work, irradiation was performed with alpha-particles from 211A or X-rays. The induction and repair of double-strand breaks (DSBs) in human normal fibroblasts were investigated using pulsed-field gel electrophoresis and fragment analysis. The relative biological effectiveness (RBE) of 211At for DSB induction varied between 1.4 and 3.1. A small increase of DSBs was observed in cycling cells compared to stationary cells. The repair kinetics was slower after 211At and more residual damage was found after 24 h. Comparison between cells with different proliferation status showed that the repair was inefficient in cycling cells with more residual damage, regardless of radiation quality. Activation of cell cycle arrests was investigated using immunofluorescent labeling of the checkpoint kinase Chk2 and by measuring cell cycle distributions with flow cytometry analysis. After alpha-particle irradiation, the average number of Chk2-foci was larger and the cells had a more affected cell cycle progression for several weeks compared with X-irradiated cells, indicating a more powerful arrest after 211At

  13. 14 CFR 145.223 - FAA inspections.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false FAA inspections. 145.223 Section 145.223... OTHER CERTIFICATED AGENCIES REPAIR STATIONS Operating Rules § 145.223 FAA inspections. (a) A certificated repair station must allow the FAA to inspect that repair station at any time to determine...

  14. 36 CFR 223.220 - Quantity determination.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Quantity determination. 223.220 Section 223.220 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE SALE AND DISPOSAL OF NATIONAL FOREST SYSTEM TIMBER Special Forest Products § 223.220 Quantity determination...

  15. 50 CFR 223.205 - Sea turtles.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Sea turtles. 223.205 Section 223.205... Threatened Marine and Anadromous Species § 223.205 Sea turtles. (a) The prohibitions of section 9 of the Act (16 U.S.C. 1538) relating to endangered species apply to threatened species of sea turtle, except as...

  16. 50 CFR 223.203 - Anadromous fish.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Anadromous fish. 223.203 Section 223.203... Threatened Marine and Anadromous Species § 223.203 Anadromous fish. Available guidance documents cited in the...)(1) of the ESA (16 U.S.C. 1538(a)(1)) relating to endangered species apply to fish with an intact...

  17. 31 CFR 223.5 - Business.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Business. 223.5 Section 223.5 Money... OF THE TREASURY FINANCIAL MANAGEMENT SERVICE SURETY COMPANIES DOING BUSINESS WITH THE UNITED STATES § 223.5 Business. (a) The company must engage in the business of suretyship whether or not also making...

  18. 29 CFR 553.223 - Meal time.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 3 2010-07-01 2010-07-01 false Meal time. 553.223 Section 553.223 Labor Regulations... Enforcement Employees of Public Agencies Tour of Duty and Compensable Hours of Work Rules § 553.223 Meal time... personnel in accordance with section 7(a)(1) of the Act, the public agency may exclude meal time from hours...

  19. 7 CFR 1280.223 - Reports.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Reports. 1280.223 Section 1280.223 Agriculture... INFORMATION ORDER Lamb Promotion, Research, and Information Order Reports, Books, and Records § 1280.223 Reports. Each first handler required to remit assessments to the Board for live lambs pursuant to § 1280...

  20. Level Scheme of 223Fr

    International Nuclear Information System (INIS)

    Gaeta, R.; Gonzalez, J.A.; Gonzalez, L.; Roldan, C.

    1972-01-01

    A study has been made of the decay of 2 27 Ac at levels of 223 F r, means of alpha Spectrometers of Si barrier detector and gamma Spectrometers of Ge(Li). The rotational bands 1/2-(541 ↓ ] , 1/2-(530 ↑ ) and 3/2-(532 ↓ ) have been identified, as well as two octupolar bands associated with the fundamental one. The results obtained indicate that the unified model is applicable in this intermediate zone of the nuclide chart. (Author) 150 refs

  1. 48 CFR 223.370-2 - Definition.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Definition. 223.370-2..., DEPARTMENT OF DEFENSE SOCIOECONOMIC PROGRAMS ENVIRONMENT, ENERGY AND WATER EFFICIENCY, RENEWABLE ENERGY... Safety Data 223.370-2 Definition. Ammunition and explosives, as used in this section, is defined in the...

  2. 36 CFR 223.227 - Sale advertisement.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Sale advertisement. 223.227... DISPOSAL OF NATIONAL FOREST SYSTEM TIMBER Special Forest Products Advertisement and Bids § 223.227 Sale advertisement. (a) The Forest Service shall advertise any special forest products sales with an appraised value...

  3. 49 CFR 223.3 - Application.

    Science.gov (United States)

    2010-10-01

    ... general railroad system of transportation; (2) Rapid transit operations in an urban area that are not... 49 Transportation 4 2010-10-01 2010-10-01 false Application. 223.3 Section 223.3 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION, DEPARTMENT OF...

  4. 36 CFR 223.51 - Bid monitoring.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Bid monitoring. 223.51 Section 223.51 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE SALE AND... Bid monitoring. Each Regional Forester shall monitor bidding patterns on timber sales to determine if...

  5. 31 CFR 223.20 - Final decisions.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Final decisions. 223.20 Section 223.20 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE, DEPARTMENT OF THE TREASURY FINANCIAL MANAGEMENT SERVICE SURETY COMPANIES DOING BUSINESS WITH THE UNITED...

  6. 31 CFR 223.21 - Reinstatement.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Reinstatement. 223.21 Section 223.21 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE, DEPARTMENT OF THE TREASURY FINANCIAL MANAGEMENT SERVICE SURETY COMPANIES DOING BUSINESS WITH THE UNITED...

  7. 50 CFR 223.207 - Approved TEDs.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Approved TEDs. 223.207 Section 223.207 Wildlife and Fisheries NATIONAL MARINE FISHERIES SERVICE, NATIONAL OCEANIC AND ATMOSPHERIC ADMINISTRATION, DEPARTMENT OF COMMERCE MARINE MAMMALS THREATENED MARINE AND ANADROMOUS SPECIES Restrictions Applicable to Threatened Marine and Anadromous Specie...

  8. 27 CFR 46.223 - Tax credit.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false Tax credit. 46.223 Section... for Sale on April 1, 2009 Tax Liability Calculation § 46.223 Tax credit. The dealer is allowed a credit of up to $500 against the total floor stocks tax. However, controlled groups are eligible for only...

  9. 31 CFR 223.4 - Deposits.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Deposits. 223.4 Section 223.4 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE, DEPARTMENT OF THE TREASURY FINANCIAL MANAGEMENT SERVICE SURETY COMPANIES DOING BUSINESS WITH THE UNITED STATES...

  10. 31 CFR 223.8 - Financial reports.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Financial reports. 223.8 Section 223.8 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE, DEPARTMENT OF THE TREASURY FINANCIAL MANAGEMENT SERVICE SURETY COMPANIES DOING BUSINESS WITH THE UNITED...

  11. 31 CFR 223.17 - Revocation.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Revocation. 223.17 Section 223.17 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE, DEPARTMENT OF THE TREASURY FINANCIAL MANAGEMENT SERVICE SURETY COMPANIES DOING BUSINESS WITH THE UNITED...

  12. 36 CFR 223.35 - Performance bond.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Performance bond. 223.35 Section 223.35 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE SALE AND... Performance bond. Timber sale contracts may require the purchaser to furnish a performance bond for...

  13. Final Report for research grant "Development of Methods for High Specific Activity Labeling of Biomolecules Using Astatine-211 in Different Oxidation States"

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, D. Scott [Univ. of Washington, Seattle, WA (United States)

    2011-12-14

    The overall objective of this research effort was to develop methods for labeling biomolecules with higher oxidation state species of At-211. This was to be done in an effort to develop reagents that had higher in vivo stability than the present carbon-bonded At-211-labeled compounds. We were unsuccessful in that effort, as none of the approaches studied provided reagents that were stable to in vivo deastatination. However, we gained a lot of information about At-211 in higher oxidation states. The studies proved to be very difficult as small changes in pH and other conditions appeared to change the nature of the species that obtained (by HPLC retention time analyses), with many of the species being unidentifiable. The fact that there are no stable isotopes of astatine, and the chemistry of the nearest halogen iodine is quite different, made it very difficult to interpret results of some experiments. With that said, we believe that a lot of valuable information was obtained from the studies. The research effort evaluated: (1) methods for chemical oxidation of At-211, (2) approaches to chelation of oxidized At-211, and (3) approaches to oxidation of astatophenyl compounds. A major hurdle that had to be surmounted to conduct the research was the development of HPLC conditions to separate and identify the various oxidized species formed. Attempts to develop conditions for separation of iodine and astatine species by normal and reversed-phase TLC and ITLC were not successful. However, we were successful in developing conditions (from a large number of attempts) to separate oxidized forms of iodine ([I-125]iodide, [I-125]iodate and [I-125]periodate) and astatine ([At-211]astatide, [At-211]astatate, [At-211]perastatate, and several unidentified At-211 species). Information on the basic oxidation and characterization of At-211 species is provided under Objective 1. Conditions were developed to obtain new At-211 labeling method where At-211 is chelated with the DOTA and

  14. Dicty_cDB: SLH223 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLH223 (Link to dictyBase) - - - Contig-U16450-1 SLH223Z (Link... to Original site) - - SLH223Z 404 - - - - Show SLH223 Library SL (Link to library) Clone ID SLH223 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-A/SLH223Q.Seq.d/ Representative seq. ID SLH22...3Z (Link to Original site) Representative DNA sequence >SLH223 (SLH223Q) /CSM/SL/SLH2-A/SLH223Q.Seq.d/ XXXXX...logy vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value SLH223 (SLH2

  15. 36 CFR 223.36 - Volume determination.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Volume determination. 223.36... Volume determination. (a) Timber sale contracts may provide for volume determination by scaling... the contract or permit provides for the determination of volume by tree measurement and the timber has...

  16. 18 CFR 3b.223 - Fees.

    Science.gov (United States)

    2010-04-01

    ... INFORMATION Rules for Disclosure of Records § 3b.223 Fees. (a) Fees will be charged for the direct cost of... practicable, self-service duplication of requested documents may also be made on duplicating machines by the... to determine if they fall within the disclosure requirements of this part; and (3) When the system...

  17. 36 CFR 223.133 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... 223.133 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE SALE AND... from Forest Service timber sale contracts for a reasonable, specified period of time. A purchaser so... evidence means proof by information that, compared with that opposing it, leads to the conclusion that the...

  18. 36 CFR 223.88 - Bidding methods.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Bidding methods. 223.88... methods. (a) Competitive sales of National Forest timber shall be offered through either sealed or oral auction bidding. The method chosen for each sale will: (1) Insure open and fair competition, (2) Insure...

  19. 36 CFR 223.231 - Bidding methods.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Bidding methods. 223.231... methods. The Contracting Officer or designated forest officer shall offer advertised sales of special forest products through sealed bid or sealed bid followed by oral auction. The method selected shall: (a...

  20. Reference: 223 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 223 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u15923347i Dohmann Es... cause the cop/det/fus mutant phenotype in Arabidopsis. 7 1967-78 15923347 2005 Jul The Plant cell Dohmann Esther M N|Kuhnle Carola|Schwechheimer Claus

  1. 49 CFR 22.3 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... Office of the Secretary of Transportation SHORT-TERM LENDING PROGRAM (STLP) General § 22.3 Definitions... transportation-related contract(s), subcontract(s), and/or purchase order(s) that has been pledged as collateral... loan to the borrower. Loan guarantee means the agreement of DOT OSDBU to issue a guarantee of payment...

  2. 27 CFR 28.223 - Export marks.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Export marks. 28.223... Export marks. In addition to the marks and brands required to be placed on kegs, barrels, cases, crates... “Export” on each container or case before removal for export, for use on vessels or aircraft, or for...

  3. 14 CFR 223.3 - Mandatory free transportation.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Mandatory free transportation. 223.3 Section 223.3 Aeronautics and Space OFFICE OF THE SECRETARY, DEPARTMENT OF TRANSPORTATION (AVIATION PROCEEDINGS) ECONOMIC REGULATIONS FREE AND REDUCED-RATE TRANSPORTATION General Provisions § 223.3 Mandatory...

  4. 36 CFR 223.110 - Delegation to regional forester.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Delegation to regional forester. 223.110 Section 223.110 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF... § 223.110 Delegation to regional forester. The Chief, Forest Service, after approval of conditions of...

  5. 39 CFR 223.1 - Headquarters and areas.

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Headquarters and areas. 223.1 Section 223.1 Postal Service UNITED STATES POSTAL SERVICE ORGANIZATION AND ADMINISTRATION RELATIONSHIPS AND COMMUNICATION CHANNELS § 223.1 Headquarters and areas. Headquarters provides policy guidance, procedures, and...

  6. 49 CFR 238.223 - Locomotive fuel tanks.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Locomotive fuel tanks. 238.223 Section 238.223... Equipment § 238.223 Locomotive fuel tanks. Locomotive fuel tanks shall comply with either the following or....21: (a) External fuel tanks. External locomotive fuel tanks shall comply with the requirements...

  7. 31 CFR 223.11 - Limitation of risk: Protective methods.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Limitation of risk: Protective methods. 223.11 Section 223.11 Money and Finance: Treasury Regulations Relating to Money and Finance... BUSINESS WITH THE UNITED STATES § 223.11 Limitation of risk: Protective methods. The limitation of risk...

  8. 31 CFR 223.2 - Application for certificate of authority.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Application for certificate of authority. 223.2 Section 223.2 Money and Finance: Treasury Regulations Relating to Money and Finance... BUSINESS WITH THE UNITED STATES § 223.2 Application for certificate of authority. Every company wishing to...

  9. 31 CFR 223.6 - Requirements applicable to surety companies.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Requirements applicable to surety companies. 223.6 Section 223.6 Money and Finance: Treasury Regulations Relating to Money and Finance... BUSINESS WITH THE UNITED STATES § 223.6 Requirements applicable to surety companies. Every company now or...

  10. 50 CFR Figure 10 to Part 223 - Flounder TED

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Flounder TED 10 Figure 10 to Part 223 Wildlife and Fisheries NATIONAL MARINE FISHERIES SERVICE, NATIONAL OCEANIC AND ATMOSPHERIC ADMINISTRATION, DEPARTMENT OF COMMERCE MARINE MAMMALS THREATENED MARINE AND ANADROMOUS SPECIES Pt. 223, Fig. 10 Figure 10 to Part 223—Flounder TED EC01JY91.056 [5...

  11. 50 CFR Figure 3 to Part 223 - Matagorda TED

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Matagorda TED 3 Figure 3 to Part 223 Wildlife and Fisheries NATIONAL MARINE FISHERIES SERVICE, NATIONAL OCEANIC AND ATMOSPHERIC ADMINISTRATION, DEPARTMENT OF COMMERCE MARINE MAMMALS THREATENED MARINE AND ANADROMOUS SPECIES Pt. 223, Fig. 3 Figure 3 to Part 223—Matagorda TED EC01JY91.047 [52...

  12. 31 CFR 223.14 - Schedules of single risks.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Schedules of single risks. 223.14 Section 223.14 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL... UNITED STATES § 223.14 Schedules of single risks. During the months of January, April, July, and October...

  13. 48 CFR 223.570 - Drug-free work force.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Drug-free work force. 223.570 Section 223.570 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM... TECHNOLOGIES, OCCUPATIONAL SAFETY, AND DRUG-FREE WORKPLACE Drug-Free Workplace 223.570 Drug-free work force. ...

  14. 36 CFR 223.37 - Revegetation of temporary roads.

    Science.gov (United States)

    2010-07-01

    ... roads. 223.37 Section 223.37 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF... Provisions § 223.37 Revegetation of temporary roads. Timber sale contracts, permits and other documents... roads constructed or used thereunder so as to permit the reestablishment by artificial or natural means...

  15. 50 CFR Figure 4 to Part 223 - Georgia TED

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Georgia TED 4 Figure 4 to Part 223 Wildlife and Fisheries NATIONAL MARINE FISHERIES SERVICE, NATIONAL OCEANIC AND ATMOSPHERIC ADMINISTRATION, DEPARTMENT OF COMMERCE MARINE MAMMALS THREATENED MARINE AND ANADROMOUS SPECIES Pt. 223, Fig. 4 Figure 4 to Part 223—Georgia TED EC01JY91.048 [52 FR...

  16. 14 CFR 223.5 - Responsibility of agencies.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Responsibility of agencies. 223.5 Section... PROCEEDINGS) ECONOMIC REGULATIONS FREE AND REDUCED-RATE TRANSPORTATION General Provisions § 223.5 Responsibility of agencies. The Federal Aviation Administration, National Transportation Safety Board, National...

  17. 22 CFR 22.3 - Remittances in the United States.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Remittances in the United States. 22.3 Section...-DEPARTMENT OF STATE AND FOREIGN SERVICE § 22.3 Remittances in the United States. (a) Type of remittance. Remittances shall be in the form of: (1) Check or bank draft drawn on a bank in the United States; (2) money...

  18. 31 CFR 223.3 - Issuance of certificates of authority.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Issuance of certificates of authority. 223.3 Section 223.3 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued... United States or of any State, or it is limited by its articles of incorporation or corporate charter to...

  19. 31 CFR 223.16 - List of certificate holding companies.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false List of certificate holding companies. 223.16 Section 223.16 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE, DEPARTMENT OF THE TREASURY FINANCIAL MANAGEMENT SERVICE SURETY COMPANIES DOING BUSINESS...

  20. 31 CFR 223.18 - Performance of agency obligations.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Performance of agency obligations. 223.18 Section 223.18 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE, DEPARTMENT OF THE TREASURY FINANCIAL MANAGEMENT SERVICE SURETY COMPANIES DOING BUSINESS...

  1. 31 CFR 223.19 - Informal hearing on agency complaints.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Informal hearing on agency complaints. 223.19 Section 223.19 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE, DEPARTMENT OF THE TREASURY FINANCIAL MANAGEMENT SERVICE SURETY COMPANIES DOING BUSINESS...

  2. 31 CFR 223.9 - Valuation of assets and liabilities.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Valuation of assets and liabilities. 223.9 Section 223.9 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE, DEPARTMENT OF THE TREASURY FINANCIAL MANAGEMENT SERVICE SURETY COMPANIES DOING BUSINESS...

  3. 36 CFR 223.3 - Sale of seized material.

    Science.gov (United States)

    2010-07-01

    ... AND DISPOSAL OF NATIONAL FOREST SYSTEM TIMBER General Provisions § 223.3 Sale of seized material. Seized material (trees, portions of trees or other forest products cut in trespass from National Forest... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Sale of seized material. 223...

  4. 49 CFR 223.15 - Requirements for existing passenger cars.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Requirements for existing passenger cars. 223.15... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION SAFETY GLAZING STANDARDS-LOCOMOTIVES, PASSENGER CARS AND CABOOSES Specific Requirements § 223.15 Requirements for existing passenger cars. (a) Passenger cars built or...

  5. 24 CFR 248.223 - Alternative State strategy.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Alternative State strategy. 248.223... Preservation Act of 1987 § 248.223 Alternative State strategy. (a) The Commissioner may approve a State strategy providing for State approval of plans of action that involve termination of low income...

  6. 46 CFR 108.223 - Guards on exposed equipment.

    Science.gov (United States)

    2010-10-01

    ... have hand covers, guards, or rails installed on all belts, gears, shafts, pulleys, sprockets, spindles... 46 Shipping 4 2010-10-01 2010-10-01 false Guards on exposed equipment. 108.223 Section 108.223 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) A-MOBILE OFFSHORE DRILLING UNITS DESIGN...

  7. 31 CFR 223.12 - Recognition as reinsurer.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Recognition as reinsurer. 223.12 Section 223.12 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE, DEPARTMENT OF THE TREASURY FINANCIAL MANAGEMENT SERVICE SURETY COMPANIES DOING BUSINESS WITH THE...

  8. 31 CFR 223.10 - Limitation of risk.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Limitation of risk. 223.10 Section 223.10 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE, DEPARTMENT OF THE TREASURY FINANCIAL MANAGEMENT SERVICE SURETY COMPANIES DOING BUSINESS WITH THE...

  9. 31 CFR 223.1 - Certificate of authority.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Certificate of authority. 223.1 Section 223.1 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE, DEPARTMENT OF THE TREASURY FINANCIAL MANAGEMENT SERVICE SURETY COMPANIES DOING BUSINESS WITH THE...

  10. 31 CFR 223.7 - Investment of capital and assets.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Investment of capital and assets. 223... WITH THE UNITED STATES § 223.7 Investment of capital and assets. The cash capital and other funds of... periodically issue instructions for the guidance of companies with respect to investments and other matters...

  11. 40 CFR 97.223 - CAIR permit contents and term.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 20 2010-07-01 2010-07-01 false CAIR permit contents and term. 97.223 Section 97.223 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS... facilitate coordination of the renewal of the CAIR permit with issuance, revision, or renewal of the CAIR SO2...

  12. 40 CFR 96.223 - CAIR permit contents and term.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 20 2010-07-01 2010-07-01 false CAIR permit contents and term. 96.223 Section 96.223 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS... necessary to facilitate coordination of the renewal of the CAIR permit with issuance, revision, or renewal...

  13. Level Scheme of {sup 223}Fr; Estudio del esquema de niveles del {sup 223}Fr

    Energy Technology Data Exchange (ETDEWEB)

    Gaeta, R; Gonzalez, L; Roldan, C

    1972-07-01

    A study has been made of the decay of {sup 227}Ac at levels of {sub 223}Fr, means of alpha Spectrometers of Si barrier detector and gamma Spectrometers of Ge(Li). The rotational bands 1/2-(541 {down_arrow}), 1/2-(530 {up_arrow}) and 3/2-(532 {down_arrow}) have been identified, as well as two octupolar bands associated with the fundamental one. The results obtained indicate that the unified model is applicable in this intermediate zone of the nuclide chart. (Author) 150 refs.

  14. 14 CFR 223.25 - List of affiliates.

    Science.gov (United States)

    2010-01-01

    ... the exact relationship of each affiliate to the carrier. (b) No pass may be issued under § 223.22(a) to a director, officer, employee, or members of their immediate family, of any affiliate, unless that...

  15. 14 CFR 223.24 - Transportation of empty mail bags.

    Science.gov (United States)

    2010-01-01

    ... PROCEEDINGS) ECONOMIC REGULATIONS FREE AND REDUCED-RATE TRANSPORTATION International Travel § 223.24 Transportation of empty mail bags. Any carrier authorized to engage in foreign air transportation may transport...

  16. 33 CFR 135.223 - Certificates, denial or revocation.

    Science.gov (United States)

    2010-07-01

    ... SECURITY (CONTINUED) MARINE POLLUTION FINANCIAL RESPONSIBILITY AND COMPENSATION OFFSHORE OIL POLLUTION COMPENSATION FUND Financial Responsibility for Offshore Facilities § 135.223 Certificates, denial or revocation... false statement to the Fund Administrator in connection with establishing or maintaining evidence of...

  17. The miR-223 host non-coding transcript linc-223 induces IRF4 expression in acute myeloid leukemia by acting as a competing endogenous RNA

    KAUST Repository

    Mangiavacchi, Arianna; Sorci, Melissa; Masciarelli, Silvia; Larivera, Simone; Legnini, Ivano; Iosue, Ilaria; Bozzoni, Irene; Fazi, Francesco; Fatica, Alessandro

    2016-01-01

    Alterations in genetic programs required for terminal myeloid differentiation and aberrant proliferation characterize acute myeloid leukemia (AML) cells. Here, we identify the host transcript of miR-223, linc-223, as a novel functional long non

  18. Recovery of Ra-223 from natural thorium irradiated by protons

    Energy Technology Data Exchange (ETDEWEB)

    Vasiliev, Aleksandr N.; Ostapenko, Valentina S. [Lomonosov Moscow State Univ. (Russian Federation); Russian Academy of Sciences, Moscow-Troitsk (Russian Federation). Inst. for Nuclear Research; Lapshina, Elena V.; Ermolaev, Stanislav V.; Zhuikov, Boris L. [Russian Academy of Sciences, Moscow-Troitsk (Russian Federation). Inst. for Nuclear Research; Danilov, Sergey S. [Lomonosov Moscow State Univ. (Russian Federation); Kalmykov, Stepan N. [Lomonosov Moscow State Univ. (Russian Federation); National Research Center ' Kurchatov Institute' (NRC ' Kurchatov Institute' ), Moscow (Russian Federation)

    2016-11-01

    Irradiation of natural thorium with medium-energy protons is considered to be a prospective approach to large-scale production of {sup 225}Ac and {sup 223}Ra. In addition to the earlier-developed method of {sup 225}Ac isolation, the present work focuses on the simultaneous recovery of {sup 223}Ra from the same thorium target. Radiochemical procedure is based on liquid-liquid extraction, cation exchange and extraction chromatography. The procedure provides separation of radium from spallation and fission products generated in the thorium target. High chemical yield (85-90%) and radionuclide purity of {sup 223}Ra (> 99.8% except {sup 224}Ra and {sup 225}Ra isotopes) have been achieved.

  19. 48 CFR 52.223-1 - Biobased Product Certification.

    Science.gov (United States)

    2010-10-01

    ....223-1 Biobased Product Certification. As prescribed in 23.406(a), insert the following provision: Biobased Product Certification (DEC 2007) As required by the Farm Security and Rural Investment Act of 2002... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Biobased Product...

  20. 36 CFR 223.32 - Timber sale operating plan.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Timber sale operating plan... SALE AND DISPOSAL OF NATIONAL FOREST SYSTEM TIMBER Timber Sale Contracts Contract Conditions and Provisions § 223.32 Timber sale operating plan. Sale contracts with a term of 2 years or more shall provide...

  1. 36 CFR 223.62 - Timber purchaser road construction credit.

    Science.gov (United States)

    2010-07-01

    ... § 223.62 Timber purchaser road construction credit. Appraisal may also establish stumpage value as if... timber is appraised and sold on such basis, purchaser credit for road construction, not to exceed the estimated construction cost of such roads or other developments specified in the timber sale contract, shall...

  2. 36 CFR 223.82 - Contents of advertisement.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Contents of advertisement... SALE AND DISPOSAL OF NATIONAL FOREST SYSTEM TIMBER Timber Sale Contracts Advertisement and Bids § 223.82 Contents of advertisement. (a) A timber sale advertisement shall include the following information...

  3. 36 CFR 223.80 - When advertisement is required.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false When advertisement is... AGRICULTURE SALE AND DISPOSAL OF NATIONAL FOREST SYSTEM TIMBER Timber Sale Contracts Advertisement and Bids § 223.80 When advertisement is required. Except as otherwise provided in this part each sale in which...

  4. 36 CFR 223.228 - Contents of advertisement.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Contents of advertisement... SALE AND DISPOSAL OF NATIONAL FOREST SYSTEM TIMBER Special Forest Products Advertisement and Bids § 223.228 Contents of advertisement. The Forest Service shall include the following information in an...

  5. 10 CFR 431.223 - Materials incorporated by reference.

    Science.gov (United States)

    2010-01-01

    ... for Traffic Signals,” Version 1.1 issued February 4, 2003. (2) Institute of Transportation Engineers (ITE), “Vehicle Traffic Control Signal Heads: Light Emitting Diode (LED) Circular Signal Supplement... AND INDUSTRIAL EQUIPMENT Traffic Signal Modules and Pedestrian Modules Test Procedures § 431.223...

  6. THE METABOLSIM AND TOXICITY OF RADIUM-223 IN RATS

    Energy Technology Data Exchange (ETDEWEB)

    Durbin, Patricia; Durbin, Patricia W.; Asling, C. Willet.; Jeung, Nylan; Williams, Marilyn H.; Post, James.; Johnston, Muriel E.; Hamilton, Joseph G.

    1958-02-21

    This report covers studies of the excretion and retention of 'tracer' and toxic doses of the 11.2-day Ra{sup 223} isotope, its acute toxicity (organ weight changes, gross and microscopic pathology, and Fe{sup 59} utilization by the bone marrow), and long-term histopathological changes and alterations in the hemogram.

  7. 36 CFR 223.81 - Shorter advertising periods in emergencies.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Shorter advertising periods... OF AGRICULTURE SALE AND DISPOSAL OF NATIONAL FOREST SYSTEM TIMBER Timber Sale Contracts Advertisement and Bids § 223.81 Shorter advertising periods in emergencies. In emergency situations where prompt...

  8. 36 CFR 223.137 - Causes for debarment.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Causes for debarment. 223.137...) Conviction of or civil judgment for: (1) Theft, forgery, bribery, embezzlement, falsification or destruction... Conservation and Shortage Relief Act of 1990 (16 U.S.C. 620, et seq.) (Act) or any regulation or contract...

  9. 36 CFR 223.83 - Contents of prospectus.

    Science.gov (United States)

    2010-07-01

    ... AND DISPOSAL OF NATIONAL FOREST SYSTEM TIMBER Timber Sale Contracts Advertisement and Bids § 223.83... logging requirements for the sale. (7) The status of marking at time of advertisement. (8) The method of... assistance available to small business purchasers. (19) Notification of preferential award to small business...

  10. 14 CFR 125.223 - Airborne weather radar equipment requirements.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Airborne weather radar equipment... Equipment Requirements § 125.223 Airborne weather radar equipment requirements. (a) No person may operate an airplane governed by this part in passenger-carrying operations unless approved airborne weather radar...

  11. 36 CFR 223.47 - Date of completion of permanent road construction.

    Science.gov (United States)

    2010-07-01

    ... permanent road construction. 223.47 Section 223.47 Parks, Forests, and Public Property FOREST SERVICE... Conditions and Provisions § 223.47 Date of completion of permanent road construction. (a) The date of completion of permanent road construction obligations as set forth in the Notice of Sale shall be...

  12. 36 CFR 223.41 - Payment when purchaser elects government road construction.

    Science.gov (United States)

    2010-07-01

    ... government road construction. 223.41 Section 223.41 Parks, Forests, and Public Property FOREST SERVICE... Conditions and Provisions § 223.41 Payment when purchaser elects government road construction. Each contract having a provision for construction of specified roads with total estimated construction costs of $50,000...

  13. 36 CFR 223.38 - Standards for road design and construction.

    Science.gov (United States)

    2010-07-01

    ... Provisions § 223.38 Standards for road design and construction. Road construction authorized under timber... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Standards for road design and construction. 223.38 Section 223.38 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF...

  14. 36 CFR 223.84 - Small business bid form provisions on sales with specified road construction.

    Science.gov (United States)

    2010-07-01

    ... provisions on sales with specified road construction. 223.84 Section 223.84 Parks, Forests, and Public... specified road construction. For each sale described in § 223.82(b), the bid form must include provision for a small business concern: (a) To elect road construction by the Forest Service and where such...

  15. 36 CFR 223.218 - Consistency with plans, environmental standards, and other management requirements.

    Science.gov (United States)

    2010-07-01

    ..., environmental standards, and other management requirements. 223.218 Section 223.218 Parks, Forests, and Public... Special Forest Products § 223.218 Consistency with plans, environmental standards, and other management... with applicable land management plans. Each contract, permit, or other authorizing instrument shall...

  16. 48 CFR 52.223-12 - Refrigeration Equipment and Air Conditioners.

    Science.gov (United States)

    2010-10-01

    ... and Air Conditioners. 52.223-12 Section 52.223-12 Federal Acquisition Regulations System FEDERAL... Provisions and Clauses 52.223-12 Refrigeration Equipment and Air Conditioners. As prescribed in 23.804(b), insert the following clause: Refrigeration Equipment and Air Conditioners (MAY 1995) The Contractor shall...

  17. 12 CFR 303.223 - Applicant's right to hearing following denial.

    Science.gov (United States)

    2010-01-01

    ... Criminal Offenses) § 303.223 Applicant's right to hearing following denial. An applicant may request a... 12 Banks and Banking 4 2010-01-01 2010-01-01 false Applicant's right to hearing following denial. 303.223 Section 303.223 Banks and Banking FEDERAL DEPOSIT INSURANCE CORPORATION PROCEDURE AND RULES OF...

  18. 31 CFR 223.22 - Fees for services of the Treasury Department.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Fees for services of the Treasury Department. 223.22 Section 223.22 Money and Finance: Treasury Regulations Relating to Money and Finance... BUSINESS WITH THE UNITED STATES § 223.22 Fees for services of the Treasury Department. (a) Fees shall be...

  19. 50 CFR Figure 13 to Part 223 - Single Grid Hard TED Escape Opening

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Single Grid Hard TED Escape Opening 13 Figure 13 to Part 223 Wildlife and Fisheries NATIONAL MARINE FISHERIES SERVICE, NATIONAL OCEANIC AND ATMOSPHERIC ADMINISTRATION, DEPARTMENT OF COMMERCE MARINE MAMMALS THREATENED MARINE AND ANADROMOUS SPECIES Pt. 223, Fig. 13 Figure 13 to Part 223—Singl...

  20. 50 CFR Figure 6 to Part 223 - TED Extension in Summer Flounder Trawl

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false TED Extension in Summer Flounder Trawl 6 Figure 6 to Part 223 Wildlife and Fisheries NATIONAL MARINE FISHERIES SERVICE, NATIONAL OCEANIC AND ATMOSPHERIC ADMINISTRATION, DEPARTMENT OF COMMERCE MARINE MAMMALS THREATENED MARINE AND ANADROMOUS SPECIES Pt. 223, Fig. 6 Figure 6 to Part 223—TED...

  1. 50 CFR Figure 15 to Part 223 - Weedless TED Brace Bar Description

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Weedless TED Brace Bar Description 15 Figure 15 to Part 223 Wildlife and Fisheries NATIONAL MARINE FISHERIES SERVICE, NATIONAL OCEANIC AND ATMOSPHERIC ADMINISTRATION, DEPARTMENT OF COMMERCE MARINE MAMMALS THREATENED MARINE AND ANADROMOUS SPECIES Pt. 223, Fig. 15 Figure 15 to Part 223...

  2. 36 CFR 223.4 - Exchange of trees or portions of trees.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Exchange of trees or portions of trees. 223.4 Section 223.4 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE SALE AND DISPOSAL OF NATIONAL FOREST SYSTEM TIMBER General Provisions § 223.4 Exchange of trees or...

  3. 36 CFR 223.12 - Permission to cut, damage, or destroy trees without advertisement.

    Science.gov (United States)

    2010-07-01

    ... destroy trees without advertisement. 223.12 Section 223.12 Parks, Forests, and Public Property FOREST... § 223.12 Permission to cut, damage, or destroy trees without advertisement. Permission may be granted to cut, damage, or destroy trees, portions of trees, or other forest products on National Forest System...

  4. 49 CFR 223.17 - Identification of equipped locomotives, passenger cars and cabooses.

    Science.gov (United States)

    2010-10-01

    ... cars and cabooses. 223.17 Section 223.17 Transportation Other Regulations Relating to Transportation...-LOCOMOTIVES, PASSENGER CARS AND CABOOSES Specific Requirements § 223.17 Identification of equipped locomotives, passenger cars and cabooses. Each locomotive, passenger car and caboose that is fully equipped with glazing...

  5. 18 CFR 284.223 - Transportation by interstate pipelines on behalf of shippers.

    Science.gov (United States)

    2010-04-01

    ... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Transportation by interstate pipelines on behalf of shippers. 284.223 Section 284.223 Conservation of Power and Water Resources... by Interstate Pipelines on Behalf of Others and Services by Local Distribution Companies § 284.223...

  6. The miR-223 host non-coding transcript linc-223 induces IRF4 expression in acute myeloid leukemia by acting as a competing endogenous RNA

    KAUST Repository

    Mangiavacchi, Arianna

    2016-08-10

    Alterations in genetic programs required for terminal myeloid differentiation and aberrant proliferation characterize acute myeloid leukemia (AML) cells. Here, we identify the host transcript of miR-223, linc-223, as a novel functional long non-coding RNA (lncRNA) in AML. We show that from the primary nuclear transcript, the alternative production of miR-223 and linc-223 is finely regulated during monocytic differentiation. Moreover, linc-223 expression inhibits cell cycle progression and promotes monocytic differentiation of AML cells. We also demonstrate that endogenous linc-223 localizes in the cytoplasm and acts as a competing endogenous RNA for miR-125-5p, an oncogenic microRNA in leukemia. In particular, we show that linc-223 directly binds to miR-125-5p and that its knockdown increases the repressing activity of miR-125-5p resulting in the downregulation of its target interferon regulatory factor 4 (IRF4), which it was previously shown to inhibit the oncogenic activity of miR-125-5p in vivo. Furthermore, data from primary AML samples show significant downregulation of linc-223 in different AML subtypes. Therein, these findings indicate that the newly identified lncRNA linc-223 may have an important role in myeloid differentiation and leukemogenesis, at least in part, by cross-talking with IRF4 mRNA.

  7. Radioactive decay of 223Ra by 14C emission

    International Nuclear Information System (INIS)

    Yashita, S.; Gregorich, K.; Ghiorso, A.

    1985-01-01

    Recently H.J. Rose and G.A. Jones at the University of Oxford reported the very difficult observation of an exotic radioactive decay mode in 233 Ra, its spontaneous disintegration by the emission of 14 C particles. The authors have confirmed their somewhat surprising discovery by an independent method. Within the present experimental accuracy the magnetic rigidity, energy and branching ratio support the assignment of 14 C emission from 223 Ra as proposed by the Oxford experiment

  8. Real-Time Scintigraphic Assessment of Intravenous Radium-223 Administration for Quality Control

    Directory of Open Access Journals (Sweden)

    Chadwick L. Wright

    2015-01-01

    Full Text Available Radium-223 (223Ra dichloride is an approved intravenous radiotherapy for patients with osseous metastases from castration-resistant prostate cancer (CRPC. In addition to the therapeutic alpha radiation, there is additional 223Ra radiation generated which produces photons that can be imaged with conventional gamma cameras. No studies have evaluated real-time and quality imaging during intravenous 223Ra administration to verify systemic circulation and exclude 223Ra extravasation at the injection site. A retrospective review was performed for fifteen 223Ra administrations for CRPC patients which were imaged using a large field of view portable gamma camera (LFOVPGC for the purposes of quality control and patient safety. Dynamic imaging of the chest was performed before, during, and after the 223Ra administration to verify systemic circulation, per institutional clinical protocol. Before and after 223Ra administration, a static image was obtained of the intravenous access site. Dynamic imaging of the chest confirmed systemic administration early during the 1-minute injection period for all patients. There were no cases of focal 223Ra extravasation at the site of intravenous access. These results verify that systemic 223Ra administrations can be quantified with real-time imaging using an LFOVPGC. This simple approach can confirm and quantify systemic circulation of 223Ra early during injection and exclude focal extravasation for the purposes of quality control.

  9. Hydroxyapatite particles as carriers for "2"2"3Ra

    International Nuclear Information System (INIS)

    Vasiliev, A.N.

    2017-01-01

    Systematic investigation of optimal conditions for preparation and in vitro stability of HAP particles labeled with "2"2"3Ra, that could be considered as promising candidates for targeted α-therapy, has been carried out. Two different approaches to HAP labelling were tested: sorption of Ra"2"+ on pre-synthesized HAP-particles and incorporation of Ra"2"+ into the structure of HAP during its synthesis. Two textural forms of HAP particles were used-nanoparticles and particles with the diameter of 350 ± 20 μm. Kinetics of "2"2"3Ra sorption on HAP of different particle size and desorption in 0.9 % NaCl solution were studied. The influence of solution acidity and solid to liquid phase ratio on sorption of Ra was evaluated and the sorption yield up to 98 % was achieved. It was found that the optimal conditions for the sorption included synthesis of HAP nanoparticles in the presence of "2"2"3Ra at pH values of 4-7 followed by annealing at 900 deg C. In this case subsequent cumulative desorption of Ra was <5 % of initial activity. (author)

  10. Determination of Ra-223 in human excretion samples by means of α-spectrometry; Bestimmung von {sup 223}Ra in Ausscheidungsproben mittels α-Spektrometrie

    Energy Technology Data Exchange (ETDEWEB)

    Zoriy, M.V.; Froning, M.; Hill, P. [Forschungszentrum Juelich GmbH (Germany). Geschaeftsbereich Strahlenschutz und Sicherheit

    2015-07-01

    To ensure the safety of occupationally exposed person for possible incorporation of {sup 223}Ra during the handling with Alpharadin / Xofigo {sup registered}, the determination of {sup 223}Ra activity in its excretion sample (e.g, in a stool sample) might be of great importance. To assess the {sup 223}Ra activity in human faeces samples a new analytical method was developed in our laboratory. The determination is performed by means of grid-ionization a-spectrometry. After a relatively simple sample preparation procedure (usually within max. 6 hours) and the addition of an internal standard, a direct determination of {sup 223}Ra with the grid ionization chamber (GIK) is possible. The method was optimized and successfully tested. The procedure-related LOD for {sup 223}Ra in a 24-hour faeces sample was 0.1 Bq/Probe.

  11. Practical recommendations for radium-223 treatment of metastatic castration-resistant prostate cancer

    International Nuclear Information System (INIS)

    Du, Yong; Carrio, Ignasi; De Vincentis, Giuseppe; Fanti, Stefano; Ilhan, Harun; Mommsen, Caroline; Nitzsche, Egbert; Sundram, Francis; Vogel, Wouter; Oyen, Wim; Lewington, Val

    2017-01-01

    Radium Ra 223 dichloride (radium-223, Xofigo registered) is the first targeted alpha therapy for patients with castration-resistant prostate cancer and symptomatic bone metastases. Radium-223 provides a new treatment option for this setting, but also necessitates a new treatment management approach. We provide straightforward and practical recommendations for European nuclear medicine centres to optimize radium-223 service provision. An independent research consultancy agency observed radium-223 procedures and conducted interviews with all key staff members involved in radium-223 treatment delivery in 11 nuclear medicine centres across six countries (Germany, Italy, the Netherlands, Spain, Switzerland and the UK) experienced in administering radium-223. The findings were collated and discussed at a meeting of experts from these centres, during which key consensus recommendations were defined. The recommendations cover centre organization and preparation; patient referral; radium-223 ordering, preparation and disposal; radium-223 treatment delivery/administration; and patient experience. Guidance includes structured coordination and communication within centres and multidisciplinary teams, focusing on sharing best practice to provide high-quality, patient-centred care throughout the treatment pathway. These expert recommendations are intended to complement existing management guidelines. Sharing best practice and experience will help nuclear medicine centres to optimize radium-223 service provision and improve patient care. (orig.)

  12. Practical recommendations for radium-223 treatment of metastatic castration-resistant prostate cancer

    Energy Technology Data Exchange (ETDEWEB)

    Du, Yong [The Royal Marsden NHS Foundation Trust, Department of Nuclear Medicine and PET/CT, London (United Kingdom); Carrio, Ignasi [Hospital Sant Pau, Barcelona (Spain); De Vincentis, Giuseppe [Policlinico Umberto I University Hospital Rome, Rome (Italy); Fanti, Stefano [University Hospital Bologna, Bologna (Italy); Ilhan, Harun [Ludwig-Maximilians-University Hospital, Munich (Germany); Mommsen, Caroline [Praxis fuer diagnostische und therapeutische Nuklearmedizin Berlin, Berlin (Germany); Nitzsche, Egbert [Canton Hospital Aarau, Aarau (Switzerland); Sundram, Francis [University Hospital Southampton NHS Foundation Trust, Southampton (United Kingdom); Vogel, Wouter [The Netherlands Cancer Institute, Amsterdam (Netherlands); Oyen, Wim [The Royal Marsden NHS Foundation Trust, Department of Nuclear Medicine and PET/CT, London (United Kingdom); The Institute of Cancer Research, London (United Kingdom); Lewington, Val [Guy' s and St Thomas' NHS Foundation Trust, London (United Kingdom)

    2017-09-15

    Radium Ra 223 dichloride (radium-223, Xofigo registered) is the first targeted alpha therapy for patients with castration-resistant prostate cancer and symptomatic bone metastases. Radium-223 provides a new treatment option for this setting, but also necessitates a new treatment management approach. We provide straightforward and practical recommendations for European nuclear medicine centres to optimize radium-223 service provision. An independent research consultancy agency observed radium-223 procedures and conducted interviews with all key staff members involved in radium-223 treatment delivery in 11 nuclear medicine centres across six countries (Germany, Italy, the Netherlands, Spain, Switzerland and the UK) experienced in administering radium-223. The findings were collated and discussed at a meeting of experts from these centres, during which key consensus recommendations were defined. The recommendations cover centre organization and preparation; patient referral; radium-223 ordering, preparation and disposal; radium-223 treatment delivery/administration; and patient experience. Guidance includes structured coordination and communication within centres and multidisciplinary teams, focusing on sharing best practice to provide high-quality, patient-centred care throughout the treatment pathway. These expert recommendations are intended to complement existing management guidelines. Sharing best practice and experience will help nuclear medicine centres to optimize radium-223 service provision and improve patient care. (orig.)

  13. Therapy palliative with 223Ra without special radiation protection measures?

    International Nuclear Information System (INIS)

    Just, Guenther; Petzold, Juergen

    2015-01-01

    For nearly 2 years now as a therapy of the castration resistant prostata carcinoma a nuclide therapy with 223 Ra-Dichloride (trade-mark Xofigo) is applied. Xofigo is applied by a medical specialist for nuclear medicine altogether 6 times in a monthly distance. The activity used in each case is according to the body weight (50 kBq/kg BW). This therapy is licensed by the supervisory authorities of the German federal countries as an ambulant therapy. Special radiation protection measures are only required when exceeding a given number of 17 patients per year as incorparation measurements.

  14. Imaging response during therapy with radium-223 for castration-resistant prostate cancer with bone metastases

    DEFF Research Database (Denmark)

    Keizman, D; Fosboel, M O; Reichegger, H

    2017-01-01

    BACKGROUND: The imaging response to radium-223 therapy is at present poorly described. We aimed to describe the imaging response to radium-223 treatment. METHODS: We retrospectively evaluated the computed tomography (CT) and bone scintigraphy response of metastatic castration-resistant prostate c....../or radiological) may be noted during the first 3 months, and should not be confused with progression. Imaging by CT scan should be considered after three and six doses of radium-223 to rule out extraskeletal disease progression....

  15. MicroRNA-223 controls susceptibility to tuberculosis by regulating lung neutrophil recruitment.

    Science.gov (United States)

    Dorhoi, Anca; Iannaccone, Marco; Farinacci, Maura; Faé, Kellen C; Schreiber, Jörg; Moura-Alves, Pedro; Nouailles, Geraldine; Mollenkopf, Hans-Joachim; Oberbeck-Müller, Dagmar; Jörg, Sabine; Heinemann, Ellen; Hahnke, Karin; Löwe, Delia; Del Nonno, Franca; Goletti, Delia; Capparelli, Rosanna; Kaufmann, Stefan H E

    2013-11-01

    The molecular mechanisms that control innate immune cell trafficking during chronic infection and inflammation, such as in tuberculosis (TB), are incompletely understood. During active TB, myeloid cells infiltrate the lung and sustain local inflammation. While the chemoattractants that orchestrate these processes are increasingly recognized, the posttranscriptional events that dictate their availability are unclear. We identified microRNA-223 (miR-223) as an upregulated small noncoding RNA in blood and lung parenchyma of TB patients and during murine TB. Deletion of miR-223 rendered TB-resistant mice highly susceptible to acute lung infection. The lethality of miR-223(–/–) mice was apparently not due to defects in antimycobacterial T cell responses. Exacerbated TB in miR-223(–/–) animals could be partially reversed by neutralization of CXCL2, CCL3, and IL-6, by mAb depletion of neutrophils, and by genetic deletion of Cxcr2. We found that miR-223 controlled lung recruitment of myeloid cells, and consequently, neutrophil-driven lethal inflammation. We conclude that miR-223 directly targets the chemoattractants CXCL2, CCL3, and IL-6 in myeloid cells. Our study not only reveals an essential role for a single miRNA in TB, it also identifies new targets for, and assigns biological functions to, miR-223. By regulating leukocyte chemotaxis via chemoattractants, miR-223 is critical for the control of TB and potentially other chronic inflammatory diseases.

  16. A Radium-223 microgenerator from cyclotron-produced trace Actinium-227

    International Nuclear Information System (INIS)

    Abou, Diane S.; Pickett, Juile; Mattson, John E.; Thorek, Daniel L.J.

    2017-01-01

    The alpha particle emitter Radium-223 dichloride ("2"2"3RaCl_2) has recently been approved for treatment of late-stage bone metastatic prostate cancer. There is considerable interest in studying this new agent outside of the clinical setting, however the supply of "2"2"3Ra is limited and expensive. We have engineered a "2"2"3Ra microgenerator using traces of "2"2"7Ac previously generated from cyclotron-produced "2"2"5Ac. Radiochemically pure "2"2"3RaCl_2 was made, characterized, evaluated in vivo, and the source was recovered in high yield for regeneration of the microgenerator. - Highlights: • A "2"2"3Ra microgenerator was built using residual "2"2"7Ac from cyclotron-produced "2"2"5Ac. • Following "2"2"5Ac decay, the residual "2"2"7Ac was processed into pure "2"2"3Ra. • "2"2"7Ac and "2"2"7Th were recovered in high yield for a permanent supply of "2"2"3Ra. • Clinically supplied and generator-produced "2"2"3Ra have equivalent in vivo distribution. • Microdose column provides sufficient material for research use.

  17. 12 CFR 223.54 - What advertisements and statements are prohibited by section 23B?

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 3 2010-01-01 2010-01-01 false What advertisements and statements are prohibited by section 23B? 223.54 Section 223.54 Banks and Banking FEDERAL RESERVE SYSTEM (CONTINUED) BOARD OF GOVERNORS OF THE FEDERAL RESERVE SYSTEM TRANSACTIONS BETWEEN MEMBER BANKS AND THEIR AFFILIATES (REGULATION W) General Provisions of Section 23B §...

  18. 48 CFR 952.223 - Clauses related to environment, energy and water efficiency, renewable energy technologies...

    Science.gov (United States)

    2010-10-01

    ... environment, energy and water efficiency, renewable energy technologies, occupational safety, and drug-free workplace. 952.223 Section 952.223 Federal Acquisition Regulations System DEPARTMENT OF ENERGY CLAUSES AND... related to environment, energy and water efficiency, renewable energy technologies, occupational safety...

  19. 12 CFR 223.33 - What rules apply to derivative transactions?

    Science.gov (United States)

    2010-01-01

    ... Requirements Under Section 23A § 223.33 What rules apply to derivative transactions? (a) Market terms... with affiliates comply with the market terms requirement of § 223.51. (c) Credit derivatives. A credit... 12 Banks and Banking 3 2010-01-01 2010-01-01 false What rules apply to derivative transactions...

  20. 5 CFR 591.223 - When does OPM conduct COLA surveys?

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false When does OPM conduct COLA surveys? 591.223 Section 591.223 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS ALLOWANCES AND DIFFERENTIALS Cost-of-Living Allowance and Post Differential-Nonforeign Areas Cost-Of-Living...

  1. 50 CFR Figure 12 to Part 223 - Escape Opening & Cover Dimensions for 71-inch TED

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Escape Opening & Cover Dimensions for 71-inch TED 12 Figure 12 to Part 223 Wildlife and Fisheries NATIONAL MARINE FISHERIES SERVICE, NATIONAL OCEANIC AND ATMOSPHERIC ADMINISTRATION, DEPARTMENT OF COMMERCE MARINE MAMMALS THREATENED MARINE AND ANADROMOUS SPECIES Pt. 223, Fig. 12 Figure 12 to...

  2. 25 CFR 166.223 - Can I use a permit as collateral for a loan?

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Can I use a permit as collateral for a loan? 166.223... PERMITS Permit Requirements Permit (leasehold) Mortgage § 166.223 Can I use a permit as collateral for a loan? We may approve a permit containing a provision that authorizes the permittee to encumber the...

  3. 36 CFR 223.9 - Free use to owners of certain mining claims.

    Science.gov (United States)

    2010-07-01

    ... mining claims. 223.9 Section 223.9 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF... of certain mining claims. Free use will be granted to an owner of a mining claim located subsequent to July 23, 1955, or of a mining claim which is otherwise subject to Section 4 of the Act of July 23...

  4. 36 CFR 223.280 - Waiver of fees and/or fair market value.

    Science.gov (United States)

    2010-07-01

    ... fees and/or fair market value. The Forest Service waives the collection of fees otherwise required... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Waiver of fees and/or fair market value. 223.280 Section 223.280 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF...

  5. Daily temperature and precipitation data for 223 USSR Stations

    Energy Technology Data Exchange (ETDEWEB)

    Razuvaev, V.N.; Apasova, E.G.; Martuganov, R.A. [Research Institute of Hydrometeorological Information, Obninsk (Russian Federation); Vose, R.S. [Univ. of Tennessee, Knoxville, TN (United States); Steurer, P.M. [National Climatic Data Center, Asheville, NC (United States)

    1993-11-01

    On- May 23, 1972, the United States and the USSR established a bilateral initiative known as the Agreement on Protection of the Environment. Given recent interest in possible greenhouse gas-induced climate change, Working Group VIII (Influence of Environmental Changes on Climate) has become particularly useful to the scientific communities of both nations. Among its many achievements, Working Group VIII has been instrumental in the exchange of climatological information between the principal climate data centers of each country [i.e., the National Climatic Data Center (NCDC) in Asheville, North Carolina, and the Research Institute of Hydrometeorological Information in Obninsk, Russia]. Considering the relative lack of climate records previously available for the USSR, data obtained via this bilateral exchange are particularly valuable to researchers outside the former Soviet Union. To expedite the dissemination of these data, NOAA`s Climate and Global Change Program funded the Carbon Dioxide Information Analysis Center (CDIAC) and NCDC to distribute one of the more useful archives acquired through this exchange: a 223-station daily data set covering the period 1881-1989. This data set contains: (1) daily mean, minimum, and maximum temperature data; (2) daily precipitation data; (3) station inventory information (WMO No., name, coordinates, and elevation); (4) station history information (station relocation and rain gauge replacement dates); and (5) quality assurance information (i.e., flag codes that were assigned as a result of various data checks). The data set is available, free of charge, as a Numeric Data Package (NDP) from CDIAC. The NDP consists of 18 data files and a printed document which describes both the data files and the 223-station network in detail.

  6. MicroRNA-223 Targeting STIM1 Inhibits the Biological Behavior of Breast Cancer

    Directory of Open Access Journals (Sweden)

    Yanfang Yang

    2018-01-01

    Full Text Available Background/Aims: To investigate the cellular effects and clinical significance of microRNA-223 (miR-223 in breast cancer by targeting stromal interaction molecule1 (STIM1. Methods: Breast cancer cell lines (T47D, MCF-7, SKB-R3, MDA-MB-231 and MDA-MB-435 and a normal breast epithelial cell line (MCF-10A were prepared for this study. MiR-223 mimics, anti-miR-223 and pcDNA 3.1-STIM1 were transiently transfected into cancer cells independently or together, and then RT-qPCR was performed to detect the expressions of miR-223 and STIM1 mRNA, dual-luciferase reporter assay was conducted to examine the effects of miR-223 on STIM1, Western blotting was used to measure the expressions of the STIM1 proteins, MTT and Trans-well assays were performed to detect cell proliferation and invasion. Finally, the correlation of miR-223 and STIM1 was investigated by detecting with ISH and IHC in breast cancer specimens or the corresponding adjacent normal tissues. Results: Compared with normal cells and tissues, breast cancer tissues and cells exhibited significantly lower expression of miR-223, but higher expression of STIM1. MiR-223 could inhibit the proliferation and invasiveness of breast cancer cells by negatively regulating the expressions of STIM1. Reimplantation with STIM1 partially rescued the miRNA-223-induced inhibition of breast cancer cells. Clinical data revealed that high expression of STIM1 and miR-223 was respectively detrimental and beneficial factor impacting patient’s disease-free survival (DFS rather than overall survival (OS. Moreover, Pearson correlation analysis also confirmed that STIM1 was inversely correlated with miR-223. Conclusion: MiR-223 inhibits the proliferation and invasion of breast cancer by targeting STIM1. The miR-223/STIM1 axis could possibly be a potential therapeutic target for treating breast cancer patients.

  7. MiR-223 suppresses cell proliferation by targeting IGF-1R.

    Directory of Open Access Journals (Sweden)

    Cheng You Jia

    Full Text Available To study the roles of microRNA-223 (miR-223 in regulation of cell growth, we established a miR-223 over-expression model in HeLa cells infected with miR-223 by Lentivirus pLL3.7 system. We observed in this model that miR-223 significantly suppressed the proliferation, growth rate, colony formation of HeLa cells in vitro, and in vivo tumorigenicity or tumor formation in nude mice. To investigate the mechanisms involved, we scanned and examined the potential and putative target molecules of miR-223 by informatics, quantitative PCR and Western blot, and found that insulin-like growth factor-1 receptor (IGF-1R was the functional target of miR-223 inhibition of cell proliferation. Targeting IGF-1R by miR-223 was not only seen in HeLa cells, but also in leukemia and hepatoma cells. The downstream pathway, Akt/mTOR/p70S6K, to which the signal was mediated by IGF-1R, was inhibited as well. The relative luciferase activity of the reporter containing wild-type 3'UTR(3'untranslated region of IGF-1R was significantly suppressed, but the mutant not. Silence of IGF-1R expression by vector-based short hairpin RNA resulted in the similar inhibition with miR-223. Contrarily, rescued IGF-1R expression in the cells that over-expressed miR-223, reversed the inhibition caused by miR-223 via introducing IGF-1R cDNA that didn't contain the 3'UTR. Meanwhile, we also noted that miR-223 targeted Rasa1, but the downstream molecules mediated by Rasa1 was neither targeted nor regulated. Therefore we believed that IGF-1R was the functional target for miR-223 suppression of cell proliferation and its downstream PI3K/Akt/mTOR/p70S6K pathway suppressed by miR-223 was by targeting IGF-1R.

  8. 48 CFR 952.223-71 - Integration of environment, safety, and health into work planning and execution.

    Science.gov (United States)

    2010-10-01

    ..., safety, and health into work planning and execution. 952.223-71 Section 952.223-71 Federal Acquisition... Provisions and Clauses 952.223-71 Integration of environment, safety, and health into work planning and... safety and health standards applicable to the work conditions of contractor and subcontractor employees...

  9. 25 CFR 1000.223 - When can a Tribe/Consortium request a waiver of a regulation?

    Science.gov (United States)

    2010-04-01

    ... regulation? 1000.223 Section 1000.223 Indians OFFICE OF THE ASSISTANT SECRETARY, INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR ANNUAL FUNDING AGREEMENTS UNDER THE TRIBAL SELF-GOVERNMENT ACT AMENDMENTS TO THE INDIAN SELF-DETERMINATION AND EDUCATION ACT Waiver of Regulations § 1000.223 When can a Tribe/Consortium...

  10. MiR-223 targeting MAFB suppresses proliferation and migration of nasopharyngeal carcinoma cells

    International Nuclear Information System (INIS)

    Yang, Wanyong; Lan, Xi; Li, Dongmin; Li, Tao; Lu, Shemin

    2015-01-01

    Mounting evidence suggests that miRNAs have major functions in tumor pathogenesis, and this study aimed to identify the candidate miRNA and investigate its role in nasopharyngeal carcinoma (NPC). MiRNA and mRNA expressions were screened by microarray assays. The cell proliferation, colony formation and migration ability were measured by MTT, soft agar and wound healing assays, respectively. The tumor growth suppression was evaluated by xenografting in nude mice. The plasma miR-223 levels in NPC patients were detected by TaqMan analysis. Real-time quantitative PCR and Western blotting were used to confirm miR-223 and MAFB expression levels. The targeting relationship between miR-223 and MAFB was verified using dual luciferase reporter assay. The miR-223 expression was decreased in CNE-1, CNE-2 cells as compared with NP69 cells, an immortalized human nasopharyngeal epithelial cell line, and its level also reduced in NPC patients’ plasma as compared with healthy controls. Exogenous expression of miR-223 in CNE-2 cells could inhibit cell proliferation both in vitro and in vivo. Extrogenous miR-223 in CNE-2 cells would decrease the ability of colony formation and migration. MAFB, a transcription factor of Maf family members, was identified as a target gene of miR-223. We found that migration and invasion abilities were inhibited by MAFB silencing. MiR-223 negatively regulates the growth and migration of NPC cells via reducing MAFB expression, and this finding provides a novel insight into understanding miR-223 regulation mechanism in nasopharyngeal carcinoma tumorigenesis

  11. Reagents for Astatination of Biomolecules. 5. Evaluation of hydrazone linkers in 211At- and 125I-labeled closo-decaborate(2-) conjugates of Fab′ as a means of decreasing kidney retention

    Science.gov (United States)

    Wilbur, D. Scott; Chyan, Ming-Kuan; Hamlin, Donald K.; Nguyen, Holly; Vessella, Robert L.

    2011-01-01

    Evaluation of monoclonal antibody (MAb) fragments (e.g. Fab′, Fab or engineered fragments) as cancer-targeting reagents for therapy with the α-particle emitting radionuclide astatine-211 (211At) has been hampered by low in vivo stability of the label and a propensity of these proteins localize to kidneys. Fortunately, our group has shown that the low stability of the 211At label, generally a meta- or para-[211At]astatobenzoyl conjugate, on MAb Fab′ fragments can be dramatically improved by use of closo-decaborate(2-) conjugates. However, the higher stability of radiolabeled MAb Fab′ conjugates appears to result in retention of the radioactivity in kidneys. This investigation was conducted to evaluate whether the retention of radioactivity in kidney might be decreased by the use of acid-cleavable hydrazone between the Fab′ and the radiolabeled closo-decaborate(2-) moiety. Five conjugation reagents containing sulfhydryl-reactive maleimide groups, a hydrazone functionality and a closo-decaborate(2-) moiety were prepared. In four of the five conjugation reagents, a discrete polyethylene glycol (PEG) linker was used, and one substituent adjacent to the hydrazone was varied (phenyl, benzoate, anisole or methyl) to provide varying acid-sensitivity. In the initial studies, the five maleimido-closo-decaborate(2-) conjugation reagents were radioiodinated (125I or 131I), then conjugated with an anti-PSMA Fab′ (107-1A4 Fab′). Biodistributions of the five radioiodinated Fab′ conjugates were obtained in nude mice at 1, 4 and 24 h post injection (pi). In contrast to closo-decaborate(2-) conjugated to 107-1A4 Fab′ through a non-cleavable linker, two conjugates containing either a benzoate or a methyl substituent on the hydrazone functionality displayed clearance rates from kidney, liver and spleen that were similar to those obtained with directly radioiodinated Fab′ (i.e. no conjugate). The maleimido-closo-decaborate(2-) conjugation reagent containing a benzoate

  12. Prague, September 1st, 1816: Premiere of Louis Spohr’s Faust 223. A documentary study

    Czech Academy of Sciences Publication Activity Database

    Freemanová, Michaela

    2016-01-01

    Roč. 53, 2/3 (2016), s. 223-234 ISSN 0018-7003 Institutional support: RVO:68378076 Keywords : Louis Spohr’s Faust * theatre performance * Prague’s Estates Theatre Subject RIV: AL - Art, Architecture, Cultural Heritage

  13. 36 CFR 223.201 - Limitations on unprocessed timber harvested in Alaska.

    Science.gov (United States)

    2010-07-01

    ... Conservation and Shortage Relief Act of 1990 Program § 223.201 Limitations on unprocessed timber harvested in... or serious deterioration of logs unsalable locally because of an unforeseen loss of market, (c...

  14. 75 FR 14483 - Third Meeting: RTCA Special Committee 223: Airport Surface Wireless Communications

    Science.gov (United States)

    2010-03-25

    .../SC223-005) Special Committee Leadership Designated Federal Official (DFO): Mr. Brent Phillips Co-Chair... Continue AeroMACS Profile definition Wednesday Afternoon--Reconvene Plenary Profiles WG Status Report and...

  15. 75 FR 30899 - Fourth Meeting: RTCA Special Committee 223: Airport Surface Wireless Communications

    Science.gov (United States)

    2010-06-02

    ... Paper No. 084- 10/SC223-007) Special Committee Leadership Designated Federal Official (DFO): Mr. Brent...) Breakout Session User services and applications definition Wednesday Afternoon--Reconvene Plenary Profiles...

  16. Preparation of 227Ac/223Ra by neutron irradiation of 226Ra

    International Nuclear Information System (INIS)

    Ekaterina Kukleva; Jan Kozempel; Martin Vlk; Petra Micolova; Dusan Vopalka

    2015-01-01

    Radium-223 is a prospective alpha-emitter for targeted radionuclide therapy. Although 223 Ra is formed naturally by the decay of 235 U, for practical reasons its preparation involves neutron irradiation of 226 Ra. The β - decay of the 227 Ra (T ½ = 43 min) produced via 226 Ra(n,γ) 227 Ra reaction leads to 227 Ac, a mother nuclide of 227 Th and subsequently 223 Ra. Radium target material is generally available in multigram quantities from historical stock. The main aim of this study was to experimentally as well as theoretically evaluate and verify the available literature data on production of 227 Ac/ 223 Ra. According to the data obtained from the γ-spectra, the approximate yield values were determined and effective cross section value for the 227 Ac production was calculated to 14 ± 4 b. (author)

  17. MicroRNA-223 controls susceptibility to tuberculosis by regulating lung neutrophil recruitment

    OpenAIRE

    Dorhoi, Anca; Iannaccone, Marco; Farinacci, Maura; Faé, Kellen C.; Schreiber, Jörg; Moura-Alves, Pedro; Nouailles, Geraldine; Mollenkopf, Hans-Joachim; Oberbeck-Müller, Dagmar; Jörg, Sabine; Heinemann, Ellen; Hahnke, Karin; Löwe, Delia; Del Nonno, Franca; Goletti, Delia

    2013-01-01

    The molecular mechanisms that control innate immune cell trafficking during chronic infection and inflammation, such as in tuberculosis (TB), are incompletely understood. During active TB, myeloid cells infiltrate the lung and sustain local inflammation. While the chemoattractants that orchestrate these processes are increasingly recognized, the posttranscriptional events that dictate their availability are unclear. We identified microRNA-223 (miR-223) as an upregulated small noncoding RNA in...

  18. MicroRNA-223 Expression Is Upregulated in Insulin Resistant Human Adipose Tissue

    Directory of Open Access Journals (Sweden)

    Tung-Yueh Chuang

    2015-01-01

    Full Text Available MicroRNAs (miRNAs are short noncoding RNAs involved in posttranscriptional regulation of gene expression and influence many cellular functions including glucose and lipid metabolism. We previously reported that adipose tissue (AT from women with polycystic ovary syndrome (PCOS or controls with insulin resistance (IR revealed a differentially expressed microRNA (miRNA profile, including upregulated miR-93 in PCOS patients and in non-PCOS women with IR. Overexpressed miR-93 directly inhibited glucose transporter isoform 4 (GLUT4 expression, thereby influencing glucose metabolism. We have now studied the role of miR-223, which is also abnormally expressed in the AT of IR subjects. Our data indicates that miR-223 is significantly overexpressed in the AT of IR women, regardless of whether they had PCOS or not. miR-223 expression in AT was positively correlated with HOMA-IR. Unlike what is reported in cardiomyocytes, overexpression of miR-223 in human differentiated adipocytes was associated with a reduction in GLUT4 protein content and insulin-stimulated glucose uptake. In addition, our data suggests miR-223 regulates GLUT4 expression by direct binding to its 3′ untranslated region (3′UTR. In conclusion, in AT miR-223 is an IR-related miRNA that may serve as a potential therapeutic target for the treatment of IR-related disorders.

  19. Radium-223 in treatment of castration-resistant prostate cancer with skeletal metastases

    Directory of Open Access Journals (Sweden)

    V. B. Matveev

    2017-01-01

    Full Text Available More than 90 % of patients with metastatic castration-resistant prostate cancer (CRPC have radiologically confirmed skeletal metastases. Traditional treatment methods such as administration of painkillers, external beam therapy, bisphosphonates or denosumab, as well as injections of strontium-89 or samarium-153 radionuclides, have only palliative effect and in some cases can postpone development of skeletal complications. Alpha-emitter radium-223 dichloride (Ra-223; alpharadin previously is currently one of the known drugs with proven effectiveness in relation to increasing overall survival of patients with CRPC. Ra-223 was developed specifically for patients with CRPC and symptomatic skeletal metastases. The drug targets the areas of skeletal tissue remodeling. Ra-223 is the therapy of choice in patients with CRPC and skeletal metastases and without confirmed visceral metastases before and after docetaxel chemotherapy. Chemotherapy after treatment with Ra-223 is a possible and satisfactory tolerable treatment option. Combination of Ra-223 with abiraterone, enzalutamide, or denosumab is, apparently, effective and safe, but further studies are necessary.

  20. The Emerging Role of miR-223 in Platelet Reactivity: Implications in Antiplatelet Therapy

    Science.gov (United States)

    Shi, Rui; Zhou, Xin; Ji, Wen-Jie; Zhang, Ying-Ying; Ma, Yong-Qiang; Zhang, Jian-Qi

    2015-01-01

    Platelets are anuclear cells and are devoid of genomic DNA, but they are capable of de novo protein synthesis from mRNA derived from their progenitor cells, megakaryocytes. There is mounting evidence that microRNA (miRNA) plays an important role in regulating gene expression in platelets. miR-223 is the most abundant miRNAs in megakaryocytes and platelets. One of the miR-223-regulated genes is ADP P2Y12, a key target for current antiplatelet drug therapy. Recent studies showed that a blunted response to P2Y12 antagonist, that is, high on-treatment platelet reactivity (HTPR), is a strong predictor of major cardiovascular events (MACEs) in coronary heart disease (CHD) patients receiving antiplatelet treatment. Recent clinical cohort study showed that the level of circulating miR-223 is inversely associated with MACE in CHD patients. In addition, our recent data demonstrated that the level of both intraplatelet and circulating miR-223 is an independent predictor for HTPR, thus providing a link between miR-223 and MACE. These lines of evidence indicate that miR-223 may serve as a potential regulatory target for HTPR, as well as a diagnostic tool for identification of HTPR in clinical settings. PMID:26221610

  1. MicroRNA-223 Is Upregulated in Active Tuberculosis Patients and Inhibits Apoptosis of Macrophages by Targeting FOXO3.

    Science.gov (United States)

    Xi, Xiue; Zhang, Chunxiao; Han, Wei; Zhao, Huayang; Zhang, Huiqiang; Jiao, Junhua

    2015-12-01

    Macrophage apoptosis is a host innate defense mechanism against tuberculosis (TB). In this study, we aimed to investigate the role of microRNA-223 (miR-223) in macrophage apoptosis of TB. We analyzed apoptosis in peripheral blood macrophages of active TB patients, infected human macrophages (TDMs and MDMs) with the Mycobacterium tuberculosis (Mtb) strain H37Rv, and observed the expression of miR-223 to investigate the relationship between miR-223 and macrophage apoptosis induced by Mtb. The apoptosis rate of peripheral blood macrophages decreased in active TB patients compared with healthy controls, and miR-223 expression increased significantly in macrophages after H37Rv infection. Transfection of human macrophages (TDMs and MDMs) with miR-223 inhibited macrophage apoptosis. We also demonstrated that miR-223 directly suppressed forkhead box O3 (FOXO3), and FOXO3 played a critical role as a mediator of the biological effects of miR-223 in macrophage apoptosis. The overexpression of FOXO3 remarkably reversed the apoptosis inhibitory effect of miR-223. Our data provide new clues for the essential role of miR-223 in the regulation of anti-Mtb-directed immune responses, which relies on the regulation of FOXO3 expression.

  2. Cytokinesis is blocked in mammalian cells transfected with Chlamydia trachomatis gene CT223

    Directory of Open Access Journals (Sweden)

    Weeks Sara K

    2009-01-01

    Full Text Available Abstract Background The chlamydiae alter many aspects of host cell biology, including the division process, but the molecular biology of these alterations remains poorly characterized. Chlamydial inclusion membrane proteins (Incs are likely candidates for direct interactions with host cell cytosolic proteins, as they are secreted to the inclusion membrane and exposed to the cytosol. The inc gene CT223 is one of a sequential set of orfs that encode or are predicted to encode Inc proteins. CT223p is localized to the inclusion membrane in all tested C. trachomatis serovars. Results A plasmid transfection approach was used to examine the function of the product of CT223 and other Inc proteins within uninfected mammalian cells. Fluorescence microscopy was used to demonstrate that CT223, and, to a lesser extent, adjacent inc genes, are capable of blocking host cell cytokinesis and facilitating centromere supranumeracy defects seen by others in chlamydiae-infected cells. Both phenotypes were associated with transfection of plasmids encoding the carboxy-terminal tail of CT223p, a region of the protein that is likely exposed to the cytosol in infected cells. Conclusion These studies suggest that certain Inc proteins block cytokinesis in C. trachomatis-infected cells. These results are consistent with the work of others showing chlamydial inhibition of host cell cytokinesis.

  3. Lymphocyte function following radium-223 therapy in patients with metastasized, castration-resistant prostate cancer

    International Nuclear Information System (INIS)

    Barsegian, Vahe; Moeckel, Daniel; Mueller, Stefan P.; Bockisch, Andreas; Horn, Peter A.; Lindemann, Monika

    2017-01-01

    Therapy with the alpha-emitter radium-223 chloride ("2"2"3Ra) is an innovative therapeutic option in patients with metastasized, castration-resistant prostate cancer. However, radiotherapy can lead to hematopoietic toxicity. The aim of this study was to determine if "2"2"3Ra therapy induces an impairment of cellular antimicrobial immune responses. In 11 patients receiving "2"2"3Ra treatment, lymphocyte proliferation and the production of pro- and anti-inflammatory cytokines (interferon-γ and interleukin-10) were determined, using lymphocyte transformation testing and ELISpot, respectively. Lymphocyte function after stimulation with mitogens and microbial antigens was assessed prior to therapy and at day 1, 7 and 28 after therapy. Lymphocyte proliferation and the production of interferon-γ and interleukin-10 towards mitogens and antigens remained unchanged after therapy. Consistent with these in vitro data, we did not observe infectious complications after treatment. The results argue against an impairment of lymphocyte function after "2"2"3Ra therapy. Thus, immune responses against pathogens should remain unaffected. (orig.)

  4. Lymphocyte function following radium-223 therapy in patients with metastasized, castration-resistant prostate cancer

    Energy Technology Data Exchange (ETDEWEB)

    Barsegian, Vahe; Moeckel, Daniel [Helios Kliniken, Institute of Nuclear Medicine, Schwerin (Germany); Mueller, Stefan P.; Bockisch, Andreas [University Hospital Essen, Department of Nuclear Medicine, Essen (Germany); Horn, Peter A.; Lindemann, Monika [University Hospital Essen, Institute for Transfusion Medicine, Essen (Germany)

    2017-02-15

    Therapy with the alpha-emitter radium-223 chloride ({sup 223}Ra) is an innovative therapeutic option in patients with metastasized, castration-resistant prostate cancer. However, radiotherapy can lead to hematopoietic toxicity. The aim of this study was to determine if {sup 223}Ra therapy induces an impairment of cellular antimicrobial immune responses. In 11 patients receiving {sup 223}Ra treatment, lymphocyte proliferation and the production of pro- and anti-inflammatory cytokines (interferon-γ and interleukin-10) were determined, using lymphocyte transformation testing and ELISpot, respectively. Lymphocyte function after stimulation with mitogens and microbial antigens was assessed prior to therapy and at day 1, 7 and 28 after therapy. Lymphocyte proliferation and the production of interferon-γ and interleukin-10 towards mitogens and antigens remained unchanged after therapy. Consistent with these in vitro data, we did not observe infectious complications after treatment. The results argue against an impairment of lymphocyte function after {sup 223}Ra therapy. Thus, immune responses against pathogens should remain unaffected. (orig.)

  5. Preparation and labelling hydroxyapatite with 223Ra and 99mTc

    International Nuclear Information System (INIS)

    Malkova, E.; Micolova, P.; Vlk, M.; Kozempel, J.; Rabyk, M.

    2015-01-01

    The aim of this study was the preparation, studies and investigation of novel nanoparticles suitable for targeted delivery of 223 Ra and 99 mTc. Preliminary experiments were focused on the synthesis of hydroxyapatite nanoparticles (HANPs) and their affinity to 223 Ra and 99m Tc. Technetium-99m ( 99 mTc, T 1 /2 = 6.0 h) is the most commonly used medical radionuclide for diagnostic procedures. Radium-223 is the first -emitting radionuclide approved for targeted radionuclide therapy. The physical half-life of 223 Ra of 11.4 days is providing sufficient time for the synthesis, distribution and administration of the radiopharmaceutical to patients. HANPs labelling yields with 223 Ra were 95 - 100 % and with 99m Tc were 93 - 94 % depending on the reaction conditions. HANPs were studied on FT-IR (Fourier transform infrared spectroscopy), XRPD (X-Ray Powder Diffraction), DLS (Dynamic Light Scattering), and the sizes of nanoparticles were studied at temperatures 80, 120 and 200 grad C. (authors)

  6. 2-(2,3-Dihydro-1H-indol-3-yl)ethanol

    DEFF Research Database (Denmark)

    Frydenvang, Karla Andrea; Sommer, Michael Bech; Heckmann, Dieter

    2004-01-01

    The first direct resolution of racemic 2-(2,3-dihydro-lH-indol-3-yl)ethanol-prepared by catalytic hydrogenation of 2-(lH-indol-3-yl)ethanol-has been accomplished by chiral simulated moving bed (SMB) chromatography. The single enantiomers were isolated as their dihydrogen phosphate salts. Single......-crystal X-ray analyses were successful, revealing that the (+)-enantiomer of 2-(2,3-dihydro-lH-indol-3-yl)ethanol has the (S) configuration. Chirality 16:126-130, 2004....

  7. Levels in 223Th populated by α decay of 227U

    Science.gov (United States)

    Kalaninová, Z.; Antalic, S.; Heßberger, F. P.; Ackermann, D.; Andel, B.; Kindler, B.; Laatiaoui, M.; Lommel, B.; Maurer, J.

    2015-07-01

    Levels in 223Th populated by the α decay of 227U were investigated using α -γ decay spectroscopy. The 227U isotope was produced in the fusion-evaporation reaction 22Ne +208Pb at the velocity filter separator for heavy-ion reaction products at Gesellschaft für Schwerionenforschung in Darmstadt (Germany). Several new excited levels and γ transitions were identified in 223Th . An improved α -decay scheme of 227U was suggested. The experimental α -decay energy spectrum of 227U was compared with the Monte Carlo simulation performed using the toolkit geant4.

  8. On the interpretation of the 14C fine structure observed in the 223Ra decay

    International Nuclear Information System (INIS)

    Hussonnois, M.; Le Du, J.F.; Brillard, L.

    1989-01-01

    The low hindrance factors observed in the 14 C decay of 223 Ra to the 209 Pb excited states at 779 and 1423 KeV are interpreted as a consequence of the similitude of the wave functions describing the uncoupled neutron in 223 Ra, Ω = 3/2 (3/2 [631] x3/2 [761], and in the two first excited states of 209 Pb, namely the 1i 11/2 and 1j 15/2 shell model orbits

  9. Weak lensing study of dark matter filaments and application to the binary cluster A 222 and A 223

    NARCIS (Netherlands)

    Dietrich, JP; Schneider, P; Clowe, D; Romano-Diaz, E; Kerp, J

    We present a weak lensing analysis of the double cluster system Abell 222 and Abell 223. The lensing reconstruction shows evidence for a possible dark matter filament connecting both clusters. The case for a filamentary connection between A 222/223 is supported by an analysis of the galaxy density

  10. 36 CFR 223.113 - Modification of contracts to prevent environmental damage or to conform to forest plans.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Modification of contracts to prevent environmental damage or to conform to forest plans. 223.113 Section 223.113 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE SALE AND DISPOSAL OF NATIONAL FOREST SYSTEM...

  11. miR-223 is upregulated in monocytes from patients with tuberculosis and regulates function of monocyte-derived macrophages.

    Science.gov (United States)

    Liu, Yanhua; Wang, Ruo; Jiang, Jing; Yang, Bingfen; Cao, Zhihong; Cheng, Xiaoxing

    2015-10-01

    Tuberculosis (TB) is a serious infectious disease that most commonly affects the lungs. Macrophages are among the first line defenders against establishment of Mycobacterium tuberculosis infection in the lungs. In this study, we found that activation and cytokine production in monocyte-derived macrophages (MDM) from patients with active TB was impaired. miR-223 expression was significantly elevated in monocytes and MDM from patients with TB compared with healthy controls. To determine the functional role of miR-223 in macrophages, stable miR-223-expressing and miR-223 antisense-expressing U937 cells were established. Compared with empty vector controls, expression of IL-1β, IL-6, TNF-α and IL-12p40 genes was significantly higher in miR-223 antisense-expressing U937 cells, but lower in miR-223-expressing U937 cells. miR-223 can negatively regulate activation of NF-κB by inhibition of p65 phosphorylation and nuclear translocation. It is concluded that miR-223 can regulate macrophage function by inhibition of cytokine production and NF-κB activation. Copyright © 2015 Elsevier Ltd. All rights reserved.

  12. 78 FR 59624 - Guidance for Industry #223: Small Entity Compliance Guide-Declaring Color Additives in Animal...

    Science.gov (United States)

    2013-09-27

    ... DEPARTMENT OF HEALTH AND HUMAN SERVICES Food and Drug Administration 21 CFR Part 501 [Docket No. FDA-2013-D-1088] Guidance for Industry 223: Small Entity Compliance Guide--Declaring Color Additives... industry 223 entitled ``Small Entity Compliance Guide--Declaring Color Additives in Animal Foods.'' This...

  13. 12 CFR 223.42 - What covered transactions are exempt from the quantitative limits, collateral requirements, and...

    Science.gov (United States)

    2010-01-01

    ...) Purchasing certain liquid assets. Purchasing an asset having a readily identifiable and publicly available... quantitative limits, collateral requirements, and low-quality asset prohibition? 223.42 Section 223.42 Banks... requirements, and low-quality asset prohibition? The following transactions are not subject to the quantitative...

  14. 50 CFR Figure 16 to Part 223 - Escape Opening and Flap Dimensions for the Double Cover Flap TED

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Escape Opening and Flap Dimensions for the Double Cover Flap TED 16 Figure 16 to Part 223 Wildlife and Fisheries NATIONAL MARINE FISHERIES SERVICE, NATIONAL OCEANIC AND ATMOSPHERIC ADMINISTRATION, DEPARTMENT OF COMMERCE MARINE MAMMALS THREATENED MARINE AND ANADROMOUS SPECIES Pt. 223, Fig. 1...

  15. 50 CFR Figure 5 to Part 223 - Net Diagram for the Excluder Panel of the Parker Soft TED

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Net Diagram for the Excluder Panel of the Parker Soft TED 5 Figure 5 to Part 223 Wildlife and Fisheries NATIONAL MARINE FISHERIES SERVICE, NATIONAL OCEANIC AND ATMOSPHERIC ADMINISTRATION, DEPARTMENT OF COMMERCE MARINE MAMMALS THREATENED MARINE AND ANADROMOUS SPECIES Pt. 223, Fig. 5 Figure 5...

  16. A model-specific role of microRNA-223 as a mediator of kidney injury during experimental sepsis.

    Science.gov (United States)

    Colbert, James F; Ford, Joshay A; Haeger, Sarah M; Yang, Yimu; Dailey, Kyrie L; Allison, Kristen C; Neudecker, Viola; Evans, Christopher M; Richardson, Vanessa L; Brodsky, Kelley S; Faubel, Sarah; Eltzschig, Holger K; Schmidt, Eric P; Ginde, Adit A

    2017-08-01

    Sepsis outcomes are heavily dependent on the development of septic organ injury, but no interventions exist to interrupt or reverse this process. microRNA-223 (miR-223) is known to be involved in both inflammatory gene regulation and host-pathogen interactions key to the pathogenesis of sepsis. The goal of this study was to determine the role of miR-223 as a mediator of septic kidney injury. Using miR-223 knockout mice and multiple models of experimental sepsis, we found that miR-223 differentially influences acute kidney injury (AKI) based on the model used. In the absence of miR-223, mice demonstrated exaggerated AKI in sterile models of sepsis (LPS injection) and attenuated AKI in a live-infection model of sepsis (cecal ligation and puncture). We demonstrated that miR-223 expression is induced in kidney homogenate after cecal ligation and puncture, but not after LPS or fecal slurry injection. We investigated additional potential mechanistic explanations including differences in peritoneal bacterial clearance and host stool virulence. Our findings highlight the complex role of miR-223 in the pathogenesis of septic kidney injury, as well as the importance of differences in experimental sepsis models and their consequent translational applicability. Copyright © 2017 the American Physiological Society.

  17. 48 CFR 1852.223-74 - Drug- and alcohol-free workforce.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Drug- and alcohol-free... and Clauses 1852.223-74 Drug- and alcohol-free workforce. As prescribed in 1823.570-2, insert the following clause: Drug- and Alcohol-Free Workforce (MAR 1996) (a) Definitions. As used in this clause the...

  18. 36 CFR 223.278 - Sale of forest botanical products and collection of fees.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Sale of forest botanical..., DEPARTMENT OF AGRICULTURE SALE AND DISPOSAL OF NATIONAL FOREST SYSTEM TIMBER Forest Botanical Products § 223.278 Sale of forest botanical products and collection of fees. The responsible Forest Officer shall...

  19. 27 CFR 25.223 - Destruction of beer off brewery premises.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Destruction of beer off... TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS BEER Voluntary Destruction § 25.223 Destruction of beer off brewery premises. (a) Destruction without supervision. A brewer may destroy beer without...

  20. 5 CFR 9901.223 - Appeal to DoD for review of classification decisions.

    Science.gov (United States)

    2010-01-01

    ... state specific points of disagreement with the current classification. The employee may also include a....223 Appeal to DoD for review of classification decisions. (a) Employee representation. An employee may... an appeal. A management official may disallow an employee's representative when— (1) An individual's...

  1. 48 CFR 52.223-15 - Energy Efficiency in Energy-Consuming Products.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Energy Efficiency in... Provisions and Clauses 52.223-15 Energy Efficiency in Energy-Consuming Products. As prescribed in 23.206, insert the following clause: Energy Efficiency in Energy-Consuming Products (DEC 2007) (a) Definition. As...

  2. 39 CFR 223.2 - Channels of communication, headquarters with area offices.

    Science.gov (United States)

    2010-07-01

    ... RELATIONSHIPS AND COMMUNICATION CHANNELS § 223.2 Channels of communication, headquarters with area offices. (a... 39 Postal Service 1 2010-07-01 2010-07-01 false Channels of communication, headquarters with area...). Whether published on paper or online, such policies must be coordinated with other appropriate...

  3. Radium-223 therapy of advanced metastatic castration-resistant prostate cancer

    DEFF Research Database (Denmark)

    Fosbøl, Marie Øbro; Petersen, Peter Meidahl; Kjaer, Andreas

    2018-01-01

    ) can serve as a prognostic biomarker of overall survival (OS) and hematological toxicity, as well as a tool for response assessment in patients with mCRPC treated with223RaCl2Methods:Retrospective study of the Danish cohort of mCRPC patients who received223RaCl2therapy between March 2014 and October...... ratio 2.65 [95% CI: 1.5-4.71];P= 0.001). Likewise, baseline BSI was prognostic for occurrence of hematological toxicity and patients with BSI > 5 had an odds ratio of 3.02 (95% CI: 1.2-7.8;P= 0.02) for toxicity. BSI declined during therapy in 44% of patients who completed three cycles of223RaCl2(n= 52......) and in 84% of patients after EOT (n= 32). There was no significant association between change in BSI during therapy and OS.Conclusion:BSI is a promising biomarker for late-stage mCRPC patients receiving223RaCl2for prognostication of OS and hematological toxicity. Further prospective studies are needed...

  4. 48 CFR 1852.223-72 - Safety and Health (Short Form).

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Safety and Health (Short... and Clauses 1852.223-72 Safety and Health (Short Form). As prescribed in 1823.7001(e), insert the following clause: Safety and Health (Short Form) (APR 2002) (a) Safety is the freedom from those conditions...

  5. 50 CFR 223.206 - Exceptions to prohibitions relating to sea turtles.

    Science.gov (United States)

    2010-10-01

    ...) Fail to employ basket-style longline gear such that the mainline is deployed slack when fishing. (v... set between any two floats. Vessel operators using basket-style longline gear must set a minimum of 10... 14070, Mar. 23, 1999] Editorial Note: For Federal Register citations to § 223.206, see the List of CFR...

  6. Dosimetry of {sup 223}Ra-chloride: dose to normal organs and tissues

    Energy Technology Data Exchange (ETDEWEB)

    Lassmann, Michael [University of Wuerzburg, Department of Nuclear Medicine, Wuerzburg (Germany); Nosske, Dietmar [Federal Office for Radiation Protection (BfS), Department of Radiation and Health, Oberschleissheim (Germany)

    2013-02-15

    {sup 223}Ra-Chloride (also called Alpharadin {sup registered}) targets bone metastases with short range alpha particles. In recent years several clinical trials have been carried out showing, in particular, the safety and efficacy of palliation of painful bone metastases in patients with castration-resistant prostate cancer using {sup 223}Ra-chloride. The purpose of this work was to provide a comprehensive dosimetric calculation of organ doses after intravenous administration of {sup 223}Ra-chloride according to the present International Commission on Radiological Protection (ICRP) model for radium. Absorbed doses were calculated for 25 organs or tissues. Bone endosteum and red bone marrow show the highest dose coefficients followed by liver, colon and intestines. After a treatment schedule of six intravenous injections with 0.05 MBq/kg of {sup 223}Ra-chloride each, corresponding to 21 MBq for a 70 kg patient, the absorbed alpha dose to the bone endosteal cells is about 16 Gy and the corresponding absorbed dose to the red bone marrow is approximately 1.5 Gy. The comprehensive list of dose coefficients presented in this work will assist in comparing and evaluating organ doses from various therapy modalities used in nuclear medicine and will provide a base for further development of patient-specific dosimetry. (orig.)

  7. 36 CFR 223.7 - Permission for free use of timber outside free-use areas.

    Science.gov (United States)

    2010-07-01

    ..., DEPARTMENT OF AGRICULTURE SALE AND DISPOSAL OF NATIONAL FOREST SYSTEM TIMBER General Provisions § 223.7 Permission for free use of timber outside free-use areas. Similar material may be cut outside of a free-use area without permit in cases of emergency, but the person taking such material shall promptly notify...

  8. 48 CFR 52.223-5 - Pollution Prevention and Right-to-Know Information.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Pollution Prevention and... Provisions and Clauses 52.223-5 Pollution Prevention and Right-to-Know Information. As prescribed in 23.1005, insert the following clause: Pollution Prevention and Right-to-Know Information (AUG 2003) (a...

  9. Fine structures in 14C emission of 223Ra and 224Ra

    International Nuclear Information System (INIS)

    Hourani, E.; Rosier, L.; Berrier-Ronsin, G.; Elayi, A.; Mueller, A.C.; Rappenecker, G.; Rotbard, G.; Renou, G.; Liebe, A.; Stab, L.

    1991-01-01

    The measurement of the energy spectrum of 14 C nuclei emitted in the spontaneous radioactivity from 223 Ra and 224 Ra has been carried out, using thin and intense sources (480 MBq for 223 Ra and 3550 MBq for 224 Ra). The sources were obtained by implanting mass-separated beams from ISOLDE (CERN) into Al and vitreous C catchers. The measurement was performed with the supraconducting solenoidal spectrometer SOLENO installed at Orsay. The discovery, of a fine structure in the energy spectrum of 14 C emission from 223 Ra, which is analogous to the one known for α emission, is confirmed. Only 13% of the branching ratio in 14 C decay leads to the ground state of the residual nucleus, while 8l% to the first excited state. For 14 C emission of 224 Ra, a lower limit of 2 for the hindrance factor has been measured for the transition to the first excited state in the residual nucleus. Also, a precise identification in Z with a E·ΔE telescope has been performed for the radiation from the 223 Ra source. (author) 22 refs., 11 figs., 1 tab

  10. 36 CFR 223.6 - Cutting and removal of timber in free-use areas.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Cutting and removal of timber... OF AGRICULTURE SALE AND DISPOSAL OF NATIONAL FOREST SYSTEM TIMBER General Provisions § 223.6 Cutting... or designated by forest officers may be cut and removed for personal use for domestic purposes...

  11. SU-F-J-08: Quantitative SPECT Imaging of Ra-223 in a Phantom

    Energy Technology Data Exchange (ETDEWEB)

    Yue, J; Hobbs, R; Sgouros, G; Frey, E [Johns Hopkins University Baltimore, MD (United States)

    2016-06-15

    Purpose: Ra-223 therapy of prostate cancer bone metastases is being used to treat patients routinely. However, the absorbed dose distribution at the macroscopic and microscopic scales remains elusive, due to the inability to image the small activities injected. Accurate activity quantification through imaging is essential to calculate the absorbed dose in organs and sub-units in radiopharmaceutical therapy, enabling personalized absorbed dose-based treatment planning methodologies and more effective and optimal treatments. Methods: A 22 cm diameter by 20 cm long cylindrical phantom, containing a 3.52 cm diameter sphere, was used. A total of 2.01 MBq of Ra-223 was placed in the phantom with 177.6 kBq in the sphere. Images were acquired on a dual-head Siemens Symbia T16 gamma camera using three 20% full-width energy windows and centered at 84, 154, and 269 keV (120 projections, 360° rotation, 45 s per view). We have implemented reconstruction of Ra-223 SPECT projections using OS-EM (up to 20 iterations of 10 subsets) with compensation for attenuation using CT-based attenuation maps, collimator-detector response (CDR) (including septal penetration, scatter and Pb x-ray modeling), and scatter in the patient using the effective source scatter estimation (ESSE) method. The CDR functions and scatter kernels required for ESSE were computed using the SIMIND MC simulation code. All Ra-223 photon emissions as well as gamma rays from the daughters Rn-219 and Bi-211 were modeled. Results: The sensitivity of the camera in the three combined windows was 107.3 cps/MBq. The visual quality of the SPECT images was reasonably good and the activity in the sphere was 27% smaller than the true activity. This underestimation is likely due to partial volume effect. Conclusion: Absolute quantitative Ra-223 SPECT imaging is achievable with careful attention to compensate for image degrading factors and system calibration.

  12. Radiation exposure of relatives of patients treated with Ra-223 dichloride

    International Nuclear Information System (INIS)

    Wanke, C.; Szermerski, B.; Solle, A.; Geworski, L.; Kranert, W.T.; Andreeff, M.; TU Dresden

    2015-01-01

    Since November 2013, a radiopharmaceutical containing Ra-223 dichloride as active substance is approved in the European Union for patients with castration resistant prostate cancer with symptomatic bone metastases and no known visceral metastases. Ra-223 (T 1/2 = 11.43 d) decays via a chain of 4 alpha and 2 beta decays. This therapy is presently the only application of an alpha emitter in clinical routine therapy. To show that the exposure of relatives and caregivers of patients treated with Ra-223 dichloride in an outpatient setting does not exceed a value of 1 mSv, the multicenter study ''RAPSODY'' was conducted. As Ra-223 and most of its progeny emit alpha particles, the internal exposure had to be evaluated in particular. Within this study, measurements of the radiation emitted from the patient were performed using standard dose-rate meters. Wipe-tests were taken in the patients' homes to identify significant contaminations and evaluated by liquid scintillation counting. Samples of saliva and sweat were taken and measured using gamma spectrometry. Ra-223 disintegrates to the noble gas Rn-219 and was measured in the exhaled breath from the patients using conventional Radon Monitors. Furthermore, a computational fluid dynamics simulation (CFD) was performed to assess the radioactivity in the air, which could be inhaled by persons close to the patient. Conclusions: The potential exposure of relatives and caregivers by external irradiation and incorporation of radioactivity exhaled or excreted by the patient with saliva or sweat is well below 1 mSv. No objections are seen regarding outpatient treatment. This paper summarizes contents of a poster presented at the Annual Meeting of the Society of Nuclear Medicine and Molecular Imaging.

  13. Estimation of dose rate of a package ({sup 223+}Ra) and evaluation of transport index; Dosisleistungsabschaetzung bei einem Versandstueck ({sup 223+}Ra) und Ermittlung der Transportkennzahl nach ADR

    Energy Technology Data Exchange (ETDEWEB)

    Bittner, Michael [TUEV SUED Industrie Services GmbH, Region Nordost, Leipzig (Germany). Anlagensicherheit/Strahlenschutz; Richter, Jens [TUEV SUED Industrie Services GmbH, Region Nordost, Dresden (Germany). Anlagensicherheit/Strahlenschutz

    2016-08-01

    The transport index of a package is to be determined according to provisions of the ADR. It is directly related to the maximum radiation level in mSv/h at a distance of 1 m from the external surface of the package or pallet. To evaluate the existing distribution of the dose equivalent outside the package or pallet calculations of photon dose rates are required. For Monte-Carlo simulations with MCNP5 a three-dimensional model of a package containing Xofigo trademark was created, which contains all relevant sources from {sup 223}Ra and its decay chain.

  14. Therapy palliative with {sup 2}23Ra without special radiation protection measures?; Palliative Therapie mit {sup 223}Ra ohne besondere Strahlenschutzmassnahmen?

    Energy Technology Data Exchange (ETDEWEB)

    Just, Guenther [Forschungsbuero Radonbalneologie (FRB), Grosspoesna (Germany); Petzold, Juergen

    2015-07-01

    For nearly 2 years now as a therapy of the castration resistant prostata carcinoma a nuclide therapy with {sup 223}Ra-Dichloride (trade-mark Xofigo) is applied. Xofigo is applied by a medical specialist for nuclear medicine altogether 6 times in a monthly distance. The activity used in each case is according to the body weight (50 kBq/kg BW). This therapy is licensed by the supervisory authorities of the German federal countries as an ambulant therapy. Special radiation protection measures are only required when exceeding a given number of 17 patients per year as incorparation measurements.

  15. Astatine-211 labeling. A study towards automatic production of astatinated antibodies

    International Nuclear Information System (INIS)

    Emma Aneheim; Per Albertsson; Sture Lindegren; Holger Jensen

    2015-01-01

    Targeted alpha therapy is especially interesting for therapy of microscopic cancer tumors due to short path length and high linear energy transfer of the alpha particles. One of the most promising nuclides for targeted alpha therapy is 211 At. To facilitate larger clinical studies using 211 At, the current manual synthesis of radiolabeled antibodies would benefit from being transferred into an automated method. In this work, successful modifications of the manual synthesis have been performed in order to adapt it to automation. The automatic synthesis has also been tested using the modified synthesis method. (author)

  16. A Monte Carlo study on {sup 223}Ra imaging for unsealed radionuclide therapy

    Energy Technology Data Exchange (ETDEWEB)

    Takahashi, Akihiko, E-mail: takahsr@hs.med.kyushu-u.ac.jp; Miwa, Kenta; Sasaki, Masayuki [Faculty of Medical Sciences, Department of Health Sciences, Kyushu University, 3-1-1, Maidashi, Higashi-ku, Fukuoka 812-8582 (Japan); Baba, Shingo [Department of Clinical Radiology, Kyushu University Hospital, 3-1-1, Maidashi, Higashi-ku, Fukuoka 812-8582 (Japan)

    2016-06-15

    Purpose: Radium-223 ({sup 223}Ra), an α-emitting radionuclide, is used in unsealed radionuclide therapy for metastatic bone tumors. The demand for qualitative {sup 223}Ra imaging is growing to optimize dosimetry. The authors simulated {sup 223}Ra imaging using an in-house Monte Carlo simulation code and investigated the feasibility and utility of {sup 223}Ra imaging. Methods: The Monte Carlo code comprises two modules, HEXAGON and NAI. The HEXAGON code simulates the photon and electron interactions in the tissues and collimator, and the NAI code simulates the response of the NaI detector system. A 3D numeric phantom created using computed tomography images of a chest phantom was installed in the HEXAGON code. {sup 223}Ra accumulated in a part of the spine, and three x-rays and 19 γ rays between 80 and 450 keV were selected as the emitted photons. To evaluate the quality of the {sup 223}Ra imaging, the authors also simulated technetium-99m ({sup 99m}Tc) imaging under the same conditions and compared the results. Results: The sensitivities of the three photopeaks were 147 counts per unit of source activity (cps MBq{sup −1}; photopeak: 84 keV, full width of energy window: 20%), 166 cps MBq{sup −1} (154 keV, 15%), and 158 cps MBq{sup −1} (270 keV, 10%) for a low-energy general-purpose (LEGP) collimator, and those for the medium-energy general-purpose (MEGP) collimator were 33, 13, and 8.0 cps MBq{sup −1}, respectively. In the case of {sup 99m}Tc, the sensitivity was 55 cps MBq{sup −1} (141 keV, 20%) for LEGP and 52 cps MBq{sup −1} for MEGP. The fractions of unscattered photons of the total photons reflecting the image quality were 0.09 (84 keV), 0.03 (154 keV), and 0.02 (270 keV) for the LEGP collimator and 0.41, 0.25, and 0.50 for the MEGP collimator, respectively. Conversely, this fraction was approximately 0.65 for the simulated {sup 99m}Tc imaging. The sensitivity with the LEGP collimator appeared very high. However, almost all of the counts were

  17. Factors affecting {sup 223}Ra therapy: clinical experience after 532 cycles from a single institution

    Energy Technology Data Exchange (ETDEWEB)

    Etchebehere, Elba C. [The University of Texas MD Anderson Cancer Center, Department of Nuclear Medicine, Houston, TX (United States); Campinas State University (Unicamp), Department of Nuclear Medicine, Campinas (Brazil); Milton, Denai R. [The University of Texas MD Anderson Cancer Center, Department of Biostatistics, Houston, TX (United States); Araujo, John C. [The University of Texas MD Anderson Cancer Center, Department of Genitourinary Medical Oncology, Houston, TX (United States); Swanston, Nancy M.; Macapinlac, Homer A.; Rohren, Eric M. [The University of Texas MD Anderson Cancer Center, Department of Nuclear Medicine, Houston, TX (United States)

    2016-01-15

    The aim of this study was to identify baseline features that predict outcome in {sup 223}Ra therapy. We retrospectively reviewed 110 patients with metastatic castration-resistant prostate cancer treated with {sup 223}Ra. End points were overall survival (OS), progression-free survival (PFS), bone event-free survival (BeFS), and bone marrow failure (BMF). The following parameters were evaluated prior to the first {sup 223}Ra cycle: serum levels of hemoglobin (Hb), prostate-specific antigen (PSA), alkaline phosphatase (ALP), Eastern Cooperative Oncology Group (ECOG) status, pain score, use of chemotherapy, and external beam radiation therapy (EBRT). During/after {sup 223}Ra we evaluated: the total number of radium cycles (Ra{sub Tot}), the PSA doubling time (PSA{sub DT}), and the use of chemotherapy, EBRT, abiraterone, and enzalutamide. A significant reduction of ALP (p < 0.001) and pain score (p = 0.041) occurred throughout the {sup 223} Ra cycles. The risk of progression was associated with declining ECOG status [hazard ratio (HR) = 3.79; p < 0.001] and decrease in PSA{sub DT} (HR = 8.22; p < 0.001). Ra{sub Tot}, ALP, initial ECOG status, initial pain score, and use of abiraterone were associated with OS (p ≤ 0.008), PFS (p ≤ 0.003), and BeFS (p ≤ 0.020). Ra{sub Tot}, ALP, initial ECOG status, and initial pain score were significantly associated with BMF (p ≤ 0.001) as well as Hb (p < 0.001) and EBRT (p = 0.009). On multivariable analysis, only Ra{sub Tot} and abiraterone remained significantly associated with OS (p < 0.001; p = 0.033, respectively), PFS (p < 0.001; p = 0.041, respectively), and BeFS (p < 0.001; p = 0.019, respectively). Additionally, Ra{sub Tot} (p = 0.027) and EBRT (p = 0.013) remained significantly associated with BMF. Concomitant use of abiraterone and {sup 223}Ra seems to have a beneficial effect, while the EBRT may increase the risk of BMF. (orig.)

  18. The Impact of MicroRNA-223-3p on IL-17 Receptor D Expression in Synovial Cells.

    Directory of Open Access Journals (Sweden)

    Nozomu Moriya

    Full Text Available Rheumatoid arthritis (RA is an autoimmune inflammatory disease affecting joints. Elevated plasma levels of microRNA-223-3p (miR-223-3p in patients with RA are implicated in the pathogenesis of the disease. This study aimed to analyze the functional role of miR-223-3p in the pathogenesis of RA by overexpressing miR-223-3p in synovial cell lines.Arthritis was induced in the RA model of SKG mice by injection of ß-glucan. The histopathologic features of joints were examined using hematoxylin and eosin and immunohistochemical staining. Plasma levels of miRNA were determined by panel real-time PCR analysis. Target genes of the differentially expressed miRNAs in SKG mice were analyzed using miRNA target prediction algorithms. The dual-luciferase reporter system was used to evaluate the relationship between miR-223-3p and IL-17 receptor D (IL-17RD. The activity of miR-223-3p was analyzed by transfection of plasmid vectors overexpressing miR-223-3p into IL-17RD-expressing NIH3T3 and MH7A cell lines. Il6 and Il17rd mRNA expression was analyzed by quantitative real-time PCR. IL-17RD protein expression was analyzed by western blot analysis.We identified 17 upregulated miRNAs (fold change > 2.0 in plasma of SKG mice injected with ß-glucan relative to untreated SKG mice. Il17rd was identified as the candidate target gene of miR-223-3p using five miRNA target prediction algorithms. The transfection of plasmid vectors overexpressing miR-223-3p into NIH3T3 and MH7A cells resulted in the downregulation of Il17rd expression and upregulation of Il6 expression. Expression of miR-223-3p and Il6 mRNA in MH7A cells was upregulated; however, that of Il17rd mRNA was downregulated following TNF-α stimulation. IL-17RD expression in synovial tissues from SKG mice and RA patients was inversely correlated with the severity of arthritis.This study is the first to demonstrate that miR-223-3p downregulates IL-17RD in both mouse and human cells; miR-223-3p may contribute to

  19. Precise Study of Fine Structure in $^{14}$C Emission from $^{223}$Ra

    CERN Multimedia

    2002-01-01

    We request 10 shifts in two sessions of beam time at ISOLDE for the production of a $^{223}$Ra source. This source will be used with the superconducting spectrometer SOLENO at Orsay for a precise measurement (good statistics and energy resolution) of the fine stucture in the energy spectrum of $^{14}$C nuclei emitted by $^{223}$Ra, discovered at Orsay in July 1989. The measurement will be devoted to carry out the hindrance factors of the transitions to 15$\\!^-\\!$/2$\\,$ (1.423 MeV) and 5$\\!^+\\!$/2$\\,$ (1.567 MeV) excited states of $^{209}$Pb, which present a particular interest for obtaining spectroscopic information and testing nuclear models.

  20. Potential role of miR-9 and miR-223 in recurrent ovarian cancer

    Directory of Open Access Journals (Sweden)

    McGuinness Eamonn

    2008-04-01

    Full Text Available Abstract Background MicroRNAs (miRNAs are small, noncoding RNAs that negatively regulate gene expression by binding to target mRNAs. miRNAs have not been comprehensively studied in recurrent ovarian cancer, yet an incurable disease. Results Using real-time RT-PCR, we obtained distinct miRNA expression profiles between primary and recurrent serous papillary ovarian adenocarcinomas (n = 6 in a subset of samples previously used in a transcriptome approach. Expression levels of top dysregulated miRNA genes, miR-223 and miR-9, were examined using TaqMan PCR in independent cohorts of fresh frozen (n = 18 and FFPE serous ovarian tumours (n = 22. Concordance was observed on TaqMan analysis for miR-223 and miR-9 between the training cohort and the independent test cohorts. Target prediction analysis for the above miRNA "recurrent metastatic signature" identified genes previously validated in our transcriptome study. Common biological pathways well characterised in ovarian cancer were shared by miR-9 and miR-223 lists of predicted target genes. We provide strong evidence that miR-9 acts as a putative tumour suppressor gene in recurrent ovarian cancer. Components of the miRNA processing machinery, such as Dicer and Drosha are not responsible for miRNA deregulation in recurrent ovarian cancer, as deluded by TaqMan and immunohistochemistry. Conclusion We propose a miRNA model for the molecular pathogenesis of recurrent ovarian cancer. Some of the differentially deregulated miRNAs identified correlate with our previous transcriptome findings. Based on integrated transcriptome and miRNA analysis, miR-9 and miR-223 can be of potential importance as biomarkers in recurrent ovarian cancer.

  1. Kinetics of leptin binding to the Q223R leptin receptor.

    Directory of Open Access Journals (Sweden)

    Hans Verkerke

    Full Text Available Studies in human populations and mouse models of disease have linked the common leptin receptor Q223R mutation to obesity, multiple forms of cancer, adverse drug reactions, and susceptibility to enteric and respiratory infections. Contradictory results cast doubt on the phenotypic consequences of this variant. We set out to determine whether the Q223R substitution affects leptin binding kinetics using surface plasmon resonance (SPR, a technique that allows sensitive real-time monitoring of protein-protein interactions. We measured the binding and dissociation rate constants for leptin to the extracellular domain of WT and Q223R murine leptin receptors expressed as Fc-fusion proteins and found that the mutant receptor does not significantly differ in kinetics of leptin binding from the WT leptin receptor. (WT: ka 1.76×106±0.193×106 M-1 s-1, kd 1.21×10-4±0.707×10-4 s-1, KD 6.47×10-11±3.30×10-11 M; Q223R: ka 1.75×106±0.0245×106 M-1 s-1, kd 1.47×10-4±0.0505×10-4 s-1, KD 8.43×10-11±0.407×10-11 M. Our results support earlier findings that differences in affinity and kinetics of leptin binding are unlikely to explain mechanistically the phenotypes that have been linked to this common genetic variant. Future studies will seek to elucidate the mechanism by which this mutation influences susceptibility to metabolic, infectious, and malignant pathologies.

  2. Targeted alpha therapy using Radium-223: From physics to biological effects.

    Science.gov (United States)

    Marques, I A; Neves, A R; Abrantes, A M; Pires, A S; Tavares-da-Silva, E; Figueiredo, A; Botelho, M F

    2018-05-25

    With the advance of the use of ionizing radiation in therapy, targeted alpha therapy (TAT) has assumed an important role around the world. This kind of therapy can potentially reduce side effects caused by radiation in normal tissues and increased destructive radiobiological effects in tumor cells. However, in many countries, the use of this therapy is still in a pioneering phase. Radium-223 ( 223 Ra), an alpha-emitting radionuclide, has been the first of its kind to be approved for the treatment of bone metastasis in metastatic castration-resistant prostate cancer. Nevertheless, the interaction mechanism and the direct effects of this radiopharmaceutical in tumor cells are not fully understood neither characterized at a molecular level. In fact, the ways how TAT is linked to radiobiological effects in cancer is not yet revised. Therefore, this review introduces some physical properties of TAT that leads to biological effects and links this information to the hallmarks of cancer. The authors also collected the studies developed with 223 Ra to correlate with the three categories reviewed - properties of TAT, 5 R's of radiobiology and hallmarks of cancer- and with the promising future to this radiopharmaceutical. Copyright © 2018 Elsevier Ltd. All rights reserved.

  3. Study of "2"2"3Ra uptake mechanism by Fe_3O_4 nanoparticles: towards new prospective theranostic SPIONs

    International Nuclear Information System (INIS)

    Mokhodoeva, Olga; Vlk, Martin; Málková, Eva; Kukleva, Ekaterina; Mičolová, Petra; Štamberg, Karel; Šlouf, Miroslav; Dzhenloda, Rustam; Kozempel, Ján

    2016-01-01

    The use of superparamagnetic iron oxide nanoparticles (SPIONs) and radiolabelled nanoparticles (NPs) has grown considerably over the recent years, and the SPIONs labelled with medicinal radionuclides offer new opportunities in multimodal diagnostics and in the drug-delivery systems for targeted alpha-particle therapy (TAT) driven by magnetic field gradient or by biologically active moieties bound on NPs shell. However, the mechanisms of NPs radiolabelling are not studied substantially and still remain unclear, even though the way of label attachment directly implies the stability of the label-nanoparticle construct. Since the "2"2"3Ra was the first clinically approved alpha-emitter, it is a promising nuclide for further development of its targeted carriers. We report here on the study of "2"2"3Ra uptake by the Fe_3O_4SPIONs, together with an attempt to propose the "2"2"3Ra uptake mechanism by the Fe_3O_4NPs in the presence of a phosphate buffer a typical formulation medium, under the pseudo-equilibrium conditions. Further, the in vitro stability tests of the prepared ["2"2"3Ra]Fe_3O_4NPs were performed to estimate the "2"2"3Ra label stability. The potential use of "2"2"3Ra-labelled SPIONs in theranostic applications is also discussed.Graphical abstract

  4. The potential of {sup 223}Ra and {sup 18}F-fluoride imaging to predict bone lesion response to treatment with {sup 223}Ra-dichloride in castration-resistant prostate cancer

    Energy Technology Data Exchange (ETDEWEB)

    Murray, Iain; Chittenden, Sarah J.; Denis-Bacelar, Ana M.; Flux, Glenn D. [Royal Marsden NHS Foundation Trust, Joint Department of Physics, Sutton, Surrey (United Kingdom); The Institute of Cancer Research, London (United Kingdom); Hindorf, Cecilia [Royal Marsden NHS Foundation Trust, Joint Department of Physics, Sutton, Surrey (United Kingdom); The Institute of Cancer Research, London (United Kingdom); Skaane University Hospital, Department of Radiation Physics, Lund (Sweden); Parker, Christopher C. [Royal Marsden NHS Foundation Trust, Department of Urology, Sutton (United Kingdom); Chua, Sue [Royal Marsden NHS Foundation Trust, Department of Nuclear Medicine, Sutton (United Kingdom)

    2017-10-15

    The aims of this study were to calculate bone lesion absorbed doses resulting from a weight-based administration of {sup 223}Ra-dichloride, to assess the relationship between those doses and corresponding {sup 18}F-fluoride uptake and to assess the potential of quantitative {sup 18}F-fluoride imaging to predict response to treatment. Five patients received two intravenous injections of {sup 223}Ra-dichloride, 6 weeks apart, at 110 kBq/kg whole-body weight. The biodistribution of {sup 223}Ra in metastatic lesions as a function of time after administration as well as associated lesion dosimetry were determined from serial {sup 223}Ra scans. PET/CT imaging using {sup 18}F-fluoride was performed prior to the first treatment (baseline), and at week 6 immediately before the second treatment and at week 12 after baseline. Absorbed doses to metastatic bone lesions ranged from 0.6 Gy to 44.1 Gy. For individual patients, there was an average factor difference of 5.3 (range 2.5-11.0) between the maximum and minimum lesion dose. A relationship between lesion-absorbed doses and serial changes in {sup 18}F-fluoride uptake was demonstrated (r{sup 2} = 0.52). A log-linear relationship was demonstrated (r{sup 2} = 0.77) between baseline measurements of {sup 18}F-fluoride uptake prior to {sup 223}Ra-dichloride therapy and changes in uptake 12 weeks after the first cycle of therapy. Correlations were also observed between both {sup 223}Ra and {sup 18}F-fluoride uptake in lesions (r = 0.75) as well as between {sup 223}Ra absorbed dose and {sup 18}F-fluoride uptake (r = 0.96). There is both inter-patient and intra-patient heterogeneity of absorbed dose estimates to metastatic lesions. A relationship between {sup 223}Ra lesion absorbed dose and subsequent lesion response was observed. Analysis of this small group of patients suggests that baseline uptake of {sup 18}F-fluoride in bone metastases is significantly correlated with corresponding uptake of {sup 223}Ra, the associated {sup 223

  5. Refinement of the deletion in 8q22.2-q22.3: the minimum deletion size at 8q22.3 related to intellectual disability and epilepsy.

    Science.gov (United States)

    Kuroda, Yukiko; Ohashi, Ikuko; Saito, Toshiyuki; Nagai, Jun-ichi; Ida, Kazumi; Naruto, Takuya; Iai, Mizue; Kurosawa, Kenji

    2014-08-01

    Kuechler et al. [2011] reported five patients with interstitial deletions in 8q22.2-q22.3 who had intellectual disability, epilepsy, and dysmorphic features. We report on a new patient with the smallest overlapping de novo deletion in 8q22.3 and refined the phenotype. The proposita was an 8-year-old girl, who developed seizures at 10 months, and her epileptic seizure became severe and difficult to control with antiepileptic drugs. She also exhibited developmental delay and walked alone at 24 months. She was referred to us for evaluation for developmental delay and epilepsy at the age of 8 years. She had intellectual disability (IQ 37 at 7 years) and autistic behavior, and spoke two word sentences at 8 years. She had mild dysmorphic features, including telecanthus and thick vermilion of the lips. Array comparative genomic hybridization detected a 1.36 Mb deletion in 8q22.3 that encompassed RRM2B and NCALD, which encode the small subunit of p53-inducible ribonucleotide reductase and neurocalcin delta in the neuronal calcium sensor family of calcium-binding proteins, respectively. The minimum overlapping region between the present and previously reported patients is considered to be a critical region for the phenotype of the deletion in 8q22.3. We suggest that the deletion in 8q22.3 may represent a clinically recognizable condition, which is characterized by intellectual disability and epilepsy. © 2014 Wiley Periodicals, Inc.

  6. Test of the transverse magneticity of the ξ(2.23)

    International Nuclear Information System (INIS)

    Ward, B.F.L.

    1986-08-01

    We propose the Jacob-Wick helicity amplitude ratios x-bar=A 1 /A 0 and y-bar=A 2 /A 0 for Ψ/J → γξ, ξ → K + K - , as tests of the transverse magneticity of the two gluon constituents of the ξ(2.23) under the assumption that the latter state is in fact a spin 2 bound state of two constituents gluons. Here A j is the respective amplitude for ξ helicity j, j=0,1,2. We therefore encourage experimentalists to measure these ratios. (author)

  7. MicroRNA-223 Enhances Radiation Sensitivity of U87MG Cells In Vitro and In Vivo by Targeting Ataxia Telangiectasia Mutated

    Energy Technology Data Exchange (ETDEWEB)

    Liang, Liping; Zhu, Ji [Departments of Radiation Oncology, Fudan University Shanghai Cancer Center, Department of Oncology, Shanghai Medical College, Fudan University, Shanghai (China); Zaorsky, Nicholas G. [Department of Radiation Oncology, Fox Chase Cancer Center, Philadelphia, Pennsylvania (United States); Deng, Yun [Departments of Radiation Oncology, Fudan University Shanghai Cancer Center, Department of Oncology, Shanghai Medical College, Fudan University, Shanghai (China); Wu, Xingzhong [Department of Biochemistry and Molecular Biology, Shanghai Medical College, Fudan University, Shanghai (China); Liu, Yong [Departments of Radiation Oncology, Fudan University Shanghai Cancer Center, Department of Oncology, Shanghai Medical College, Fudan University, Shanghai (China); Liu, Fangqi; Cai, Guoxiang; Gu, Weilie [Department of Colorectal Cancer, Fudan University, Shanghai Cancer Center, Shanghai (China); Shen, Lijun [Departments of Radiation Oncology, Fudan University Shanghai Cancer Center, Department of Oncology, Shanghai Medical College, Fudan University, Shanghai (China); Zhang, Zhen, E-mail: zhenzhang6@hotmail.com [Departments of Radiation Oncology, Fudan University Shanghai Cancer Center, Department of Oncology, Shanghai Medical College, Fudan University, Shanghai (China)

    2014-03-15

    Purpose: Ataxia telangiectasia mutated (ATM) protein is important in the DNA damage response because it repairs radiation-induced damage in cancers. We examined the effect of microRNA-223 (miR-223), a regulator of ATM expression, on radiation sensitivity of cancer cells. Methods and Materials: Human embryonic kidney 293 T (293T) cells were infected with pLL3.7-miR-223 plasmid to generate the pLL3.7-miR-223 and -empty virus (EV) lentivirus (miR-223 and EV). A dual luciferase assay in which the reporter contained wild-type 3′ untranslated region (UTR) of ATM was performed. U87MG cells were infected with miR-223 or EV to establish the overexpressed stable cell lines (U87-223 or U87-EV, respectively). Cells were irradiated in vitro, and dose enhancement ratios at 2 Gy (DER{sub 2}) were calculated. Hind legs of BALB/c athymic mice were injected with U87-223 or U87-EV cells; after 2 weeks, half of the tumors were irradiated. Tumor volumes were tracked for a total of 5 weeks. Results: The dual luciferase reporter assay showed a significant reduction in luciferase activity of 293T cells cotransfected with miR-223 and the ATM 3′UTR compared to that in EV control. Overexpression of miR-223 in U87MG cells showed that ATM expression was significantly downregulated in the U87-223 cells compared to that in U87-EV (ATM/β-actin mRNA 1.0 vs 1.5, P<.05). U87-223 cells were hypersensitive to radiation compared to U87-EV cells in vitro (DER{sub 2} = 1.32, P<.01). Mice injected with miR-223-expressing tumors had almost the same tumors after 3 weeks (1.5 cm{sup 3} vs 1.7 cm{sup 3}). However, irradiation significantly decreased tumor size in miR-223-expressing tumors compared to those in controls (0.033 cm{sup 3} vs 0.829 cm{sup 3}). Conclusions: miR-223 overexpression downregulates ATM expression and sensitizes U87 cells to radiation in vitro and in vivo. MicroRNA-223 may be a novel cancer-targeting therapy, although its cancer- and patient-specific roles are

  8. Therapy assessment of bone metastatic disease in the era of {sup 223}radium

    Energy Technology Data Exchange (ETDEWEB)

    Etchebehere, Elba; Brito, Ana Emilia [The University of Campinas, Division of Nuclear Medicine, Campinas (Brazil); Rezaee, Alireza; Langsteger, Werner [St. Vincent' s Hospital, Department of Nuclear Medicine and Endocrinology, PET - CT Center LINZ, Ordensklinikum, Linz (Austria); Beheshti, Mohsen [St. Vincent' s Hospital, Department of Nuclear Medicine and Endocrinology, PET - CT Center LINZ, Ordensklinikum, Linz (Austria); Paracelsus Medical University, Department of Nuclear Medicine and Endocrinology, Salzburg (Austria)

    2017-08-15

    Defining an optimal imaging modality for assessment of therapy and the best time of evaluation are pivotal for ideal patient's management. {sup 223}Ra (Xofigo registered, formerly Alpharadin) has been approved by the FDA and European Medicines Agency for treatment of metastatic castration-resistant prostate cancer with painful osseous involvement. PET/CT imaging using various radiotracers such as {sup 18}F-FDG, {sup 18}F-FCH, {sup 68}Ga-PSMA and {sup 18}F-NaF have been investigated to mitigate the limitations of conventional imaging modalities. Diagnostic radiotracers that have properties similar to a therapeutic radiotracer will precisely assess of the possibility and efficacy of a treatment; this is the theranostic concept. An example of a diagnostic test employed for selecting targeted therapy is the combined use of {sup 18}F-fluoride PET/CT for evaluation of possible therapy with {sup 223}Ra. This review examines the most recent publications related to this topic. (orig.)

  9. Phosphazene like film formation on InP in liquid ammonia (223 K)

    Energy Technology Data Exchange (ETDEWEB)

    Gonçalves, A.-M., E-mail: goncalves@chimie.uvsq.fr; Njel, C.; Mathieu, C.; Aureau, D.; Etcheberry, A.

    2013-07-01

    An anodic photo-galvanostatic treatment at low current density (1 μA·cm{sup −2}) is carried out on n-InP semiconductor in liquid ammonia (223 K). The gradual chemical evolution of the surface is studied as a function of the anodic charge. Proof and reproducibility of the chemical transformation of the surface are clearly evidenced by X-ray photoelectron spectroscopy (XPS) analyses. Like by cyclic voltammetry, the perfect coverage of the InP surface by a thin phosphazene like film is also revealed by XPS data. However, a low anodic charge (≈ 0.5 mC·cm{sup −2}) is required by photo-galvanostatic treatment while a higher anodic charge (≈ 7 mC·cm{sup −2}) is involved by cyclic voltammetry. The excess of charge could be related to ammonia oxidation during the formation of the passivating film. This result proves the electrochemical oxidation of the solvent as a determinant step of the mechanism film formation. - Highlights: ► Cyclic voltammetry and galvanostatic modes on n-InP in liquid ammonia (223 K). ► A thin film growth is reached by photo-anodic polarization. ► The same phosphazene like film is evidenced by X-ray photoelectron spectroscopy. ► An excess of charge is observed by cyclic voltammetry. ► An electrochemical oxidation step of the solvent is assumed.

  10. 47 CFR 25.223 - Off-axis EIRP spectral density limits for feeder link earth stations in the 17/24 GHz BSS.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 2 2010-10-01 2010-10-01 false Off-axis EIRP spectral density limits for feeder link earth stations in the 17/24 GHz BSS. 25.223 Section 25.223 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES SATELLITE COMMUNICATIONS Technical Standards § 25...

  11. The Gln223Arg polymorphism of the leptin receptor in Pima Indians: influence on energy expenditure, physical activity and lipid metabolism

    DEFF Research Database (Denmark)

    Stefan, N; Vozarova, B; Del Parigi, A

    2002-01-01

    Leptin regulates body weight by its receptor-mediated anorectic, thermogenic and antisteatotic effects. Recently, lower leptin binding to the soluble form of the leptin receptor (LEPR) was shown in carriers of the Arg223-encoding allele of the Gln223Arg polymorphism of the LEPR. To investigate wh...

  12. A 223-nm KrCl excimer laser on a He-Kr-HCl mixture

    International Nuclear Information System (INIS)

    Razhev, A M; Zhupikov, A A; Kargapol'tsev, E S

    2004-01-01

    The results of experimental studies of the parameters of a 223-nm electric-discharge KrCl excimer laser on a He-Kr-HCl mixture depending on the excitation conditions and the composition of the active gaseous medium are presented. To achieve the maximum values of the output energy and the efficiency of the KrCl laser on mixtures with buffer gaseous helium, an excitation system was used that included a circuit with an LC inverter with a high-voltage switch based on an RU-65 spark gap. An output energy of 320 mJ with an efficiency of 0.5% relative to the energy stored in the capacitors is obtained in a KrCl laser with an active medium based on the buffer He gas at a charging voltage of 30 kV. Radiation pulses with a duration of 22±1 ns and a pulse power of 15 MW are obtained. (lasers)

  13. A bone marrow toxicity model for 223Ra alpha-emitter radiopharmaceutical therapy

    International Nuclear Information System (INIS)

    Hobbs, Robert F; Song Hong; Sgouros, George; Watchman, Christopher J; Bolch, Wesley E; Aksnes, Anne-Kirsti; Ramdahl, Thomas; Flux, Glenn D

    2012-01-01

    Ra-223, an α-particle emitting bone-seeking radionuclide, has recently been used in clinical trials for osseous metastases of prostate cancer. We investigated the relationship between absorbed fraction-based red marrow dosimetry and cell level-dosimetry using a model that accounts for the expected localization of this agent relative to marrow cavity architecture. We show that cell level-based dosimetry is essential to understanding potential marrow toxicity. The GEANT4 software package was used to create simple spheres representing marrow cavities. Ra-223 was positioned on the trabecular bone surface or in the endosteal layer and simulated for decay, along with the descendants. The interior of the sphere was divided into cell-size voxels and the energy was collected in each voxel and interpreted as dose cell histograms. The average absorbed dose values and absorbed fractions were also calculated in order to compare those results with previously published values. The absorbed dose was predominantly deposited near the trabecular surface. The dose cell histogram results were used to plot the percentage of cells that received a potentially toxic absorbed dose (2 or 4 Gy) as a function of the average absorbed dose over the marrow cavity. The results show (1) a heterogeneous distribution of cellular absorbed dose, strongly dependent on the position of the cell within the marrow cavity; and (2) that increasing the average marrow cavity absorbed dose, or equivalently, increasing the administered activity resulted in only a small increase in potential marrow toxicity (i.e. the number of cells receiving more than 4 or 2 Gy), for a range of average marrow cavity absorbed doses from 1 to 20 Gy. The results from the trabecular model differ markedly from a standard absorbed fraction method while presenting comparable average dose values. These suggest that increasing the amount of radioactivity may not substantially increase the risk of toxicity, a result unavailable to the

  14. Multistate observations of the Galactic black hole XTE J1752-223: evidence for an intermediate black hole spin

    NARCIS (Netherlands)

    Reis, R.C.; Miller, J.M.; Fabian, A.C.; Cackett, E.M.; Maitra, D.; Reynolds, C.S.; Rupen, M.; Steeghs, D.T.H.; Wijnands, R.

    2011-01-01

    The Galactic black hole candidate XTE J1752−223 was observed during the decay of its 2009 outburst with the Suzaku and XMM-Newton observatories. The observed spectra are consistent with the source being in the ‘intermediate’ and ‘low-hard’ states, respectively. The presence of a strong, relativistic

  15. Measuring the radium quartet (228Ra, 226Ra, 224Ra, 223Ra) in seawater samples using gamma spectrometry

    International Nuclear Information System (INIS)

    Beek, P. van; Souhaut, M.; Reyss, J.-L.

    2010-01-01

    Radium isotopes are widely used in marine studies (eg. to trace water masses, to quantify mixing processes or to study submarine groundwater discharge). While 228 Ra and 226 Ra are usually measured using gamma spectrometry, short-lived Ra isotopes ( 224 Ra and 223 Ra) are usually measured using a Radium Delayed Coincidence Counter (RaDeCC). Here we show that the four radium isotopes can be analyzed using gamma spectrometry. We report 226 Ra, 228 Ra, 224 Ra, 223 Ra activities measured using low-background gamma spectrometry in standard samples, in water samples collected in the vicinity of our laboratory (La Palme and Vaccares lagoons, France) but also in seawater samples collected in the plume of the Amazon river, off French Guyana (AMANDES project). The 223 Ra and 224 Ra activities determined in these samples using gamma spectrometry were compared to the activities determined using RaDeCC. Activities determined using the two techniques are in good agreement. Uncertainties associated with the 224 Ra activities are similar for the two techniques. RaDeCC is more sensitive for the detection of low 223 Ra activities. Gamma spectrometry thus constitutes an alternate method for the determination of short-lived Ra isotopes.

  16. 14 CFR 223.22 - Other persons to whom free and reduced-rate transportation may be furnished.

    Science.gov (United States)

    2010-01-01

    ... OF TRANSPORTATION (AVIATION PROCEEDINGS) ECONOMIC REGULATIONS FREE AND REDUCED-RATE TRANSPORTATION International Travel § 223.22 Other persons to whom free and reduced-rate transportation may be furnished. Air... such transportation is undertaken for a promotional purpose; (f) Persons being transported on an...

  17. 48 CFR 52.223-16 - IEEE 1680 Standard for the Environmental Assessment of Personal Computer Products.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false IEEE 1680 Standard for the... CONTRACT CLAUSES Text of Provisions and Clauses 52.223-16 IEEE 1680 Standard for the Environmental Assessment of Personal Computer Products. As prescribed in 23.706(b)(1), insert the following clause: IEEE...

  18. A 380-kb Duplication in 7p22.3 Encompassing the LFNG Gene in a Boy with Asperger Syndrome

    NARCIS (Netherlands)

    Vulto-van Silfhout, A.T.; de Brouwer, A.F.; de Leeuw, N.; Obihara, C.C.; Brunner, H.G.; Vries, L.B.A. de

    2012-01-01

    De novo genomic aberrations are considered an important cause of autism spectrum disorders. We describe a de novo 380-kb gain in band p22.3 of chromosome 7 in a patient with Asperger syndrome. This duplicated region contains 9 genes including the LNFG gene that is an important regulator of NOTCH

  19. 36 CFR 223.118 - Appeal process for small business timber sale set-aside program share recomputation decisions.

    Science.gov (United States)

    2010-07-01

    ... appeal: (i) The appellant's name, mailing address, and daytime telephone number; (ii) The title or type... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Appeal process for small... FOREST SYSTEM TIMBER Timber Sale Contracts Contract Administration § 223.118 Appeal process for small...

  20. Leptin receptor Gln223Arg polymorphism and breast cancer risk in Nigerian women: A case control study

    International Nuclear Information System (INIS)

    Okobia, Michael N; Taioli, Emanuela; Bunker, Clareann H; Garte, Seymour J; Zmuda, Joseph M; Ezeome, Emmanuel R; Anyanwu, Stanley N; Uche, Emmanuel E; Kuller, Lewis H; Ferrell, Robert E

    2008-01-01

    Leptin, a 16 kDa polypeptide hormone, implicated in various physiological processes, exerts its action through the leptin receptor, a member of the class I cytokine receptor family. Both leptin and leptin receptor have recently been implicated in processes leading to breast cancer initiation and progression in animal models and humans. An A to G transition mutation in codon 223 in exon 6 of the leptin receptor gene, resulting in glutamine to arginine substitution (Gln223Arg), lies within the first of two putative leptin-binding regions and may be associated with impaired signaling capacity of the leptin receptor. This study was designed to assess the role of this polymorphism in breast cancer susceptibility in Nigerian women. We utilized a polymerase chain reaction (PCR)-based restriction fragment length polymorphism (RFLP) assay to evaluate the association between the Gln223Arg polymorphism of the leptin receptor gene and breast risk in Nigeria in a case control study involving 209 women with breast cancer and 209 controls without the disease. Study participants were recruited from surgical outpatient clinics and surgical wards of four University Teaching Hospitals located in Midwestern and southeastern Nigeria between September 2002 and April 2004. Premenopausal women carrying at least one LEPR 223Arg allele were at a modestly increased risk of breast cancer after adjusting for confounders (OR = 1.8, 95% confidence interval [CI] 1.0–3.2, p = 0.07). There was no association with postmenopausal breast cancer risk (OR = 0.9, 95% CI 0.4–1.8, p = 0.68). Our results suggest that the LEPR Gln223Arg polymorphism in the extracellular domain of the LEPR receptor gene is associated with a modestly increased risk of premenopausal breast cancer in Nigerian women

  1. Oxidized Low-density Lipoprotein (ox-LDL) Cholesterol Induces the Expression of miRNA-223 and L-type Calcium Channel Protein in Atrial Fibrillation

    Science.gov (United States)

    He, Fengping; Xu, Xin; Yuan, Shuguo; Tan, Liangqiu; Gao, Lingjun; Ma, Shaochun; Zhang, Shebin; Ma, Zhanzhong; Jiang, Wei; Liu, Fenglian; Chen, Baofeng; Zhang, Beibei; Pang, Jungang; Huang, Xiuyan; Weng, Jiaqiang

    2016-08-01

    Atrial fibrillation (AF) is the most common sustained arrhythmia causing high morbidity and mortality. While changing of the cellular calcium homeostasis plays a critical role in AF, the L-type calcium channel α1c protein has suggested as an important regulator of reentrant spiral dynamics and is a major component of AF-related electrical remodeling. Our computational modeling predicted that miRNA-223 may regulate the CACNA1C gene which encodes the cardiac L-type calcium channel α1c subunit. We found that oxidized low-density lipoprotein (ox-LDL) cholesterol significantly up-regulates both the expression of miRNA-223 and L-type calcium channel protein. In contrast, knockdown of miRNA-223 reduced L-type calcium channel protein expression, while genetic knockdown of endogenous miRNA-223 dampened AF vulnerability. Transfection of miRNA-223 by adenovirus-mediated expression enhanced L-type calcium currents and promoted AF in mice while co-injection of a CACNA1C-specific miR-mimic counteracted the effect. Taken together, ox-LDL, as a known factor in AF-associated remodeling, positively regulates miRNA-223 transcription and L-type calcium channel protein expression. Our results implicate a new molecular mechanism for AF in which miRNA-223 can be used as an biomarker of AF rheumatic heart disease.

  2. Mir-22-3p Inhibits Arterial Smooth Muscle Cell Proliferation and Migration and Neointimal Hyperplasia by Targeting HMGB1 in Arteriosclerosis Obliterans

    Directory of Open Access Journals (Sweden)

    Shui-chuan Huang

    2017-08-01

    Full Text Available Background: Aberrant vascular smooth muscle cell (VSMC proliferation and migration contribute to the development of vascular pathologies, such as atherosclerosis and post-angioplasty restenosis. The aim of this study was to determine whether miR-22-3p plays a role in regulating human artery vascular smooth muscle cell (HASMC function and neointima formation. Methods: Quantitative real-time PCR (qRT-PCR and fluorescence in situ hybridization (FISH were used to detect miR-22-3p expression in human arteries. Cell Counting Kit-8 (CCK-8 and EdU assays were performed to assess cell proliferation, and transwell and wound closure assays were performed to assess cell migration. Moreover, luciferase reporter assays were performed to identify the target genes of miR-22-3p. Finally, a rat carotid artery balloon-injury model was used to determine the role of miR-22-3p in neointima formation. Results: MiR-22-3p expression was downregulated in arteriosclerosis obliterans (ASO arteries compared with normal arteries, as well as in platelet-derived growth factor-BB (PDGF-BB-stimulated HASMCs compared with control cells. MiR-22-3p overexpression had anti-proliferative and anti-migratory effects and dual-luciferase assay showed that high mobility group box-1 (HMGB1 is a direct target of miR-22-3p in HASMCs. Furthermore, miR-22-3p expression was negatively correlated with HMGB1 expression in ASO tissue specimens. Finally, LV-miR-22-3p-mediated miR-22-3p upregulation significantly suppressed neointimal hyperplasia specifically by reducing HMGB1 expression in vivo. Conclusions: Our results indicate that miR-22-3p is a key molecule in regulating HASMC proliferation and migration by targeting HMGB1 and that miR-22-3p and HMGB1 may be therapeutic targets in the treatment of human ASO.

  3. Objective age of acquisition for 223 Italian words: norms and effects on picture naming speed.

    Science.gov (United States)

    Lotto, Lorella; Surian, Luca; Job, Remo

    2010-02-01

    The present study provides a set of objective age of acquisition (AoA) norms for 223 Italian words that may be useful for conducting cross-linguistic studies or experiments on Italian language processing. The data were collected by presenting children from the ages of 2 to 11 with a normed picture set (Lotto, Dell'Acqua, & Job, 2001). Following the study of Morrison, Chappell, and Ellis (1997), we report two measures of objective AoA. Both measures strongly correlated with each other, and they also showed a good correlation with the rated AoA provided by adult participants. Furthermore, we assessed the relationship between the AoA measures and other variables used in psycholinguistic experiments. Regression analyses showed that familiarity, typicality, and word frequency were significant predictors of AoA. AoA, but not word frequency, was found to determine naming latencies. Finally, we present a path model in which AoA is a mediator in predicting speed in picture naming. The norms and the picture set can also be downloaded from http://dpss.psy.unipd.it/files/strumenti.php and from http://brm.psychonomic-journals.org/content/supplemental.

  4. Radiation dosimetry in digital breast tomosynthesis: Report of AAPM Tomosynthesis Subcommittee Task Group 223

    Energy Technology Data Exchange (ETDEWEB)

    Sechopoulos, Ioannis, E-mail: isechop@emory.edu [Departments of Radiology and Imaging Sciences, Hematology and Medical Oncology and Winship Cancer Institute, Emory University, 1701 Uppergate Drive Northeast, Suite 5018, Atlanta, Georgia 30322 (United States); Sabol, John M. [GE Healthcare, Global Diagnostic X-Ray, Mailstop W-701, 3000 North Grandview Boulevard, Waukesha, Wisconsin 53188 (United States); Berglund, Johan [Research and Development, Philips Women' s Healthcare, Solna (Sweden); Bolch, Wesley E. [J. Crayton Pruitt Family Department of Biomedical Engineering, University of Florida, Gainesville, Florida 32611 (United States); Brateman, Libby [University of Florida, Gainesville, Florida 32611 (United States); Christodoulou, Emmanuel; Goodsitt, Mitchell [Department of Radiology, University of Michigan, 1500 East Medical Center Drive, Ann Arbor, Michigan 48109 (United States); Flynn, Michael [Department of Radiology, Henry Ford Health System, Radiology Research 2F, 1 Ford Place, Detroit, Michigan 48202 (United States); Geiser, William [Department of Imaging Physics, The University of Texas MD Anderson Cancer Center, Houston, Texas 77030-4009 (United States); Kyle Jones, A. [Department of Imaging Physics, The University of Texas MD Anderson Cancer Center, Houston, Texas 77030 (United States); Lo, Joseph Y.; Paul Segars, W. [Department of Radiology, Medical Physics Graduate Program, and Department of Biomedical Engineering, Carl E. Ravin Advanced Imaging Laboratories, Duke University, Durham, North Carolina 27705 (United States); Maidment, Andrew D. A. [Department of Radiology, Perelman School of Medicine at the University of Pennsylvania, Philadelphia, Pennsylvania 19104-4206 (United States); Nishino, Kazuyoshi [R and D X-ray Products Group, Shimadzu Corporation, Tokyo (Japan); Nosratieh, Anita [Biomedical Engineering Graduate Group, Department of Radiology, University of California, Davis, California 95817 (United States); and others

    2014-09-15

    The radiation dose involved in any medical imaging modality that uses ionizing radiation needs to be well understood by the medical physics and clinical community. This is especially true of screening modalities. Digital breast tomosynthesis (DBT) has recently been introduced into the clinic and is being used for screening for breast cancer in the general population. Therefore, it is important that the medical physics community have the required information to be able to understand, estimate, and communicate the radiation dose levels involved in breast tomosynthesis imaging. For this purpose, the American Association of Physicists in Medicine Task Group 223 on Dosimetry in Tomosynthesis Imaging has prepared this report that discusses dosimetry in breast imaging in general, and describes a methodology and provides the data necessary to estimate mean breast glandular dose from a tomosynthesis acquisition. In an effort to maximize familiarity with the procedures and data provided in this Report, the methodology to perform the dose estimation in DBT is based as much as possible on that used in mammography dose estimation.

  5. Phytoplankton community responses to acidification of Lake 223, Experimental Lakes Area, Northwestern Ontario

    Energy Technology Data Exchange (ETDEWEB)

    Findlay, D.L.; Kasian, S.E.

    1986-10-01

    From 1976 to 1983 the pH of Lake 223 was artificially lowered by additions of H/sub 2/SO/sub 4/. From an initial level of 6.7, the pH was lowered at a rate of 0.5 pH units a year until it reached 5.0 and was held there for 3 yr. The decrease in pH caused major changes in the epilimnetic phytoplankton community in this lake. Biomass increased as pH decreased. Chlorophyte (Chlorella) abundance increased as pH decreased from 6.1 to 5.6 while Cyanophytes (Merismopedia and Chroococcus) and dinoflagellates (Gymnodinium and Peridinium) dominated once pH decreased below 5.6. Community diversities decreased because of these species shifts and a decrease in the number of species. The amount of edible biomass increased as the pH decreased from 6.7 to 5.6, then declined as pH decreased to 5.0. 25 refs.

  6. Radiation dosimetry in digital breast tomosynthesis: Report of AAPM Tomosynthesis Subcommittee Task Group 223

    International Nuclear Information System (INIS)

    Sechopoulos, Ioannis; Sabol, John M.; Berglund, Johan; Bolch, Wesley E.; Brateman, Libby; Christodoulou, Emmanuel; Goodsitt, Mitchell; Flynn, Michael; Geiser, William; Kyle Jones, A.; Lo, Joseph Y.; Paul Segars, W.; Maidment, Andrew D. A.; Nishino, Kazuyoshi; Nosratieh, Anita

    2014-01-01

    The radiation dose involved in any medical imaging modality that uses ionizing radiation needs to be well understood by the medical physics and clinical community. This is especially true of screening modalities. Digital breast tomosynthesis (DBT) has recently been introduced into the clinic and is being used for screening for breast cancer in the general population. Therefore, it is important that the medical physics community have the required information to be able to understand, estimate, and communicate the radiation dose levels involved in breast tomosynthesis imaging. For this purpose, the American Association of Physicists in Medicine Task Group 223 on Dosimetry in Tomosynthesis Imaging has prepared this report that discusses dosimetry in breast imaging in general, and describes a methodology and provides the data necessary to estimate mean breast glandular dose from a tomosynthesis acquisition. In an effort to maximize familiarity with the procedures and data provided in this Report, the methodology to perform the dose estimation in DBT is based as much as possible on that used in mammography dose estimation

  7. Six- and three-hourly meteorological observations from 223 USSR stations

    Energy Technology Data Exchange (ETDEWEB)

    Razuvaev, V.N.; Apasova, E.B.; Martuganov, R.A. [All-Russian Research Inst. of Hydrometeorologicl Information, Obninsk (Russia). World Data Centre; Kaiser, D.P. [Oak Ridge National Lab., TN (United States)

    1995-04-01

    This document describes a database containing 6- and 3-hourly meteorological observations from a 223-station network of the former Soviet Union. These data have been made available through cooperation between the two principal climate data centers of the United States and Russia: the National Climatic Data Center (NCDC), in Asheville, North Carolina, and the All-Russian Research Institute of Hydrometeorological Information -- World Data Centre (RIHMI-WDC) in Obninsk. Station records consist of 6- and 3-hourly observations of some 24 meteorological variables including temperature, weather type, precipitation amount, cloud amount and type, sea level pressure, relative humidity, and wind direction and speed. The 6-hourly observations extend from 1936 to 1965; the 3-hourly observations extend from 1966 through the mid-1980s (1983, 1984, 1985, or 1986; depending on the station). These data have undergone extensive quality assurance checks by RIHMI-WDC, NCDC, and the Carbon Dioxide Information Analysis Center (CDIAC). The database represents a wealth of meteorological information for a large and climatologically important portion of the earth`s land area, and should prove extremely useful for a wide variety of regional climate change studies. These data are available free of charge as a numeric data package (NDP) from CDIAC. The NDP consists of this document and 40 data files that are available via the Internet or on 8mm tape. The total size of the database is {approximately}2.6 gigabytes.

  8. MicroRNA-223 and miR-143 are important systemic biomarkers for disease activity in psoriasis

    DEFF Research Database (Denmark)

    Løvendorf, Marianne B; Zibert, John R; Gyldenløve, Mette

    2014-01-01

    BACKGROUND: Psoriasis is a systemic inflammatory skin disease. MicroRNAs (miRNAs) are a class of small non-coding RNA molecules that recently have been found in the blood to be relevant as disease biomarkers. OBJECTIVE: We aimed to explore miRNAs potential as blood biomarkers for psoriasis. METHODS......: Using microarray and quantitative real-time PCR we measured the global miRNA expression in whole blood, plasma and peripheral blood mononuclear cells (PBMCs) from patients with psoriasis and healthy controls. RESULTS: We identified several deregulated miRNAs in the blood from patients with psoriasis...... following a significant decrease in psoriasis severity, miR-223 and miR-143 were significantly downregulated in the PBMCs from patients with psoriasis. CONCLUSION: We suggest that changes in the miR-223 and miR-143 expressions in PBMCs from patients with psoriasis may serve as novel biomarkers for disease...

  9. Discovery of the radioactive decay of 223Ra by 14C emission and experiments with the magnetic spectrometer Soleno

    International Nuclear Information System (INIS)

    Hourani, E.; Hussonnois, M.

    1987-01-01

    The aim of this report is to review the experiment of Rose and Jones (discovery in 1984 of radioactive decay of 223 Ra by 14 C nuclei emission) with the subsequent one of Alexandrov (et al) performed with the same technique. The experiments performed by the group at Orsay on 14 C radioactivity of radium isotopes with the magnetic spectrometer Soleno are also reviewed. This review comprises the presentation and comments of the original results and arguments taken in their historical context

  10. Activation of MMPs in Macrophages by Mycobacterium tuberculosis via the miR-223-BMAL1 Signaling Pathway.

    Science.gov (United States)

    Lou, Jun; Wang, Yongli; Zhang, Zhimin; Qiu, Weiqiang

    2017-12-01

    An interaction between Mycobacterium tuberculosis and macrophages constitutes an essential step in tuberculosis development, as macrophages exert both positive and negative effects on M. tuberculosis-triggered organ lesions. In this study, we focused on the regulation of the expression of matrix metalloproteinases (MMPs), which is responsible for lung matrix degradation and bacteria dissection, in macrophages following M. tuberculosis infection. Female BALB/c mice were intravenously injected with the M. tuberculosis strain H37Rv at 0 h zeitgeber time (ZT0) or 12 h zeitgeber time (ZT12). The expression and activity of MMP-1, -2, -3, and -9 in lungs and spleens were then evaluated. In vitro, peritoneal macrophages were harvested at ZT0 or at ZT12 and infected with 10 MOI M. tuberculosis. The expression of MMPs, microRNA-223 and BMAL1 was analyzed by qRT-PCR and/or Western blot. The binding of BMAL1 3'-UTR by miR-223 was confirmed by luciferase activity assay. Additionally, wild-type BMAL1 or NLS mut BMAL1 plasmids were transfected to evaluate the effect of BMAL1 on MMPs. The results showed a differential expression of MMPs in mice tissues infected at different times. M. tuberculosis infection caused enhanced MMP-1, -9, and miR-223 expression, with inhibited BMAL1 expression. MiR-223 modulated BMAL1 expression via the direct binding of BMAL1 3'-UTR. Furthermore, wild-type BMAL1 other than NLS mut BMAL1 attenuated MMPs expression in M. tuberculosis-infected macrophages. Overall, this study demonstrated a potential involvement of circadian rhythm in MMP activation by M. tuberculosis in macrophages. J. Cell. Biochem. 118: 4804-4812, 2017. © 2017 Wiley Periodicals, Inc. © 2017 Wiley Periodicals, Inc.

  11. Analysis of Gln223Agr Polymorphism of Leptin Receptor Gene in Type II Diabetic Mellitus Subjects among Malaysians

    Directory of Open Access Journals (Sweden)

    Chong Pei Pei

    2013-09-01

    Full Text Available Leptin is known as the adipose peptide hormone. It plays an important role in the regulation of body fat and inhibits food intake by its action. Moreover, it is believed that leptin level deductions might be the cause of obesity and may play an important role in the development of Type 2 Diabetes Mellitus (T2DM, as well as in cardiovascular diseases (CVD. The Leptin Receptor (LEPR gene and its polymorphisms have not been extensively studied in relation to the T2DM and its complications in various populations. In this study, we have determined the association of Gln223Agr loci of LEPR gene in three ethnic groups of Malaysia, namely: Malays, Chinese and Indians. A total of 284 T2DM subjects and 281 healthy individuals were recruited based on International Diabetes Federation (IDF criteria. Genomic DNA was extracted from the buccal specimens of the subjects. The commercial polymerase chain reaction (PCR method was carried out by proper restriction enzyme MSP I to both amplify and digest the Gln223Agr polymorphism. The p-value among the three studied races was 0.057, 0.011 and 0.095, respectively. The values such as age, WHR, FPG, HbA1C, LDL, HDL, Chol and Family History were significantly different among the subjects with Gln223Agr polymorphism of LEPR (p < 0.05.

  12. Analysis of Gln223Agr polymorphism of Leptin Receptor Gene in type II diabetic mellitus subjects among Malaysians.

    Science.gov (United States)

    Etemad, Ali; Ramachandran, Vasudevan; Pishva, Seyyed Reza; Heidari, Farzad; Aziz, Ahmad Fazli Abdul; Yusof, Ahmad Khairuddin Mohamed; Pei, Chong Pei; Ismail, Patimah

    2013-09-18

    Leptin is known as the adipose peptide hormone. It plays an important role in the regulation of body fat and inhibits food intake by its action. Moreover, it is believed that leptin level deductions might be the cause of obesity and may play an important role in the development of Type 2 Diabetes Mellitus (T2DM), as well as in cardiovascular diseases (CVD). The Leptin Receptor (LEPR) gene and its polymorphisms have not been extensively studied in relation to the T2DM and its complications in various populations. In this study, we have determined the association of Gln223Agr loci of LEPR gene in three ethnic groups of Malaysia, namely: Malays, Chinese and Indians. A total of 284 T2DM subjects and 281 healthy individuals were recruited based on International Diabetes Federation (IDF) criteria. Genomic DNA was extracted from the buccal specimens of the subjects. The commercial polymerase chain reaction (PCR) method was carried out by proper restriction enzyme MSP I to both amplify and digest the Gln223Agr polymorphism. The p-value among the three studied races was 0.057, 0.011 and 0.095, respectively. The values such as age, WHR, FPG, HbA1C, LDL, HDL, Chol and Family History were significantly different among the subjects with Gln223Agr polymorphism of LEPR (p < 0.05).

  13. Astatine-211 labelled proteins and their stability in vivo

    International Nuclear Information System (INIS)

    Yi Changhou; Jin Jannan; Zhang Shuyuan; Wang Ketai; Zhang Dayuan; Zhou Maolun

    1989-01-01

    211 At or 131 I labelled proteins, e.g. 211 At-IgG or 211 At-BSA (bovine serum albumin) were prepared by 211 At reaction with the diazo-compound of para-aminobenzoic acid, which is then conjugated with IgG or BSA via an acylation reaction. The 211 At-carbon bond was found metabolically stable under in vivo conditions. For the labelling of proteins with 211 At or 131 I, other methods of direct oxidation are also described. The results show that for the labelling of proteins with 211 At, high rate of incorporation can be obtained with hydrogen peroxide as oxidant, but the labelling of proteins with 131 I is more favourable with the strong oxidant Chloramine-T. (author) 12 refs.; 6 figs

  14. Multidrug resistant 2009 A/H1N1 influenza clinical isolate with a neuraminidase I223R mutation retains its virulence and transmissibility in ferrets.

    Directory of Open Access Journals (Sweden)

    Erhard van der Vries

    2011-09-01

    Full Text Available Only two classes of antiviral drugs, neuraminidase inhibitors and adamantanes, are approved for prophylaxis and therapy against influenza virus infections. A major concern is that influenza virus becomes resistant to these antiviral drugs and spreads in the human population. The 2009 pandemic A/H1N1 influenza virus is naturally resistant to adamantanes. Recently a novel neuraminidase I223R mutation was identified in an A/H1N1 virus showing cross-resistance to the neuraminidase inhibitors oseltamivir, zanamivir and peramivir. However, the ability of this virus to cause disease and spread in the human population is unknown. Therefore, this clinical isolate (NL/2631-R223 was compared with a well-characterized reference virus (NL/602. In vitro experiments showed that NL/2631-I223R replicated as well as NL/602 in MDCK cells. In a ferret pathogenesis model, body weight loss was similar in animals inoculated with NL/2631-R223 or NL/602. In addition, pulmonary lesions were similar at day 4 post inoculation. However, at day 7 post inoculation, NL/2631-R223 caused milder pulmonary lesions and degree of alveolitis than NL/602. This indicated that the mutant virus was less pathogenic. Both NL/2631-R223 and a recombinant virus with a single I223R change (recNL/602-I223R, transmitted among ferrets by aerosols, despite observed attenuation of recNL/602-I223R in vitro. In conclusion, the I223R mutated virus isolate has comparable replicative ability and transmissibility, but lower pathogenicity than the reference virus based on these in vivo studies. This implies that the 2009 pandemic influenza A/H1N1 virus subtype with an isoleucine to arginine change at position 223 in the neuraminidase has the potential to spread in the human population. It is important to be vigilant for this mutation in influenza surveillance and to continue efforts to increase the arsenal of antiviral drugs to combat influenza.

  15. Prevalence and Characteristics of Discogenic Pain in Tertiary Practice: 223 Consecutive Cases Utilizing Lumbar Discography.

    Science.gov (United States)

    Verrills, Paul; Nowesenitz, Gillian; Barnard, Adele

    2015-08-01

    Between 26% and 42% of chronic low back pain is attributed to internal disc disruption of lumbar intervertebral discs. These prevalence estimates and data characterizing discogenic pain originate largely from research at elite practices, conducted 20 years ago. With few studies since, their concordance with rates in community practice has rarely been addressed. To assess the prevalence and key features of discogenic pain within community-based tertiary practice, and to evaluate the accuracy and clinical utility of discography. This prospective, three-year study of 223 consecutive cases of chronic low back pain used image-guided lumbar discography to identify symptomatic and flanking asymptomatic discs. A subset of patients (n = 195) had previously undergone posterior column blocks to investigate spinal facet and/or sacroiliac joints as contributing pain sources. A total of 644 discs were tested without infection or complication. Positive discograms were recorded in 74% of patients, with 22.9% negative and 3.1% assessed as indeterminate. Among patients receiving both discography and diagnostic blocks, 63% had proven discogenic pain, 18% had pain of mixed etiology and 14% remained undiagnosed. Taking into account all low back pain cases during this study (n = 756), discogenic pain prevalence was 21.8% (95% CI: 17-26%). The prevalence of discogenic pain in this community practice is below the range, but within confidence intervals, previously reported. Prevalence is considerably elevated, however, among well-selected patients and discography enabled a firm diagnosis in most such cases. These findings are broadly in keeping with those reached in key publications and support the clinical utility of discography. Wiley Periodicals, Inc.

  16. Radium-223 in the Treatment of Osteoblastic Metastases: A Critical Clinical Review

    Energy Technology Data Exchange (ETDEWEB)

    Humm, John L. [Department of Medical Physics, Memorial Sloan-Kettering Cancer Center, New York, New York (United States); Sartor, Oliver [Departments of Medicine and Urology, Tulane Cancer Center, Tulane University School of Medicine, New Orleans, Louisiana (United States); Parker, Chris [Department of Clinical Oncology, Institute of Cancer Research, Sutton (United Kingdom); Bruland, Oyvind S. [Department of Oncology, Norwegian Radium Hospital and Institute for Clinical Medicine, University of Oslo, Oslo (Norway); Macklis, Roger, E-mail: rmmacklis@gmail.com [Department of Radiation Oncology, University Hospitals of Cleveland and Case Western Reserve University, Cleveland, Ohio (United States)

    2015-04-01

    The element radium (Ra) was discovered by the Curies in 1898 and within a decade was in broad scientific testing for the management of several forms of cancer. The compound was known to give rise to a series of both high-energy particulate and penetrating γ-emissions. The latter found an important role in early 20th century brachytherapy applications, but the short-range α-particles seemed much less useful. Although highly cytotoxic when released within a few cell diameters of critical cell nuclei, the dense double-strand break damage was poorly repaired, and concerns regarding treatment-related toxicities and secondary malignancies halted clinical development. Moreover, the most common isotope of Ra has an exceptionally long half-life (>1600 years for {sup 226}Ra) that proved daunting when aiming for a systemic cancer therapy. Fortunately, other radium isotopes have more convenient half-lives while still producing cytotoxic α particles. Radium-223 dichloride has a half-life of 11.4 days, and this isotope was identified as an excellent candidate for radionuclide therapy of cancers metastatic to bone. The calcium-mimetic chemical properties of the radium allowed intravenous infusion with rapid uptake to sites of new bone formation. The highly efficient bone localization suggested a potential therapeutic role for osteoblastic bone metastases, and a series of phase 1, 2, and 3 clinical trials was undertaken to explore this possibility. This series of clinical explorations culminated in the ALSYMPCA trial, an international, placebo-controlled, phase 3 study that accrued 921 symptomatic men with bone-metastatic, castrate-resistant prostate cancer. Results of this trial demonstrated a prolongation of overall survival, and regulatory agencies around the world have now approved this product as a treatment for advanced prostate cancer.

  17. Study of {sup 223}Ra uptake mechanism by Fe{sub 3}O{sub 4} nanoparticles: towards new prospective theranostic SPIONs

    Energy Technology Data Exchange (ETDEWEB)

    Mokhodoeva, Olga [Russian Academy of Sciences, Vernadsky Institute of Geochemistry and Analytical Chemistry (Russian Federation); Vlk, Martin; Málková, Eva; Kukleva, Ekaterina; Mičolová, Petra; Štamberg, Karel [Czech Technical University in Prague, Department of Nuclear Chemistry, Faculty of Nuclear Sciences and Physical Engineering (Czech Republic); Šlouf, Miroslav [Academy of Sciences of the Czech Republic, Institute of Macromolecular Chemistry (Czech Republic); Dzhenloda, Rustam [Russian Academy of Sciences, Vernadsky Institute of Geochemistry and Analytical Chemistry (Russian Federation); Kozempel, Ján, E-mail: jan.kozempel@fjfi.cvut.cz [Czech Technical University in Prague, Department of Nuclear Chemistry, Faculty of Nuclear Sciences and Physical Engineering (Czech Republic)

    2016-10-15

    The use of superparamagnetic iron oxide nanoparticles (SPIONs) and radiolabelled nanoparticles (NPs) has grown considerably over the recent years, and the SPIONs labelled with medicinal radionuclides offer new opportunities in multimodal diagnostics and in the drug-delivery systems for targeted alpha-particle therapy (TAT) driven by magnetic field gradient or by biologically active moieties bound on NPs shell. However, the mechanisms of NPs radiolabelling are not studied substantially and still remain unclear, even though the way of label attachment directly implies the stability of the label-nanoparticle construct. Since the {sup 223}Ra was the first clinically approved alpha-emitter, it is a promising nuclide for further development of its targeted carriers. We report here on the study of {sup 223}Ra uptake by the Fe{sub 3}O{sub 4}SPIONs, together with an attempt to propose the {sup 223}Ra uptake mechanism by the Fe{sub 3}O{sub 4}NPs in the presence of a phosphate buffer a typical formulation medium, under the pseudo-equilibrium conditions. Further, the in vitro stability tests of the prepared [{sup 223}Ra]Fe{sub 3}O{sub 4}NPs were performed to estimate the {sup 223}Ra label stability. The potential use of {sup 223}Ra-labelled SPIONs in theranostic applications is also discussed.Graphical abstract.

  18. Dosimetry of bone metastases in targeted radionuclide therapy with alpha-emitting {sup 223}Ra-dichloride

    Energy Technology Data Exchange (ETDEWEB)

    Pacilio, Massimiliano [Azienda Ospealiera San Camillo Forlianini, Rome (Italy). Dept. of Medical Physics; Ventroni, Guido; Mango, Lucio [Azienda Ospealiera San Camillo Forlianini, Rome (Italy). Dept. of Nuclear Medicin; De Vincentis, Giuseppe; Di Castro, Elisabetta; Frantellizzi, Viviana; Follacchio, Giulia Anna; Garkavaya, Tatiana [Rome Univ. (Italy). Dept. of Radiological, Oncological and Anatomo Pathological Sciences; Cassano, Bartolomeo; Lorenzon, Leda [Rome Univ. (Italy). Postgraduate School of Medical Physics; Pellegrini, Rosanna; Pani, Roberto [Rome Univ. (Italy). Dept. of Molecular Medicine; Ialongo, Pasquale [Azienda Ospealiera San Camillo Forlianini, Rome (Italy). Dept. of Radiology

    2016-01-15

    Ra-dichloride is an alpha-emitting radiopharmaceutical used in the treatment of bone metastases from castration-resistant prostate cancer. Image-based dosimetric studies remain challenging because the emitted photons are few. The aim of this study was to implement a methodology for in-vivo quantitative planar imaging, and to assess the absorbed dose to lesions using the MIRD approach. The study included nine Caucasian patients with 24 lesions (6 humeral head lesions, 4 iliac wing lesions, 2 scapular lesions, 5 trochanter lesions, 3 vertebral lesions, 3 glenoid lesions, 1 coxofemoral lesion). The treatment consisted of six injections (one every 4 weeks) of 50 kBq per kg body weight. Gamma-camera calibrations for {sup 223}Ra included measurements of sensitivity and transmission curves. Patients were statically imaged for 30 min, using an MEGP collimator, double-peak acquisition, and filtering to improve the image quality. Lesions were delineated on {sup 99m}Tc-MDP whole-body images, and the ROIs superimposed on the {sup 223}Ra images after image coregistration. The activity was quantified with background, attenuation, and scatter correction. Absorbed doses were assessed deriving the S values from the S factors for soft-tissue spheres of OLINDA/EXM, evaluating the lesion volumes by delineation on the CT images. In 12 lesions with a wash-in phase the biokinetics were assumed to be biexponential, and to be monoexponential in the remainder. The optimal timing for serial acquisitions was between 1 and 5 h, between 18 and 24 h, between 48 and 60 h, and between 7 and 15 days. The error in cumulated activity neglecting the wash-in phase was between 2 % and 12 %. The mean effective half-life (T{sub 1/2eff}) of {sup 223}Ra was 8.2 days (range 5.5-11.4 days). The absorbed dose (D) after the first injection was 0.7 Gy (range 0.2-1.9 Gy). Considering the relative biological effectiveness (RBE) of alpha particles (RBE = 5), D{sub RBE} = 899 mGy/MBq (range 340-2,450 mGy/MBq). The

  19. New method for large scale production of medically applicable Actinium-225 and Radium-223

    International Nuclear Information System (INIS)

    Aliev, R.A.; Vasilyev, A.N.; Ostapenko, V.; Kalmykov, S.N.; Zhuikov, B.L.; Ermolaev, S.V.; Lapshina, E.V.

    2014-01-01

    Alpha-emitters ( 211 At, 212 Bi, 213 Bi, 223 Ra, 225 Ac) are promising for targeted radiotherapy of cancer. Only two alpha decays near a cell membrane result in 50% death of cancer cell and only a single decay inside the cell is required for this. 225 Ac may be used either directly or as a mother radionuclide in 213 Bi isotope generator. Production of 225 Ac is provided by three main suppliers - Institute for Transuranium Elements in Germany, Oak Ridge National Laboratory in USA and Institute of Physics and Power Engineering in Obninsk, Russia. The current worldwide production of 225 Ac is approximately 1.7 Ci per year that corresponds to only 100-200 patients that could be treated annually. The common approach for 225 Ac production is separation from mother 229 Th or irradiation of 226 Ra with protons in a cyclotron. Both the methods have some practical limitations to be applied routinely. 225 Ac can be also produced by irradiation of natural thorium with medium energy protons . Cumulative cross sections of 225 Ac, 227 Ac, 227 Th, 228 Th formations have been obtained recently. Thorium targets (1-9 g) were irradiated by 114-91 MeV proton beam (1-50 μA) at INR linear accelerator. After dissolution in 8 M HNO 3 + 0.004 M HF thorium was removed by double LLX by HDEHP in toluene (1:1). Ac and REE were pre-concentrated and separated from Ra and most fission products by DGA-Resin (Triskem). After washing out by 0.01 M HNO 3 Ac was separated from REE by TRU Resin (Triskem) in 3 M HNO 3 media. About 6 mCi 225 Ac were separated in hot cell with chemical yield 85%. The method may be upscaled for production of Ci amounts of the radionuclide. The main impurity is 227 Ac (0.1% at the EOB) but it does not hinder 225 Ac from being used for medical 225 Ac/ 213 Bi generators. (author)

  20. Emission of exotic clusters by nuclei and discovery of a fine structure in the 14C decay of 223Ra

    International Nuclear Information System (INIS)

    Vergnes, M.

    1992-01-01

    This paper is intended as a broad, mainly experimental, survey of the recent field of exotic cluster radioactivity in heavy nuclei. The first part summarizes the development of the field since the first experimental finding in 1984, insisting on 14 C emission, and giving a schematic status of the corresponding models. The second part describes in detail the 1989 discovery, in Orsay, of a fine structure of the 14 C decay of 223 Ra and the search for a similar effect in even-even neighboring nuclei 222 Ra and 224 Ra. A possible qualitative interpretation of the 'hindrance' of the transition to the ground state of 209 Pb is proposed

  1. Electron bremsstrahlung in collisions of 223 MeV/u He-like uranium ions with gaseous targets

    Energy Technology Data Exchange (ETDEWEB)

    Ludziejewski, T.; Beyer, H.; Bosch, F.; Brinzanescu, O.; Franzke, B.; Kozhuharov, C.; Liesen, D.; Menzel, G.; Meier, J.; Mokler, P.H.; Reich, H.; Steck, M.; Stenner, L. [Gesellschaft fuer Schwerionenforschung, D-64220 Darmstadt (Germany); Stoehlker, Th. [University of Frankfurt, D-60486 Frankfurt (Germany); Gesellschaft fuer Schwerionenforschung, D-64220 Darmstadt (Germany); Keller, S. [University of Frankfurt, D-60054 Frankfurt (Germany); Dunford, R.W. [Argonne National Laboratory, Argonne, IL 60439 (United States); Livingston, A.E. [University of Notre Dame, Indiana 4556 (United States); Rymuza, P. [Institute for Nuclear Studies, 05-400 Swierk (Poland); Stachura, Z. [Institute of Nuclear Physics, 31-342 Cracow (Poland); Swiat, P.; Warczak, A. [Jagiellonian University, 30-059 Cracow (Poland)

    1998-06-14

    The bremsstrahlung process in the domain of strong Coulomb fields has been investigated for N{sub 2} and Ar target electrons colliding with He-like uranium ions at 223 MeV/u. The differential cross sections for bremsstrahlung were measured at laboratory observation angles of 48 deg., 90 deg., and 132 deg. Substantial discrepancies were found between the experimental cross sections and the first-order Born approximation calculations. The reported data provide a new testing ground for non-perturbative treatment of the coupling between radiation and matter in the presence of strong fields. (author)

  2. Electron bremsstrahlung in collisions of 223 MeV/u He-like uranium ions with gaseous targets

    International Nuclear Information System (INIS)

    Ludziejewski, T.; Beyer, H.; Bosch, F.; Brinzanescu, O.; Franzke, B.; Kozhuharov, C.; Liesen, D.; Menzel, G.; Meier, J.; Mokler, P.H.; Reich, H.; Steck, M.; Stenner, L.; Stoehlker, T.; Keller, S.; Dunford, R.W.; Livingston, A.E.; Rymuza, P.; Stachura, Z.; Swiat, P.; Warczak, A.

    1997-09-01

    The bremsstrahlung process in the domain of strong Coulomb fields has been investigated for N 2 and Ar target electrons colliding with He-like uranium ions at 223 MeV/u. The doubly differential cross sections for bremsstrahlung were measured at the laboratory observation angles of 48 , 90 , and 132 . Substantial discrepancies were found between the experimental cross secions and the first order Born approximation calculations. The reported data provide a new testing ground for non-perturbative treatment of the coupling between radiation and matter in the presence of strong fields. (orig.)

  3. Electron bremsstrahlung in collisions of 223 MeV/u He-like uranium ions with gaseous targets

    Energy Technology Data Exchange (ETDEWEB)

    Ludziejewski, T.; Beyer, H.; Bosch, F.; Brinzanescu, O.; Franzke, B.; Kozhuharov, C.; Liesen, D.; Menzel, G.; Meier, J.; Mokler, P.H.; Reich, H.; Steck, M.; Stenner, L. [Gesellschaft fuer Schwerionenforschung mbH, Darmstadt (Germany); Stoehlker, T. [Gesellschaft fuer Schwerionenforschung mbH, Darmstadt (Germany)]|[Frankfurt Univ. (Germany); Keller, S. [Frankfurt Univ. (Germany); Dunford, R.W. [Argonne National Lab., IL (United States); Livingston, A.E. [Notre Dame Univ., IN (United States); Rymuza, P. [Institute for Nuclear Studies, Swierk (Poland); Stachura, Z. [Henryk Niewodniczanski Inst. of Nuclear Physics, Cracow (Poland); Swiat, P.; Warczak, A. [Jagiellonian Univ., Krakow (Poland)

    1997-09-01

    The bremsstrahlung process in the domain of strong Coulomb fields has been investigated for N{sub 2} and Ar target electrons colliding with He-like uranium ions at 223 MeV/u. The doubly differential cross sections for bremsstrahlung were measured at the laboratory observation angles of 48 , 90 , and 132 . Substantial discrepancies were found between the experimental cross secions and the first order Born approximation calculations. The reported data provide a new testing ground for non-perturbative treatment of the coupling between radiation and matter in the presence of strong fields. (orig.) 35 refs.

  4. Emission of exotic clusters by nuclei and discovery of a fine structure in the 14C decay of 223Ra

    International Nuclear Information System (INIS)

    Vergnes, M.

    1992-01-01

    This paper is intended as a broad, mainly experimental, survey of the recent field of exotic cluster radioactivity in heavy nuclei. The first part summarizes the development of the field since the first experimental finding in 1984, insisting on 14 C emission, and giving a schematic status of the corresponding models. The second part describes in detail the 1989 discovery, in Orsay, of a fine structure of the 14 C decay of 223 Ra and the search for a similar effect in even-even neighboring nuclei 222 Ra and 224 Ra. A possible qualitative interpretation of the ''hindrance'' of the transition to the ground state of 209 Pb is proposed

  5. Influence of serum leptin levels and Q223R leptin receptor polymorphism on clinical characteristic of patients with rheumatoid arthritis from Western Mexico.

    Science.gov (United States)

    Angel-Chávez, Luis I; Ruelas-Cinco, Elizabeth; Hernández-Bello, Jorge; Castro, Elena; Vázquez-Villamar, Mirna; Parra-Rojas, Isela; Brennan-Bourdon, L Michele; Muñoz-Barrios, Salvador; Guerrero-Velázquez, Celia; Muñoz-Valle, José Francisco

    2018-04-01

    The aim of the present study was to evaluate the possible association between the Q223R Leptin receptor (LEPR) polymorphism (A>G; rs1137101) and leptin levels in patients with rheumatoid arthritis (RA) from Western Mexico. A cross-sectional study was performed with 70 RA patients and 74 controls subject (CS). Disease activity was evaluated using DAS28 score, the Q223R LEPR polymorphism was determined by the Polymerase Chain Reaction-Restriction Fragment Length Polymorphism (PCR-RFLP) and serum leptin levels, erythrocyte sedimentation rate (ESR), C-reactive protein (CRP) and rheumatoid factor (RF) were quantified. RA patients had significant high serum leptin levels compared with CS; leptin levels correlated strongly with body composition measures, but not with inflammatory markers, disease evolution, and activity. The genotype and allele frequencies of the Q223R LEPR polymorphism were not associated with RA. Similarly, leptin levels did not differ between Q223R LEPR genotypes. The LEPR Q223R polymorphism was not associated with RA risk in patients from Mexican population, even though high levels of serum leptin were present and these could explain the low weight observed in RA patients when they were compared to control subjects. However, the serum leptin levels did not correlate with inflammatory markers, severity and disease evolution.

  6. Autosomal dominant hereditary spastic paraplegia with axonal sensory motor polyneuropathy maps to chromosome 21q 22.3.

    Science.gov (United States)

    Peddareddygari, Leema Reddy; Hanna, Philip A; Igo, Robert P; Luo, Yuqun A; Won, Sungho; Hirano, Michio; Grewal, Raji P

    2016-01-01

    Hereditary spastic paraplegia (HSP) are a genetically and clinically heterogeneous group of disorders. At present, 19 autosomal dominant loci for HSP have been mapped. We ascertained an American family of European descent segregating an autosomal dominant HSP associated with peripheral neuropathy. A genome wide scan was performed with 410 microsatellite repeat marker (Weber lab screening set 16) and following linkage and haplotype analysis, fine mapping was performed. Established genes or loci for HSP were excluded by direct sequencing or haplotype analysis. All established loci for HSP were excluded. Fine mapping suggested a locus on chromosome 21q22.3 flanked by markers D21S1411 and D21S1446 with a maximum logarithm of odds score of 2.05 and was supported by haplotype analysis. A number of candidate genes in this region were analyzed and no disease-producing mutations were detected. We present the clinical and genetic analysis of an American family with autosomal dominant HSP with axonal sensory motor polyneuropathy mapping to a novel locus on chromosome 21q22.3 designated SPG56.

  7. Application of the Nonballistic Model to the Black Hole Candidate XTE J1752-223 and the Quasar NRAO 150

    Energy Technology Data Exchange (ETDEWEB)

    Zheng, T. Y.; Gong, B. P., E-mail: bpgong@mail.hust.edu.cn [Department of Physics, Huazhong University of Science and Technology, Wuhan 430074 (China)

    2017-02-01

    Optical and radio observations of the black hole candidate XTE J1752-223 have exhibited a slightly curved motion of the jet components, which is associated with its radio light curve. In addition, observations of the quasar NRAO 150 have revealed a core–jet structure wobbling with a high angular speed. In this paper, the phenomena displayed in these two different sources are interpreted as the precession of a bent jet. In such a scenario, hot spots reproduced at different separations from the core precess on the same precession cone, in which different components correspond to different propagation times to the observer. By fitting the kinematics of the components of XTE J1752-223 and its light curve with a curved pattern of precession period 314 days, we find that the propagation time can make an earlier event appear later, and the jet axis can oscillate during its precession. Simulating the quasar NRAO 150 with the same scenario reveals that the knots at larger separation from the core precess at a slower speed than those closer in. A possible mechanism relating to the cooling time of a component is proposed. These three new results are of importance in understanding the physics underlying the curved jet as well as the activity of the central engine of different black hole systems.

  8. Application of the Nonballistic Model to the Black Hole Candidate XTE J1752-223 and the Quasar NRAO 150

    International Nuclear Information System (INIS)

    Zheng, T. Y.; Gong, B. P.

    2017-01-01

    Optical and radio observations of the black hole candidate XTE J1752-223 have exhibited a slightly curved motion of the jet components, which is associated with its radio light curve. In addition, observations of the quasar NRAO 150 have revealed a core–jet structure wobbling with a high angular speed. In this paper, the phenomena displayed in these two different sources are interpreted as the precession of a bent jet. In such a scenario, hot spots reproduced at different separations from the core precess on the same precession cone, in which different components correspond to different propagation times to the observer. By fitting the kinematics of the components of XTE J1752-223 and its light curve with a curved pattern of precession period 314 days, we find that the propagation time can make an earlier event appear later, and the jet axis can oscillate during its precession. Simulating the quasar NRAO 150 with the same scenario reveals that the knots at larger separation from the core precess at a slower speed than those closer in. A possible mechanism relating to the cooling time of a component is proposed. These three new results are of importance in understanding the physics underlying the curved jet as well as the activity of the central engine of different black hole systems.

  9. 226Ra, 228Ra, 223Ra, and 224Ra in coastal waters with application to coastal dynamics and groundwater input

    International Nuclear Information System (INIS)

    Moore, W.S.

    1997-01-01

    Four radium isotopes offer promise in unraveling the complex dynamics of coastal ocean circulation and groundwater input. Each isotope is produced by decay of a thorium parent bound to sediment. The activities of these thorium isotopes and the sediment-water distribution coefficient for radium provide an estimate of the source function of each Ra isotope to the water. In salt marshes that receive little surface water input, Ra activities which exceed coastal ocean values must originate within the marsh. In North Inlet, South Carolina, the activities of 226 Ra exported from the marsh far exceed the activities generated within the marsh. To supply the exported activities, substantial groundwater input is required. In the coastal region itself, 226 Ra activities exceed the amount that can be supplied from rivers. Here also, substantial groundwater input is required. Within the coastal ocean, 223 Ra and 224 Ra may be used to determine mixing rates with offshore waters. Shore-perpendicular profiles of 223 Ra and 224 Ra show consistent trends which may be modeled as eddy diffusion coefficients of 350-540 m 2 s -1 . These coefficients allow an assessment of cross-shelf transport and provide further insight on the importance of groundwater to coastal regions. (author)

  10. SU-F-T-57: Delivered Activity Accuracy of Radium 223 Dichloride Injections, When Being Administrated for Castration Resistant Prostate Cancer, Symptomatic Bone Metastases. The Impact of Residual Activity in the Spent Syringe and Dispensing Accuracy of Ra 223

    International Nuclear Information System (INIS)

    Jennings, G

    2016-01-01

    Purpose: To quantify the delivered activity accuracy of Radium 223 dichloride injections, when being administrated for castration – resistant prostate cancer, symptomatic bone metastases. The impact of residual activity in the spent syringe and dispensing accuracy of Ra 223. Methods: The administration is by slow intravenous injection over 1 minute followed by double flushing of the 10 mL syringe and IV with saline. Eighty (80) procedures was used to investigate variations in the activity from the amount prescribed (µCi) = 1.35 × Patient weight Kg. The Activity dispensed into a 10mL syringe using a NIST traceable Capintec CRC-25R Chamber and a cross calibrated capintec CRC-15R to measure activity in the syringe immediately before and after administration Results: The patients weight range from 121Ib to 235lb and doses ranging 74.25 µCi to 144.2 µCi. The deviation of dispensed dose vs Prescribed dose average +2.1% with a range of −1.1% to +5.7%. The Dose measured before administration ranges 79.3 µCi to 154.9 µCi. Deviation from the dispensed dose was show to average +2.9% with a range of −0.8% to +7.3%. The average residual dose post injection was 2.5 µCi or 2.2% of the pre injection activity. Ranging from 0.9 µCi to 6.2 µCi, 0.7% to 5.4% respectively. Subtracting the residual activity from that measured activity before injection and comparing it to prescription dose was shown to have an average variation of +2.7% with a range of −0.8% to 7.4%. Conclusion: The case resulted in the 6.2 µCi maximum residual dose had two syringes. A small, 82.8 µCi activity, case resulted in the 7.4% maximum variation in measures less residual verses prescription dose. The average +2.1 % dispenses activity of Ra 223 over the prescription dosage was seen to counteract the average 2.2% residual dosage found to remain in the syringe

  11. SU-F-T-57: Delivered Activity Accuracy of Radium 223 Dichloride Injections, When Being Administrated for Castration Resistant Prostate Cancer, Symptomatic Bone Metastases. The Impact of Residual Activity in the Spent Syringe and Dispensing Accuracy of Ra 223

    Energy Technology Data Exchange (ETDEWEB)

    Jennings, G [Marsden Medical Physics Associates, Denville, NJ (United States)

    2016-06-15

    Purpose: To quantify the delivered activity accuracy of Radium 223 dichloride injections, when being administrated for castration – resistant prostate cancer, symptomatic bone metastases. The impact of residual activity in the spent syringe and dispensing accuracy of Ra 223. Methods: The administration is by slow intravenous injection over 1 minute followed by double flushing of the 10 mL syringe and IV with saline. Eighty (80) procedures was used to investigate variations in the activity from the amount prescribed (µCi) = 1.35 × Patient weight Kg. The Activity dispensed into a 10mL syringe using a NIST traceable Capintec CRC-25R Chamber and a cross calibrated capintec CRC-15R to measure activity in the syringe immediately before and after administration Results: The patients weight range from 121Ib to 235lb and doses ranging 74.25 µCi to 144.2 µCi. The deviation of dispensed dose vs Prescribed dose average +2.1% with a range of −1.1% to +5.7%. The Dose measured before administration ranges 79.3 µCi to 154.9 µCi. Deviation from the dispensed dose was show to average +2.9% with a range of −0.8% to +7.3%. The average residual dose post injection was 2.5 µCi or 2.2% of the pre injection activity. Ranging from 0.9 µCi to 6.2 µCi, 0.7% to 5.4% respectively. Subtracting the residual activity from that measured activity before injection and comparing it to prescription dose was shown to have an average variation of +2.7% with a range of −0.8% to 7.4%. Conclusion: The case resulted in the 6.2 µCi maximum residual dose had two syringes. A small, 82.8 µCi activity, case resulted in the 7.4% maximum variation in measures less residual verses prescription dose. The average +2.1 % dispenses activity of Ra 223 over the prescription dosage was seen to counteract the average 2.2% residual dosage found to remain in the syringe.

  12. Hydrogen bonding between the QB site ubisemiquinone and Ser-L223 in the bacterial reaction centre – a combined spectroscopic and computational perspective^

    OpenAIRE

    Martin, Erik; Baldansuren, Amgalanbaatar; Lin, Tzu-Jen; Samoilova, Rimma I.; Wraight, Colin A.; Dikanov, Sergei A.; O’Malley, Patrick J.

    2012-01-01

    In the QB site of the Rba. sphaeroides photosynthetic reaction centre the donation of a hydrogen bond from the hydroxyl group of Ser-L223 to the ubisemiquinone formed after the first flash is debatable. In this study we use a combination of spectroscopy and quantum mechanics/molecular mechanics (QM/MM) calculations to comprehensively explore this topic. We show that ENDOR, ESEEM and HYSCORE spectroscopic differences between the mutant L223SA and the wild type sample (WT) are negligible, indic...

  13. A unique drug distribution process for radium Ra 223 dichloride injection and its implication for product quality, patient privacy, and delineation of professional responsibilities.

    Science.gov (United States)

    Dansereau, Raymond N

    2014-11-01

    On May 15, 2013, Bayer Healthcare Pharmaceuticals announced that it had received marketing approval for the therapeutic radioactive medication radium Ra 223 dichloride injection (Xofigo; Ra 223). The product acquisition and distribution process for hospital-based nuclear pharmacies and nuclear medicine services is unlike any other. The product is distributed as a low-risk compounded sterile preparation through a single compounding nuclear pharmacy located in Denver, Colorado, pursuant to a prescription. This model for drug distribution and delivery to the user institution has implications for product quality, patient privacy, and delineation of professional responsibilities. © The Author(s) 2014.

  14. Comparative study of chance coincidence correction in measuring 223Ra and 224Ra by delay coincidence method

    International Nuclear Information System (INIS)

    Yan Yongjun; Huang Derong; Zhou Jianliang; Qiu Shoukang

    2013-01-01

    The delay coincidence measurement of 220 Rn and 219 Rn has been proved to be a valid indirect method for measuring 224 Ra and 223 Ra extracted from natural water, which can provide valuable information on estuarine/ocean mixing, submarine groundwater discharge, and water/soil interactions. In practical operation chance coincidence correction must be considered, mostly Moore's correction method, but Moore's and Giffin's methods were incomplete in some ways. In this paper the modification (method 1) and a new chance coincidence correction formula (method 2) were provided. Experiments results are presented to demonstrate the conclusions. The results show that precision is improved while counting rate is less than 70 min- 1 . (authors)

  15. Efficacy and Outcome Predictors of Gonadotropin Treatment for Male Congenital Hypogonadotropic Hypogonadism: A Retrospective Study of 223 Patients.

    Science.gov (United States)

    Liu, Zhaoxiang; Mao, Jangfeng; Wu, Xueyan; Xu, Hongli; Wang, Xi; Huang, Bingkun; Zheng, Junjie; Nie, Min; Zhang, Hongbing

    2016-03-01

    Gonadotropin induces masculinization and spermatogenesis in men with congenital hypogonadotropic hypogonadism (CHH). However, large cohort studies for the efficacy and reliable predictors of this therapy need to be conducted. The aim of this study was to investigate the efficacy of gonadotropin treatment in a large cohort of male CHH patients and analyze putative predictors for successful spermatogenesis. This retrospective study included 223 CHH azoospermic patients without puberty development treated between 2005 and 2014. All patients received combined human chorionic gonadotropin (HCG) and human menopausal gonadotropin (HMG) and were followed up for >6 months (5109 person-months). Serum total testosterone level, testicular size, spermatogenesis, and pregnancy outcome were recorded at each visit. After gonadotropin therapy, testicular size was enlarged from 2.1 ± 1.6 to 8.1 ± 4.6 mL (P 0/mL) occurred at a median period of 15 months (95% confidence interval 13.5-16.5). Larger basal testicular volume (P = 0.012) and noncryptorchidism history (P = 0.028) are independent predictors for earlier sperm appearance. Sixty four percent (143/223) of patients succeeded in producing sperms and the average time for initial sperm detection was 14 ± 8 months. However, their sperm concentrations (11.7 [2.1, 24.4] million/mL) and sperm progressive motility (A + B 36.9% ± 20.2%) are significantly lower than World Health Organization standards. Of the 34 patients who desired for fathering children, 19 patients impregnanted their partners during the treatment. Gonadotropin therapy induces spermatogenesis in male CHH patients. A larger basal testicular size and noncryptorchidism history are favorable indicators for earlier spermatogenesis.

  16. Dysbindin (DTNBP1, 6p22.3) is Associated with Childhood-Onset Psychosis and Endophenotypes Measured by the Premorbid Adjustment Scale (PAS)

    Science.gov (United States)

    Gornick, M. C.; Addington, A. M.; Sporn, A.; Gogtay, N.; Greenstein, D.; Lenane, M.; Gochman, P.; Ordonez, A.; Balkissoon, R.; Vakkalanka, R.; Weinberger, D. R.; Rapoport, J. L.; Straub, R. E.

    2005-01-01

    Straub "et al." ("2002") recently identified the 6p22.3 gene dysbindin (DTNBP1) through positional cloning as a schizophrenia susceptibility gene. We studied a rare cohort of 102 children with onset of psychosis before age 13. Standardized ratings of early development, medication response, neuropsychological and cognitive performance, premorbid…

  17. Measuring the radium quartet ({sup 228}Ra, {sup 226}Ra, {sup 224}Ra, {sup 223}Ra) in seawater samples using gamma spectrometry

    Energy Technology Data Exchange (ETDEWEB)

    Beek, P. van, E-mail: vanbeek@legos.obs-mip.f [LEGOS, Laboratoire d' Etudes en Geophysique et Oceanographie Spatiales (CNRS/CNES/IRD/UPS), Observatoire Midi Pyrenees, 14 Avenue Edouard Belin, 31400 Toulouse (France); Souhaut, M. [LEGOS, Laboratoire d' Etudes en Geophysique et Oceanographie Spatiales (CNRS/CNES/IRD/UPS), Observatoire Midi Pyrenees, 14 Avenue Edouard Belin, 31400 Toulouse (France); Reyss, J.-L. [LSCE, Laboratoire des Sciences du Climat et de l' Environnement (CNRS/CEA/UVSQ), Avenue de la Terrasse, 91198 Gif-sur-Yvette (France)

    2010-07-15

    Radium isotopes are widely used in marine studies (eg. to trace water masses, to quantify mixing processes or to study submarine groundwater discharge). While {sup 228}Ra and {sup 226}Ra are usually measured using gamma spectrometry, short-lived Ra isotopes ({sup 224}Ra and {sup 223}Ra) are usually measured using a Radium Delayed Coincidence Counter (RaDeCC). Here we show that the four radium isotopes can be analyzed using gamma spectrometry. We report {sup 226}Ra, {sup 228}Ra, {sup 224}Ra, {sup 223}Ra activities measured using low-background gamma spectrometry in standard samples, in water samples collected in the vicinity of our laboratory (La Palme and Vaccares lagoons, France) but also in seawater samples collected in the plume of the Amazon river, off French Guyana (AMANDES project). The {sup 223}Ra and {sup 224}Ra activities determined in these samples using gamma spectrometry were compared to the activities determined using RaDeCC. Activities determined using the two techniques are in good agreement. Uncertainties associated with the {sup 224}Ra activities are similar for the two techniques. RaDeCC is more sensitive for the detection of low {sup 223}Ra activities. Gamma spectrometry thus constitutes an alternate method for the determination of short-lived Ra isotopes.

  18. 12 CFR 223.2 - What is an “affiliate” for purposes of sections 23A and 23B and this part?

    Science.gov (United States)

    2010-01-01

    ... the holding company controls the private equity fund under 12 CFR 225.173(d)(4). (v) Definition. For... (REGULATION W) Introduction and Definitions § 223.2 What is an “affiliate” for purposes of sections 23A and... this section, “affiliate” with respect to a member bank means: (1) Parent companies. Any company that...

  19. Radium isotope (223Ra, 224Ra, 226Ra and 228Ra) distribution near Brazil's largest port, Paranaguá Bay, Brazil

    International Nuclear Information System (INIS)

    Dias, Thais H.; Oliveira, Joselene de; Sanders, Christian J.; Carvalho, Franciane; Sanders, Luciana M.; Machado, Eunice C.; Sá, Fabian

    2016-01-01

    This work investigates the 223 Ra, 224 Ra, 226 Ra and 228 Ra isotope distribution in river, estuarine waters and sediments of the Paranaguá Estuarine Complex (PEC). The stratification of the Ra isotopes along water columns indicate differing natural sources. In sediments, the radium isotope activities was inversely proportional to the particle size. The highest concentrations of 223 Ra, 224 Ra, 226 Ra and 228 Ra in the water column were found in the bottom more saline waters and towards the inner of the estuary. These relatively high concentrations towards the bottom of the estuary may be attributed to the influence of tidally driven groundwater source and desorption from particles at the maximum turbidity zone. The apparent river water ages from the radium isotope ratios, 223 Ra/ 224 Ra and 223 Ra/ 228 Ra, indicate that the principal rivers that flow into the estuary have residence times from between 6 and 11 days. - Highlights: • Radium isotope concentrations were evaluated along a large estuarine system. • The radioactivity level in river, estuary and sediments was within a normal range. • Spatial distributions of site specific radionuclides have differing activities and sources.

  20. Radium-223-Dichloride in Castration Resistant Metastatic Prostate Cancer—Preliminary Results of the Response Evaluation Using F-18-Fluoride PET/CT

    Directory of Open Access Journals (Sweden)

    Kalevi Kairemo

    2015-10-01

    Full Text Available The purpose of this study was to evaluate the outcome after Radium-223-dichloride (223RaCl2 treatment of patients with skeletal metastases of castration resistant prostate cancer using whole-body 18F-Fluoride PET/CT. Sodium 18F-fluoride [18F]-NaF PET/CT was performed prior the treatment of 223RaCl2, after the first cycle and after the sixth cycle. The skeletal metastases were analyzed quantitatively using modified PET response evaluation PERCIST criteria. The patients were also analyzed for S-PSA. All ten patients responded in [18F]-NaF scans after 6 cycles, but interim analysis after the 1st cycle did not give additional information about the outcome. The S-PSA decrease correlated with [18F]-NaF response, only 1 patient demonstrated progressive disease, i.e., >25% increase in S-PSA values during 223RaCl2. Our results (although preliminary suggest that 18F-Fluoride PET/CT is useful in the follow-up of castration resistant prostate cancer with skeletal metastases.

  1. MicroRNA-22-3p is down-regulated in the plasma of Han Chinese patients with premature ovarian failure.

    Science.gov (United States)

    Dang, Yujie; Zhao, Shidou; Qin, Yingying; Han, Ting; Li, Weiping; Chen, Zi-Jiang

    2015-03-01

    To determine whether plasma microRNAs (miRNAs) are differentially expressed between women with and without premature ovarian failure (POF), and to uncover the association of miRNAs with risk of POF. Microarray with real-time polymerase chain reaction validation. University hospital. A total of 140 individuals with premature ovarian failure (POF) and 140 age- and body mass index-matched control subjects of Han Chinese ancestry. None. Relative miRNA expression levels in plasma of POF and control group. Fifty-one differentially expressed miRNAs were identified by chip-based discovery stage between ten patients with POF and ten control subjects, among which nine miRNAs (let-7b-5p, let-7c, miR-15b-5p, miR-22-3p, miR-23a-3p, miR-23b-3p, miR-24-3p, miR-151a-5p, and miR-151b) were selected and validated. The relative expression level of miR-22-3p was significantly down-regulated in POF compared with control subjects. MiR-22-3p yielded a receiver operating characteristic (ROC) curve area of 0.668 (95% confidence interval 0.602-0.733) in discriminating POF from controls. In addition, logistic binary regression analysis and linear regression analysis showed the miR-22-3p to be a protective factor for POF (odds ratio 0.766, 95% CI 0.643-0.912) and negatively associated with serum FSH. Furthermore, bioinformatics analysis indicated that the target function of miR-22-3p was involved in apoptosis, endocytosis, and tumorigenesis. Mir-22-3p showed a lower expression level in POF and was modestly effective in distinguishing POF from control subjects. The decreased expression of miR-22-3p in plasma of POF may reflect the diminished ovarian reserve and be a consequence of the pathologic process of POF. Copyright © 2015 American Society for Reproductive Medicine. Published by Elsevier Inc. All rights reserved.

  2. Open clusters. II. Fundamental parameters of B stars in Collinder 223, Hogg 16, NGC 2645, NGC 3114, and NGC 6025

    Science.gov (United States)

    Aidelman, Y.; Cidale, L. S.; Zorec, J.; Panei, J. A.

    2015-05-01

    Context. The knowledge of accurate values of effective temperature, surface gravity, and luminosity of stars in open clusters is very important not only to derive cluster distances and ages but also to discuss the stellar structure and evolution. Unfortunately, stellar parameters are still very scarce. Aims: Our goal is to study five open clusters to derive stellar parameters of the B and Be star population and discuss the cluster properties. In a near future, we intend to gather a statistically relevant samples of Be stars to discuss their origin and evolution. Methods: We use the Barbier-Chalonge-Divan spectrophotometric system, based on the study of low-resolution spectra around the Balmer discontinuity, since it is independent of the interstellar and circumstellar extinction and provides accurate Hertzsprung-Russell diagrams and stellar parameters. Results: We determine stellar fundamental parameters, such as effective temperatures, surface gravities, spectral types, luminosity classes, absolute and bolometric magnitudes and colour gradient excesses of the stars in the field of Collinder 223, Hogg 16, NGC 2645, NGC 3114, and NGC 6025. Additional information, mainly masses and ages of cluster stellar populations, is obtained using stellar evolution models. In most cases, stellar fundamental parameters have been derived for the first time. We also discuss the derived cluster properties of reddening, age and distance. Conclusions: Collinder 223 cluster parameters are overline{E(B-V) = 0.25 ± 0.03} mag and overline{(mv - M_v)0 = 11.21 ± 0.25} mag. In Hogg 16, we clearly distinguish two groups of stars (Hogg 16a and Hogg 16b) with very different mean true distance moduli (8.91 ± 0.26 mag and 12.51 ± 0.38 mag), mean colour excesses (0.26 ± 0.03 mag and 0.63 ± 0.08 mag), and spectral types (B early-type and B late-/A-type stars, respectively). The farthest group could be merged with Collinder 272. NGC 2645 is a young cluster (age between 40 Myr and 69 Myr. In

  3. Nance-Horan syndrome: localization within the region Xp21.1-Xp22.3 by linkage analysis.

    Science.gov (United States)

    Stambolian, D; Lewis, R A; Buetow, K; Bond, A; Nussbaum, R

    1990-07-01

    Nance-Horan Syndrome (NHS) or X-linked cataract-dental syndrome (MIM 302350) is a disease of unknown pathogenesis characterized by congenital cataracts and dental anomalies. We performed linkage analysis in three kindreds with NHS by using six RFLP markers between Xp11.3 and Xp22.3. Close linkage was found between NHS and polymorphic loci DXS43 (theta = 0 with lod score 2.89), DXS41 (theta = 0 with lod score 3.44), and DXS67 (theta = 0 with lod score 2.74), defined by probes pD2, p99-6, and pB24, respectively. Recombinations were found with the marker loci DXS84 (theta = .04 with lod score 4.13), DXS143 (theta = .06 with lod score 3.11) and DXS7 (theta = .09 with lod score 1.68). Multipoint linkage analysis determined the NHS locus to be linked completely to DXS41 (lod score = 7.07). Our linkage results, combined with analysis of Xp interstitial deletions, suggest that the NHS locus is located within or close to the Xp22.1-Xp22.2 region.

  4. Radiotoxicity of gadolinium-148 and radium-223 in mouse testes: Relative biological effectiveness of alpha-particle emitters in vivo

    International Nuclear Information System (INIS)

    Howell, R.W.; Goddu, S.M.; Narra, V.R.

    1997-01-01

    The biological effects of radionuclides that emit α particles are of considerable interest in view of their potential for therapy and their presence in the environment. The present work is a continuation of our ongoing effort to study the radiotoxicity of α-particle emitters in vivo using the survival of murine testicular sperm heads as the biological end point. Specifically, the relative biological effectiveness (RBE) of very low-energy α particles (3.2 MeV) emitted by 148 Gd is investigated and determined to be 7.4 ± 2.4 when compared to the effects of acute external 120 kVp X rays. This datum, in conjunction with our earlier results for 210 Po and 212 Pb in equilibrium with its daughters, is used to revise and extend the range of validity of our previous RBE-energy relationship for α particles emitted by tissue-incorporated radionuclides. The new empirical relationship is given by RBE α = 9.14 - 0.510 E α , where 3 α 223 Ra (in equilibrium with its daughters) experimentally in the same biological model and comparing the value obtained experimentally with the predicted value. The resulting RBE values are 5.4 ± 0.9 and 5.6, respectively. This close agreement strongly supports the adequacy of the empirical RBE-E α relationship to predict the biological effects of α-particle emitters in vivo. 42 refs., 5 figs., 1 tab

  5. Tracing water movement in Mumbai harbor bay using naturally occurring "2"2"4Ra and "2"2"3Ra as tracer

    International Nuclear Information System (INIS)

    Yadav, V.B.; Sartandel, S.J.; Jha, S.K.; Tripathi, R.M.

    2017-01-01

    Measurement of short lived radium isotopes "2"2"4Ra and "2"2"3Ra in seawater samples collected from Mumbai Harbor Bay was carried out using MnO_2 based in-situ pre-concentration technique coupled with coincidence counting. Longitudinal variation of "2"2"4Ra and "2"2"3Ra was found in the range 17.74 - 98.66 dpm/100L and 0.56 - 2.26 dpm/100L respectively. Higher value of radium isotopes was found near shore sampling points where reused seawater and surface water from land intrudes in creek. A decreasing pattern was observed in the creek as we move to offshore locations. Lower activity ratio in offshore locations indicates the flow of water towards open sea. (author)

  6. Reflections on the therapeutic use of 223RaCl2 for bone metastases resulting from prostate cancer resistant to castration

    International Nuclear Information System (INIS)

    Astudillo V, A. J.; Paredes G, L.

    2015-10-01

    In January 2014 the Comision Federal para la Proteccion contra Riesgos Sanitarios of the Ministry of Health in Mexico, authorize the use of 223 RaCl 2 as the first radiopharmaceutical emitter α for therapeutic purposes in cases of bone metastases resulting from prostate cancer resistant to castration. The paper analyzes the main variables that affect the metrological traceability using activity meters to evaluate the gamma activity of 223 RaCl 2 in hospitals, because it has a chain of complex decay with alpha, beta and gamma emitters, so was important to verify if a gamma activity measurement for a multiple emitter is reliable to determine the total alpha absorbed dose to bone in a patient. (Author)

  7. Clinical safety of a polyvalent F(ab')2 equine antivenom in 223 African snake envenomations : a field trial in Cameroon

    OpenAIRE

    Chippaux, Jean-Philippe; Lang, J.; Amadi Eddine, S; Fagot, P.; Rage, V.; Peyrieux, J.C.; Le Mener, V.

    1998-01-01

    A large-scale clinical trial was conducted, according to World Health Organization Good Clinical Practice guidelines, in 7 centres in North Cameroon to determine the safety and efficacy of a polyvalent antivenom composed of purified F(ab')2. This study included 223 patients presenting clinically with an obvious snake bite, predominantly due to #Echis ocellatus$ (viper), the most abundant species in this savannah region. Clinical surveillance was maintained for 5 d in all patients and until th...

  8. A Boy with an LCR3/4-Flanked 10q22.3q23.2 Microdeletion and Uncommon Phenotypic Features

    Science.gov (United States)

    Petrova, E.; Neuner, C.; Haaf, T.; Schmid, M.; Wirbelauer, J.; Jurkutat, A.; Wermke, K.; Nanda, I.; Kunstmann, E.

    2014-01-01

    The recurrent 10q22.3q23.2 deletion with breakpoints within low copy repeats 3 and 4 is a rare genomic disorder, reported in only 13 patients to date. The phenotype is rather uncharacteristic, which makes a clinical diagnosis difficult. A phenotypic feature described in almost all patients is a delay in speech development, albeit systematic studies are still pending. In this study, we report on a boy with an LCR3/4-flanked 10q22.3q23.2 deletion exhibiting an age-appropriate language development evaluated by a standardized test at an age of 2 years and 3 months. The boy was born with a cleft palate – a feature not present in any of the patients described before. Previously reported cases are reviewed, and the role of the BMPR1A gene is discussed. The phenotype of patients with an LCR3/4-flanked 10q22.3q23.2 deletion can be rather variable, so counseling the families regarding the prognosis of an affected child should be done with caution. Long-term studies of affected children are needed to delineate the natural history of this rare disorder. PMID:24550761

  9. Variable developmental delays and characteristic facial features-A novel 7p22.3p22.2 microdeletion syndrome?

    Science.gov (United States)

    Yu, Andrea C; Zambrano, Regina M; Cristian, Ingrid; Price, Sue; Bernhard, Birgitta; Zucker, Marc; Venkateswaran, Sunita; McGowan-Jordan, Jean; Armour, Christine M

    2017-06-01

    Isolated 7p22.3p22.2 deletions are rarely described with only two reports in the literature. Most other reported cases either involve a much larger region of the 7p arm or have an additional copy number variation. Here, we report five patients with overlapping microdeletions at 7p22.3p22.2. The patients presented with variable developmental delays, exhibiting relative weaknesses in expressive language skills and relative strengths in gross, and fine motor skills. The most consistent facial features seen in these patients included a broad nasal root, a prominent forehead a prominent glabella and arched eyebrows. Additional variable features amongst the patients included microcephaly, metopic ridging or craniosynostosis, cleft palate, cardiac defects, and mild hypotonia. Although the patients' deletions varied in size, there was a 0.47 Mb region of overlap which contained 7 OMIM genes: EIP3B, CHST12, LFNG, BRAT1, TTYH3, AMZ1, and GNA12. We propose that monosomy of this region represents a novel microdeletion syndrome. We recommend that individuals with 7p22.3p22.2 deletions should receive a developmental assessment and a thorough cardiac exam, with consideration of an echocardiogram, as part of their initial evaluation. © 2017 Wiley Periodicals, Inc.

  10. Loss of heterozygosity on chromosome 9q22.3 in microdissected basal cell carcinomas around the Semipalatinsk Nuclear Testing Site, Kazakhstan.

    Science.gov (United States)

    Iwata, Kenji; Takamura, Noboru; Nakashima, Masahiro; Alipov, Gabit; Mine, Mariko; Matsumoto, Naomichi; Yoshiura, Koichiro; Prouglo, Yuriy; Sekine, Ichiro; Katayama, Ichiro; Yamashita, Shunichi

    2004-04-01

    A high incidence of skin cancers has been noted around the Semipalatinsk Nuclear Testing Site (SNTS) in Kazakhstan. Recently, basal cell carcinoma (BCC) susceptibility genes, human homolog of the Drosophila pathed gene (PTCH), and the xeroderma pigmentosa group A-complementing gene (XPA), have been cloned and localized on chromosome 9q22.3. To clarify the effect of low-dose irradiation on the occurrence of BCC, we used microdissection and polymerase chain reaction to identify loss of heterozygosity (LOH) at 9q22.3 using BCC samples obtained from this region. Ten Japanese samples were analyzed as controls. LOH with at least 1 marker was identified in 5 of 14 cases from around SNTS, whereas only 1 case with 1 marker was identified among the 10 Nagasaki cases. The total number of LOH alleles from SNTS (8 of 45) was significantly higher than the number from Nagasaki (1 of 26) (P = 0.03). The higher incidence of LOH on 9q22.3 in BCC from around SNTS suggests involvement of chronic low-dose irradiation by fallout from the test site as a factor in the cancers.

  11. Severe intellectual disability, omphalocele, hypospadia and high blood pressure associated to a deletion at 2q22.1q22.3: case report

    Directory of Open Access Journals (Sweden)

    Mulatinho Milene

    2012-06-01

    Full Text Available Abstract Background Recently, array-comparative genomic hybridization (aCGH platforms have significantly improved the resolution of chromosomal analysis allowing the identification of genomic copy number gains and losses smaller than 5 Mb. Here we report on a young man with unexplained severe mental retardation, autism spectrum disorder, congenital malformations comprising hypospadia and omphalocele, and episodes of high blood pressure. An ~ 6 Mb interstitial deletion that includes the causative genes is identified by oligonucleotide-based aCGH. Results Our index case exhibited a de novo chromosomal abnormality at 2q22 [del(2(q22.1q22.3dn] which was not visible at the 550 haploid band level. The deleted region includes eight genes: HNMT, SPOPL, NXPH2, LOC64702, LRP1B, KYNU, ARHGAP15 and GTDC1. Discussion aCGH revealed an ~ 6 Mb deletion in 2q22.1 to 2q22.3 in an as-yet unique clinical case associated with intellectual disability, congenital malformations and autism spectrum disorder. Interestingly, the deletion is co-localized with a fragile site (FRA2K, which could be involved in the formation of this chromosomal aberration. Further studies are needed to determine if deletions of 2q22.1 to 2q22.3 define a new microdeletion syndrome.

  12. RNA interference of endochitinases in the sugarcane endophyte Trichoderma virens 223 reduces its fitness as a biocontrol agent of pineapple disease.

    Directory of Open Access Journals (Sweden)

    Aline S Romão-Dumaresq

    Full Text Available The sugarcane root endophyte Trichoderma virens 223 holds enormous potential as a sustainable alternative to chemical pesticides in the control of sugarcane diseases. Its efficacy as a biocontrol agent is thought to be associated with its production of chitinase enzymes, including N-acetyl-ß-D-glucosaminidases, chitobiosidases and endochitinases. We used targeted gene deletion and RNA-dependent gene silencing strategies to disrupt N-acetyl-ß-D-glucosaminidase and endochitinase activities of the fungus, and to determine their roles in the biocontrol of soil-borne plant pathogens. The loss of N-acetyl-ß-D-glucosaminidase activities was dispensable for biocontrol of the plurivorous damping-off pathogens Rhizoctonia solani and Sclerotinia sclerotiorum, and of the sugarcane pathogen Ceratocystis paradoxa, the causal agent of pineapple disease. Similarly, suppression of endochitinase activities had no effect on R. solani and S. sclerotiorum disease control, but had a pronounced effect on the ability of T. virens 223 to control pineapple disease. Our work demonstrates a critical requirement for T. virens 223 endochitinase activity in the biocontrol of C. paradoxa sugarcane disease, but not for general antagonism of other soil pathogens. This may reflect its lifestyle as a sugarcane root endophyte.

  13. MO-AB-201-01: Regulatory Compliance and Safety with New Radiotherapies: Spheres and Ra-223

    Energy Technology Data Exchange (ETDEWEB)

    Phillips, L. [Stanford University (United States)

    2015-06-15

    The role of the Radiation Safety Officer at a medical facility can be complicated. The complexity of the position is based on the breadth of services provided at the institution and the nature of the radioactive materials license. Medical practices are constantly changing and the use of ionizing radiation continues to rise in this area. Some of the newer medical applications involving radiation have unique regulatory and safety issues that must be addressed. Oversight of the uses of radiation start at the local level (radiation safety officer, radiation safety committee) and are heavily impacted by outside agencies (i.e. Nuclear Regulatory Commission, State Radiologic Health, The Joint Commission (TJC), etc). This session will provide both an overview of regulatory oversight and essential compliance practices as well as practical ways to assess and introduce some of the new applications utilizing radioactive materials into your medical facility. Learning Objectives: Regulatory Compliance and Safety with New Radiotherapies: Spheres and Ra-223 (Lance Phillips) Understand the radioactive materials license amendment process to add new radiotherapies (i.e., SIR-Spheres, Therasphere, Xofigo). Understand the AU approval process for microspheres and Xofigo. Examine the training and handling requirements for new procedures. Understand the process involved with protocol development, SOP in order to define roles and responsibilities. The RSO and The RSC: Challenges and Opportunities (Colin Dimock) Understand how to form an effective Committee. Examine what the Committee does for the Program and the RSO. Understand the importance of Committee engagement. Discuss the balance of the complimentary roles of the RSO and the Committee. The Alphabet Soup of Regulatory Compliance: Being Prepared for Inspections (Linda Kroger) Recognize the various regulatory bodies and organizations with oversight or impact in Nuclear Medicine, Radiology and Radiation Oncology. Examine 10CFR35

  14. The CALYMHA survey: Lyα escape fraction and its dependence on galaxy properties at z = 2.23

    Science.gov (United States)

    Matthee, Jorryt; Sobral, David; Oteo, Iván; Best, Philip; Smail, Ian; Röttgering, Huub; Paulino-Afonso, Ana

    2016-05-01

    We present the first results from our CAlibrating LYMan α with Hα (CALYMHA) pilot survey at the Isaac Newton Telescope. We measure Lyα emission for 488 Hα selected galaxies at z = 2.23 from High-z Emission Line Survey in the COSMOS and UDS fields with a specially designed narrow-band filter (λc = 3918 Å, Δλ = 52 Å). We find 17 dual Hα-Lyα emitters [fLyα > 5 × 10-17 erg s-1 cm-2, of which five are X-ray active galactic nuclei (AGN)]. For star-forming galaxies, we find a range of Lyα escape fractions (fesc, measured with 3 arcsec apertures) from 2 to 30 per cent. These galaxies have masses from 3 × 108 M⊙ to 1011 M⊙ and dust attenuations E(B - V) = 0-0.5. Using stacking, we measure a median escape fraction of 1.6 ± 0.5 per cent (4.0 ± 1.0 per cent without correcting Hα for dust), but show that this depends on galaxy properties. The stacked fesc tends to decrease with increasing star formation rate and dust attenuation. However, at the highest masses and dust attenuations, we detect individual galaxies with fesc much higher than the typical values from stacking, indicating significant scatter in the values of fesc. Relations between fesc and UV slope are bimodal, with high fesc for either the bluest or reddest galaxies. We speculate that this bimodality and large scatter in the values of fesc is due to additional physical mechanisms such as outflows facilitating fesc for dusty/massive systems. Lyα is significantly more extended than Hα and the UV. fesc continues to increase up to at least 20 kpc (3σ, 40 kpc [2σ]) for typical star-forming galaxies and thus the aperture is the most important predictor of fesc.

  15. Do clinicians and patients agree regarding symptoms? A comparison after definitive radiochemotherapy in 223 uterine cervical cancer patients

    Energy Technology Data Exchange (ETDEWEB)

    Kirchheiner, K.; Poetter, R. [Medical Univ. Vienna (Austria). Dept. of Radiotherapy; Nout, R. [University Medical Center Leiden (Netherlands). Dept. of Clinical Oncology; Lindegaard, J. [University Hospital Aarhus (Denmark). Dept. of Oncology; Petric, P. [Institute of Oncology Ljubljana (Slovenia). Dept. of Radiotherapy; Limbergen, E.V. [University Hospital Leuven (Belgium). Dept. of Radiotherapy; Juergenliemk-Schulz, I.M. [University Medical Center Utrecht (Netherlands). Dept. of Radiation Oncology; Haie-Meder, C. [Institut Gustave-Roussy, Villejuif (France). Dept. of Radiotherapy; Doerr, W. [Technische Univ. Dresden (Germany). Dept. of Radiotherapy and Radiooncology

    2012-10-15

    Background: In clinical cancer research of morbidity, low associations between clinician-assessed toxicity/morbidity and patient-reported symptoms are consistently described in the literature. While morbidity grading systems are supposed to follow more or less objective criteria, patient reported symptoms inherently are based on a subjective self-evaluation of the impact on quality of life. The aim of this study was to focus on major discrepancies with high clinical relevance and to evaluate its impact with regard to underreporting of morbidity. Material and methods: Early morbidity assessed by clinicians with CTCAEv.3 and patient reported quality of life (EORTC-QLQ-C30/CX24) were compared regarding 12 overlapping symptoms in 223 patients with uterine cervical cancer 3 months after definitive radio(chemo)therapy in the ongoing EMBRACE study. Mismatches showing discrepancies between both grading systems were classified, if patients reported substantial symptoms (quite a bit/very much) and CTCAE grading was rated G0. Results: In total, 360 substantial symptoms were reported by patients by EORTC-QLQ; 159 (44%) of those were not recognized by CTCAE. Symptoms with the highest occurrence of mismatches overall are urinary frequency, fatigue, and insomnia. Large institutional differences were found, showing two centers with 4 vs. 71% of patients with at least one mismatch. Conclusion: Analysis of mismatches indicated a high risk of underestimation of early morbidity. Thus, nearly half of the patient-reported substantial symptoms were not recognized by CTCAE scoring (G0) 3 months after treatment. Prospective assessment of morbidity in clinical studies should, therefore, integrate patient reported symptoms to receive a complete and comprehensive picture. (orig.)

  16. MO-AB-201-01: Regulatory Compliance and Safety with New Radiotherapies: Spheres and Ra-223

    International Nuclear Information System (INIS)

    Phillips, L.

    2015-01-01

    The role of the Radiation Safety Officer at a medical facility can be complicated. The complexity of the position is based on the breadth of services provided at the institution and the nature of the radioactive materials license. Medical practices are constantly changing and the use of ionizing radiation continues to rise in this area. Some of the newer medical applications involving radiation have unique regulatory and safety issues that must be addressed. Oversight of the uses of radiation start at the local level (radiation safety officer, radiation safety committee) and are heavily impacted by outside agencies (i.e. Nuclear Regulatory Commission, State Radiologic Health, The Joint Commission (TJC), etc). This session will provide both an overview of regulatory oversight and essential compliance practices as well as practical ways to assess and introduce some of the new applications utilizing radioactive materials into your medical facility. Learning Objectives: Regulatory Compliance and Safety with New Radiotherapies: Spheres and Ra-223 (Lance Phillips) Understand the radioactive materials license amendment process to add new radiotherapies (i.e., SIR-Spheres, Therasphere, Xofigo). Understand the AU approval process for microspheres and Xofigo. Examine the training and handling requirements for new procedures. Understand the process involved with protocol development, SOP in order to define roles and responsibilities. The RSO and The RSC: Challenges and Opportunities (Colin Dimock) Understand how to form an effective Committee. Examine what the Committee does for the Program and the RSO. Understand the importance of Committee engagement. Discuss the balance of the complimentary roles of the RSO and the Committee. The Alphabet Soup of Regulatory Compliance: Being Prepared for Inspections (Linda Kroger) Recognize the various regulatory bodies and organizations with oversight or impact in Nuclear Medicine, Radiology and Radiation Oncology. Examine 10CFR35

  17. Dosimetric characterization of a 2-D array of 223 solid state detectors for daily morning checks in Tomo Therapy equipment

    International Nuclear Information System (INIS)

    Reyes S, U.; Sosa A, M.; Vega C, H. R.

    2015-10-01

    Tomo Therapy is a new technique for the cancer treatment; however, the equipment must meet nearly all mechanical and dosimetric characteristics of a conventional linear accelerator for medical use. Daily quality controls are vital to the good operation of the equipment and thus guarantee excellent quality in the daily delivery of treatments. This paper presents the procedure of the dosimetric characterization of a two-dimensional array of 223 solid state detectors, called TomoDose of the Sun Nuclear Company. Dosimetric important criteria are established to perform these checks quickly and accurately. Dosimetric tests proposed are: repeatability, linearity, dependence of Sad and SSD. Some results are compared with readings of the ionization chamber Exradim A1SL. Finally the results of 30 consecutive days are presented to establish criteria for evidence of dose, field size, symmetry and flattening of the radiation beam on Tomo Therapy equipment. Expected values for daily verification are: Dose constancy of 194.89 c Gy, σ= 1.31 c Gy, symmetry in the X axis of -0.19 %, σ=0.08 %, symmetry in the Y axis of 1.66 %, σ= 0.05 %, flattened in the X axis of 25.71 %, σ= 0.05 % and flattened in the Y axis of 6.41 %, σ= 10.23 %. Field sizes obtained were 40.45 cm in the X axis and 5.10 on the Y axis, with standard deviations of 0.02 cm and 0.01 cm, respectively. TomoDose dosimetric values, compared to the values obtained with ionization chamber, presented differences smaller than 2%. (Author)

  18. Do clinicians and patients agree regarding symptoms? A comparison after definitive radiochemotherapy in 223 uterine cervical cancer patients

    International Nuclear Information System (INIS)

    Kirchheiner, K.; Poetter, R.; Nout, R.; Lindegaard, J.; Petric, P.; Limbergen, E.V.; Juergenliemk-Schulz, I.M.; Haie-Meder, C.; Doerr, W.

    2012-01-01

    Background: In clinical cancer research of morbidity, low associations between clinician-assessed toxicity/morbidity and patient-reported symptoms are consistently described in the literature. While morbidity grading systems are supposed to follow more or less objective criteria, patient reported symptoms inherently are based on a subjective self-evaluation of the impact on quality of life. The aim of this study was to focus on major discrepancies with high clinical relevance and to evaluate its impact with regard to underreporting of morbidity. Material and methods: Early morbidity assessed by clinicians with CTCAEv.3 and patient reported quality of life (EORTC-QLQ-C30/CX24) were compared regarding 12 overlapping symptoms in 223 patients with uterine cervical cancer 3 months after definitive radio(chemo)therapy in the ongoing EMBRACE study. Mismatches showing discrepancies between both grading systems were classified, if patients reported substantial symptoms (quite a bit/very much) and CTCAE grading was rated G0. Results: In total, 360 substantial symptoms were reported by patients by EORTC-QLQ; 159 (44%) of those were not recognized by CTCAE. Symptoms with the highest occurrence of mismatches overall are urinary frequency, fatigue, and insomnia. Large institutional differences were found, showing two centers with 4 vs. 71% of patients with at least one mismatch. Conclusion: Analysis of mismatches indicated a high risk of underestimation of early morbidity. Thus, nearly half of the patient-reported substantial symptoms were not recognized by CTCAE scoring (G0) 3 months after treatment. Prospective assessment of morbidity in clinical studies should, therefore, integrate patient reported symptoms to receive a complete and comprehensive picture. (orig.)

  19. Post-traumatic stress symptoms and post-traumatic growth in 223 childhood cancer survivors: predictive risk factors

    Directory of Open Access Journals (Sweden)

    Marta eTremolada

    2016-02-01

    Full Text Available With modern therapies and supportive care, survival rates of childhood cancer have increased considerably. However, there are long-term psychological sequelae of these treatments that may not manifest until pediatric survivors are into adulthood. The prevalence of post-traumatic stress disorder (PTSD in young adult survivors of childhood cancer ranges from 6.2% to 22%; associated risk factors are young age at the assessment, female gender, low education level and some disease-related factors. The aim of this study was to investigate, in adolescent and young adult (AYA survivors of childhood cancer, the incidence and severity of post-traumatic stress symptoms (PTSS, and to identify the risk factors and the associated post-traumatic growth (PTG index.Participants were 223 AYA cancer survivors recruited during follow-up visits in the Oncohematology Clinic of the Department of Child and Woman’s Health, University of Padua. Data were collected from self-report questionnaires on PTSS incidence, PTG mean score, perceived social support, and medical and socio-demographic factors. Ex-patients’ mean age at the assessment was 19.33 years (SD = 3.01, 15-25, 123 males and 100 females, with a mean of years off-therapy of 9.64 (SD=4.17. Most (52.5% had survived an hematological disorder and 47.5% a solid tumor when they were aged, on average, 8.02 years (SD=4.40.The main results indicated a moderate presence of clinical (≥9 symptoms: 9.4% and sub-clinical PTSS (6-8 symptoms: 11.2%, with the avoidance criterion most often encountered. Re-experience symptoms and PTG mean score were significantly associated (r=0.24 p=0.0001. A hierarchical regression model (R2 = 0.08; F = 1.46; p = 0.05 identified female gender (β = 0.16; p = 0.05 and less perceived social support (β = -0.43; p = 0.05 as risk factors to developing PTSS. Another hierarchical regression model assessed the possible predictors of the PTG total score (R2 = 0.36; F = 9.1; p = 0.0001, with

  20. A meta-analysis of associations of LEPR Q223R and K109R polymorphisms with Type 2 diabetes risk

    Science.gov (United States)

    Yang, Yunzhong

    2018-01-01

    Background Leptin receptor (LEPR) plays a pivotal role in the control of body weight, energy metabolism, and insulin sensitivity. Various genetic association studies were performed to evaluate associations of LEPR genetic variants with type 2 diabetes (T2D) susceptibility. Methods A comprehensive search was conducted to identify all eligible case-control studies for examining the associations of LEPR single nucleotide polymorphisms (SNPs) Q223R (rs1137101) and K109R (rs1137100) with T2D risk. Odds ratios (OR) and corresponding 95% confidence intervals (CIs) were used to measure the magnitudes of association. Results For Q223R, 13 studies (11 articles) consisting of a total of 4030 cases and 2844 controls, and for K109R 7 studies (7 articles) consisting of 3319 cases and 2465 controls were available. Under an allele model, Q223R was not significantly associated with T2D risk (OR = 1.09, 95% CI: 0.80–1.48, P-value = 0.5989), which was consistent with results obtained under four genotypic models (ranges: ORs 1.08–1.20, 95% CIs: 0.58–2.02 to 0.64–2.26; P-values, 0.3650–0.8177, which all exceeded multiplicity-adjusted α = 0.05/5 = 0.01). In addition, no significant association was found between K109R and T2D risk based on either an allele model (OR = 0.93, 95% CI: 0.85–1.03, P-value = 0.1868) or four genotypic models (ranges: ORs 0.81–0.99, 95% CIs: 0.67–0.86 to 0.97–1.26, P-values, 0.0207–0.8804 which all exceeded multiplicity-adjusted α of 0.01). The magnitudes of association for these two SNPs were not dramatically changed in subgroup analyses by ethnicity or sensitivity analyses. Funnel plot inspections as well as Begg and Mazumdar adjusted rank correlation test and Egger linear regression test did not reveal significant publication biases in main and subgroup analyses. Bioinformatics analysis predicted that both missense SNPs were functionally neutral and benign. Conclusions The present meta-analysis did not detect significant genetic

  1. Reflections on the therapeutic use of {sup 223}RaCl{sub 2} for bone metastases resulting from prostate cancer resistant to castration; Reflexiones sobre el uso terapeutico de {sup 223}RaCl{sub 2} para metastasis osea derivada de cancer de prostata resistente a la castracion

    Energy Technology Data Exchange (ETDEWEB)

    Astudillo V, A. J.; Paredes G, L., E-mail: armando.astudillo@inin.gob.mx [ININ, Carretera Mexico-Toluca s/n, 52750 Ocoyoacac, Estado de Mexico (Mexico)

    2015-10-15

    In January 2014 the Comision Federal para la Proteccion contra Riesgos Sanitarios of the Ministry of Health in Mexico, authorize the use of {sup 223}RaCl{sub 2} as the first radiopharmaceutical emitter α for therapeutic purposes in cases of bone metastases resulting from prostate cancer resistant to castration. The paper analyzes the main variables that affect the metrological traceability using activity meters to evaluate the gamma activity of {sup 223}RaCl{sub 2} in hospitals, because it has a chain of complex decay with alpha, beta and gamma emitters, so was important to verify if a gamma activity measurement for a multiple emitter is reliable to determine the total alpha absorbed dose to bone in a patient. (Author)

  2. Preparation and luminescence properties of Eu2+-doped CaSi2O2-dN2+2/3d phosphors

    International Nuclear Information System (INIS)

    Gu Yunxin; Zhang Qinghong; Wang Hongzhi; Li Yaogang

    2009-01-01

    Eu 2+ -doped CaSi 2 O 2-d N 2+2/3d phosphors for white LED lamps were prepared by solid-state reaction, and the effects of heat-treatment conditions and the overall composition of host lattice on the optical properties have been discussed. Eu 2+ -doped CaSi 2 O 2-d N 2+2/3d displayed a single broad emission band peak at 540 nm, which could be assigned to the allowed transition of Eu 2+ from the lowest crystal field component of 4f 6 5d to 4f 7 ground-state level. The excitation band of samples, extending from UV to blue, is extremely wide, so the phosphors are suitable for white LED lamps in combination with a UV or blue LED dies. The highest PL intensity is found for the sample sintered at 1400 0 C. Moreover, the emission intensity decreases when N partially replaces O. A red shift of emission wavelength did not occur with increasing of the N content.

  3. B-Cell Chronic Lymphocytic Leukemia with 11q22.3 Rearrangement in Patient with Chronic Myeloid Leukemia Treated with Imatinib

    Directory of Open Access Journals (Sweden)

    Krzysztof Lewandowski

    2016-01-01

    Full Text Available The coexistence of two diseases chronic myeloid leukemia (CML and B-cell chronic lymphocytic leukemia (B-CLL is a rare phenomenon. Both neoplastic disorders have several common epidemiological denominators (they occur more often in men over 50 years of age but different origin and long term prognosis. In this paper we described the clinical and pathological findings in patient with CML in major molecular response who developed B-CLL with 11q22.3 rearrangement and Coombs positive hemolytic anemia during the imatinib treatment. Due to the presence of the symptoms of autoimmune hemolytic anemia and optimal CML response to the imatinib treatment, the decision about combined therapy with prednisone and imatinib was made. During the follow-up, the normalization of complete blood count and resolution of peripheral lymphadenopathy were noted. The hematologic response of B-CLL was diagnosed. The repeated FISH analysis of cultured peripheral blood lymphocytes showed 2% of cells carrying 11q22.3 rearrangement. At the same time, molecular monitoring confirmed the deep molecular response of CML. The effectiveness of such combination in the described case raises the question about the best therapeutic option in such situation, especially in patients with good imatinib tolerance and optimal response.

  4. Corrigendum to “Multi-modal Fission in Collinear Ternary Cluster decay of 252Cf(sf,fff” [Phys. Lett. B 746 (2015 223

    Directory of Open Access Journals (Sweden)

    W. von Oertzen

    2017-02-01

    Full Text Available The scale of the ordinate axis of Fig. 4 on page 226 of PLB 746 (2015 223 was incorrect. The new version of Fig. 4 (which is “Fig. 1” in the present note with the correct ordinate axis is given here (upper part. The lower part shows the previous version. Five potential wells and barriers are shown. Considering a sequential process, two barriers are relevant for the sequential decay, with equal barriers for the symmetric cases with a smaller fragment at the center (in these cases only one barrier is shown. For the asymmetric case of 70Ni + 50Ca + 132Sn, two different barriers appear, denoted as (B1 and (B2, which correspond to the interactions of the middle cluster 50Ca with the outer nuclei 70Ni and 132Sn, respectively. In a sequential mechanism the separation of 132Sn from the other part via the barrier B2 has the smaller height, thus it is favored for the first step. For the second step the barrier (B1 between Ni and Ca, appears at smaller distances (dot-dashed curve and is higher. The order of the barriers of the five channels is unchanged, compared to the figure in Ref. W. von Oertzen et al., Phys. Lett. B 746 (2015 223.

  5. Concurrent Supermassive Black Hole and Galazy Growth: Linking Environment and Nuclear Activity in Zeta Equals 2.23 H Alpha Emitters

    Science.gov (United States)

    Lehmer, B. D.; Lucy, A. B.; Alexander, D. M.; Best, P. N.; Geach, J. E.; Harrison, C. M.; Hornschemeier, A. E.; Matsuda, Y.; Mullaney, J. R.; Smail, Ian; hide

    2013-01-01

    We present results from an approximately equal 100 ks Chandra observation of the 2QZ Cluster 1004+00 structure at z = 2.23 (hereafter 2QZ Clus). 2QZ Clus was originally identified as an overdensity of four optically-selected QSOs at z = 2.23 within a 15 × 15 arcmin square region. Narrow-band imaging in the near-IR (within the K band) revealed that the structure contains an additional overdensity of 22 z = 2.23 H alpha-emitting galaxies (HAEs), resulting in 23 unique z = 2.23 HAEs/QSOs (22 within the Chandra field of view). Our Chandra observations reveal that three HAEs in addition to the four QSOs harbor powerfully accreting supermassive black holes (SMBHs), with 2-10 keV luminosities of approximately equal (8-60) × 10(exp 43) erg s(exp-1) and X-ray spectral slopes consistent with unobscured active galactic nucleus (AGN). Using a large comparison sample of 210 z = 2.23 HAEs in the Chandra-COSMOS field (C-COSMOS), we find suggestive evidence that the AGN fraction increases with local HAE galaxy density. The 2QZ Clus HAEs reside in a moderately overdense environment (a factor of approximately equal 2 times over the field), and after excluding optically-selected QSOs, we find that the AGN fraction is a factor of approximately equal 3.5(+3.8/ -2.2) times higher than C-COSMOS HAEs in similar environments. Using stacking analyses of the Chandra data and Herschel SPIRE observations at 250micrometers, we respectively estimate mean SMBH accretion rates ( M(BH)) and star formation rates (SFRs) for the 2QZ Clus and C-COSMOS samples. We find that the mean 2QZ Clus HAE stacked X-ray luminosity is QSO-like (L(2-10 keV) approximately equal [6-10] × 10(exp 43) erg s(exp -1)), and the implied M(BH)/SFR approximately equal (1.6-3.2) × 10(exp -3) is broadly consistent with the local M(BH)/Stellar Mass relation and z approximately equal 2 X-ray selected AGN. In contrast, the C-COSMOS HAEs are on average an order of magnitude less X-ray luminous and have M(BH)/SFR approximately

  6. The effect of dimethyl sulfoxide on the induction of DNA strand breaks in plasmid DNA and colony formation of PC Cl3 mammalian cells by alpha-, beta-, and Auger electron emitters (223)Ra, (188)Re, and (99m)Tc.

    Science.gov (United States)

    Runge, Roswitha; Oehme, Liane; Kotzerke, Jörg; Freudenberg, Robert

    2016-12-01

    DNA damage occurs as a consequence of both direct and indirect effects of ionizing radiation. The severity of DNA damage depends on the physical characteristics of the radiation quality, e.g., the linear energy transfer (LET). There are still contrary findings regarding direct or indirect interactions of high-LET emitters with DNA. Our aim is to determine DNA damage and the effect on cellular survival induced by (223)Ra compared to (188)Re and (99m)Tc modulated by the radical scavenger dimethyl sulfoxide (DMSO). Radioactive solutions of (223)Ra, (188)Re, or (99m)Tc were added to either plasmid DNA or to PC Cl3 cells in the absence or presence of DMSO. Following irradiation, single strand breaks (SSB) and double strand breaks (DSB) in plasmid DNA were analyzed by gel electrophoresis. To determine the radiosensitivity of the rat thyroid cell line (PC Cl3), survival curves were performed using the colony formation assay. Exposure to 120 Gy of (223)Ra, (188)Re, or (99m)Tc leads to maximal yields of SSB (80 %) in plasmid DNA. Irradiation with 540 Gy (223)Ra and 500 Gy (188)Re or (99m)Tc induced 40, 28, and 64 % linear plasmid conformations, respectively. DMSO prevented the SSB and DSB in a similar way for all radionuclides. However, with the α-emitter (223)Ra, a low level of DSB could not be prevented by DMSO. Irradiation of PC Cl3 cells with (223)Ra, (188)Re, and (99m)Tc pre-incubated with DMSO revealed enhanced survival fractions (SF) in comparison to treatment without DMSO. Protection factors (PF) were calculated using the fitted survival curves. These factors are 1.23 ± 0.04, 1.20 ± 0.19, and 1.34 ± 0.05 for (223)Ra, (188)Re, and (99m)Tc, respectively. For (223)Ra, as well as for (188)Re and (99m)Tc, dose-dependent radiation effects were found applicable for plasmid DNA and PC Cl3 cells. The radioprotection by DMSO was in the same range for high- and low-LET emitter. Overall, the results indicate the contribution of mainly indirect radiation

  7. Luminescence of a new class of UV-blue-emitting phosphors MSi2O2-deltaN2+2/3delta:Ce3+ (M = Ca, Sr, Ba)

    NARCIS (Netherlands)

    Li, Y.Q.; With, de G.; Hintzen, H.T.J.M.

    2005-01-01

    The luminescence properties of Ce3+,Na+-codoped MSi2O22dN2+2/3d (M 5 Ca, Sr, Ba) are reported. The undoped and Ce3+,Na+-codoped MSi2O22dN2+2/3d powders were prepared by a solid-state reaction at temperatures between 1300–1400 uC under N2–H2 (10%) atmosphere in the system MO–SiO2–Si3N4 (M 5 Ca, Sr,

  8. ONKALO pose experiment. Geophysical logging and imaging of drillholes ONK-PP223, ONK-PP226, ONK-PP254 and ONK-PP259...261

    International Nuclear Information System (INIS)

    Tarvainen, A.-M.

    2011-08-01

    Suomen Malmi Oy conducted geophysical drillhole logging as well as optical and acoustic imaging of shallow drillholes ONK-PP223, ONK-PP226, ONK-PP254, ONKPP259, ONK-PP260 and ONK-PP261 at ONKALO in the investigation niche ONKTKU- 3 (POSE) between December 2009 and June 2010. The survey is a part of Posiva Oy's detailed investigation program for the final disposal of spent nuclear fuel. The assignment included the field work and data processing. The report describes field operation, equipment as well as processing procedures and shows the obtained results and an analysis of their quality in the appendices. The raw and processed data are delivered digitally in WellCAD, PDF and Excel format. (orig.)

  9. Complex Interaction of Hb Q-Thailand (HBA1: c.223G>C) with β-Thalassemia/Hb E (HBB: c.79G>A) Disease.

    Science.gov (United States)

    Panyasai, Sitthichai; Satthakarn, Surada; Pornprasert, Sakorn

    2018-01-01

    Hb Q-Thailand [α74(EF3)Asp→His (α1), GAC>CAC, HBA1: c.223G>C] is an abnormal hemoglobin (Hb) frequently found in Thailand and Southeast Asian countries. The association of the α Q-Thailand allele with other globin gene disorders has important implications in diagnosis. Here, we report how to diagnose the coinheritance of Hb Q-Thailand with β-thalassemia (β-thal)/Hb E disease in four Thai samples from high performance liquid chromatography (HPLC) and capillary electrophoresis (CE) testing results. Understanding of the HPLC chromatogram and CE electropherogram patterns of this complex mutation is important for interpretation of testing results and providing genetic counseling.

  10. Discovery and Monitoring of a New Black Hole Candidate XTE J1752-223 with RXTE: RMS Spectrum Evolution, BH Mass and the Source Distance

    Science.gov (United States)

    Shaposhinikov, Nikolai; Markwardt, Craig; Swank, Jean; Krimm, Hans

    2010-01-01

    We report on the discovery and monitoring observations of a new galactic black hole candidate XTE J1752-223 by Rossi X-ray Timing Explorer (RXTE). The new source appeared on the X-ray sky on October 21 2009 and was active for almost 8 months. Phenomenologically, the source exhibited the low-hard/highsoft spectral state bi-modality and the variability evolution during the state transition that matches standard behavior expected from a stellar mass black hole binary. We model the energy spectrum throughout the outburst using a generic Comptonization model assuming that part of the input soft radiation in the form of a black body spectrum gets reprocessed in the Comptonizing medium. We follow the evolution of fractional root-mean-square (RMS) variability in the RXTE/PCA energy band with the source spectral state and conclude that broad band variability is strongly correlated with the source hardness (or Comptonized fraction). We follow changes in the energy distribution of rms variability during the low-hard state and the state transition and find further evidence that variable emission is strongly concentrated in the power-law spectral component. We discuss the implication of our results to the Comptonization regimes during different spectral states. Correlations of spectral and variability properties provide measurements of the BH mass and distance to the source. The spectral-timing correlation scaling technique applied to the RXTE observations during the hardto- soft state transition indicates a mass of the BH in XTE J1752-223 between 8 and 11 solar masses and a distance to the source about 3.5 kiloparsec.

  11. Final Report for grant entitled "Production of Astatine-211 for U.S. Investigators"

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, Daniel Scott

    2012-12-12

    Alpha-particle emitting radionuclides hold great promise in the therapy of cancer, but few alpha-emitters are available to investigators to evaluate. Of the alpha-emitters that have properties amenable for use in humans, 211At is of particular interest as it does not have alpha-emitting daughter radionuclides. Thus, there is a high interest in having a source of 211At for sale to investigators in the US. Production of 211At is accomplished on a cyclotron using an alpha-particle beam irradiation of bismuth metal. Unfortunately, there are few cyclotrons available that can produce an alpha particle beam for that production. The University of Washington has a cyclotron, one of three in the U.S., that is currently producing 211At. In the proposed studies, the things necessary for production and shipment of 211At to other investigators will be put into place at UW. Of major importance is the efficient production and isolation of 211At in a form that can be readily used by other investigators. In the studies, production of 211At on the UW cyclotron will be optimized by determining the best beam energy and the highest beam current to maximize 211At production. As it would be very difficult for most investigators to isolate the 211At from the irradiated target, the 211At-isolation process will be optimized and automated to more safely and efficiently obtain the 211At for shipment. Additional tasks to make the 211At available for distribution include obtaining appropriate shipping vials and containers, putting into place the requisite standard operating procedures for Radiation Safety compliance at the levels of 211At activity to be produced / shipped, and working with the Department of Energy, Isotope Development and Production for Research and Applications Program, to take orders, make shipments and be reimbursed for costs of production and shipment.

  12. Reaction of aromatic diazonium salts with carrier-free radioiodine and astatine, evidence for complex formation

    International Nuclear Information System (INIS)

    Meyer, G.J.; Roessler, K.; Stoecklin, G.

    1979-01-01

    Systematic studies of the astatodiazoniation reaction and a comparison with iododediazoniation under comparable conditions are reported. The yields for all astatohalobenzenes and -toluenes were nearly constant and unaffected by the nature of the diazonium compound, its isomeric form, and the number of isomers used at the same time. Only astatofluorobenzenes were obtained at higher yields. An electron-transfer mechanism is proposed for dediazoniation at these low halide concentration levels. At sufficient thermal excitation levels the electron transfer leads to the dissociation of nitrogen, while the phenyl and halogen radicals recombine. The isomer distribution found for some of the derivatives from dediazoniation may also be due to steric effects

  13. Astatine-211-labeled biotin conjugates resistant to biotinidase for use in pretargeted radioimmunotherapy

    International Nuclear Information System (INIS)

    Foulon, Catherine F.; Alston, Kevin L.; Zalutsky, Michael R.

    1998-01-01

    We report herein the preparation and biological evaluation of two radioastatinated biotin conjugates, (3-[ 211 At]astatobenzoyl)norbiotinamide and ((5-[ 211 At]astato-3-pyridinyl)carbonyl)norbiotinamide. Both conjugates were stable in the presence of human serum and cerebrospinal fluid as well as murine serum, indicating a resistance to degradation to biotinidase. The normal tissue clearance of (3-[ 211 At]astatobenzoyl)norbiotinamide and ((5-[ 211 At]astato-3-pyridinyl)carbonyl)norbiotinamide was rapid, as observed previously with their iodo analogues. Also reported are the first syntheses of N-succinimidyl 5-[ 211 At]astato-3-pyridinecarboxylate and 3-[ 211 At]astatoaniline, two reagents of potential utility for labeling proteins and peptides with 211 At

  14. Microdosimetry of astatine-211 and comparison with that of iodine-125

    International Nuclear Information System (INIS)

    Unak, T.

    2001-01-01

    211 At is an alpha and Auger emitter radionuclide and has been frequently used for labeling of different kind of chemical agents. 125 I is also known as an effective Auger emitter. The radionuclides which emit short range and high LET radiations such as alpha particles and Auger electrons have high radiotoxic effectiveness on the living systems. The microdosimetric data are suitable to clarify the real radiotoxic effectiveness and to get the detail of diagnostic and therapeutic application principles of these radionuclides. In this study, the energy and dose absorptions by cell nucleus from alpha particles and Auger electrons emitted by 211 At have been calculated using a Monte Carlo calculation program (code: UNMOC). For these calculations two different model corresponding to the cell nucleus have been used and the data obtained were compared with the data earlier obtained for 125 I. As a result, the radiotoxicity of 211 At is in the competition with 125 I. In the case of a specific agent labelled with 211 At or 125 I is incorporated into the cell or cell nucleus, but non-bound to DNA or not found very close to it, 211 At should considerably be much more radiotoxic than 125 I, but in the case of the labelled agent is bound to DNA or take a place very close to it, the radiotoxicity of 125 I should considerably be higher than 211 At. (author)

  15. Evaluation of Novel Wet Chemistry Separation and Purification Methods to Facilitate Automation of Astatine-211 Isolation

    International Nuclear Information System (INIS)

    Wilbur, Daniel Scott

    2016-01-01

    This research is a collaborative effort between the research groups of the PIs, Dr. D. Scott Wilbur in the Department of Radiation Oncology at the University of Washington (UW) and Matthew O'Hara at the Pacific Northwest National Laboratory (PNNL). In this report only those studies conducted at UW and the budget information from UW will be reported. A separate progress and financial report will be provided by PNNL. This final report outlines the experiments (Tasks) conducted and results obtained at UW from July 1, 2013 thru June 30, 2016 (2-year project with 1 year no-cost extension). The report divides the information on the experiments and results obtained into the 5 specific objectives of the research efforts and the Tasks within those objectives. This format is used so that it is easy to see what has been accomplished in each area. A brief summary of the major findings from the studies is provided below. Summary of Major Findings from Research/Training Activities at UW: Anion and cation exchange columns did not provide adequate 211 At capture and/or extraction results under conditions studied to warrant further evaluation; PEG-Merrifield resins containing mPEG350, mPEG750, mPEG2000 and mPEG5000 were synthesized and evaluated; All of the mPEG resins with different sized mPEG moieties conjugated gave similar 211 At capture (>95%) from 8M HCl solutions and release with conc. NH 4 OH (~50-80%), but very low quantities were released when NaOH was used as an eluent; Capture and release of 211 At when loading [ 211 At]astatate appeared to be similar to that of [ 211 At]astatide on PEG columns, but further studies need to be conducted to confirm that; Capture of 211 At on PEG columns was lower (e.g. 80-90%) from solutions of 8M HNO 3 , but higher capture rates (e.g. 99%) can be obtained when 10M HNO 3 is mixed with an equal quantity of 8M HCl; Addition of reductants to the 211 At solutions did not appear to change the percent capture, but may have an effect on the % extracted; There was some indication that the PEG-Merrifield resins could be saturated (perhaps with Bi) resulting in lower capture percentages, but more studies need to be done to confirm that; A target dissolution chamber, designed and built at PNNL, works well with syringe pumps so it can be used in an automated system; Preliminary semi-automated 211 At isolation studies have been conducted with full-scale target dissolution and 211 At isolation using a PEG column on the Hamilton automated system gave low overall recoveries, but HNO 3 was used (rather than HCl) for loading the 211 At and flow rates were not optimized; Results obtained using PEG columns are high enough to warrant further development on a fully automated system; Results obtained also indicate that additional studies are warranted to evaluate other types of columns for 211 At separation from bismuth, which allow use of HNO 3 /HCl mixtures for loading and NaOH for eluting 211 At. Such a column could greatly simplify the overall isolation process and make it easier to automate.

  16. The potential of 211Astatine for NIS-mediated radionuclide therapy in prostate cancer

    International Nuclear Information System (INIS)

    Willhauck, Michael J.; Sharif Samani, Bibi-Rana; Goeke, Burkhard; Wolf, Ingo; Senekowitsch-Schmidtke, Reingard; Stark, Hans-Juergen; Meyer, Geerd J.; Knapp, Wolfram H.; Morris, John C.; Spitzweg, Christine

    2008-01-01

    We reported recently the induction of selective iodide uptake in prostate cancer cells (LNCaP) by prostate-specific antigen (PSA) promoter-directed sodium iodide symporter (NIS) expression that allowed a significant therapeutic effect of 131 I. In the current study, we studied the potential of the high-energy alpha-emitter 211 At, also transported by NIS, as an alternative radionuclide after NIS gene transfer in tumors with limited therapeutic efficacy of 131 I due to rapid iodide efflux. We investigated uptake and therapeutic efficacy of 211 At in LNCaP cells stably expressing NIS under the control of the PSA promoter (NP-1) in vitro and in vivo. NP-1 cells concentrated 211 At in a perchlorate-sensitive manner, which allowed a dramatic therapeutic effect in vitro. After intrapertoneal injection of 211 At (1 MBq), NP-1 tumors accumulated approximately 16% ID/g 211 At (effective half-life 4.6 h), which resulted in a tumor-absorbed dose of 1,580 ± 345 mGy/MBq and a significant tumor volume reduction of up to 82 ± 19%, while control tumors continued their growth exponentially. A significant therapeutic effect of 211 At has been demonstrated in prostate cancer after PSA promoter-directed NIS gene transfer in vitro and in vivo suggesting a potential role for 211 At as an attractive alternative radioisotope for NIS-targeted radionuclide therapy, in particular in smaller tumors with limited radionuclide retention time. (orig.)

  17. Sci-Thur AM: YIS – 01: New technologies for astatine-211 targeted alpha therapy research

    Energy Technology Data Exchange (ETDEWEB)

    Crawford, Jason; Yang, Hua; Schaffer, Paul; Ruth, Thomas [University of Victoria, Victoria, BC (Canada); TRIUMF, Vancouver, BC (Canada)

    2016-08-15

    Purpose: The short-range, densely ionizing α-particles emitted by {sup 211}At (t{sub 1/2}=7.2h) are well suited for the treatment of diffuse microscopic disease, using cancer targeting biomolecules. {sup 211}At availability is limited by the rarity of α-cyclotrons required for standard production. Image-based dosimetry is also limited for {sup 211}At, which emits low intensity X-rays. Our goal was to leverage state-of-the-art infrastructure at TRIUMF to produce and evaluate two related isotopes, {sup 211}Rn (t{sub 1/2}=14.6h, 73% decay to {sup 211}At) as a generator for {sup 211}At, and {sup 209}At (t{sub 1/2}=5.4h, X-ray/gamma-ray emitter) as a novel 211At surrogate for preclinical imaging studies. Methods: Produced by spallation of uranium with 480 MeV protons, mass separated ion beams of short-lived francium isotopes were implanted into NaCl targets where {sup 211}Rn or {sup 209}At were produced by radioactive decay, in situ. {sup 211}Rn was transferred to dodecane from which {sup 211}At was efficiently extracted and evaluated for clinical applicability. High energy SPECT/CT was evaluated for measuring {sup 209}At activity distributions in mice and phantoms. Results: Our small scale {sup 211}Rn/{sup 211}At generator system provided high purity {sup 211}At samples. The methods are immediately scalable to the level of radioactivity required for in vivo experiments with {sup 211}At. {sup 209}At-based high energy SPECT imaging was determined suitable for pursuing image-based dosimetry in mouse tumour models. In the future, we will utilize quantitative {sup 209}At-SPECT for image-based dose calculations. Conclusion: These early studies provided a foundation for future endeavours with {sup 211}At-based α-therapy. Canada is now significantly closer to clinical targeted α-therapy of cancer.

  18. Targeted radionuclide therapy with astatine-211: Oxidative dehalogenation of astatobenzoate conjugates.

    Science.gov (United States)

    Teze, David; Sergentu, Dumitru-Claudiu; Kalichuk, Valentina; Barbet, Jacques; Deniaud, David; Galland, Nicolas; Maurice, Rémi; Montavon, Gilles

    2017-05-31

    211 At is a most promising radionuclide for targeted alpha therapy. However, its limited availability and poorly known basic chemistry hamper its use. Based on the analogy with iodine, labelling is performed via astatobenzoate conjugates, but in vivo deastatination occurs, particularly when the conjugates are internalized in cells. Actually, the chemical or biological mechanism responsible for deastatination is unknown. In this work, we show that the C-At "organometalloid" bond can be cleaved by oxidative dehalogenation induced by oxidants such as permanganates, peroxides or hydroxyl radicals. Quantum mechanical calculations demonstrate that astatobenzoates are more sensitive to oxidation than iodobenzoates, and the oxidative deastatination rate is estimated to be about 6 × 10 6 faster at 37 °C than the oxidative deiodination one. Therefore, we attribute the "internal" deastatination mechanism to oxidative dehalogenation in biological compartments, in particular lysosomes.

  19. Production of Astatine-211 at the Duke University Medical Center for its regional distribution

    Energy Technology Data Exchange (ETDEWEB)

    Zalutsky, Michael [Duke University Medical Center, Durham, NC (United States)

    2016-01-01

    Systemic targeted radiation therapy and radioimmunotherapy continue to be important tools in the treatment of certain cancers. Because of their high energy and short path length, alpha particle emitters such as 211At are more effective than either external beam x- ray or in vivo beta radiation in delivering potentially curative doses of radiation. The limited clinical trials that have been conducted to date have yielded encouraging responses in some patients, e.g., malignant brain tumors. In order to escalate the additional necessary research and development in radiochemistry, radiobiology and efficacy evaluation of alpha particle radiotherapeutics, it is universally agreed that access to an affordable, reliable supply of 211At is warranted. In conjunction with the Department of Energy's intent to enhance stable and radioactive isotope availability for research applications, it is the primary objective of this project to improve 211At production and purification capabilities at Duke so that this radionuclide can be supplied to researchers at other institutions throughout the US.The most widely used 211At production method involves the α,2n reaction on Bismuth using a cyclotron with beams ≤ 28 MeV. Yields can be enhanced with use of an internal target that allows for a higher alpha fluence plus efficient heat dissipation in the target. Both of these items are in place at Duke; however, in order to support production for multi-institutional use, irradiation campaigns in excess of 50 µAp and four hours duration will be needed. Further, post-irradiation processing equipment is lacking that will enable the distribution process. Financial support is sought for i) a shielded, ventilated processing/containment hood; ii) development of a post-irradiation target retrieval system; iii) fabrication of a 211At distillation and recovery module and iv) a performance review and, where needed, an enhancement of seven major subsystems that comprise the CS-30 Cyclotron. With these modifications in place, routine production of ≥200 mCi of At-211 should be readily achievable, given our methodological development of At-211 target preparation, internal target irradiation and dry distillation to recover the radionuclide.

  20. Use of interhalogen exchange for preparation of astatine-benzene and iodo-benzene

    International Nuclear Information System (INIS)

    Kolachkovski, A.; Khalkin, V.A.

    1976-01-01

    Experimental testing of interhalogen exchange between the solid and liquid phases has been carried out at 155 deg C with particular reference to a NaOH-Na 131 I-BrPh system. Iodine transition rate is dependent on the process duration and alkali amount. The relative amounts of 131 IPh resultant from the reaction of interhalogen exchange is evaluated by paper chromatography. The results obtained may be considered as those which provide experimental support for the assumed efficiency of the production of 131 IPh based on the reaction of interhalogen exchange to yield 70-80% 131 IPh

  1. Preparation and evaluation of an astatine-211-labeled sigma receptor ligand for alpha radionuclide therapy

    International Nuclear Information System (INIS)

    Ogawa, Kazuma; Mizuno, Yoshiaki; Washiyama, Kohshin; Shiba, Kazuhiro; Takahashi, Naruto; Kozaka, Takashi; Watanabe, Shigeki; Shinohara, Atsushi; Odani, Akira

    2015-01-01

    Introduction: Sigma receptors are overexpressed in a variety of human tumors, making them potential targets for radionuclide receptor therapy. We have previously synthesized and evaluated 131 I-labeled (+)-2-[4-(4-iodophenyl)piperidino]cyclohexanol [(+)-[ 131 I]pIV], which has a high affinity for sigma receptors. Therefore, (+)-[ 131 I]pIV significantly inhibited tumor cell proliferation in tumor-bearing mice. In the present study, we report the synthesis and the in vitro and in vivo characterization of (+)-[ 211 At]pAtV, an 211 At-labeled sigma receptor ligand, that has potential use in alpha-radionuclide receptor therapy. Methods: The radiolabeled sigma receptor ligand (+)-[ 211 At]pAtV was prepared using a standard halogenation reaction generating a 91% radiochemical yield with 98% purity after HPLC purification. The partition coefficient of (+)-[ 211 At]pAtV was measured. Cellular uptake experiments and in vivo biodistribution experiments were performed using a mixed solution of (+)-[ 211 At]pAtV and (+)-[ 125 I]pIV; the human prostate cancer cell line DU-145, which expresses high levels of the sigma receptors, and DU-145 tumor-bearing mice. Results: The lipophilicity of (+)-[ 211 At]pAtV was similar to that of (+)-[ 125 I]pIV. DU-145 cellular uptake and the biodistribution patterns in DU-145 tumor-bearing mice at 1 h post-injection were also similar between (+)-[ 211 At]pAtV and (+)-[ 125 I]pIV. Namely, (+)-[ 211 At]pAtV demonstrated high uptake and retention in tumor via binding to sigma receptors. Conclusion: These results indicate that (+)-[ 211 At]pAtV could function as an new agent for alpha-radionuclide receptor therapy.

  2. Preparation and evaluation of an astatine-211-labeled sigma receptor ligand for alpha radionuclide therapy.

    Science.gov (United States)

    Ogawa, Kazuma; Mizuno, Yoshiaki; Washiyama, Kohshin; Shiba, Kazuhiro; Takahashi, Naruto; Kozaka, Takashi; Watanabe, Shigeki; Shinohara, Atsushi; Odani, Akira

    2015-11-01

    Sigma receptors are overexpressed in a variety of human tumors, making them potential targets for radionuclide receptor therapy. We have previously synthesized and evaluated (131)I-labeled (+)-2-[4-(4-iodophenyl)piperidino]cyclohexanol [(+)-[(131)I]pIV], which has a high affinity for sigma receptors. Therefore, (+)-[(131)I]pIV significantly inhibited tumor cell proliferation in tumor-bearing mice. In the present study, we report the synthesis and the in vitro and in vivo characterization of (+)-[(211)At]pAtV, an (211)At-labeled sigma receptor ligand, that has potential use in alpha-radionuclide receptor therapy. The radiolabeled sigma receptor ligand (+)-[(211)At]pAtV was prepared using a standard halogenation reaction generating a 91% radiochemical yield with 98% purity after HPLC purification. The partition coefficient of (+)-[(211)At]pAtV was measured. Cellular uptake experiments and in vivo biodistribution experiments were performed using a mixed solution of (+)-[(211)At]pAtV and (+)-[(125)I]pIV; the human prostate cancer cell line DU-145, which expresses high levels of the sigma receptors, and DU-145 tumor-bearing mice. The lipophilicity of (+)-[(211)At]pAtV was similar to that of (+)-[(125)I]pIV. DU-145 cellular uptake and the biodistribution patterns in DU-145 tumor-bearing mice at 1h post-injection were also similar between (+)-[(211)At]pAtV and (+)-[(125)I]pIV. Namely, (+)-[(211)At]pAtV demonstrated high uptake and retention in tumor via binding to sigma receptors. These results indicate that (+)-[(211)At]pAtV could function as an new agent for alpha-radionuclide receptor therapy. Copyright © 2015 Elsevier Inc. All rights reserved.

  3. Management and outcome of fractures of the distal phalanx: a retrospective study of 285 horses with a long term outcome in 223 cases.

    Science.gov (United States)

    Rijkenhuizen, Astrid B M; de Graaf, Kim; Hak, Annelieke; Fürst, Anton; ter Braake, Frerik; Stanek, Christian; Greet, Tim R C

    2012-05-01

    A multicentre study of 285 cases was performed to enhance the management of distal phalangeal fractures on the basis of clinical evidence. The outcome after treatment was available for 223 of the cases. Horses with a non-articular type I fracture had a better prognosis (91.7%) for return to original or expected level of use than horses with an articular type II or III fracture (69.6% and 74.1%, respectively). The prognosis for types IV and V fractures was fair (57.7% and 57.1%, respectively) and for type VI good (80%). Horses with a hindlimb fracture had a significantly greater chance of a successful outcome. No significant association between age or time to start treatment and success rate was noted. The best treatment option for types I-III fractures was a conservative approach (box rest). Type IV fractures were best treated by arthroscopic removal of the fragment. Immobilisation of the hoof did not seem to influence outcome. Radiological findings and clinical healing were not accurately correlated and the re-commencement of training should be based on clinical rather than radiological findings. Complete osseous union of the fracture was not essential for a successful return to athletic activity. Copyright © 2011 Elsevier Ltd. All rights reserved.

  4. Epidemiological, virological and clinical characteristics of HBV infection in 223 HIV co-infected patients: a French multi-centre collaborative study.

    Science.gov (United States)

    Thibault, Vincent; Gaudy-Graffin, Catherine; Colson, Philippe; Gozlan, Joël; Schnepf, Nathalie; Trimoulet, Pascale; Pallier, Coralie; Saune, Karine; Branger, Michel; Coste, Marianne; Thoraval, Francoise Roudot

    2013-03-15

    Chronic hepatitis B (CHB) is a clinical concern in human immunodeficiency virus (HIV)-infected individuals due to substantial prevalence, difficulties to treat, and severe liver disease outcome. A large nationwide cross-sectional multicentre analysis of HIV-HBV co-infected patients was designed to describe and identify parameters associated with virological and clinical outcome of CHB in HIV-infected individuals with detectable HBV viremia. A multicenter collaborative cross-sectional study was launched in 19 French University hospitals distributed through the country. From January to December 2007, HBV load, genotype, clinical and epidemiological characteristics of 223 HBV-HIV co-infected patients with an HBV replication over 1000 IU/mL were investigated. Patients were mostly male (82%, mean age 42 years). Genotype distribution (A 52%; E 23.3%; D 16.1%) was linked to risk factors, geographic origin, and co-infection with other hepatitis viruses. This genotypic pattern highlights divergent contamination event timelines by HIV and HBV viruses. Most patients (74.7%) under antiretroviral treatment were receiving a drug with anti-HBV activity, including 47% receiving TDF. Genotypic lamivudine-resistance detected in 26% of the patients was linked to duration of lamivudine exposure, age, CD4 count and HIV load. Resistance to adefovir (rtA181T/V) was detected in 2.7% of patients. Advanced liver lesions were observed in 54% of cases and were associated with an older age and lower CD4 counts but not with viral load or genotype. Immune escape HBsAg variants were seldom detected. Despite the detection of advanced liver lesions in most patients, few were not receiving anti-HBV drugs and for those treated with the most potent anti-HBV drugs, persistent replication suggested non-optimal adherence. Heterogeneity in HBV strains reflects epidemiological differences that may impact liver disease progression. These findings are strong arguments to further optimize clinical management

  5. Luminescence properties of Eu2+ - activated alkaline-earth silicon-oxynitride MSi2O2-deltaN2+2/3delta (M = Ca, Sr, Ba) : A promising class of novel LED conversion phosphors

    NARCIS (Netherlands)

    Li, Y.Q.; Delsing, A.C.A.; With, de G.; Hintzen, H.T.J.M.

    2005-01-01

    The luminescence properties of Eu2+-activated alk.-earth Si-oxynitrides were studied. In the BaO-SiO2-Si3N4 system, a new BaSi2O2N2 compd. was obtained having the monoclinic structure with lattice parameters a 14.070(4), b 7.276(2), c 13.181(3) .ANG., b 107.74(6)°. All MSi2O2-dN2+2/3d:Eu2+ (M = Ca,

  6. catena-Poly[[bis[2-(2,3-dimethylanilinobenzoato-κO]cadmium(II]-di-μ-3-pyridylmethanol-κ2N:O;κ2O:N

    Directory of Open Access Journals (Sweden)

    Tadeusz Lis

    2008-03-01

    Full Text Available In the crystal structure of the title compound, [Cd(C15H14NO22(C6H7NO2]n, the Cd atom displays a distorted octahedral geometry, including two pyridine N atoms and two hydroxyl O from four symmetry-related 3-pyridylmethanol (3-pyme ligands and two carboxylate O atoms from mefenamate [2-(2,3-dimethylanilinobenzoate] anions. The Cd atoms are connected via the bridging 3-pyme ligands into chains, that extend in the a-axis direction. The Cd atom is located on a center of inversion, whereas the 3-pyme ligands and the mefenamate anions occupy general positions.

  7. Fertility desires, choice of hormone replacement and the effect of length of time since menopause on bone density in women with premature ovarian insufficiency: a review of 223 consecutive new referrals to a tertiary centre.

    Science.gov (United States)

    Mittal, Monica; Kreatsa, Maria; Narvekar, Nitish; Savvas, Michael; Hamoda, Haitham

    2014-09-01

    Premature ovarian insufficiency can have significant implications for the affected women. This review assesses the fertility desires, choice of hormone replacement, and the effect of time since menopause on the bone density of these women. This is a retrospective analysis of 223 consecutive new referrals. The average age (mean [± standard deviation]) of the women was 37.35 (± 5.88) years, with 24.1% (n = 19/79) presenting within 12 months of the onset of symptoms, most commonly, vasomotor type symptoms (n = 98/223; 43.9%). Of the women included, 58.7% (n = 131/223) took hormone replacement therapy (HRT), most commonly, an oral (n = 90/131; 68.7%) sequential preparation (n = 91/131; 69.5%), with a significant number of women >40 years of age preferring the transdermal route (n = 26/54; 48.1%; pfertility, more notable in women ≤ 40 years (n = 72/142; 50.7%; p < 0.01). Of these, 41.7% (n = 35/84) took HRT, most commonly, a sequential regimen (n = 26/35; 74.3%) with oral estradiol (n = 30/35; 85.7%); 69.5% (n = 155/223) of the women had had a bone densitometry scan performed, with 66.5% (n = 103/155) showing normal bone mineral density (BMD), but a greater likelihood of having reduced BMD the greater the time delay in presentation. No difference was seen for the three broad categories of BMD when further analysed for the cause of premature ovarian insufficiency, but a significant difference was noted for the spinal Z-scores, whereby women who underwent a surgically induced menopause were noted to have lower BMD compared with the other causes (p < 0.01). These findings can be useful in counselling women and guiding clinicians in their management of women with premature ovarian insufficiency. © The Author(s) 2014 Reprints and permissions: sagepub.co.uk/journalsPermissions.nav.

  8. A new case of Beckwith-Wiedemann syndrome with an 11p15 duplication of paternal origin [46,XY,-21,+der(21), t(11;21)(p15.2;q22.3)pat].

    Science.gov (United States)

    Krajewska-Walasek, M; Gutkowska, A; Mospinek-Krasnopolska, M; Chrzanowska, K

    1996-01-01

    We present a new case of 11p15 duplication (trisomy 11p15) in a boy (46,XY,-21,+der(21), t(11;21)(p15.2;q22.3)] suffering from Beckwith-Wiedemann syndrome (BWS), whose phenotypically normal father carries a balanced translocation between chromosomes 11 and 21[46,XY, t(11;21)(p15.2;q22.3)]. The paternal grandmother has the same balanced translocation and is also clinically normal. BWS was suspected when the boy was 6 months old because of gigantism, macroglossia, visceromegaly, ear lobe creases and abdominal distention. Apart from the characteristic BWS phenotype, the boy has other features which are almost exclusively observed in 11p trisomy (high forehead with frontal upsweep of hair, wide central nose bridge, slightly beaked nose, chubby cheeks and severe mental retardation). So far, at least eight cases of 11p15 duplication have been described as patients with BWS. In six of these, the duplication was due to inheritance of a translocated or rearranged paternal chromosome. This was also the case in our patient. In the two other previously published cases, the 11p15 duplications were de novo, but in one of these, DNA analysis has subsequently shown that the duplication was of paternal origin. We discuss our observations in relation to the above-mentioned previous cases of 11p15 duplication and the possible role of genomic imprinting in the etiology of BWS.

  9. Coffee intake, cardiovascular disease and all-cause mortality: observational and Mendelian randomization analyses in 95 000-223 000 individuals.

    Science.gov (United States)

    Nordestgaard, Ask Tybjærg; Nordestgaard, Børge Grønne

    2016-12-01

    Coffee has been associated with modestly lower risk of cardiovascular disease and all-cause mortality in meta-analyses; however, it is unclear whether these are causal associations. We tested first whether coffee intake is associated with cardiovascular disease and all-cause mortality observationally; second, whether genetic variations previously associated with caffeine intake are associated with coffee intake; and third, whether the genetic variations are associated with cardiovascular disease and all-cause mortality. First, we used multivariable adjusted Cox proportional hazard regression models evaluated with restricted cubic splines to examine observational associations in 95 366 White Danes. Second, we estimated mean coffee intake according to five genetic variations near the AHR (rs4410790; rs6968865) and CYP1A1/2 genes (rs2470893; rs2472297; rs2472299). Third, we used sex- and age adjusted Cox proportional hazard regression models to examine genetic associations with cardiovascular disease and all-cause mortality in 112 509 Danes. Finally, we used sex and age-adjusted logistic regression models to examine genetic associations with ischaemic heart disease including the Cardiogram and C4D consortia in a total of up to 223 414 individuals. We applied similar analyses to ApoE genotypes associated with plasma cholesterol levels, as a positive control. In observational analyses, we observed U-shaped associations between coffee intake and cardiovascular disease and all-cause mortality; lowest risks were observed in individuals with medium coffee intake. Caffeine intake allele score (rs4410790 + rs2470893) was associated with a 42% higher coffee intake. Hazard ratios per caffeine intake allele were 1.02 (95% confidence interval: 1.00-1.03) for ischaemic heart disease, 1.02 (0.99-1.02) for ischaemic stroke, 1.02 (1.00-1.03) for ischaemic vascular disease, 1.02 (0.99-1.06) for cardiovascular mortality and 1.01 (0.99-1.03) for all-cause mortality. Including

  10. Application of serum microRNA-9-5p, 21-5p, and 223-3p combined with tumor markers in the diagnosis of non-small-cell lung cancer in Yunnan in southwestern China.

    Science.gov (United States)

    Yang, Yanlong; Chen, Kai; Zhou, Yongchun; Hu, Zaoxiu; Chen, Shuai; Huang, Yunchao

    2018-01-01

    Xuanwei City is located in late Permian coal-accumulating areas of the northeastern region of Yunnan Province. In China, morbidity and mortality from lung cancer are highest in Yunnan. Identifying useful circulating markers suitable for the diagnosis of lung cancer in this region is quite meaningful. In this study, we evaluated diagnostic roles of serum miR-9-5p, 21-5p, 223-3p, 135b-5p, 339-5p, and 501-5p in patients with non-small-cell lung cancer (NSCLC) in Yunnan. Moreover, we evaluated the diagnostic performance of several tumor markers, including carcinoembryonic antigen (CEA), cytokeratin 19 fragment 21-1 (CYFRA21-1), and squamous cell carcinoma-related antigen (SCC). Quantitative real-time polymerase chain reaction detected six miRNAs in the serum of 104 NSCLC patients and 50 cancer-free controls. Other markers, including CEA, CYFRA21-1, and SCC, in serum were also measured. The diagnostic ability of miRNAs and tumor markers was evaluated by receiver operating characteristic (ROC) curve analysis. The diagnostic performance of these serum markers was also evaluated in Xuanwei and non-Xuanwei subjects, because the etiological and the epidemiological characteristics of lung cancer in Xuanwei were quite different from those in other regions. Serum miR-9-5p, miR-21-5p, miR-223-3p, CEA, CYFRA21-1, and SCC were upregulated in NSCLC patients, compared with cancer-free controls. No significant difference was found in miR-135b-5p, miR-339-5p, and miR-501-5p expression. The area under ROC curves (AUCs) of miR-9-5p, miR-21-5p, miR-223-3p, CEA, CYFRA21-1, and SCC were 0.706, 0.765, 0.744, 0.749, 0.735, and 0.616, respectively. When combined, miRNAs and tumor markers yielded the highest diagnostic power, with AUC of 0.886, sensitivity of 82.69%, and specificity of 88.00%. In Xuanwei subjects, miR-223-3p and CEA may be suitable biomarkers to distinguish NSCLC from cancer-free states with AUCs of 0.752 and 0.791, respectively. The diagnostic power of the combination of mi

  11. Dosimetric characterization of a 2-D array of 223 solid state detectors for daily morning checks in Tomo Therapy equipment; Caracterizacion dosimetrica de un arreglo 2D de 223 detectores de estado solido para verificaciones matutinas diarias en un equipo de Tomo Terapia

    Energy Technology Data Exchange (ETDEWEB)

    Reyes S, U.; Sosa A, M. [Universidad de Guanajuato, Division de Ciencias e Ingenieria, Lomas del Bosque No. 103, Col. Lomas del Campestre, 37150 Leon, Guanajuato (Mexico); Vega C, H. R., E-mail: uvaldoreyes@hotmail.com [Universidad Autonoma de Zacatecas, Unidad Academica de Estudios Nucleares, Cipres No. 10, Fracc. La Penuela, 98068 Zacatecas, Zac. (Mexico)

    2015-10-15

    Tomo Therapy is a new technique for the cancer treatment; however, the equipment must meet nearly all mechanical and dosimetric characteristics of a conventional linear accelerator for medical use. Daily quality controls are vital to the good operation of the equipment and thus guarantee excellent quality in the daily delivery of treatments. This paper presents the procedure of the dosimetric characterization of a two-dimensional array of 223 solid state detectors, called TomoDose of the Sun Nuclear Company. Dosimetric important criteria are established to perform these checks quickly and accurately. Dosimetric tests proposed are: repeatability, linearity, dependence of Sad and SSD. Some results are compared with readings of the ionization chamber Exradim A1SL. Finally the results of 30 consecutive days are presented to establish criteria for evidence of dose, field size, symmetry and flattening of the radiation beam on Tomo Therapy equipment. Expected values for daily verification are: Dose constancy of 194.89 c Gy, σ= 1.31 c Gy, symmetry in the X axis of -0.19 %, σ=0.08 %, symmetry in the Y axis of 1.66 %, σ= 0.05 %, flattened in the X axis of 25.71 %, σ= 0.05 % and flattened in the Y axis of 6.41 %, σ= 10.23 %. Field sizes obtained were 40.45 cm in the X axis and 5.10 on the Y axis, with standard deviations of 0.02 cm and 0.01 cm, respectively. TomoDose dosimetric values, compared to the values obtained with ionization chamber, presented differences smaller than 2%. (Author)

  12. TREE RING-BASED NET PRIMARY PRODUCTION OF Abies faxoniana FOREST OVER THE PAST 223 YEARS IN MIYALUO OF WESTERN SICHUAN, CHINA%川西米亚罗地区岷江冷杉林过去223年森林净初级生产力重建

    Institute of Scientific and Technical Information of China (English)

    李宗善; 刘国华; 伍星; 宫立; 王萌; 彭俊杰

    2014-01-01

    利用BIOME-BGC模型和树木年轮数据模拟1954~2008年川西米亚罗岷江冷杉林森林净初级生产力(NPP)动态,并构建了相应的NPP线性重建模型(方差解释量为44.8%),最终重建了该地区岷江冷杉林过去223年(1788~2010年)NPP的波动历史.在1788~2010年区间,岷江冷杉林NPP波动于498.66 ~ 563.65gC/m2/a之间,平均值和标准差分别为527.2gC/m2/a和12.45gC/m2/a.森林NPP主要上升时期有1788~ 1811年、1832~1844年、1890~1928年和1969~1993年,NPP主要的下降时期有1812~1831年、1845~1860年、1929~ 1968年和1994年至今.重建NPP序列与气象数据的相关和响应函数分析发现,夏季至秋季温度是限制森林生长的最为重要的气候要素,另外前一年秋季至初冬温度和春季至初夏的降雨对森林生长也有一定的控制性影响.树木年轮是一种指示森林NPP动态变化的可靠待用材料,可以检验和校正包括BIOME-BGC模型在内的各种生态系统过程模型.

  13. Mapping X-linked ophthalmic diseases. IV. Provisional assignment of the locus for X-linked congenital cataracts and microcornea (the Nance-Horan syndrome) to Xp22.2-p22.3.

    Science.gov (United States)

    Lewis, R A; Nussbaum, R L; Stambolian, D

    1990-01-01

    The Nance-Horan syndrome (NHS) is an infrequent X-linked disorder typified by dense congenital central cataracts, microcornea, anteverted and simplex pinnae, brachymetacarpalia, and numerous dental anomalies. The regional location of the genetic mutation causing NHS is unknown. The authors applied the modern molecular techniques of analysis of restriction fragment length polymorphisms to five multigenerational kindreds in which NHS segregated. Provisional linkage is established to two DNA markers--DXS143 at Xp22.3-p22.2 and DXS43 at Xp22.2. Regional localization of NHS will provide potential antenatal diagnosis in families at risk for the disease and will enhance understanding of the multifaceted genetic defects.

  14. E2A-positive gastric MALT lymphoma has weaker plasmacytoid infiltrates and stronger expression of the memory B-cell-associated miR-223: possible correlation with stage and treatment response.

    Science.gov (United States)

    Liu, Ting-Yun; Chen, Shee-Uan; Kuo, Sung-Hsin; Cheng, Ann-Lii; Lin, Chung-Wu

    2010-11-01

    Extranodal marginal-zone lymphoma of mucosa-associated lymphoid tissue of the stomach (gastric MALT lymphoma) is derived from memory B cells of the marginal zone. Normal memory B cells do not express markers of germinal-center B cells, such as E2A (immunoglobulin enhancer-binding factor E12/E47), B-cell chronic lymphocytic leukemia/lymphoma 6 (BCL6), or activation-induced cytidine deaminase (AID). E2A is a transcription factor that induces somatic hypermutations and blocks plasma cell differentiation. In 50 stage-I(E)/II(E1) gastric MALT lymphomas, we confirmed that all cases were BCL6(-)/AID(-), but a subset (50%, 25/50) was E2A(+). As E2A(-) and E2A(+) gastric MALT lymphomas had similar numbers of somatic hypermutations without intraclonal variations, which implied an origin from memory B cells, the expression of E2A was best regarded as a marker of aberrant follicular differentiation. Although the status of somatic hypermutation was not affected by E2A, E2A(+) gastric MALT lymphoma showed less plasmacytoid infiltrates and higher expressions of miRNA-223, a microRNA associated with memory B cells. Clinically, E2A(+) gastric MALT lymphomas were more likely to spread to perigastric lymph nodes and were less responsive to Helicobacter eradication therapy than were E2A(-) gastric MALT lymphomas. Taken together, aberrant E2A expression is a diagnostic feature of a subtype of gastric MALT lymphoma with weaker plasmacytoid infiltrates and stronger miR-223 expression. A prospective study would be necessary to verify the association between E2A expression and a poor response to Helicobacter eradication therapy.

  15. 211 At-labeled agents for alpha-immunotherapy: On the in vivo stability of astatine-agent bonds

    OpenAIRE

    Ayed , Tahra ,; Pilmé , Julien; Tézé , David; Bassal , Fadel ,; Barbet , Jacques ,; Chérel , Michel; Champion , Julie ,; Maurice , Rémi; Montavon , Gilles ,; Galland , Nicolas ,

    2016-01-01

    International audience; The application of 211 At to targeted cancer therapy is currently hindered by the rapid deastatination that occurs in vivo. As the deastatination mechanism is unknown, we tackled this issue from the viewpoint of the intrinsic properties of At-involving chemical bonds. An apparent correlation has been evidenced between in vivo stability of 211 At-labeled compounds and the AtÀR (R ¼ C, B) bond enthalpies obtained from relativistic quantum mechanical calculations. Further...

  16. Preparation and biological evaluation of an astatine-211 labeled biotin conjugate: Biotinyl-3-[211At]astatoanilide

    International Nuclear Information System (INIS)

    Foulon, Catherine F.; Schoultz, Bent W.; Zalutsky, Michael R.

    1997-01-01

    Biotinyl-3-[ 211 At]astatoanilide ([ 211 At]AtBA) was prepared in more than 80% yield by destannylation. In vitro, [ 211 At]AtBA exhibited a high affinity for streptavidin, and was stable after incubation in human serum, cerebrospinal fluid and distilled water, whereas it was rapidly degraded in mouse serum. HPLC analysis showed that the main degradation pathway in mouse serum was the cleavage of [ 211 At]astatoaniline. In mice, [ 211 At]AtBA and its 125 I-labeled analogue cleared rapidly from most tissues; however, there was some evidence for dehalogenation of both tracers

  17. Evaluation of Novel Wet Chemistry Separation and Purification Methods to Facilitate Automation of Astatine-­211 Isolation

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, Daniel Scott [Univ. of Washington, Seattle, WA (United States)

    2016-07-19

    This research is a collaborative effort between the research groups of the PIs, Dr. D. Scott Wilbur in the Department of Radiation Oncology at the University of Washington (UW) and Matthew O’Hara at the Pacific Northwest National Laboratory (PNNL). In this report only those studies conducted at UW and the budget information from UW will be reported. A separate progress and financial report will be provided by PNNL. This final report outlines the experiments (Tasks) conducted and results obtained at UW from July 1, 2013 thru June 30, 2016 (2-­year project with 1 year no-­cost extension). The report divides the information on the experiments and results obtained into the 5 specific objectives of the research efforts and the Tasks within those objectives. This format is used so that it is easy to see what has been accomplished in each area. A brief summary of the major findings from the studies is provided below. Summary of Major Findings from Research/Training Activities at UW: Anion and cation exchange columns did not provide adequate 211At capture and/or extraction results under conditions studied to warrant further evaluation; PEG-­Merrifield resins containing mPEG350, mPEG750, mPEG2000 and mPEG5000 were synthesized and evaluated; All of the mPEG resins with different sized mPEG moieties conjugated gave similar 211At capture (>95%) from 8M HCl solutions and release with conc. NH4OH (~50-­80%), but very low quantities were released when NaOH was used as an eluent; Capture and release of 211At when loading [211At]astatate appeared to be similar to that of [211At]astatide on PEG columns, but further studies need to be conducted to confirm that; Capture of 211At on PEG columns was lower (e.g. 80-­90%) from solutions of 8M HNO3, but higher capture rates (e.g. 99%) can be obtained when 10M HNO3 is mixed with an equal quantity of 8M HCl; Addition of reductants to the 211At solutions did not appear to change the percent capture, but may have an effect on the % extracted; There was some indication that the PEG-­Merrifield resins could be saturated (perhaps with Bi) resulting in lower capture percentages, but more studies need to be done to confirm that; A target dissolution chamber, designed and built at PNNL, works well with syringe pumps so it can be used in an automated system; Preliminary semi-­automated 211At isolation studies have been conducted with full-scale target dissolution and 211At isolation using a PEG column on the Hamilton automated system gave low overall recoveries, but HNO3 was used (rather than HCl) for loading the 211At and flow rates were not optimized; Results obtained using PEG columns are high enough to warrant further development on a fully automated system; Results obtained also indicate that additional studies are warranted to evaluate other types of columns for 211At separation from bismuth, which allow use of HNO3/HCl mixtures for loading and NaOH for eluting 211At. Such a column could greatly simplify the overall isolation process and make it easier to automate.

  18. Spectral and cyclic voltammetric studies on some intramolecularly hydrogen bonded arylhydrazones: Crystal and molecular structure of 2-(2-(3-nitrophenyl)hydrazono)-5,5-dimethylcyclohexane-1,3-dione

    Science.gov (United States)

    Sethukumar, A.; Arul Prakasam, B.

    2010-01-01

    A series of arylhydrazone derivatives ( 1- 7) were prepared by the coupling of acetylacetone/dimedone with respective aromatic diazonium salts and characterized by IR, 1H and 13C NMR spectra. The IR and NMR spectral data clearly manifests the effective intramolecular hydrogen bonding in all the cases. Cyclic voltammetric studies certainly indicate that in all the cases the reduced center is C dbnd N bond of hydrazonic moiety. The single crystal X-ray structural analysis of 2-(2-(3-nitrophenyl)hydrazono)-5,5-dimethylcyclohexane-1,3-dione ( 6) is also reported. Single crystal X-ray analysis of 6 evidences the intramolecular hydrogen bonding with the N(2)⋯O(4) distance of 2.642(15) Å, which can be designated as S(6) according to Etter's graph nomenclature. The cyclohexane ring conformation in the molecule ( 6) can be described as an envelope. RAHB studies suggest that the resonance assistance for hydrogen bonding is significantly reduced for the compound ( 6) due to the non-planarity of the six atoms which are involved in resonant cycle S(6) of Etter's graph. The planarity of the resonant cycle S(6) is very much disturbed by the conformational requirement of the cyclohexane ring and hence RAHB concept is less operative in this case.

  19. A familial pericentric inversion of chromosome 11 associated with a microdeletion of 163 kb and microduplication of 288 kb at 11p13 and 11q22.3 without aniridia or eye anomalies.

    Science.gov (United States)

    Balay, Lara; Totten, Ellen; Okada, Luna; Zell, Sidney; Ticho, Benjamin; Israel, Jeannette; Kogan, Jillene

    2016-01-01

    Interstitial deletions of 11p13 involving MPPED2, DCDC5, DCDC1, DNAJC24, IMMP1L, and ELP4 are previously reported to have downstream transcriptional effects on the expression of PAX6, due to a downstream regulatory region (DRR). Currently, no clear genotype-phenotype correlations have been established allowing for conclusive information regarding the exact location of the PAX6 DRR, though its location has been approximated in mouse models to be within the Elp4 gene. Of the clinical reports currently published examining patients with intact PAX6 genes but harboring deletions identified in genes downstream of PAX6, 100% indicate phenotypes which include aniridia, whereas approximately half report additional eye deformities, autism, or intellectual disability. In this clinical report, we present a 12-year-old male patient, his brother, and mother with pericentric inversions of chromosome 11 associated with submicroscopic interstitial deletions of 11p13 and duplications of 11q22.3. The inversions were identified by standard cytogenetic analysis; microarray and FISH detected the chromosomal imbalance. The patient's phenotype includes intellectual disability, speech abnormalities, and autistic behaviors, but interestingly neither the patient, his brother, nor mother have aniridia or other eye anomalies. To the best of our knowledge, these findings in three family members represent the only reported cases with 11p13 deletions downstream of PAX6 not demonstrating phenotypic characteristics of aniridia or abnormal eye development. Although none of the deleted genes are obvious candidates for the patient's phenotype, the absence of aniridia in the presence of this deletion in all three family members further delineates the location of the DRR for PAX6. © 2015 Wiley Periodicals, Inc.

  20. Strong backlog growth of 22.3% compared to September 30, 2008. Strong third quarter revenue growth of 7.8%, bringing sales for the first nine months of 2009 to 9.7 billion, or +6.4%

    International Nuclear Information System (INIS)

    2009-01-01

    AREVA generated consolidated revenue of 9.686 billion euros over the first nine months of 2009 for growth of 6.4% (+4.0% like-for-like) compared with the same period in 2008. Revenue outside France was up 8.4% to 6.999 billion euros, representing 72% of total revenue. The main revenue growth engines were the Front End division and the Transmission and Distribution division, with growth of 7.6% and 12.4% respectively. Foreign exchange had a positive impact of 91 million euros. Changes in the consolidation scope had an impact of 117 million euros, corresponding to the consolidation of acquisitions made by AREVA TA and the Transmission and Distribution division in 2008 and 2009. Third quarter 2009 revenue rose 7.8% to 3.164 billion euros (+6.7% like-for-like) compared with the third quarter of 2008. Changes in the consolidation scope had a positive impact of 31 million euros. The foreign exchange impact was minimal for the period. Quarterly growth was fueled mostly by the Front End division (+13.7%), the Back End division (+7.1%) and the Transmission and Distribution division (+8.4%). The group's backlog stood at 47.5 billion euros as of September 30, 2009 for 22.3% growth year-on-year. The backlog is up 27.4% in Nuclear and down 5.6% in Transmission and Distribution. For 2009 as a whole, the group confirms its outlook, based on the consolidation scope as of June 30, 2009, for a strong growth in backlog and in revenue and operating income close to that of the financial year 2008

  1. CopperCore 2.2.3

    NARCIS (Netherlands)

    Vogten, Hubert; Martens, Harrie; Koper, Rob

    2005-01-01

    Changes in this version: great number of bug fixes with regard to notifcation handling, allowed empty items in order to be more compatible with Reload, added QTI content type for CopperCore Service Integration, improved error handling, improved Clicc and fixed a bug regarding the else operation in a

  2. Gender | Page 223 | IDRC - International Development Research ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    ... of gender, class, caste, ethnicity, and age are integral to understanding power relations and ... concerning the access, use, and management of natural resources. ... operators had degraded water and land—and thus threatened livelihoods.

  3. 32 CFR 223.3 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... has been granted routine access to specific DoD UCNI under 10 U.S.C. 128. (c) Denying Official. An... function in support of atomic energy defense programs whose disruption could reasonably be expected to have...

  4. Publications | Page 223 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    IDRC works with developing-country researchers and institutions to build local capacity through funding, knowledge sharing, and training. ... Audio slideshow: Overview and lessons from the Canadian Learning Forum 2012 on Virtual Platforms, Knowledge Management and International Development (open access).

  5. 50 CFR 223.208 - Corals.

    Science.gov (United States)

    2010-10-01

    ... and Fisheries NATIONAL MARINE FISHERIES SERVICE, NATIONAL OCEANIC AND ATMOSPHERIC ADMINISTRATION... Guard (USCG), Authorized representatives of States or Indian Tribes. ″Oil Pollution Act″33 U.S.C. 2702... or facility solely under their control. ″Superfund Act″ (CERCLA)42 U.S.C. 9604 Administrator of the...

  6. 36 CFR 223.186 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... refers to the geographic area within which logs from any origin have neither been exported nor..., association, or other legal entity and includes any subsidiary, subcontractor, parent company, and business... factors, including but not limited to common ownership, common management, common facilities, and...

  7. 40 CFR 22.3 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... Environmental Protection Agency. Business confidentiality claim means a confidentiality claim as defined in 40... Consolidated Rules of Practice. Hearing Clerk means the Hearing Clerk, Mail Code 1900, U.S. Environmental...

  8. Gender | Page 223 | IDRC - International Development Research ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    New agricultural techniques have helped settle conflicts over land use in Arsaal, Lebanon. ... With new cash crops, many residents from the region's 1,000 villages report ... As well, additional sources of supply are becoming scarce and more ...

  9. 49 CFR 223.7 - Responsibility.

    Science.gov (United States)

    2010-10-01

    ... persons, or has caused death or injury, a penalty not to exceed $100,000 per violation may be assessed... requirement is subject to a civil penalty of at least $650 and not more than $25,000 per violation, except that: Penalties may be assessed against individuals only for willful violations, and, where a grossly...

  10. 50 CFR 22.3 - Definitions.

    Science.gov (United States)

    2010-10-01

    ..., extracting oil, natural gas and geothermal energy, construction of roads, dams, reservoirs, power plants, power transmission lines, and pipelines, as well as facilities and access routes essential to these... conservation practices. Necessary to ensure public health and safety means required to maintain society's well...

  11. 40 CFR 745.223 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... sampling. Business day means Monday through Friday with the exception of Federal holidays. Certified firm... Rico, the Virgin Islands, Guam, the Canal Zone, American Samoa, the Northern Mariana Islands, or any...

  12. 36 CFR 223.136 - Debarment.

    Science.gov (United States)

    2010-07-01

    ... decision, the debarring official shall consider the seriousness of the purchaser's acts or omissions and any mitigating factors. (b) Effect of proposed debarment. (1) Upon issuance of a notice of proposed debarment by the debarring official and until the final debarment decision is rendered, the Forest Service...

  13. 36 CFR 223.116 - Cancellation.

    Science.gov (United States)

    2010-07-01

    ... access to it, or (ii) damage to timber remaining to be cut. (4) For conviction of violation of criminal..., State agency, or political subdivision thereof, in the conduct of operations thereunder, on National...

  14. 48 CFR 223.7102 - Exceptions.

    Science.gov (United States)

    2010-10-01

    ... TECHNOLOGIES, OCCUPATIONAL SAFETY, AND DRUG-FREE WORKPLACE Storage and Disposal of Toxic and Hazardous... explosives in order to protect the public or to assist agencies responsible for Federal law enforcement in... environmental security; and (B) Provides for that person's continued financial and environmental responsibility...

  15. 14 CFR 223.1 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... than 40 percent of outstanding voting capital stock. Delivery flight means a flight from a point in the..., means the beneficial ownership of more than 40 percent of outstanding capital stock unless, ownership of more than 40 percent of outstanding capital stock unless, in a specific case, the Board determines...

  16. 33 CFR 136.223 - Compensation allowable.

    Science.gov (United States)

    2010-07-01

    ...) MARINE POLLUTION FINANCIAL RESPONSIBILITY AND COMPENSATION OIL SPILL LIABILITY TRUST FUND; CLAIMS... allowable under paragraph (a) of this section must be reduced by— (1) All compensation made available to the... under § 136.235. Government Revenues ...

  17. 36 CFR 223.63 - Advertised rates.

    Science.gov (United States)

    2010-07-01

    ...-infested, diseased, dead, or distressed timber may be sold at less than minimum rates when harvest of such timber is necessary to protect or improve the forest or prevent waste of usable wood fiber. [71 FR 11510...

  18. Publications | Page 223 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    ... innovative, liveable and prosperous Asian megacities (open access). Innovation in poor countries occurs mostly in informal settings and is less dependent on formal firms or research and development (R&D) programs. Despite this, innovation studies have paid scant attention to informal settings and the informal economy.

  19. Voegborlo et al.2.2.3

    African Journals Online (AJOL)

    PUBLICATIONS1

    Levels of some heavy metals in soils along the highway from Tafo to Aboaso in Kumasi in the. Ashanti region of ... into roadside soils and plants as a result of mechanical abrasion ... Sample collection and preparation. The road selected for the ...

  20. A de novo t(10;19)(q22.3;q13.33) leads to ZMIZ1/PRR12 reciprocal fusion transcripts in a girl with intellectual disability and neuropsychiatric alterations.

    Science.gov (United States)

    Córdova-Fletes, Carlos; Domínguez, Ma Guadalupe; Delint-Ramirez, Ilse; Martínez-Rodríguez, Herminia G; Rivas-Estilla, Ana María; Barros-Núñez, Patricio; Ortiz-López, Rocío; Neira, Vivian Alejandra

    2015-10-01

    We report a girl with intellectual disability (ID), neuropsychiatric alterations, and a de novo balanced t(10;19)(q22.3;q13.33) translocation. After chromosome sorting, fine mapping of breakpoints by array painting disclosed disruptions of the zinc finger, MIZ-type containing 1 (ZMIZ1) (on chr10) and proline-rich 12 (PRR12) (on chr19) genes. cDNA analyses revealed that the translocation resulted in gene fusions. The resulting hybrid transcripts predict mRNA decay or, if translated, formation of truncated proteins, both due to frameshifts that introduced premature stop codons. Though other molecular mechanisms may be operating, these results suggest that haploinsufficiency of one or both genes accounts for the patient's phenotype. ZMIZ1 is highly expressed in the brain, and its protein product appears to interact with neuron-specific chromatin remodeling complex (nBAF) and activator protein 1 (AP-1) complexes which play a role regulating the activity of genes essential for normal synapse and dendrite growth/behavior. Strikingly, the patient's phenotype overlaps with phenotypes caused by mutations in SMARCA4 (BRG1), an nBAF subunit presumably interacting with ZMIZ1 in brain cells as suggested by our results of coimmunoprecipitation in the mouse brain. PRR12 is also expressed in the brain, and its protein product possesses domains and residues thought to be related in formation of large protein complexes and chromatin remodeling. Our observation from E15 mouse brain cells that a Prr12 isoform was confined to nucleus suggests a role as a transcription nuclear cofactor likely involved in neuronal development. Moreover, a pilot transcriptome analysis from t(10;19) lymphoblastoid cell line suggests dysregulation of genes linked to neurodevelopment processes/neuronal communication (e.g., NRCAM) most likely induced by altered PRR12. This case represents the first constitutional balanced translocation disrupting and fusing both genes and provides clues for the potential

  1. Treatment-Induced Viral Cure of Hepatitis C Virus-Infected Patients Involves a Dynamic Interplay among three Important Molecular Players in Lipid Homeostasis: Circulating microRNA (miR)-24, miR-223, and Proprotein Convertase Subtilisin/Kexin Type 9.

    Science.gov (United States)

    Hyrina, Anastasia; Olmstead, Andrea D; Steven, Paul; Krajden, Mel; Tam, Edward; Jean, François

    2017-09-01

    In patients with chronic hepatitis C virus (HCV) infection, viral hijacking of the host-cell biosynthetic pathways is associated with altered lipid metabolism, which contributes to disease progression and may influence antiviral response. We investigated the molecular interplay among four key regulators of lipid homeostasis [microRNA (miR)-122, miR-24, miR-223, and proprotein convertase subtilisin/kexin type 9 (PCSK9)] in HCV-infected patients (n=72) who achieved a treatment-based viral cure after interferon-based therapy with first-generation direct-acting antivirals. Real-time PCR was used to quantify microRNA plasma levels, and ELISA assays were used to determine plasma concentrations of PCSK9. We report that levels of miR-24 and miR-223 significantly increased in patients achieving sustained virologic response (SVR), whereas the levels of miR-122, a liver-specific cofactor for HCV infection, decreased in these patients. PCSK9 concentrations were significantly increased in SVRs, suggesting that PCSK9 may help impede viral infection. The modulatory effect of PCSK9 on HCV infection was also demonstrated in the context of HCV-infected Huh-7.5.1 cells employing recombinant human PCSK9 mutants. Together, these results provide insights into a novel coordinated interplay among three important molecular players in lipid homeostasis - circulating miR-24, miR-223 and PCSK9 - whose regulation is affected by HCV infection and treatment-based viral cure. Copyright © 2017 The Authors. Published by Elsevier B.V. All rights reserved.

  2. 49 CFR 571.223 - Standard No. 223; Rear impact guards.

    Science.gov (United States)

    2010-10-01

    ... frame rails of certain spacing and gauge of steel). (b) A description of the chassis surface to which... this standard is to reduce the number of deaths and serious injuries that occur when light duty... installation instructions in S5.5 of this section. Chassis means the load supporting frame structure of a motor...

  3. Inactivation of human osteosarcoma cells in vitro by 211At-TP-3 monoclonal antibody: Comparison with astatine-211 and external-beam X rays

    International Nuclear Information System (INIS)

    Larsen, R.H.; Bruland, O.S.; Hoff, P.; Alstad, J.; Lindmo, T.; Rofstad, E.K.

    1994-01-01

    The potential usefulness of α-particle radioimmunotherapy in the treatment of osteosarcoma was studied in vitro by using the monoclonal antibody TP-3 and cells of three human osteosarcoma cell lines (OHS, SAOS and KPDX) differing in antigen expression. Cell survival curves were established after treatment with (a) 211 At-TP-3 of different specific activities, (b) 211 At-labeled bovine serum albumin (BSA), (c) free 211 At and (d) external-beam X rays. The three osteosarcoma cell lines showed similar survival curves, whether treated with external-beam X rays, 211 At-BSA or free 211 At. The D o 's were lower for free 211 At than for 211 At-BSA. The survival curves for 211 At-TP-3 treatment, on the other hand, differed significantly among the cell lines, suggesting that sensitivity to 211 At-TP-3 treatment was governed by cellular properties other than sensitivity to external-beam X rays. The cellular property most important for sensitivity to 211 At-TP-3 treatment was the antigen expression. Cell inactivation after 211 At-TP-3 treatment increased substantially with increasing specific activity of the 211 At-TP-3. At high specific activities, the cytotoxic effect of 211 At-TP-3 was significantly higher than that of 211 At-BSA. In conclusion, 211 At-TP-3 has the potential to give clinically favorable therapeutic ratios in the treatment of osteosarcoma. 39 refs., 5 figs., 2 tabs

  4. NaPdPS{sub 4} and RbPdPS{sub 4}: systems with infinite straight ((1)/({infinity}))[PdPS{sub 4}]{sup -} chains soluble in polar solvents and the structure of cubic RbPdPS{sub 4}{l_brace}Rb{sub 0.33}P{sub 0.4}S{sub 2.23}O{sub x}{r_brace}

    Energy Technology Data Exchange (ETDEWEB)

    Coste, Servane; Hanko, Jason; Bujoli-Doeuff, Martine; Louarn, Guy; Evain, Michel; Brec, Raymond; Alonso, Bruno; Jobic, S; Kanatzidis, Mercouri G

    2003-11-01

    The synthesis, crystal structures, chemical and spectroscopic properties of NaPdPS{sub 4}, RbPdPS{sub 4}, and RbPdPS{sub 4}{l_brace}Rb{sub 0.33}P{sub 0.4}S{sub 2.23}O{sub x}{r_brace} are described. NaPdPS{sub 4}, RbPdPS{sub 4}, are isostructural and crystallize in the tetragonal system I4/mcm with cell parameters a=7.3074(8) A, c=12.2308(14) A and a=8.2954(3) A, c=12.2284(4) A respectively. RbPdPS{sub 4}{l_brace}Rb{sub 0.33}P{sub 0.4}S{sub 2.23}O{sub x}{r_brace} is cubic, space group Pm-3n and a=12.0042(2) A. All compounds contain the same ((1)/({infinity}))[PdPS{sub 4}]{sup -} chains made of alternating square planar Pd{sup 2+} cations and tetrahedral [PS{sub 4}]{sup 3-} anions. RbPdPS{sub 4}{l_brace}Rb{sub 0.33}P{sub 0.4}S{sub 2.23}O{sub x}{r_brace} contains co-crystallized highly disordered molecular species encapsulated within [Rb{sub 8}] cubic cavities. Spectroscopic solid state {sup 31}P NMR, infrared and Raman data as well as elemental analysis suggest that these species could be S{sub n}{sup 2-} (n=3 or 4) anions and possibly cationic [P{sub 4}S{sub 6}O]{sup 6+} fragments. NaPdPS{sub 4} and RbPdPS{sub 4} exhibit exfoliative dissolution in polar solvents giving rise to solutions that show signs of complex fluid behavior.

  5. Isothermal phase (vapour + liquid) equilibrium data for binary mixtures of propene (R1270) with either 1,1,2,3,3,3-hexafluoro-1-propene (R1216) or 2,2,3-trifluoro-3-(trifluoromethyl)oxirane in the temperature range of (279 to 318) K

    International Nuclear Information System (INIS)

    Subramoney, Shalendra Clinton; Nelson, Wayne Michael; Courtial, Xavier; Naidoo, Paramespri; Coquelet, Christophe; Richon, Dominique; Ramjugernath, Deresh

    2015-01-01

    Highlights: • Phase equilibrium data for propene and hexafluoropropylene. • Phase equilibrium data for propene and hexafluoropropylene oxide. • Systems exhibit pressure-maximum azeotropes. • Data well correlated by Peng–Robinson equation of state with the Wong–Sandler mixing rule. - Abstract: Isothermal (vapour + liquid) equilibrium data (P–x–y) are presented for the 1-propene 1,1,2,3,3,3-hexafluoro-1-propene and the 1-propene + 2,2,3-trifluoro-3-(trifluoromethyl)oxirane binary systems. Both binary systems were studied at five temperatures, ranging from (279.36 to 318.09) K, at pressures up to 2 MPa. The experimental (vapour + liquid) equilibrium data were measured using an apparatus based on the “(static + analytic)” method incorporating a single movable Rapid On-Line Sampler-Injector to sample the liquid and vapour phases at equilibrium. The expanded uncertainties are approximated on average as T = 0.07 K, 0.008 MPa, and 0.007 and 0.009 for the temperature, pressure, and the liquid and vapour mole fractions, respectively. A homogenous maximum-pressure azeotrope was observed for both binary systems at all temperatures studied. The experimental data were correlated with the Peng–Robinson equation of state using the Mathias–Copeman alpha function, paired with the Wong–Sandler mixing rule and the Non-Random Two Liquid activity coefficient model. The model provided satisfactory representation of the phase equilibrium data measured

  6. Alpha particle emitters in medicine

    International Nuclear Information System (INIS)

    Fisher, D.R.

    1989-09-01

    Radiation-induced cancer of bone, liver and lung has been a prominent harmful side-effect of medical applications of alpha emitters. In recent years, however, the potential use of antibodies labeled with alpha emitting radionuclides against cancer has seemed promising because alpha particles are highly effective in cell killing. High dose rates at high LET, effectiveness under hypoxic conditions, and minimal expectancy of repair are additional advantages of alpha emitters over antibodies labeled with beta emitting radionuclides for cancer therapy. Cyclotron-produced astatine-211 ( 211 At) and natural bismuth-212 ( 212 Bi) have been proposed and are under extensive study in the United States and Europe. Radium-223 ( 223 Ra) also has favorable properties as a potential alpha emitting label, including a short-lived daughter chain with four alpha emissions. The radiation dosimetry of internal alpha emitters is complex due to nonuniformly distributed sources, short particle tracks, and high relative specific ionization. The variations in dose at the cellular level may be extreme. Alpha-particle radiation dosimetry, therefore, must involve analysis of statistical energy deposition probabilities for cellular level targets. It must also account fully for nonuniform distributions of sources in tissues, source-target geometries, and particle-track physics. 18 refs., 4 figs

  7. 36 CFR 223.216 - Special Forest Products definitions.

    Science.gov (United States)

    2010-07-01

    ..., Christmas trees, cones, ferns, firewood, forbs, fungi (including mushrooms), grasses, mosses, nuts, pine straw, roots, sedges, seeds, transplants, tree sap, wildflowers, fence material, mine props, posts and...

  8. 36 CFR 223.277 - Forest botanical products definition.

    Science.gov (United States)

    2010-07-01

    ..., boughs, bryophytes, bulbs, burls, cones, ferns, fungi (including mushrooms), forbs, grasses, mosses, nuts, pine straw, roots, sedges, seeds, shrubs, transplants, tree sap, and wildflowers. Forest botanical products are not animals, animal parts, Christmas trees, fence material, firewood, insects, mine props...

  9. 48 CFR 1552.223-72 - Care of laboratory animals.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Care of laboratory animals... Care of laboratory animals. As prescribed in 1523.303-72, insert the following clause: Care of Laboratory Animals (OCT 2000) (a) Before undertaking performance of any contract involving the use of...

  10. Dicty_cDB: VSJ223 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available etical protein ZK381.7 - Caenorhabditis elegans. 46 0.43 1 AF277887 |AF277887.1 Sida crystallina clone 67SE ...5 unordered pieces. 44 1.7 1 AF277884 |AF277884.1 Sida crystallina clone 63NA cytochrome c oxidase subunit I... (COI) gene, partial cds; mitochondrial gene for mitochondrial product. 34 3.8 2 AF277883 |AF277883.1 Sida... 2 AF277888 |AF277888.1 Sida crystallina clone 68SE cytochrome c oxidase subunit ...cytochrome c oxidase subunit I (COI) gene, partial cds; mitochondrial gene for mitochondrial product. 36 1.0

  11. 14 CFR 91.223 - Terrain awareness and warning system.

    Science.gov (United States)

    2010-01-01

    ... to the terrain awareness and warning system audio and visual warnings. (d) Exceptions. Paragraphs (a... after March 29, 2002. Except as provided in paragraph (d) of this section, no person may operate a... minimum meets the requirements for Class B equipment in Technical Standard Order (TSO)-C151. (b) Airplanes...

  12. Genetics Home Reference: 9q22.3 microdeletion

    Science.gov (United States)

    ... 20 [updated 2015 Oct 1]. In: Pagon RA, Adam MP, Ardinger HH, Wallace SE, Amemiya A, Bean LJH, Bird TD, Ledbetter N, Mefford HC, Smith RJH, Stephens K, editors. GeneReviews® [Internet]. Seattle (WA): ...

  13. 24 CFR 884.223 - Leasing to eligible families.

    Science.gov (United States)

    2010-04-01

    ... occupancy requirements in cases where there is involved or claimed to be involved incidents of, or criminal activity related to, domestic violence, dating violence, or stalking. [49 FR 31398, Aug. 7, 1984, as...

  14. 36 CFR 223.229 - Contents of prospectus.

    Science.gov (United States)

    2010-07-01

    ... acreage; (e) The estimated volumes, quality, size, or other appropriate measure for the special forest... type of contract, permit, or other authorizing instrument to be used for the sale; (i) The termination date and normal operating season, if any, of the contract, permit, or other authorizing instrument; (j...

  15. All projects related to | Page 223 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Topic: BIOTECHNOLOGY, AGRICULTURAL ENGINEERING, NATIONAL INCOME, AGRICULTURAL PRODUCTIVITY, FOOD SECURITY, RURAL ECONOMY. Region: South Africa, South of Sahara, Canada. Program: Agriculture and Food Security. Total Funding: CA$ 3,146,230.00. Vaccines to Combat Livestock Diseases ...

  16. 36 CFR 223.275 - Establishment of a pilot program.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Establishment of a pilot... Establishment of a pilot program. This subpart governs the Forest Service's pilot program for the disposal of... of Title III of H.R. 3423)), as amended in 2004 by Section 335 of Public Law 108-108. The pilot...

  17. 48 CFR 352.223-70 - Safety and health.

    Science.gov (United States)

    2010-10-01

    ... laboratories; and other applicable occupational health and safety standards issued by OSHA and included in 29... Commission Standards and Regulations, pursuant to the Energy Reorganization Act of 1974 (42 U.S.C. 5801 et... health and safety operating procedures and practices for both personnel and facilities: (i) Biosafety in...

  18. 36 CFR 223.85 - Noncompetitive sale of timber.

    Science.gov (United States)

    2010-07-01

    ... further advertisement, at not less than appraised value, any timber previously advertised for competitive... degradation or resource damage, or as the result of administrative appeals, litigation, or court orders... any applicable appeals or objection process has been completed may be considered for replacement...

  19. Dicty_cDB: SHB223 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available *r*fskiyi*kswwrctkn*cwf *kiisqttcsksstt*nfskfiiftsfkisstsske*w*fsfss*pfnigiig**ryiis igrcwcnqrtsytss*rd*rk*k...dyk*ncriyl*siiki--- ---clmmnliwleli*vniwnnirflv*lvlhqvm*vmikvvn*lkpseedhtv*yclmk lkklinkfgmfsykywmkvvlpmvkve

  20. 48 CFR 1852.223-70 - Safety and health.

    Science.gov (United States)

    2010-10-01

    ... Contractor shall comply with all Federal, State, and local laws applicable to safety and occupational health... include in any report an expression of opinion as to the fault or negligence of any employee. In addition... (OSHA) or Department of Transportation (DOT) regulations (if applicable). (4) When the Contractor (or...

  1. 36 CFR 223.234 - Determination of responsibility.

    Science.gov (United States)

    2010-07-01

    ... declared high bidder has a satisfactory record of integrity and business ethics; (4) The declared high bidder has or is able to obtain equipment and supplies suitable for harvesting the special forest product...

  2. 49 CFR 212.223 - Operating practices compliance inspector.

    Science.gov (United States)

    2010-10-01

    ...) Control of Alcohol and Drug Use (49 CFR part 219); (3) Rear End Marking Device Regulations (49 CFR part... regulations listed in paragraph (a) of this section, including the remedial action required to bring defective...

  3. 48 CFR 952.223-78 - Sustainable acquisition program.

    Science.gov (United States)

    2010-10-01

    ... preferable and sustainable manner that will promote the natural environment and protect the health and well... contract, the Contractor shall provide its services in a manner that promotes the natural environment... Products Environmental Assessment Tool (EPEAT) the Green Electronics Council site. (6) Green house gas...

  4. 1935 15' Quad #223 Aerial Photo Mosaic Index

    Data.gov (United States)

    Earth Data Analysis Center, University of New Mexico — Aerial Photo Reference Mosaics contain aerial photographs that are retrievable on a frame by frame basis. The inventory contains imagery from various sources that...

  5. 36 CFR 223.187 - Determinations of unprocessed timber.

    Science.gov (United States)

    2010-07-01

    ... generally recognized by the industry as setting a selling standard; and, (ii) A statement by the... setting a selling standard. (3) Lumber, construction timbers, or cants for remanufacture, except western... or better, with a maximum cross section of 2,000 square centimeters (310 square inches) for any...

  6. 44 CFR 206.223 - General work eligibility.

    Science.gov (United States)

    2010-10-01

    ... facilities must be submitted through a State or political subdivision of the State. (e) Negligence. No assistance will be provided to an applicant for damages caused by its own negligence. If negligence by...

  7. 36 CFR 223.142 - Causes for suspension.

    Science.gov (United States)

    2010-07-01

    ... evidence, of the following: (1) Commission of: (i) Theft, forgery, bribery, embezzlement, falsification or... lack of business integrity or business honesty that seriously and directly affects the present...

  8. 19 CFR 10.223 - Articles eligible for preferential treatment.

    Science.gov (United States)

    2010-04-01

    ... President or his designee has designated in the Federal Register as not available in commercial quantities... beneficiary country that the President or his designee and representatives of the CBTPA beneficiary country....61.00 of the HTSUS duty-free from Canada, Mexico or Israel. (3) Dyed, printed, or finished thread. An...

  9. Laser-driven ICF experiments: Laboratory Report No. 223

    International Nuclear Information System (INIS)

    McCrory, R.L.

    1991-04-01

    Laser irradiation uniformity is a key issue and is treated in some detail. The basic irradiation uniformity requirements and practical ways of achieving these requirements are both discussed, along with two beam-smoothing techniques: induced spatial incoherence (ISI), and smoothing by spectral dispersion (SSD). Experiments to measure and control the irradiation uniformity are also highlighted. Following the discussion of irradiation uniformity, a brief review of coronal physics is given, including the basic physical processes and their experimental signatures, together with a summary of pertinent diagnostics and results from experiments. Methods of determining ablation rates and thermal transport are also described. The hydrodynamics of laser-driven targets must be fully understood on the basis of experiments. Results from implosion experiments, including a brief description of the diagnostics, are presented. Future experiments aimed at determining ignition scaling and demonstrating hydrodynamically equivalent physics applicable to high-gain designs

  10. Radium-223 Improves Survival in Patients with Advanced Prostate Cancer

    Science.gov (United States)

    ... This well-executed study shows a clear survival benefit in patients who had received the treatments that were available when the study was conducted, including standard chemotherapy,” said Bhupinder Mann, MBBS, of NCI’s Division of ...

  11. 50 CFR 223.210 - North American green sturgeon.

    Science.gov (United States)

    2010-10-01

    ...) Take does not involve artificial spawning or enhancement activities; (vii) A description of the study... restoration project, or, for ongoing studies, by August 31, 2010, which includes: the geographic area affected... will not jeopardize the continued existence of the threatened Southern DPS. (c) Exemptions via ESA 4(d...

  12. 36 CFR 223.61 - Establishing minimum stumpage rates.

    Science.gov (United States)

    2010-07-01

    ... AGRICULTURE SALE AND DISPOSAL OF NATIONAL FOREST SYSTEM TIMBER Timber Sale Contracts Appraisal and Pricing.... No timber may be sold or cut under timber sale contracts for less than minimum stumpage rates except... amounts of material not meeting utilization standards of the timber sale contract. For any timber sale...

  13. 36 CFR 223.60 - Determining fair market value.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Determining fair market value... Determining fair market value. The objective of Forest Service timber appraisals is to determine fair market value. Fair market value is estimated by such methods as are authorized by the Chief, Forest Service...

  14. 36 CFR 223.101 - Determination of purchaser responsibility.

    Science.gov (United States)

    2010-07-01

    ... purchaser has a satisfactory record of integrity and business ethics; (5) The purchaser has or is able to... and governmental business commitments; (3) The purchaser has a satisfactory performance record on... applicable laws and regulations. (c) If the prospective purchaser is a small business concern and the...

  15. 48 CFR 52.223-10 - Waste Reduction Program.

    Science.gov (United States)

    2010-10-01

    ... recovered from the solid waste stream for use in the form of raw materials in the manufacture of products... promote cost-effective waste reduction in all operations and facilities covered by this contract. The Contractor's programs shall comply with applicable Federal, State, and local requirements, specifically...

  16. Critical current of high Tc superconducting Bi223/Ag tapes

    NARCIS (Netherlands)

    Huang, Y.; ten Haken, Bernard; ten Kate, Herman H.J.

    1998-01-01

    The magnetic field dependence of the critical current of various high Tc superconducting Bi2223/Ag tapes indicates that the transport current is carried through two paths: one is through weakly-linked grain boundaries (Josephson junctions); another is through well-connected grains. The critical

  17. 50 CFR 223.202 - Steller sea lion.

    Science.gov (United States)

    2010-10-01

    ... kilometers) or within sight of the eastern shore of Marmot Island, including the Steller sea lion rookery... sites. Listed Steller sea lion rookery sites consist of the rookeries in the Aleutian Islands and the... 16540 SE corner. 8. Pinnacle Rock 54°46.0 N 161°46.0 W 16540 Whole island. 9. Clubbing Rks (N) 54°43.0 N...

  18. 36 CFR 223.239 - Free use by individuals.

    Science.gov (United States)

    2010-07-01

    ... AND DISPOSAL OF NATIONAL FOREST SYSTEM TIMBER Special Forest Products Award of Contracts, Permits, Or... special forest product from National Forest System lands free of charge for personal, non-commercial use... sustainability of a special forest product; or (4) Otherwise protecting National Forest System land. (h...

  19. 48 CFR 52.223-6 - Drug-Free Workplace.

    Science.gov (United States)

    2010-10-01

    ..., State, or local health, law enforcement, or other appropriate agency; and (7) Make a good faith effort... (CONTINUED) CLAUSES AND FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 52... work done by the Contractor in connection with a specific contract where employees of the Contractor...

  20. 50 CFR 300.223 - Purse seine fishing restrictions.

    Science.gov (United States)

    2010-10-01

    ... wood or other rigid material able to support a minimum of 100 lb (34.1 kg) without breaking or.... (vi) Sea turtle resuscitation. If a sea turtle brought aboard appears dead or comatose, the following... retention of a dead sea turtle for research. In releasing a sea turtle the vessel owner or operator must: (A...

  1. Dicty_cDB: SHG223 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available s*fsnservgiilihligf*n*iahvq*kigalsgpflvsrtgdvg*tkywdktsnih** ipqkvlvh*dsrtvamevgir*gvcnnspakwtspeng*r*qwmvd...ervgiilihligf*n*iahvq*kigalsgpflvsrtgdvg*tkywdktsnih** ipqkvlvh*dsrtvamevgir*gvcnnspakwtspeng*r*qwmvdaqslkev

  2. International Bathymetric Chart of the Arctic Ocean, Version 2.23

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The goal of this initiative is to develop a digital data base that contains all available bathymetric data north of 64 degrees North, for use by mapmakers,...

  3. 12 CFR 223.22 - What valuation and timing principles apply to asset purchases?

    Science.gov (United States)

    2010-01-01

    ... the covered transaction after the purchase may be reduced to reflect amortization or depreciation of the asset, to the extent that such reductions are consistent with GAAP. (2) Exceptions. (i) Purchase...

  4. 75 FR 54421 - Sixth Meeting: RTCA Special Committee 223: Airport Surface Wireless Communications

    Science.gov (United States)

    2010-09-07

    ..., 2010 from 0900 a.m.- 1600 p.m. ADDRESSES: The meeting will be held at EUROCONTROL, Rue de la Fusee 96... Applications (FAA) NASA Cleveland Test Bed Test Results (ITT) Channel Model Considerations for AeroMACS (Uni...

  5. Topographic Map of Quadrangle 3670, Jam-Kashem (223) and Zebak (224) Quadrangles, Afghanistan

    Science.gov (United States)

    Bohannon, Robert G.

    2006-01-01

    This map was produced from several larger digital datasets. Topography was derived from Shuttle Radar Topography Mission (SRTM) 85-meter digital data. Gaps in the original dataset were filled with data digitized from contours on 1:200,000-scale Soviet General Staff Sheets (1978-1997). Contours were generated by cubic convolution averaged over four pixels using TNTmips surface-modeling capabilities. Minor artifacts resulting from the auto-contouring technique are present. Streams were auto-generated from the SRTM data in TNTmips as flow paths. Flow paths were limited in number by their Horton value on a quadrangle-by-quadrangle basis. Peak elevations were averaged over an area measuring 85 m by 85 m (represented by one pixel), and they are slightly lower than the highest corresponding point on the ground. Cultural data were extracted from files downloaded from the Afghanistan Information Management Service (AIMS) Web site (http://www.aims.org.af). The AIMS files were originally derived from maps produced by the Afghanistan Geodesy and Cartography Head Office (AGCHO). Because cultural features were not derived from the SRTM base, they do not match it precisely. Province boundaries are not exactly located. This map is part of a series that includes a geologic map, a topographic map, a Landsat natural-color-image map, and a Landsat false-color-image map for the USGS/AGS (Afghan Geological Survey) quadrangles covering Afghanistan. The maps for any given quadrangle have the same open-file number but a different letter suffix, namely, -A, -B, -C, and -D for the geologic, topographic, Landsat natural-color, and Landsat false-color maps, respectively. The open-file report (OFR) numbers for each quadrangle range in sequence from 1092 - 1123. The present map series is to be followed by a second series, in which the geology is reinterpreted on the basis of analysis of remote-sensing data, limited fieldwork, and library research. The second series is to be produced by the USGS in cooperation with the AGS and AGCHO.

  6. 32 CFR Appendix A to Part 223 - Procedures for Identifying and Controlling DoD UCNI

    Science.gov (United States)

    2010-07-01

    ... security measures, including security plans, procedures, and equipment, for the physical protection of DoD... stand-alone personal computers, or shared-logic work processing systems, if protection from unauthorized... and security by increasing significantly the likelihood of the illegal production of nuclear weapons...

  7. SU-F-T-223: Radiotherapy Incident Reporting and Analysis System (RIRAS):Early Experience

    International Nuclear Information System (INIS)

    Kapoor, R; Palta, J; Hagan, M; Burkett, D; Leidholdt, E

    2016-01-01

    Background & Purpose: RIRAS is a web-based information system deployed on the Veterans Health Administration intranet in early 2014 to collect adverse events and good catch data; analyze the causes and contributing factors; and find ways to prevent future occurrences. Material and Methods: Incident learning consists of a feedback loop which starts with reporting an event, followed by analysis of contributing factors, and culminates in the development of a patient safety work product (PSWP) to prevent recurrence. RIRAS permits both anonymous and non-anonymous reporting. Each report is analyzed by a team of medical physicists who are independent of the reporting facility. The analysts usually contact the reporting facilities for additional information. We analyzed all reports and held telephonic interviews (when necessary) with the reporters. We then generated PSWPs with corrective/preventive and learning actions. Anonymous reporting is handled in the same manner, except without the ability to further interview the reporter. Results: In a significant number of reports, the causes and recommended preventive actions were considerably altered by the independent analysis and additional information from the facility. 130 reports have been entered in RIRAS; 9 misadministrations, 83 good catches, 3 anonymous good catches, and 35 earlier reported incidents from FY2005-14. 45% of the reported incidents occurred in the treatment delivery stages, 19% in on-treatment management, and 16% in pre-treatment verification. 80% of the good catches were found in the treatment delivery workflow. Majority of these incidents were due to inconsistent patient setup instructions or documentation, nonadherence to policies and procedures, lax time-out policy, distracted RTTs, and inadequate RTT staffing. Conclusion: RIRAS has identified many areas for improvement and elevated the quality and safety of radiation treatments in the VHA. We found that the ability to learn is significantly diminished when the analysts do not have the ability to request additional information.

  8. 76 FR 6179 - Eighth Meeting: RTCA Special Committee 223: Airport Surface Wireless Communications

    Science.gov (United States)

    2011-02-03

    ... Review the EUROCAE WG-82 straw man MOPS proposal Discuss MOPS content detail versus referencing other AeroMACS Specs Review RTCA MOPS Drafting Guide and make Work Assignments Wednesday Afternoon--Reconvene...

  9. 24 CFR 884.223a - Preference for occupancy by elderly families.

    Science.gov (United States)

    2010-04-01

    ... clearly contradicted by other comparable evidence. (2) Sources in conflict. If a primary source... occupancy primarily by elderly families, including those cases where sources documents conflict, secondary... sources (“primary” sources) listed in paragraph (b)(1)(i) of this section, or at least two items from the...

  10. 48 CFR 1852.223-75 - Major breach of safety or security.

    Science.gov (United States)

    2010-10-01

    ... compromise of classified information, illegal technology transfer, workplace violence resulting in criminal... that results in compromise of classified information, illegal technology transfer, workplace violence resulting in criminal conviction, sabotage, compromise or denial of information technology services...

  11. PHITS: Particle and heavy ion transport code system, version 2.23

    International Nuclear Information System (INIS)

    Niita, Koji; Matsuda, Norihiro; Iwamoto, Yosuke; Sato, Tatsuhiko; Nakashima, Hiroshi; Sakamoto, Yukio; Iwase, Hiroshi; Sihver, Lembit

    2010-10-01

    A Particle and Heavy-Ion Transport code System PHITS has been developed under the collaboration of JAEA (Japan Atomic Energy Agency), RIST (Research Organization for Information Science and Technology) and KEK (High Energy Accelerator Research Organization). PHITS can deal with the transport of all particles (nucleons, nuclei, mesons, photons, and electrons) over wide energy ranges, using several nuclear reaction models and nuclear data libraries. Geometrical configuration of the simulation can be set with GG (General Geometry) or CG (Combinatorial Geometry). Various quantities such as heat deposition, track length and production yields can be deduced from the simulation, using implemented estimator functions called 'tally'. The code also has a function to draw 2D and 3D figures of the calculated results as well as the setup geometries, using a code ANGEL. Because of these features, PHITS has been widely used for various purposes such as designs of accelerator shielding, radiation therapy and space exploration. Recently PHITS introduces an event generator for particle transport parts in the low energy region. Thus, PHITS was completely rewritten for the introduction of the event generator for neutron-induced reactions in energy region less than 20 MeV. Furthermore, several new tallis were incorporated for estimation of the relative biological effects. This document provides a manual of the new PHITS. (author)

  12. 32 CFR Appendix B to Part 223 - Guidelines for the Determination of DoD UCNI

    Science.gov (United States)

    2010-07-01

    ... information in another document or material is not, or is no longer, DoD UCNI; case-by-case determinations are... description of security system components intended to mitigate the consequences of an accident or act of... construction drawings of a DoD SNM facility showing construction characteristics of building and associated...

  13. 48 CFR 252.223-7004 - Drug-free work force.

    Science.gov (United States)

    2010-10-01

    ... “Mandatory Guidelines for Federal Workplace Drug Testing Programs” (53 FR 11980 (April 11 1988)), issued by... that those issues that are in conflict will be a subject of negotiation at the next collective...

  14. 36 CFR 223.111 - Administration of contracts in designated disaster areas.

    Science.gov (United States)

    2010-07-01

    ...-sharing arrangement in paragraph (a) of this section, he may allow cancellation of the contract... disaster, (2) The sale of such timber will assist in sustaining the economy of such area, or (3) The sale...

  15. 48 CFR 2852.223-70 - Unsafe conditions due to the presence of hazardous material.

    Science.gov (United States)

    2010-10-01

    ... safety controls. (b) The Occupational Safety and Health Administration (OSHA) is responsible for issuing... contractor, the parties will agree on a course of action to mitigate the effects of that condition and, if...

  16. 36 CFR 223.219 - Sustainable harvest of special forest products.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Sustainable harvest of....219 Sustainable harvest of special forest products. (a) Sustainable harvest levels. Prior to offering... product's sustainable harvest level. A special forest product's sustainable harvest level is the total...

  17. 30 CFR 75.223 - Evaluation and revision of roof control plan.

    Science.gov (United States)

    2010-07-01

    ..., or coal or rock bursts; or (2) When accident and injury experience at the mine indicates the plan is...) Each unplanned roof fall and rib fall and coal or rock burst that occurs in the active workings shall...

  18. Sexospécificités | Page 223 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    In a country where Muslims wash five times a day for prayer, Yemen has brought a unique model for making the best out of its often wasted ablution water. It has reused it for a green purpose: watering traditional Yemeni gardens. Through the Regional Water Demand Initiative's (WaDImena) programme in Yemen, the ...

  19. SU-F-T-223: Radiotherapy Incident Reporting and Analysis System (RIRAS):Early Experience

    Energy Technology Data Exchange (ETDEWEB)

    Kapoor, R; Palta, J; Hagan, M [National Radiation Oncology Program (10P4H), Dept. of Veterans Affairs, Richmond, VA (United States); Burkett, D; Leidholdt, E [National Health Physics Program (10P4X), Dept. of Veterans Affairs, Little Rock, AR (United States)

    2016-06-15

    Background & Purpose: RIRAS is a web-based information system deployed on the Veterans Health Administration intranet in early 2014 to collect adverse events and good catch data; analyze the causes and contributing factors; and find ways to prevent future occurrences. Material and Methods: Incident learning consists of a feedback loop which starts with reporting an event, followed by analysis of contributing factors, and culminates in the development of a patient safety work product (PSWP) to prevent recurrence. RIRAS permits both anonymous and non-anonymous reporting. Each report is analyzed by a team of medical physicists who are independent of the reporting facility. The analysts usually contact the reporting facilities for additional information. We analyzed all reports and held telephonic interviews (when necessary) with the reporters. We then generated PSWPs with corrective/preventive and learning actions. Anonymous reporting is handled in the same manner, except without the ability to further interview the reporter. Results: In a significant number of reports, the causes and recommended preventive actions were considerably altered by the independent analysis and additional information from the facility. 130 reports have been entered in RIRAS; 9 misadministrations, 83 good catches, 3 anonymous good catches, and 35 earlier reported incidents from FY2005-14. 45% of the reported incidents occurred in the treatment delivery stages, 19% in on-treatment management, and 16% in pre-treatment verification. 80% of the good catches were found in the treatment delivery workflow. Majority of these incidents were due to inconsistent patient setup instructions or documentation, nonadherence to policies and procedures, lax time-out policy, distracted RTTs, and inadequate RTT staffing. Conclusion: RIRAS has identified many areas for improvement and elevated the quality and safety of radiation treatments in the VHA. We found that the ability to learn is significantly diminished when the analysts do not have the ability to request additional information.

  20. 47 CFR 80.223 - Special requirements for survival craft stations.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 5 2010-10-01 2010-10-01 false Special requirements for survival craft... requirements for survival craft stations. (a) Survival craft stations capable of transmitting on: (1) 2182 kHz... operate with A3E or A3N emission. (b) Survival craft stations must be able to receive the frequency and...

  1. 36 CFR 223.195 - Procedures for identifying and marking unprocessed timber.

    Science.gov (United States)

    2010-07-01

    ... procedures required herein. (f) Waiver of branding requirements. Regional Foresters may waive the branding... individual timber sale basis, all or a portion of the branding requirements pursuant to paragraph (c)(2) of...) Regions 5 and 6. On an individual timber sale basis, the branding requirement pursuant to paragraph (c)(2...

  2. 78 FR 13395 - Meeting: RTCA Special Committee 223, Airport Surface Wireless Communications

    Science.gov (United States)

    2013-02-27

    ... Review: Convergence Sub-layer. Security. MAC Layer. Physical Layer. PICS. CRSL. Review/Approval of MOPS... Washington, DC, on February 21, 2013. Paige Williams, Management Analyst, NextGen, Business Operations Group...

  3. Sud du Sahara | Page 223 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    . Langue French. Read more about Pauvreté et vulnérabilité environnementale dans les bidonvilles en pleine croissance en Angola. Langue French. Read more about Les SIG-P au service d'une gestion durable des ressources naturelles et ...

  4. 76 FR 72996 - Eleventh Meeting: RTCA Special Committee 223 Airport Surface Wireless Communications

    Science.gov (United States)

    2011-11-28

    ... Remarks by Special Committee Leadership Designated Federal Official (DFO): Mr. Brent Phillips Co-Chair: Mr... SESAR P15.2.7 Profiles Definition for AeroMACS Chap 8--Physical Layer--Updates per WiMAX Forum Chap 5...

  5. 75 FR 66423 - Seventh Meeting: RTCA Special Committee 223: Airport Surface Wireless Communications

    Science.gov (United States)

    2010-10-28

    ..., Administrative Remarks by Special Committee Leadership Designated Federal Official (DFO): Mr. Brent Phillips Co... Session User Services and Applications Definition Wednesday Afternoon--Reconvene Plenary Profiles WG...

  6. 36 CFR 223.86 - Bid restriction on resale of noncompleted contract.

    Science.gov (United States)

    2010-07-01

    ... AGRICULTURE SALE AND DISPOSAL OF NATIONAL FOREST SYSTEM TIMBER Timber Sale Contracts Advertisement and Bids... business entity or the successor in interest of any of the foregoing business entities. A person is an...

  7. People and things. CERN Courier, April 1982, v. 22(3)

    International Nuclear Information System (INIS)

    Anon.

    1982-01-01

    The article reports on achievements of various people, staff changes and position opportunities within the CERN organization and contains news updates on upcoming or past events. Now that the LEP electron-positron collider project is under way at CERN, decisions have been taken on the management of the machine construction and on preparations for the experimental programme.In bad shape with the 1982 budget inherited from the previous administration, the US high energy physics funding has been reviewed by the Reagan administration in the light of the current US economic situation. In the meantime the US High Energy Physics Advisory Panel (HEPAP) formed a committee under the chairmanship of George Trilling to look at the implications of different possible funding levels for the long range planning of US high energy physics. Work on the 3.8 km circumference ISABELLE tunnel began in 1978 and is now largely complete. The Tevatron II project at Fermilab to convert the Energy Saver to full 1000 GeV experimental operation has received US government authorization. Some 150 physicists met at SLAC recently to discuss reports on the experimental prospects at the SLAC Linear Collider (SLC). This meeting concluded the first phase of study for the SLC physics programme. More news from the CESR electron-positron ring at Cornell to update our recent story. After further operation with the new mini-beta insertions, normal operating luminosity has been improved by a factor of three

  8. 49 CFR Appendix B to Part 223 - Schedule of Civil Penalties 1

    Science.gov (United States)

    2010-10-01

    ... convenience, penalty citations will cite the CFR section and the penalty code, if any. FRA reserves the right... assessed against an individual only for a willful violation. The Administrator reserves the right to assess...

  9. 48 CFR 1552.223-71 - EPA Green Meetings and Conferences.

    Science.gov (United States)

    2010-10-01

    ... provision or language substantially the same as the provision in solicitations for meetings and conference services. EPA Green Meetings and Conferences (MAY 2007) (a) The mission of the EPA is to protect human... information about environmentally preferable features and practices your facility will have in place for the...

  10. 12 CFR 223.32 - What rules apply to financial subsidiaries of a member bank?

    Science.gov (United States)

    2010-01-01

    ... financial subsidiary. If a financial subsidiary is consolidated with its parent member bank under GAAP, the... equal to the carrying value of the securities on parent-only financial statements of the member bank... bank's parent-only GAAP financial statements is $500. The member bank initially must value the...

  11. 36 CFR 223.193 - Procedures for reporting acquisition and disposition of unprocessed Federal timber.

    Science.gov (United States)

    2010-07-01

    ... for the calendar year listing, by company, from whom the timber was acquired; the date of acquisition... certificate stating that: (i) The certifier has read and understands the form; (ii) The certifier is eligible... applicable laws. (b) Transfer of unprocessed National Forest System timber. Each person who transfers to...

  12. Guaviare: Reencontrando Espacios e Identidades (pág. 216-223

    Directory of Open Access Journals (Sweden)

    Cristian Alexis Gil Ruiz

    2010-07-01

    Full Text Available La riqueza colombiana está en las selvas, claro, la faunística y florística que enluce a nuestro querido país, a continuación les mostraré rasgos de esa riqueza encontrada en el departamento del Guaviare, más exactamente en la vereda cerro azul, en un sitio llamado Cerro pinturas y que es un patrimonio cultural y arqueológico del departamento, espacios como hay en muchos escenarios de Colombia , que es un país hermoso, con varios sitios que no se han visitado, y que son dignos de ver, es triste que como estudiantes, como docentes en formación y más que todo, como colombianos, nos estemos perdiendo estas oportunidades. Además de ello debe entenderse al docente como un sujeto no sólo educativo, también es un sujeto con vocación social, política y cultural y que sea como sea, es un ciudadano y nunca dejara de serlo, así que como docentes es nuestro deber apropiarnos de sitios como éste y educar para que sean admirados, protegidos y sobre todo respetados.

  13. 48 CFR 52.223-3 - Hazardous Material Identification and Material Safety Data.

    Science.gov (United States)

    2010-10-01

    ... offeror is the actual manufacturer of these items. Failure to submit the Material Safety Data Sheet prior... data. (f) Neither the requirements of this clause nor any act or failure to act by the Government shall... resistant envelope. [56 FR 55375, Oct. 25, 1991, as amended at 60 FR 34740, July 3, 1995; 62 FR 238, Jan. 2...

  14. 48 CFR 52.223-18 - Contractor Policy to Ban Text Messaging While Driving.

    Science.gov (United States)

    2010-10-01

    ...-mailing, instant messaging, obtaining navigational information, or engaging in any other form of electronic data retrieval or electronic data communication. The term does not include glancing at or...

  15. Iu. Ushakov & A. Stukalov, Front voennykh prokurorov [The Military Procurators’ Front], Moskva, Viatka, 2000, 223 pages.

    Directory of Open Access Journals (Sweden)

    Vanessa Voisin

    2008-07-01

    Full Text Available Front voennykh prokurorov is a collection of essays written by two writers who are not known as specialists of military history, but obviously have access to archives, as proves the reprint, in the middle of the book, of several pages from the personal files of Afanas’ev, former Main Military Prosecutor of Soviet Armed Forces.The first part of the book is devoted to Nikolai Porfir’evich Afanas’ev’s memoirs, written, according to the editors, after his retirement in 1950. Afanas’ev, though les...

  16. 29 CFR 779.223 - Control where ownership vested in individual or single organization.

    Science.gov (United States)

    2010-07-01

    ... single business organization. Ownership sufficient to exercise “control” exist also where there is more... in individual or single organization. Ownership, sufficient to exercise “control,” of course, exists... “control” may exist with much more limited ownership, and, in certain cases exists in the absence of any...

  17. 50 CFR 223.102 - Enumeration of threatened marine and anadromous species.

    Science.gov (United States)

    2010-10-01

    ..., Panama, Venezuela and all the islands of the West Indies. 71 FR 26852, May 9, 2006 73 FR 72210, Nov. 26..., Honduras, Mexico, Nicaragua, Panama, Venezuela and all the islands of the West Indies. 71 FR 26852, May 9... segments (DPSs) (for a policy statement, see 61 FR 4722, February 7, 1996), and evolutionarily significant...

  18. : tous les projets | Page 223 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Sujet: INTERNATIONAL FINANCE, INTERNATIONAL FINANCIAL MARKET, FINANCIAL POLICY, DEMOGRAPHY, DEMOGRAPHIC CHANGE, DEMOGRAPHIC TRANSITION. Région: Brazil, South America, China, Far East Asia, India, South Africa, North of Sahara, South of Sahara, North and Central America, Central Asia, ...

  19. 36 CFR 223.30 - Consistency with plans, environmental standards, and other management requirements.

    Science.gov (United States)

    2010-07-01

    ... Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE SALE AND DISPOSAL OF NATIONAL FOREST SYSTEM TIMBER...) Providing favorable conditions of water flow and quality; (f) Utilization of the timber resource to provide... characteristics; (g) Reduction of the likelihood of loss to destructive agencies; and (h) Minimizing adverse...

  20. 33 CFR 223.1 - Mississippi River Water Control Management Board.

    Science.gov (United States)

    2010-07-01

    ..., responsibilities and authority of the Mississippi River Water Control Management Board. (b) Applicability. This... control management within the Mississippi River Basin. (c) Objectives. The objectives of the Board are: (1...) Composition. The Mississippi River Water Control Management Board is a continuing board consisting of the...

  1. 75 FR 44306 - Fifth Meeting: RTCA Special Committee 223: Airport Surface Wireless Communications

    Science.gov (United States)

    2010-07-28

    ....--Overview of AeroMACS test and evaluation results summary--Mr. Ward Hall. 0930 a.m.--Selected AeroMACS fixed...-Chair: Mr. Ward Hall, ITT Corporation. 0915 a.m.--Agenda Overview. Fill out lunch orders. 0930 a.m...

  2. 76 FR 20436 - Ninth Meeting: RTCA Special Committee 223: Airport Surface Wireless Communications

    Science.gov (United States)

    2011-04-12

    ... Phillips [ssbox] Co-Chair: Mr. Aloke Roy, Honeywell International [ssbox] Co-Chair: Mr. Ward Hall, ITT... Signal-in-space requirements Interface Requirements Interoperability requirements Tour of WiMAX testing...

  3. 36 CFR 223.103 - Award of small business set-aside sales.

    Science.gov (United States)

    2010-07-01

    ....103 Award of small business set-aside sales. If timber is advertised as set aside for competitive bidding by small business concerns, award will be made to the highest bidder who qualifies as a small... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Award of small business set...

  4. Quantitative single-particle digital autoradiography with α-particle emitters for targeted radionuclide therapy using the iQID camera

    Energy Technology Data Exchange (ETDEWEB)

    Miller, Brian W., E-mail: brian.miller@pnnl.gov [Pacific Northwest National Laboratory, Richland, Washington 99354 and College of Optical Sciences, The University of Arizona, Tucson, Arizona 85719 (United States); Frost, Sofia H. L.; Frayo, Shani L.; Kenoyer, Aimee L.; Santos, Erlinda; Jones, Jon C.; Orozco, Johnnie J. [Fred Hutchinson Cancer Research Center, Seattle, Washington 98109 (United States); Green, Damian J.; Press, Oliver W.; Pagel, John M.; Sandmaier, Brenda M. [Fred Hutchinson Cancer Research Center, Seattle, Washington 98109 and Department of Medicine, University of Washington, Seattle, Washington 98195 (United States); Hamlin, Donald K.; Wilbur, D. Scott [Department of Radiation Oncology, University of Washington, Seattle, Washington 98195 (United States); Fisher, Darrell R. [Dade Moeller Health Group, Richland, Washington 99354 (United States)

    2015-07-15

    Purpose: Alpha-emitting radionuclides exhibit a potential advantage for cancer treatments because they release large amounts of ionizing energy over a few cell diameters (50–80 μm), causing localized, irreparable double-strand DNA breaks that lead to cell death. Radioimmunotherapy (RIT) approaches using monoclonal antibodies labeled with α emitters may thus inactivate targeted cells with minimal radiation damage to surrounding tissues. Tools are needed to visualize and quantify the radioactivity distribution and absorbed doses to targeted and nontargeted cells for accurate dosimetry of all treatment regimens utilizing α particles, including RIT and others (e.g., Ra-223), especially for organs and tumors with heterogeneous radionuclide distributions. The aim of this study was to evaluate and characterize a novel single-particle digital autoradiography imager, the ionizing-radiation quantum imaging detector (iQID) camera, for use in α-RIT experiments. Methods: The iQID camera is a scintillator-based radiation detection system that images and identifies charged-particle and gamma-ray/x-ray emissions spatially and temporally on an event-by-event basis. It employs CCD-CMOS cameras and high-performance computing hardware for real-time imaging and activity quantification of tissue sections, approaching cellular resolutions. In this work, the authors evaluated its characteristics for α-particle imaging, including measurements of intrinsic detector spatial resolutions and background count rates at various detector configurations and quantification of activity distributions. The technique was assessed for quantitative imaging of astatine-211 ({sup 211}At) activity distributions in cryosections of murine and canine tissue samples. Results: The highest spatial resolution was measured at ∼20 μm full width at half maximum and the α-particle background was measured at a rate as low as (2.6 ± 0.5) × 10{sup −4} cpm/cm{sup 2} (40 mm diameter detector area

  5. Quantitative single-particle digital autoradiography with α-particle emitters for targeted radionuclide therapy using the iQID camera.

    Science.gov (United States)

    Miller, Brian W; Frost, Sofia H L; Frayo, Shani L; Kenoyer, Aimee L; Santos, Erlinda; Jones, Jon C; Green, Damian J; Hamlin, Donald K; Wilbur, D Scott; Fisher, Darrell R; Orozco, Johnnie J; Press, Oliver W; Pagel, John M; Sandmaier, Brenda M

    2015-07-01

    Alpha-emitting radionuclides exhibit a potential advantage for cancer treatments because they release large amounts of ionizing energy over a few cell diameters (50-80 μm), causing localized, irreparable double-strand DNA breaks that lead to cell death. Radioimmunotherapy (RIT) approaches using monoclonal antibodies labeled with α emitters may thus inactivate targeted cells with minimal radiation damage to surrounding tissues. Tools are needed to visualize and quantify the radioactivity distribution and absorbed doses to targeted and nontargeted cells for accurate dosimetry of all treatment regimens utilizing α particles, including RIT and others (e.g., Ra-223), especially for organs and tumors with heterogeneous radionuclide distributions. The aim of this study was to evaluate and characterize a novel single-particle digital autoradiography imager, the ionizing-radiation quantum imaging detector (iQID) camera, for use in α-RIT experiments. The iQID camera is a scintillator-based radiation detection system that images and identifies charged-particle and gamma-ray/x-ray emissions spatially and temporally on an event-by-event basis. It employs CCD-CMOS cameras and high-performance computing hardware for real-time imaging and activity quantification of tissue sections, approaching cellular resolutions. In this work, the authors evaluated its characteristics for α-particle imaging, including measurements of intrinsic detector spatial resolutions and background count rates at various detector configurations and quantification of activity distributions. The technique was assessed for quantitative imaging of astatine-211 ((211)At) activity distributions in cryosections of murine and canine tissue samples. The highest spatial resolution was measured at ∼20 μm full width at half maximum and the α-particle background was measured at a rate as low as (2.6 ± 0.5) × 10(-4) cpm/cm(2) (40 mm diameter detector area). Simultaneous imaging of multiple tissue sections was

  6. Çakır et al., Afr J Tradit Complement Altern Med. (2016) 13(2):223 ...

    African Journals Online (AJOL)

    asus

    attack, oxidative stress occurs, free radicals are produced and membrane lipid peroxidation happens, all of which cause tissue damage (İlhan et al., 2005). .... in memory to store data was used for the physical exercise. In order to avoid any .... exercise retarded amygdala kindling development in rats. One of the mechanisms ...

  7. 48 CFR 952.223-76 - Conditional payment of fee or profit-safeguarding restricted data and other classified...

    Science.gov (United States)

    2010-10-01

    ... disclosure of Top Secret Restricted Data or other information classified as Top Secret, any classification... result in the loss, compromise, or unauthorized disclosure of Top Secret Restricted Data, or other information classified as Top Secret, any classification level of information in a SAP, information identified...

  8. 36 CFR 223.203 - Indirect substitution exception for National Forest System timber from within Washington State.

    Science.gov (United States)

    2010-07-01

    ... unprocessed timber was limited to whichever is less: (i) The higher of the applicant's actual purchase.... (b) Application, review and approval process. To obtain a share of the 50 million board feet exempted.... Applicants were notified of the approving official's decision by letter. If approved, the amount of the...

  9. Velocity dependence of the Penning ionization of D atoms by He(21S) and H2(23S) atoms

    International Nuclear Information System (INIS)

    Fort, J.; Laucagne, J.J.; Pesnelle, A.; Watel, G.

    1975-01-01

    A time-of-flight technique has been developed for the study of the velocity dependence of the cross section for Penning ionization of D atoms by metastable He atoms: He(2 1 S)+D→He(1 1 S)+D + +e - , He(2 3 S)+D→He(1 1 S)+D + e - [fr

  10. Practices And Opinions On In-Center Food Consumption Across 1,223 Facilities In The United States

    Directory of Open Access Journals (Sweden)

    Deborah Benner

    2012-06-01

    The top reasons for facility practices that allowed eating during dialysis were: prevention of hypoglycemia on dialysis, improved kcal intake on dialysis days, and the opportunity to provide counseling on food products currently chosen by the patient. The top reasons for facility practices not permitting eating during dialysis included: potential adverse events associated with hypotension, GI symptoms, choking, infection, pest control, and spills. Further analyses are warranted to determine whether there is a correlation between allowing patients to eat during dialysis treatment and an improvement in the nutritional status of the patients.

  11. 12 CFR 223.14 - What are the collateral requirements for a credit transaction with an affiliate?

    Science.gov (United States)

    2010-01-01

    ... issued by the member bank that represent regulatory capital of the member bank; (4) Intangible assets (including servicing assets), unless specifically approved by the Board; and (5) Guarantees, letters of... following items are not eligible collateral for purposes of this section: (1) Low-quality assets; (2...

  12. 12 CFR 223.41 - What covered transactions are exempt from the quantitative limits and collateral requirements?

    Science.gov (United States)

    2010-01-01

    ... same company controls 80 percent or more of the voting securities of the member bank and the depository... is part of an internal corporate reorganization of a holding company and involves the transfer of all... institution transactions. Transactions with a depository institution if the member bank controls 80 percent or...

  13. Archeological Data Recovery of the Camino Site (16JE223), A Spanish Colonial Period Site Near New Orleans, Louisiana

    Science.gov (United States)

    1996-03-01

    artifacts in the food consumption subcategory include cutlery , tableware, tin cans, pots and pans, and stoves. Cutlery and metal tableware relate to...general pattern of seed use is reflected. Various sedges have edible or medicinal plant parts, as do members of the Polygonaceae family. Considering

  14. Xp22.3 genomic deletions involving the CDKL5 gene in girls with early onset epileptic encephalopathy.

    Science.gov (United States)

    Mei, Davide; Marini, Carla; Novara, Francesca; Bernardina, Bernardo D; Granata, Tiziana; Fontana, Elena; Parrini, Elena; Ferrari, Anna R; Murgia, Alessandra; Zuffardi, Orsetta; Guerrini, Renzo

    2010-04-01

    Mutations of the X-linked gene cyclin-dependent kinase-like 5 (CDKL5) cause an X-linked encephalopathy with early onset intractable epilepsy, including infantile spasms and other seizure types, and a Rett syndrome (RTT)-like phenotype. Very limited information is available on the frequency and phenotypic spectrum associated with CDKL5 deletions/duplications. We investigated the role of CDKL5 deletions/duplications in causing early onset intractable epilepsy of unknown etiology in girls. We studied 49 girls with early onset intractable epilepsy, with or without infantile spasms, and developmental impairment, for whom no etiologic factors were obvious after clinical examination, brain magnetic resonance imaging (MRI) and expanded screening for inborn errors of metabolism. We performed CDKL5 gene mutation analysis in all and multiplex ligation dependent probe amplification assay (MLPA) in those who were mutation negative. Custom Array-comparative genomic hybridization (CGH), breakpoint polymerase chain reaction (PCR) analysis, and X-inactivation studies were performed in patients in whom MLPA uncovered a genomic alteration. We found CDKL5 mutations in 8.2% (4 of 49) of patients and genomic deletions in 8.2% (4 of 49). Overall, abnormalities of the CDKL5 gene accounted for 16.3% (8 of 49) of patients. CDKL5 gene deletions are an under-ascertained cause of early onset intractable epilepsy in girls. Genetic testing of CDKL5, including both mutation and deletion/duplication analysis, should be considered in this clinical subgroup.

  15. Using a Classification of Occupations to Describe Age, Sex, and Time Differences in Employment Patterns. Report No. 223.

    Science.gov (United States)

    Gottfredson, Gary D.; Daiger, Denise C.

    Employment data from the 1960 and 1970 censuses were organized using the occupational classification system of John Holland to examine age, sex, and level differences in employment and to detect changes over the 10-year period. Data were organized by both kind and level of work in an attempt to answer the following questions: What are the relative…

  16. Vol. 4(1), S/No 13, January, 2015:207-223 ISSN: 2225-8590 (Print ...

    African Journals Online (AJOL)

    DR Nneka

    2015-01-13

    Jan 13, 2015 ... and it investigated the rate at which the Nigerian media had been prevented from expressing .... military systems. In these systems all media of communication were under the ..... Media law and ethics. Students' Course ...

  17. 48 CFR 952.223-77 - Conditional payment of fee or profit-protection of worker safety and health.

    Science.gov (United States)

    2010-10-01

    ... aspects of an ISMS that results in a near miss of a Type A or B accident. A near miss is a situation in... contracts including ISMS requirements, failure to develop and obtain required DOE approval of WS&H aspects... timely manner and will not unreasonably withhold approval of the WS&H aspects of the Contractor's ISMS...

  18. 75 FR 60655 - Airworthiness Directives; Airbus Model A330-201, -202, -203, -223, and -243 Airplanes; Airbus...

    Science.gov (United States)

    2010-10-01

    ... time during which fuel tanks are exposed to flammable conditions is one of these criteria. The other... flammable fuel vapors, could result in fuel tank explosions and consequent loss of the airplane. [[Page... information and, in general, agree with their substance. But we might have found it necessary to use different...

  19. Study of 223Ra uptake mechanism by Fe3O4 nanoparticles: towards new prospective theranostic SPIONs

    Czech Academy of Sciences Publication Activity Database

    Mokhodoeva, O.; Vlk, M.; Málková, E.; Kukleva, E.; Mičolová, P.; Štamberg, K.; Šlouf, Miroslav; Dzhenloda, R.; Kozempel, J.

    2016-01-01

    Roč. 18, č. 10 (2016), s. 1-12, č. článku 301. ISSN 1388-0764 R&D Projects: GA MZd(CZ) NV16-30544A; GA TA ČR(CZ) TE01020118; GA MŠk(CZ) LO1507 Institutional support: RVO:61389013 Keywords : magnetic nanoparticles * radium * sorption Subject RIV: CD - Macromolecular Chemistry Impact factor: 2.020, year: 2016

  20. 49 CFR 40.223 - What steps must be taken to protect the security of alcohol testing sites?

    Science.gov (United States)

    2010-10-01

    ... alcohol test for only one employee at a time. (1) When an EBT screening test on an employee indicates an... the first employee. (2) As a BAT who will conduct both the screening and the confirmation test, you are to complete the entire screening and confirmation process on one employee before starting the...

  1. P2-23: Deficits on Preference but Not Attention in Patients with Depression: Evidence from Gaze Cue

    Directory of Open Access Journals (Sweden)

    Jingling Li

    2012-10-01

    Full Text Available Gaze is an important social cue and can easily capture attention. Our preference judgment is biased by others' gaze; that is, we prefer objects gazed by happy or neutral faces and dislike objects gazed by disgust faces. Since patients with depression have a negative bias in emotional perception, we hypothesized that they may have different preference judgment on the gazed objects than healthy controls. Twenty-one patients with major depressive disorder and 21 healthy age-matched controls completed an object categorization task and then rated their preference on those objects. In the categorization task, a schematic face either gazed toward or away from the to-be-categorized object. The results showed that both groups categorized faster for gazed objects than non-gazed objects, suggesting that patients did not have deficits on their attention to gaze cues. Nevertheless, healthy controls preferred gazed objects more than non-gazed objects, while patients did not have significant preference. Our result indicated that patients with depression have deficits on their social cognition rather than basic attentional mechanism.

  2. 40 CFR 421.223 - Effluent limitations guidelines representing the degree of effluent reduction attainable by the...

    Science.gov (United States)

    2010-07-01

    ...) Vanadium decomposition wet air pollution control. BAT Limitations for the Secondary Molybdenum and Vanadium... (d) Molybdenum drying wet air pollution control. BAT Limitations for the Secondary Molybdenum and... representing the degree of effluent reduction attainable by the application of the best available technology...

  3. SPECT assay of radiolabeled monoclonal antibodies. Final performance report, March 1992--November 1995

    International Nuclear Information System (INIS)

    Jaszczak, R.J.

    1995-12-01

    Research is described in the following areas: development and evaluation quantitatively of reconstruction algorithms with improved compensations for attenuation, scatter, and geometric collimator response; evaluation of single photon emission computed tomography (SPECT) quantification of iodine 123 and astatine 211; and the development and evaluation of SPECT pinhole imaging for low and medium energy photons

  4. SPECT assay of radiolabeled monoclonal antibodies. Final performance report, March 1992--November 1995

    Energy Technology Data Exchange (ETDEWEB)

    Jaszczak, R.J.

    1995-12-01

    Research is described in the following areas: development and evaluation quantitatively of reconstruction algorithms with improved compensations for attenuation, scatter, and geometric collimator response; evaluation of single photon emission computed tomography (SPECT) quantification of iodine 123 and astatine 211; and the development and evaluation of SPECT pinhole imaging for low and medium energy photons.

  5. Negative Ion Source Development and Photodetachment Studies at ISOLDE

    CERN Document Server

    AUTHOR|(CDS)2254068; Hanstorp, Dag; Rothe, Sebastian

    Astatine is one of the rarest elements on earth. The small amount of existing astatine is either created in decay chains of heavier elements or artificially. One of its longer lived isotopes, 211At, is of interest for targeted alpha therapy, a method of treating cancer by using the alpha decay of radioactive elements directly at the location of a tumor. However, its chemical properties are yet to be determined due to the short life time of astatine. A milestone towards the determination of the electronegativity of astatine was the measurement of its ionization potential (IP) at CERN-ISOLDE. However, its electron affinity (EA, the binding energy of the additional electron in a negative ion), is still to be measured. In order to determine the EA of radioisotopes by laser photodetachment spectroscopy, the Gothenburg ANion Detector for Affinity measurements by Laser Photodetachment (GANDALPH) has been built in recent years. As a proof-of-principle, the EA of the 128I negative ion, produced at the CERN-ISOLDE rad...

  6. An Expert System for Managing Storage Space Constraints Aboard United States Naval Vessels

    Science.gov (United States)

    1991-12-01

    d. solvents, thinners, primers, cmpounds, varnishes , and lacquers i e. alcohol, acetone, ether, and naphtha; f. greases * nd pastes Except for...suffocation. Malocarbon liquids are compounds of carbon containing any of the halogen elements ( fluorine , chlorine, bromine, iodine, or astatine. (Examples are

  7. Workshop on selected aspects of radiochemistry

    International Nuclear Information System (INIS)

    1991-11-01

    The aspects chosen for the workshop are: isotope preparation, separation methods; radiochemical methods and analyses; environmental protection and radiochemistry; the chemistry of the fifth halogen, astatine. From the 28 contributions presented at the workshop, 24 are of relevance in the INIS and EDB scope and are separately retrievable from the database. (BBR) [de

  8. Development and therapeutic application of internally emitting radiopharmaceuticals

    International Nuclear Information System (INIS)

    Adelstein, S.J.; Bloomer, W.D.

    1980-01-01

    This project is concerned with developing the potential of alpha-emitting radionuclides as agents for radiotherapy. Among the available α-emitters, astatine-211 appears most promising for testing the efficacy of α-emitters for therapeutic applications because: (1) it has some chemical similarities to iodine, an element that can readily be incorporated into numerous proteins and peptides; (2) it has a half life that is long enough to permit chemical manipulation yet short enough to minimize destruction of healthy cells; and (3) α-emission is associated with 100% of its decays. If appropriate biological carriers can be labeled with an alpha emitter such as 211 At, they could be of great utility in several areas of therapeutic medicine where elimination of specific cell populations is desired. While previous attempts to astatinate proteins using standard iodination techniques have been unsuccessful, effective labeling of proteins with astatine by first synthesizing an aryl astatide and then coupling this compound to the protein via an acylation has been achieved. Undergoing current investigation are several different aryl astatide-followed-by-acylation approaches including an astatinated Bolton-Hunter type reagent using concanavalin A (ConA) and melanocyte stimulating hormone (MSH) as model compounds

  9. $\\beta$-delayed fission, laser spectroscopy and shape-coexistence studies with radioactive At beams

    CERN Multimedia

    We propose to study the $\\beta$-delayed fission, laser spectroscopy and radioactive decay of the newly available pure beams of neutron-deficient and neutron-rich astatine (Z=85) isotopes. The fission probability and the fission fragment distribution of the even-even isotopes $^{194,196}$Po following the $\\beta$-decay of the isotopes $^{194,196}$At will be studied with the Windmill setup. In-source laser spectroscopy will be performed on the entire astatine isotopic chain, using a combination of the Windmill setup, ISOLTRAP MR-ToF and ISOLDE Faraday. Radioactive decay data will be acquired at the Windmill setup throughout those studies and contribute to the global understanding of the phenomenon of shape coexistence in the neutron-deficient lead region.

  10. 12 CFR 223.31 - How does section 23A apply to a member bank's acquisition of an affiliate that becomes an...

    Science.gov (United States)

    2010-01-01

    ... depreciation of the assets of the transferred company, to the extent that such reductions are consistent with GAAP; and (ii) Sales of the assets of the transferred company. (c) Valuation example. The parent...

  11. Treatment of Bone Metastases with Radium-223 in Patients with Castration Resistant Prostate Cancer (CRPC): Alternative or Complementary to Innovative Molecular Therapies?

    International Nuclear Information System (INIS)

    Bombardieri, Emilio

    2013-01-01

    The skeletal metastatic disease is a real clinical problem. Approximately 70% of patients with prostate or breast cancer and 35% of those with advanced lung, thyroid, and kidney cancers will develop skeletal metastases, which cause considerable morbidity. Several options are available for treatment, to be used either alone or in various combinations: hormones in case of hormone-sensitive tumours, chemotherapy, biphosphonates, external beam radiation therapy, surgery (in pathologic or impending fracture), bone-seeking radiopharmceuticals, and also molecular therapies. Focusing our attention to patients with prostate cancer, 50% of patients with bone metastases develop skeletal related events (SREs) such as: severe pain, pathologic fractures, spinal compression syndrome, malignant hypercalcemia, bone marrow suppression. All these SREs require adequate therapy since generally determine several functional impairments and worsen the prognosis. It is well known that skeletal complications reduce the quality of life affecting different aspects, physical, functional end emotional. SREs are associated also with lower survival

  12. Discriminant effect of morphology and range of attack on the performance level of volleyball players. DOI: 10.5007/1980-0037.2011v13n3p223

    Directory of Open Access Journals (Sweden)

    Victor Machado Reis

    2011-04-01

    Full Text Available The aim of this study was to identify the discriminant effect of morphology and range of attack-related variables on the performance level of under-17 female volleyball players. The sample consisted of young volleyball players (n=40 divided into two groups: players of the Brazilian national team (n=21 aged 15.86 ± 0.36 years, body weight of 68.11 ± 8.73 kg, and height of 181.61 ± 6.11 cm, and players of the state team of Rio Grande do Norte (n=19 aged 15.16 ± 0.88 years, body weight of 60.54 ± 7.60 kg, and height of 170.52 ± 7.97 cm. The somatotype was assessed using the Heath & Carter method. A modified Sargent test was used to assess vertical jump height and maximum attack height. The measures were compared between the two groups using the Student t-test for independent samples. Discriminant function analysis was applied to predict group allocation using the measures obtained as independent variables. The two groups differed significantly in terms of body weight, fat mass, height, maximum attack height, range of attack, and somatotype. Discriminant function analysis identified the somato-type measures (endomorphy, ectomorphy, and mesomorphy with correlation coefficients below 0.30. The canonical correlation coefficient obtained with this function was 0.856. In conclusion, somatotype or vertical jump ability does not seem to distinguish elite athletes from non-elite athletes in under-17 female volleyball players, and height is the main morphological determinant to achieve elite level performance.

  13. SU-E-J-223: A BOLD Contrast Imaging Sequence to Evaluate Oxygenation Changes Due to Breath Holding for Breast Radiotherapy: A Pilot Study

    Energy Technology Data Exchange (ETDEWEB)

    Adamson, J; Chang, Z; Cai, J; Palta, M; Horton, J; Yin, F; Blitzblau, R [Duke University Medical Center, Durham, NC (United States)

    2015-06-15

    Purpose: To develop a robust MRI sequence to measure BOLD breath hold induced contrast in context of breast radiotherapy. Methods: Two sequences were selected from prior studies as candidates to measure BOLD contrast attributable to breath holding within the breast: (1) T2* based Gradient Echo EPI (TR/TE = 500/41ms, flip angle = 60°), and (2) T2 based Single Shot Fast Spin Echo (SSFSE) (TR/TE = 3000/60ms). We enrolled ten women post-lumpectomy for breast cancer who were undergoing treatment planning for whole breast radiotherapy. Each session utilized a 1.5T GE MRI and 4 channel breast coil with the subject immobilized prone on a custom board. For each sequence, 1–3 planes of the lumpectomy breast were imaged continuously during a background measurement (1min) and intermittent breath holds (20–40s per breath hold, 3–5 holds per sequence). BOLD contrast was quantified as correlation of changes in per-pixel intensity with the breath hold schedule convolved with a hemodynamic response function. Subtle motion was corrected using a deformable registration algorithm. Correlation with breath-holding was considered significant if p<0.001. Results: The percentage of the breast ROI with positive BOLD contrast measured by the two sequences were in agreement with a correlation coefficient of R=0.72 (p=0.02). While both sequences demonstrated areas with strong BOLD response, the response was more systematic throughout the breast for the SSFSE (T2) sequence (% breast with response in the same direction: 51.2%±0.7% for T2* vs. 68.1%±16% for T2). In addition, the T2 sequence was less prone to magnetic susceptibility artifacts, especially in presence of seroma, and provided a more robust image with little distortion or artifacts. Conclusion: A T2 SSFSE sequence shows promise for measuring BOLD contrast in the context of breast radiotherapy utilizing a breath hold technique. Further study in a larger patient cohort is warranted to better refine this novel technique.

  14. Fluorine-18-fluorocholine PET/CT parameters predictive for hematological toxicity to radium-223 therapy in castrate-resistant prostate cancer patients with bone metastases: a pilot study.

    Science.gov (United States)

    Vija Racaru, Lavinia; Sinigaglia, Mathieu; Kanoun, Salim; Ben Bouallègue, Fayçal; Tal, Ilan; Brillouet, Sévérine; Bauriaud-Mallet, Mathilde; Zerdoud, Slimane; Dierickx, Lawrence; Vallot, Delphine; Caselles, Olivier; Gabiache, Erwan; Pascal, Pierre; Courbon, Frederic

    2018-05-21

    This study aims to predict hematological toxicity induced by Ra therapy. We investigated the value of metabolically active bone tumor volume (MBTV) and total bone lesion activity (TLA) calculated on pretreatment fluorine-18-fluorocholine (F-FCH) PET/CT in castrate-resistant prostate cancer (CRPC) patients with bone metastases treated with Ra radionuclide therapy. F-FCH PET/CT imaging was performed in 15 patients with CRPC before treatment with Ra. Bone metastatic disease was quantified on the basis of the maximum standardized uptake value (SUV), total lesion activity (TLA=MBTV×SUVmean), or MBTV/height (MBTV/H) and TLA/H. F-FCH PET/CT bone tumor burden and activity were analyzed to identify which parameters could predict hematological toxicity [on hemoglobin (Hb), platelets (PLTs), and lymphocytes] while on Ra therapy. Pearson's correlation was used to identify the correlations between age, prostate-specific antigen, and F-FCH PET parameters. MBTV ranged from 75 to 1259 cm (median: 392 cm). TLA ranged from 342 to 7198 cm (median: 1853 cm). Patients benefited from two to six cycles of Ra (n=56 cycles in total). At the end of Ra therapy, five of the 15 (33%) patients presented grade 2/3 toxicity on Hb and lymphocytes, whereas three of the 15 (20%) patients presented grade 2/3 PLT toxicity.Age was correlated negatively with both MBTV (r=-0.612, P=0.015) and TLA (r=-0.596, P=0.018). TLA, TLA/H, and MBTV/H predicted hematological toxicity on Hb, whereas TLA/H and MBTV/H predicted toxicity on PLTs at the end of Ra cycles. Receiver operating characteristic curve analysis allowed to define the cutoffs for MBTV (915 cm) and TLA (4198 cm) predictive for PLT toxicity, with an accuracy of 0.92 and 0.99. Tumor bone burden calculation is feasible with F-FCH PET/CT with freely available open-source software. In this pilot study, baseline F-FCH PET/CT markers (TLA, MBTV) have shown abilities to predict Hb and PLT toxicity after Ra therapy and could be explored for patient selection and treatment optimization.This is an open-access article distributed under the terms of the Creative Commons Attribution-Non Commercial-No Derivatives License 4.0 (CCBY-NC-ND), where it is permissible to download and share the work provided it is properly cited. The work cannot be changed in any way or used commercially without permission from the journal. http://creativecommons.org/licenses/by-nc-nd/4.0/.

  15. SU-E-J-223: A BOLD Contrast Imaging Sequence to Evaluate Oxygenation Changes Due to Breath Holding for Breast Radiotherapy: A Pilot Study

    International Nuclear Information System (INIS)

    Adamson, J; Chang, Z; Cai, J; Palta, M; Horton, J; Yin, F; Blitzblau, R

    2015-01-01

    Purpose: To develop a robust MRI sequence to measure BOLD breath hold induced contrast in context of breast radiotherapy. Methods: Two sequences were selected from prior studies as candidates to measure BOLD contrast attributable to breath holding within the breast: (1) T2* based Gradient Echo EPI (TR/TE = 500/41ms, flip angle = 60°), and (2) T2 based Single Shot Fast Spin Echo (SSFSE) (TR/TE = 3000/60ms). We enrolled ten women post-lumpectomy for breast cancer who were undergoing treatment planning for whole breast radiotherapy. Each session utilized a 1.5T GE MRI and 4 channel breast coil with the subject immobilized prone on a custom board. For each sequence, 1–3 planes of the lumpectomy breast were imaged continuously during a background measurement (1min) and intermittent breath holds (20–40s per breath hold, 3–5 holds per sequence). BOLD contrast was quantified as correlation of changes in per-pixel intensity with the breath hold schedule convolved with a hemodynamic response function. Subtle motion was corrected using a deformable registration algorithm. Correlation with breath-holding was considered significant if p<0.001. Results: The percentage of the breast ROI with positive BOLD contrast measured by the two sequences were in agreement with a correlation coefficient of R=0.72 (p=0.02). While both sequences demonstrated areas with strong BOLD response, the response was more systematic throughout the breast for the SSFSE (T2) sequence (% breast with response in the same direction: 51.2%±0.7% for T2* vs. 68.1%±16% for T2). In addition, the T2 sequence was less prone to magnetic susceptibility artifacts, especially in presence of seroma, and provided a more robust image with little distortion or artifacts. Conclusion: A T2 SSFSE sequence shows promise for measuring BOLD contrast in the context of breast radiotherapy utilizing a breath hold technique. Further study in a larger patient cohort is warranted to better refine this novel technique

  16. Tourette syndrome in a pedigree with a 7;18 translocation: Identification of a YAC spanning the translocation breakpoint at 18q22.3

    Energy Technology Data Exchange (ETDEWEB)

    Boghosian-Sell, L.; Overhauser, J. [Thomas Jefferson Univ., Philadelphia, PA (United States); Comings, D.E. [City of Hope Medical Center, Duarte, CA (United States)

    1996-11-01

    Tourette syndrome is a neuropsychiatric disorder characterized by the presence of multiple, involuntary motor and vocal tics. Associated pathologies include attention deficit disorder and obsessive-compulsive disorder (OCD). Extensive linkage analysis based on an autosomal dominant mode of transmission with reduced penetrance has failed to show linkage with polymorphic markers, suggesting either locus heterogeneity or a polygenic origin for Tourette syndrome. An individual diagnosed with Tourette syndrome has been described carrying a constitutional chromosome translocation. Other family members carrying the translocation exhibit features seen in Tourette syndrome including motor tics, vocal tics, and OCD. Since the disruption of specific genes by a chromosomal rearrangement can elicit a particular phenotype, we have undertaken the physical mapping of the 7;18 translocation such that genes mapping at the site of the breakpoint can be identified and evaluated for a possible involvement in Tourette syndrome. Using somatic cell hybrids retaining either the der(7) or the der(18), a more precise localization of the breakpoints on chromosomes 7 and 18 have been determined. Furthermore, physical mapping has identified two YAC clones that span the translocation breakpoint on chromosome 18 as determined by FISH. These YAC clones will be useful for the eventual identification of genes that map to chromosomes 7 and 18 at the site of the translocation. 41 refs., 3 figs., 1 tab.

  17. Hyperspectral surface materials map of quadrangle 3670, Jurm-Kishim (223) and Zebak (224) quadrangles, Afghanistan, showing iron-bearing minerals and other materials

    Science.gov (United States)

    King, Trude V.V.; Hoefen, Todd M.; Kokaly, Raymond F.; Livo, Keith E.; Johnson, Michaela R.; Giles, Stuart A.

    2013-01-01

    This map shows the spatial distribution of selected iron-bearing minerals and other materials derived from analysis of airborne HyMap™ imaging spectrometer (hyperspectral) data of Afghanistan collected in late 2007. This map is one in a series of U.S. Geological Survey/Afghanistan Geological Survey quadrangle maps covering Afghanistan. Flown at an altitude of 50,000 feet (15,240 meters (m)), the HyMap™ imaging spectrometer measured reflected sunlight in 128 channels, covering wavelengths between 0.4 and 2.5 μm. The data were georeferenced, atmospherically corrected and converted to apparent surface reflectance, empirically adjusted using ground-based reflectance measurements, and combined into a mosaic with 23-m pixel spacing. Variations in water vapor and dust content of the atmosphere, in solar angle, and in surface elevation complicated correction; therefore, some classification differences may be present between adjacent flight lines. The reflectance spectrum of each pixel of HyMap™ imaging spectrometer data was compared to the reference materials in a spectral library of minerals, vegetation, water, and other materials. Minerals occurring abundantly at the surface and those having unique spectral features were easily detected and discriminated, while minerals having slightly different compositions but similar spectral features were less easily discriminated; thus, some map classes consist of several minerals having similar spectra, such as “Goethite and jarosite.” A designation of “Not classified” was assigned to the pixel when there was no match with reference spectra.

  18. {4,5-Dimethoxy-2-[(2,3-η-2-prop-2-en-1-yl]phenyl-κC1}(8-hydroxyquinolinato-κN,Oplatinum(II

    Directory of Open Access Journals (Sweden)

    Thi Yen Hang Bui

    2016-01-01

    Full Text Available The crystal structure of the organoplatinum(II title complex, [Pt(C9H6NO(C11H13O2] or [Pt(methyleugenol(8-hydroxyquinolinato], has been determined in order to verify the coordination environment of the PtII cation, which was found to be square-planar with the N and O atoms of the quinolinate ligand cis and trans, respectively, with respect to the ethylenic double bond. The least-squares planes through the two aromatic ring systems make an angle of 39.87 (10°. In the crystal, chains are formed parallel to [100] sustained by C—H...O hydrogen bonds. Parallel chains further interact via C—H...O and C—H...π contacts. The complex shows interesting activity on four human cancer cell lines with IC50 values between 1.92 and 4.86 µM.

  19. Safety Evaluation Report related to the renewal of the operating license for the training and research reactor at the University of Lowell (Docket No. 50-223)

    International Nuclear Information System (INIS)

    1985-11-01

    This Safety Evaluation Report for the application filed by the University of Lowell (UL) for renewal of operating license number R-125 to continue to operate its research reactor has been prepared by the Office of Nuclear Reactor Regulation of the US Nuclear Regulatory Commission. The facility is located on the North Campus of the University of Lowell in Lowell, Massachusetts. The staff concludes that the reactor can continue to be operated by the University of Lowell without endangering the health and safety of the public

  20. Deletion 21q22.3 and duplication 7q35q36.3 in a Colombian girl: a case report

    OpenAIRE

    Ruiz-Botero, Felipe; Pachajoa, Harry

    2016-01-01

    Background Genetic disorders are a major cause in the etiology of cases with intellectual disability; however, analysis by a conventional technique such as cytogenetic karyotyping only allows the detection of chromosomal alterations in approximately 9.5?% of cases. The inclusion of new technologies such as high resolution microarray analysis has allowed the study of alterations in chromosomal segments that are less than 5?Mb in length; this has led to an increase in the diagnosis of these pat...

  1. Review of Andrés Solimano, International Migration in the Age of Crisis and Globalisation. Historical and Recent Experiences, Cambridge University Press, 2010. 223 Pp.

    Directory of Open Access Journals (Sweden)

    Dirina Claudiu – Ciprian

    2015-12-01

    Full Text Available “International Migration in the Age of Crisis and Globalization. Historical and Recent Experiences” represents a work of major interest in the field of migration and globalization. Apparently two concepts that relate one to another, on a background of major population dynamics, the two notions are the two important pillars in what might perfectly be described as a complex analysis of migration, starting from the elements that have initiated it, and culminating with a fine comparison of positive and negative aspects of this phenomenon.

  2. Restrictions in Quality of Life after Intramedullary Nailing of Tibial Shaft Fracture. A retrospective follow-up study of 223 cases

    DEFF Research Database (Denmark)

    Larsen, Peter; Lund, Hans; Læssøe, Uffe

    2014-01-01

    of follow-up was 7.9 years. Compared to reference population, the study group reported 44% higher incidence of knee pain, 39% higher incidence of ADL limitations, 58% higher incidence of limitations in QOL and 60% higher incidence of limitations during sports activities. Comparison of age related...... differences between the study group and reference population showed that the age group 18-34 years reported the most difficulties. CONCLUSION::Compared with a reference population, 60% of the patients experienced limitations in activity and restrictions in QOL and 44% reported knee pain. This was mainly...

  3. 76 FR 24832 - Airworthiness Directives; Airbus Model A330-201, -202, -203, -223, and -243 Airplanes, A330-300...

    Science.gov (United States)

    2011-05-03

    ... include vacuum loss and elasticity laminate checker inspections for damage including de-bonding between... exist or develop on other products of the same type design. Differences Between This AD and the MCAI or... elasticity laminate checker inspection on the trailing edge area (Area 2) for damage including de-bonding...

  4. 12 CFR 223.3 - What are the meanings of the other terms used in sections 23A and 23B and this part?

    Science.gov (United States)

    2010-01-01

    ... investment by a member bank in a financial subsidiary that counts as a covered transaction and is required to...) “GAAP” means U.S. generally accepted accounting principles. (s) “General purpose credit card” has the...

  5. Cloning of the cDNA for a human homologue of the Drosophila white gene and mapping to chromosome 21q22.3.

    OpenAIRE

    Chen, H.; Rossier, C.; Lalioti, M. D.; Lynn, A.; Chakravarti, A.; Perrin, G.; Antonarakis, S. E.

    1996-01-01

    In an effort to contribute to the transcript map of human chromosome 21 and the understanding of the pathophysiology of trisomy 21, we have used exon trapping to identify fragments of chromosome 21 genes. Two trapped exons, from pools of chromosome 21-specific cosmids, showed homology to the Drosophila white (w) gene. We subsequently cloned the corresponding cDNA for a human homologue of the Drosophila w gene (hW) from human retina and fetal brain cDNA libraries. The gene belongs to the ATP-b...

  6. The TAL1 complex targets the FBXW7 tumor suppressor by activating miR-223 in human T cell acute lymphoblastic leukemia

    OpenAIRE

    Mansour, Marc R.; Sanda, Takaomi; Lawton, Lee N.; Li, Xiaoyu; Kreslavsky, Taras; Novina, Carl D.; Brand, Marjorie; Gutierrez, Alejandro; Kelliher, Michelle A.; Jamieson, Catriona H.M.; von Boehmer, Harald; Young, Richard A.; Look, A. Thomas

    2013-01-01

    The oncogenic transcription factor TAL1/SCL is aberrantly expressed in 60% of cases of human T cell acute lymphoblastic leukemia (T-ALL) and initiates T-ALL in mouse models. By performing global microRNA (miRNA) expression profiling after depletion of TAL1, together with genome-wide analysis of TAL1 occupancy by chromatin immunoprecipitation coupled to massively parallel DNA sequencing, we identified the miRNA genes directly controlled by TAL1 and its regulatory partners HEB, E2A, LMO1/2, GAT...

  7. A simple method for labelling proteins with 211At via diazotized aromatic diamine

    International Nuclear Information System (INIS)

    Wunderlich, G.; Franke, W.-G.; Fischer, S.; Dreyer, R.

    1987-01-01

    A simple and rapid method for labelling proteins with 211 At by means of a 1,4-diaminobenzene link is described. This link is transformed into the diazonium salt and subsequently reactions of both 211 At and proteins with the diazonium salt take place simultaneously. For possibly high yields of astatized protein an appropriate temperature of 273 K was found. The results demonstrate the difference between the reaction mechanisms of iodine and astatine with proteins. (author)

  8. The Installation Restoration Program Toxicology Guide. Volume 2

    Science.gov (United States)

    1987-05-01

    Periodic Table: fluorine , chlorine, bromine, iodine, and astatine. Fluorine is the most active of all chemical elements. 5/87 LIST OF ABBREVIATIONS...fire- retardant varnishes and as an aminizing agent for cotton fabric (901). 37.2 ENVIRONMENTAL FATE A1D EXPOSURE PATHWAYS 37.2.1 Transport in Soil...subject to packaging and labeling regulations. Directive on Paints, Varnishes . Printing Inks. Adhesives and Similar Product; (1334) Pentachlorophenol

  9. Radiohalogenation of biomolecules. An experimental study on radiohalogen preparation, precursor synthesis, radiolabeling and biodistribution

    International Nuclear Information System (INIS)

    Koziorowski, J.

    1998-01-01

    Radiohalogens are widely used in nuclear medicine, both as tool for diagnostic in vivo imaging, and in radionuclide therapy. This study deals with the use of radiohalogens; separation, precursor synthesis, labeling and biological behavior. The focus is on 211 At and 124 I, the former being a candidate for nuclide therapy and the latter potentially useful for diagnostic imaging and Auger-electron based radiotherapy. For astatine the separation, labeling and some biological behavior is described, and for iodine the latter two. Astatine was separated from an irradiated bismuth target by dry distillation. A novel cryotrap was developed for the isolation of astatine and subsequent synthesis of radiolabeled compounds. 5-[ 211 At]astato-2'-deoxyuridine (AUdR) and N-succinimidyl-4-[ 211 At]astatobenzoate (SAB) were synthesized in 95% respectively 90% radiochemical yields. The former is incorporated into DNA of proliferating cells and can therefore be used as an endoradiotherapeutic agent. The latter is a conjugate for the astatination of proteins. Human epidermal growth factor (hEGF) was tagged with astatine using three approaches: a) direct labeling of native hEGF, b) conjugation with SAB, and c) direct labeling of an hEGF - 7-(3-aminopropyl)-7,8-dicarba-nido-undecaborate(1-) conjugate. The overall labeling yields were 3.5% for direct labeling, 44% for SAB and 70% for the hEGF-nido-carborane conjugate. A new route to N-succinimidyl 3- and 4- [ 124 I]iodobenzoate, two reagents for radioiodination of proteins is described affording 90% radiochemical yield. Three radioiodinated analogs of PK11195, 1-(2-chlorophenyl)-N-methyl-N-(1-methylpropyl)isoquinoline-3-carboxyam ide, a peripheral-type benzodiazepine receptor antagonist, were synthesized. All three analogs were obtained in >90% radiochemical yield. Synthesis and application of 5-[ 124 I]iodo-2'-deoxyuridine (IUdR) is presented. The closo-dodecaborate anion was evaluated as prosthetic group for radioiodination of

  10. Charge radii and electromagnetic moments of At-211195

    Science.gov (United States)

    Cubiss, J. G.; Barzakh, A. E.; Seliverstov, M. D.; Andreyev, A. N.; Andel, B.; Antalic, S.; Ascher, P.; Atanasov, D.; Beck, D.; Bieroń, J.; Blaum, K.; Borgmann, Ch.; Breitenfeldt, M.; Capponi, L.; Cocolios, T. E.; Day Goodacre, T.; Derkx, X.; De Witte, H.; Elseviers, J.; Fedorov, D. V.; Fedosseev, V. N.; Fritzsche, S.; Gaffney, L. P.; George, S.; Ghys, L.; Heßberger, F. P.; Huyse, M.; Imai, N.; Kalaninová, Z.; Kisler, D.; Köster, U.; Kowalska, M.; Kreim, S.; Lane, J. F. W.; Liberati, V.; Lunney, D.; Lynch, K. M.; Manea, V.; Marsh, B. A.; Mitsuoka, S.; Molkanov, P. L.; Nagame, Y.; Neidherr, D.; Nishio, K.; Ota, S.; Pauwels, D.; Popescu, L.; Radulov, D.; Rapisarda, E.; Revill, J. P.; Rosenbusch, M.; Rossel, R. E.; Rothe, S.; Sandhu, K.; Schweikhard, L.; Sels, S.; Truesdale, V. L.; Van Beveren, C.; Van den Bergh, P.; Wakabayashi, Y.; Van Duppen, P.; Wendt, K. D. A.; Wienholtz, F.; Whitmore, B. W.; Wilson, G. L.; Wolf, R. N.; Zuber, K.

    2018-05-01

    Hyperfine-structure parameters and isotope shifts of At-211195 have been measured for the first time at CERN-ISOLDE, using the in-source resonance-ionization spectroscopy method. The hyperfine structures of isotopes were recorded using a triad of experimental techniques for monitoring the photo-ion current. The Multi-Reflection Time-of-Flight Mass Spectrometer, in connection with a high-resolution electron multiplier, was used as an ion-counting setup for isotopes that either were affected by strong isobaric contamination or possessed a long half-life; the ISOLDE Faraday cups were used for cases with high-intensity beams; and the Windmill decay station was used for short-lived, predominantly α -decaying nuclei. The electromagnetic moments and changes in the mean-square charge radii of the astatine nuclei have been extracted from the measured hyperfine-structure constants and isotope shifts. This was only made possible by dedicated state-of-the-art large-scale atomic computations of the electronic factors and the specific mass shift of atomic transitions in astatine that are needed for these extractions. By comparison with systematics, it was possible to assess the reliability of the results of these calculations and their ascribed uncertainties. A strong deviation in the ground-state mean-square charge radii of the lightest astatine isotopes, from the trend of the (spherical) lead isotopes, is interpreted as the result of an onset of deformation. This behavior bears a resemblance to the deviation observed in the isotonic polonium isotopes. Cases for shape coexistence have been identified in At,199197, for which a significant difference in the charge radii for ground (9 /2- ) and isomeric (1 /2+ ) states has been observed.

  11. Human radiation studies: Remembering the early years: Oral history of Dr. Patricia Wallace Durbin, Ph.D., conducted November 11, 1994

    International Nuclear Information System (INIS)

    1995-07-01

    This report is a transcript of an interview of Dr. Patricia Wallace Durbin by representatives of the US DOE Office of Human Radiation Research. Dr. Durbin was selected for this interview because of her knowledge of the human plutonium injections and her recollections of key figures, especially Joseph Hamilton. After a brief biographical sketch Dr. Durbin discusses her loss of research funding from DOE, her recollections concerning research into strontium metabolism as part of Project Sunshine, her recollections relating to the rationale for studies of human metabolism of radionuclides, her remembrances of Dr. Hamilton's Astatine and Plutonium research, and her experiences in gathering archival records concerning these researches

  12. ORF Alignment: NC_003280 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available h = 143 ... Query: 164 TFHRDLYSFTTAQTICEEECGNLVSIHSANENRYVMTIASHTTQANVLIGGMWPMDHVNT 223 ... TFHRDLYSFTTAQTICE...EECGNLVSIHSANENRYVMTIASHTTQANVLIGGMWPMDHVNT Sbjct: 4 ... TFHRDLYSFTTAQTICEEECGNLVSIHSANENRYVMTIASHTTQANV

  13. ORF Alignment: NC_002655 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available : 164 GIALGAEDYVRNLRTERSPEGTELLFARCSILQAARSAGIQAFDTVYSDANNEAGFLQEA 223 ... GIALGAEDYVRNLRTERSPEGTELLFARC...SILQAARSAGIQAFDTVYSDANNEAGFLQEA Sbjct: 121 GIALGAEDYVRNLRTERSPEGTELLFARCSILQAARSAGIQAFDTVYSDANNEAGFLQEA 180 ...

  14. ORF Alignment: NC_006347 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available = 69 ... Query: 164 NRLKSALIANMNHEIRTPLNAIVGFASLLSIIDDEKEQQEYIGLIQSNTEHLLRLMNDVI 22...3 ... NRLKSALIANMNHEIRTPLNAIVGFASLLSIIDDEKEQQEYIGLIQSNTEHLLRLMNDVI Sbjct: 7 ... NRLKSALIANMNHEIRTPLNAIVGFASLLSIIDDEKEQQEYIGLIQSNTEHLLRLMNDVI 66 ...

  15. SU-F-J-223: Patterns of Failure for Laryngeal Cancer Patients Treated with Definitive IMRT: Comparing Two Different Methods for Determining the Origin of Recurrence From Follow-Up PET/CT Scans

    Energy Technology Data Exchange (ETDEWEB)

    Brodin, P; Guha, C; Tome, W [Albert Einstein College of Medicine and Montefiore Medical Center, Bronx, New York (United States); Kabarriti, R; Kalnicki, S; Garg, M [Montefiore Medical Center, Bronx, New York (United States); Vogelius, I [Rigshospitalet, Copenhagen University Hospital, Copenhagen (Denmark)

    2016-06-15

    Purpose: To determine patterns of failure in laryngeal cancer treated with definitive IMRT by comparing two different methods for identifying the recurrence epicenter on follow-up PET/CT. Methods: We identified 20 patients treated for laryngeal squamous cell carcinoma with definitive IMRT who had loco-regional recurrence diagnosed on PET/CT. Recurrence PET/CT scans were co-registered with the original treatment planning CT using deformable image registration with the VoxAlign deformation engine in MIM Software. Recurrence volumes were delineated on co-registered follow-up scans using a semi-automatic PETedge tool and two separate methods were used to identify the recurrence point of origin: a) Finding the point within the recurrence volume for which the maximum distance to the surface of the surrounding recurrence volume is smaller than for any other point. b) Finding the point within the recurrence volume with the maximum standardized uptake value (SUVmax), without geometric restrictions.For each method the failure pattern was determined as whether the recurrence origin fell within the original high-dose target volumes GTV70, CTV70, PTV70 (receiving 70Gy), intermediate-risk PTV59 (receiving 59.4Gy) or low-risk PTV54 (receiving 54.1Gy), in the original treatment planning CT. Results: 23 primary/nodal recurrences from the 20 patients were analyzed. The three-dimensional distance between the two different origins was on average 10.5mm (std.dev. 10mm). Most recurrences originated in the high-dose target volumes for both methods with 13 (57%) and 11 (48%) in the GTV70 and 20 (87%) and 20 (87%) in the PTV70 for method a) and b), respectively. There was good agreement between the two methods in classifying the origin target volumes with 69% concordance for GTV70, 89% for CTV70 and 100% for PTV70. Conclusion: With strong agreement in patterns of failure between two separate methods for determining recurrence origin, we conclude that most recurrences occurred within the high-dose treatment region, which influences potential risk-adaptive treatment strategies.

  16. CALABI, Francesca. Fílon de Alexandria (Filone di Alessandria. Tradução: José Bortolini. São Paulo: Paulus, 2014. 223 pp. ISBN: 978-85-349-3854-9. R$ 38,00.

    Directory of Open Access Journals (Sweden)

    Rodrigo Pinto de Brito

    2016-08-01

    Full Text Available Francesca Calabi é professora do Dipartamento di Studi Umanistici – Filosofia na Università degli Studi di Pavia, na Itália, onde leciona desde 2004 disciplinas de História da Filosofia Tardo-antiga. Seus cursos versam sobre temas como “O daimon de Sócrates” e “O asno de ouro” (ambas obras de Apuleio. Também lê, revisa e finaliza traduções suas em sala de aula, como a da “Carta de Aristeas a Filócrates”, um texto do séc. III a.C que descreve a tradução da Torá para o grego pelos 72 sábios e tradutores enviados a Alexandria a convite do então bibliotecário alexandrino, o peripatético Demétrio de Falero.

  17. Association of breast cancer risk in BRCA1 and BRCA2 mutation carriers with genetic variants showing differential allelic expression : identification of a modifier of breast cancer risk at locus 11q22.3

    NARCIS (Netherlands)

    Hamdi, Yosr; Soucy, Penny; Kuchenbaeker, Karoline B; Pastinen, Tomi; Droit, Arnaud; Lemaçon, Audrey; Adlard, Julian; Aittomäki, Kristiina; Andrulis, Irene L; Arason, Adalgeir; Arnold, Norbert; Arun, Banu K; Azzollini, Jacopo; Bane, Anita; Barjhoux, Laure; Barrowdale, Daniel; Benitez, Javier; Berthet, Pascaline; Blok, Marinus J; Bobolis, Kristie; Bonadona, Valérie; Bonanni, Bernardo; Bradbury, Angela R; Brewer, Carole; Buecher, Bruno; Buys, Saundra S; Caligo, Maria A; Chiquette, Jocelyne; Chung, Wendy K; Claes, Kathleen B M; Daly, Mary B; Damiola, Francesca; Davidson, Rosemarie; De la Hoya, Miguel; De Leeneer, Kim; Diez, Orland; Ding, Yuan Chun; Dolcetti, Riccardo; Domchek, Susan M; Dorfling, Cecilia M; Eccles, Diana; Eeles, Ros; Einbeigi, Zakaria; Ejlertsen, Bent; Engel, Christoph; Gareth Evans, D; Feliubadalo, Lidia; Foretova, Lenka; Fostira, Florentia; Foulkes, William D; Fountzilas, George; Friedman, Eitan; Frost, Debra; Ganschow, Pamela; Ganz, Patricia A; Garber, Judy; Gayther, Simon A; Gerdes, Anne-Marie; Glendon, Gord; Godwin, Andrew K; Goldgar, David E; Greene, Mark H; Gronwald, Jacek; Hahnen, Eric; Hamann, Ute; Hansen, Thomas V O; Hart, Steven; Hays, John L; Hogervorst, Frans B L; Hulick, Peter J; Imyanitov, Evgeny N; Isaacs, Claudine; Izatt, Louise; Jakubowska, Anna; James, Paul; Janavicius, Ramunas; Jensen, Uffe Birk; John, Esther M; Joseph, Vijai; Just, Walter; Kaczmarek, Katarzyna; Karlan, Beth Y; Kets, Carolien M; Kirk, Judy; Kriege, Mieke; Laitman, Yael; Laurent, Maïté; Lazaro, Conxi; Leslie, Goska; Lester, Jenny; Lesueur, Fabienne; Liljegren, Annelie; Loman, Niklas; Loud, Jennifer T; Manoukian, Siranoush; Mariani, Milena; Mazoyer, Sylvie; McGuffog, Lesley; Meijers-Heijboer, Hanne E J; Meindl, Alfons; Miller, Austin; Montagna, Marco; Mulligan, Anna Marie; Nathanson, Katherine L; Neuhausen, Susan L; Nevanlinna, Heli; Nussbaum, Robert L; Olah, Edith; Olopade, Olufunmilayo I; Ong, Kai-Ren; Oosterwijk, Jan C; Osorio, Ana; Papi, Laura; Park, Sue Kyung; Pedersen, Inge Sokilde; Peissel, Bernard; Segura, Pedro Perez; Peterlongo, Paolo; Phelan, Catherine M; Radice, Paolo; Rantala, Johanna; Rappaport-Fuerhauser, Christine; Rennert, Gad; Richardson, Andrea; Robson, Mark; Rodriguez, Gustavo C; Rookus, Matti A; Schmutzler, Rita Katharina; Sevenet, Nicolas; Shah, Payal D; Singer, Christian F; Slavin, Thomas P; Snape, Katie; Sokolowska, Johanna; Sønderstrup, Ida Marie Heeholm; Southey, Melissa; Spurdle, Amanda B; Stadler, Zsofia; Stoppa-Lyonnet, Dominique; Sukiennicki, Grzegorz; Sutter, Christian; Tan, Yen; Tea, Muy-Kheng; Teixeira, Manuel R; Teulé, Alex; Teo, Soo-Hwang; Terry, Mary Beth; Thomassen, Mads; Tihomirova, Laima; Tischkowitz, Marc; Tognazzo, Silvia; Toland, Amanda Ewart; Tung, Nadine; van den Ouweland, Ans M W; van der Luijt, Rob B; van Engelen, Klaartje; van Rensburg, Elizabeth J; Varon-Mateeva, Raymonda; Wappenschmidt, Barbara; Wijnen, Juul T; Rebbeck, Timothy; Chenevix-Trench, Georgia; Offit, Kenneth; Couch, Fergus J; Nord, Silje; Easton, Douglas F; Antoniou, Antonis C; Simard, Jacques

    PURPOSE: Cis-acting regulatory SNPs resulting in differential allelic expression (DAE) may, in part, explain the underlying phenotypic variation associated with many complex diseases. To investigate whether common variants associated with DAE were involved in breast cancer susceptibility among BRCA1

  18. Association of breast cancer risk in BRCA1 and BRCA2 mutation carriers with genetic variants showing differential allelic expression: identification of a modifier of breast cancer risk at locus 11q22.3

    NARCIS (Netherlands)

    Y. Hamdi (Yosr); Soucy, P. (Penny); Kuchenbaeker, K.B. (Karoline B.); Pastinen, T. (Tomi); A. Droit (Arnaud); Lemaçon, A. (Audrey); J.W. Adlard (Julian); K. Aittomäki (Kristiina); I.L. Andrulis (Irene); A. Arason (Adalgeir); N. Arnold (Norbert); B.K. Arun (Banu); J. Azzollini; A.L. Bane (Anita L.); Barjhoux, L. (Laure); D. Barrowdale (Daniel); J. Benítez (Javier); P. Berthet (Pascaline); M.J. Blok (Marinus); K.A. Bobolis (Kristie A.); V. Bonadona (Valérie); B. Bonnani (Bernardo); Bradbury, A.R. (Angela R.); C. Brewer (Carole); B. Buecher (Bruno); Buys, S.S. (Saundra S.); M.A. Caligo (Maria); Chiquette, J. (Jocelyne); W. Chung (Wendy); K.B.M. Claes (Kathleen B.M.); Daly, M.B. (Mary B.); F. Damiola (Francesca); R. Davidson (Rosemarie); M. de La Hoya (Miguel); K. De Leeneer (Kim); O. Díez (Orland); Y.C. Ding (Yuan); R. Dolcetti (Riccardo); S.M. Domchek (Susan); C.M. Dorfling (Cecilia); D. Eccles (Diana); R. Eeles (Ros); Z. Einbeigi (Zakaria); B. Ejlertsen (Bent); EMBRACE; C. Engel (Christoph); Gareth Evans, D.; L. Feliubadaló (L.); L. Foretova (Lenka); F. Fostira (Florentia); Foulkes, W.D. (William D.); G. Fountzilas (George); E. Friedman (Eitan); D. Frost (Debra); P. Ganschow (Pamela); P.A. Ganz (Patricia A.); J. Garber (Judy); S.A. Gayther (Simon); GEMO Study Collaborators; A-M. Gerdes (Anne-Marie); G. Glendon (Gord); A.K. Godwin (Andrew K.); D. Goldgar (David); M.H. Greene (Mark H.); J. Gronwald (Jacek); E. Hahnen (Eric); U. Hamann (Ute); T.V.O. Hansen (Thomas); S. Hart (Stewart); J. Hays (John); HEBON; F.B.L. Hogervorst (Frans); P.J. Hulick (Peter); E.N. Imyanitov (Evgeny); C. Isaacs (Claudine); L. Izatt (Louise); A. Jakubowska (Anna); M. James (Margaret); R. Janavicius (Ramunas); U.B. Jensen; E.M. John (Esther); V. Joseph (Vijai); Just, W. (Walter); Kaczmarek, K. (Katarzyna); Karlan, B.Y. (Beth Y.); KConFab Investigators; C.M. Kets; J. Kirk (Judy); Kriege, M. (Mieke); Y. Laitman (Yael); Laurent, M. (Maïté); C. Lazaro (Conxi); Leslie, G. (Goska); K.J. Lester (Kathryn); F. Lesueur (Fabienne); A. Liljegren (Annelie); N. Loman (Niklas); J.T. Loud (Jennifer); S. Manoukian (Siranoush); Mariani, M. (Milena); S. Mazoyer (Sylvie); L. McGuffog (Lesley); E.J. Meijers-Heijboer (Hanne); A. Meindl (Alfons); A. Miller (Austin); M. Montagna (Marco); A.-M. Mulligan (Anna-Marie); K.L. Nathanson (Katherine); S.L. Neuhausen (Susan); H. Nevanlinna (Heli); R.L. Nussbaum (Robert L.); Olah, E. (Edith); O.I. Olopade (Olufunmilayo I.); K.-R. Ong (Kai-Ren); J.C. Oosterwijk (Jan); A. Osorio (Ana); L. Papi (Laura); S.K. Park (Sue K.); Pedersen, I.S. (Inge Sokilde); B. Peissel (Bernard); P.P. Segura (Pedro Perez); P. Peterlongo (Paolo); C. Phelan (Catherine); P. Radice (Paolo); J. Rantala (Johanna); Rappaport-Fuerhauser, C. (Christine); G. Rennert (Gad); A.L. Richardson (Andrea); M. Robson (Mark); G.C. Rodriguez (Gustavo); M.A. Rookus (Matti); R.K. Schmutzler (Rita); N. Sevenet (Nicolas); Shah, P.D. (Payal D.); C.F. Singer (Christian); Slavin, T.P. (Thomas P.); Snape, K. (Katie); J. Sokolowska (Johanna); Sønderstrup, I.M.H. (Ida Marie Heeholm); M.C. Southey (Melissa); A.B. Spurdle (Amanda); Stadler, Z. (Zsofia); D. Stoppa-Lyonnet (Dominique); G. Sukiennicki (Grzegorz); C. Sutter (Christian); Tan, Y. (Yen); M.-K. Tea; P.J. Teixeira; A. Teulé (A.); S.-H. Teo (Soo-Hwang); M.B. Terry (Mary Beth); M. Thomassen (Mads); L. Tihomirova (Laima); M. Tischkowitz (Marc); S. Tognazzo (Silvia); A.E. Toland (Amanda); N. Tung (Nadine); A.M.W. van den Ouweland (Ans); R.B. van der Luijt (Rob); K. van Engelen (Klaartje); E.J. van Rensburg (Elizabeth); R. Varon-Mateeva (Raymonda); B. Wapenschmidt (Barbara); J.T. Wijnen (Juul); R. Rebbeck (Timothy); G. Chenevix-Trench (Georgia); K. Offit (Kenneth); Couch, F.J. (Fergus J.); S. Nord (Silje); D.F. Easton (Douglas F.); A.C. Antoniou (Antonis C.); Simard, J. (Jacques)

    2016-01-01

    textabstractPurpose: Cis-acting regulatory SNPs resulting in differential allelic expression (DAE) may, in part, explain the underlying phenotypic variation associated with many complex diseases. To investigate whether common variants associated with DAE were involved in breast cancer susceptibility

  19. Quality assurance in electrical engineering. VDE Regional Group Frankfurt am Main, workshop from November 2-23, 1987. Qualitaetssicherung in der elektrischen Energietechnik. VDE-Bezirksverein Frankfurt am Main, Arbeitsgemeinschaft vom 2. 11. bis 23. 11. 1987

    Energy Technology Data Exchange (ETDEWEB)

    Forst, H J [ed.

    1987-01-01

    Quality assurance measures are explained at the example of an energy distributor. The VDE (German Association of Electrical Engineers) work team addresses the following articles on quality assurance to experts of energy techniques and those interested in this field. In detail, following topics are dealt with: Basic thoughts and principles of quality assurance; Quality assurance done by the producer, shown at the example of a medium-voltage power switch. Quality assurance done by the producer, shown at the example of a low-voltage power switch. Quality assurance done by the producer of electric distributing hands, shown at the example of a medium-voltage distributing band. Quality assurance by the producer of electric distributing boards, shown at the example of a low-voltage board. Quality assurance by means of maintenance measures in the electric system technique of a public utility. Quality assurance of electric systems and operational means of a public utility. Quality assurance by the operator of electric systems, shown at the example of an industrial plant. (HAG).

  20. Final Results of the Randomized Phase II NorCap-CA223 Trial Comparing First-Line All-Oral Versus Taxane-Based Chemotherapy for HER2-Negative Metastatic Breast Cancer.

    Science.gov (United States)

    Cinieri, Saverio; Chan, Arlene; Altundag, Kadri; Vandebroek, An; Tubiana-Mathieu, Nicole; Barnadas, Agusti; Dodyk, Patricia; Lazzarelli, Silvia; Botha, Michiel; Rauch, Daniel; Villanova, Gustavo; Coskun, Ugur

    2017-04-01

    The purpose of this study was to evaluate the efficacy of 3 first-line chemotherapy combination regimens for HER2-negative metastatic breast cancer (mBC). In this open-label, 3-arm, randomized phase II trial, patients were randomized to all-oral NORCAP (vinorelbine/capecitabine), GEMPAC (gemcitabine/paclitaxel), or GEMDOC (gemcitabine/docetaxel) as first-line chemotherapy for HER2-negative mBC. Stratification factors were center, previous (neo)adjuvant anthracycline, and age. The primary end point was disease control rate (DCR; complete or partial response, or stable disease for ≥3 months). The DCR was 73% (95% confidence interval [CI], 59-85) with NORCAP (36 of 49 patients), 78% (95% CI, 64-88) with GEMPAC (39 of 50 patients), and 80% (95% CI, 66-90) with GEMDOC (40 of 50 patients). Objective response rates were 33% (16 of 49 patients), 24% (12 of 50 patients), and 50% (25 of 50 patients), respectively; median progression-free survival was 7.6, 9.0, and 11.4 months, respectively. Median overall survival was 30 to 31 months with all regimens. The most common Grade ≥3 adverse event with each regimen was neutropenia (24 patients [50%], 23 patients [46%], and 43 patients [86%], respectively). The most common nonhematological Grade ≥3 adverse event was fatigue. Grade 2 alopecia occurred in 36 patients (72%) who received GEMPAC and 38 patients (76%) who received GEMDOC, but only 4 patients (8%) who received NORCAP. There was no evidence of a detrimental effect of NORCAP on quality of life. All-oral NORCAP is an active first-line chemotherapy regimen and might be offered as an alternative to first-line taxane-based therapy for HER2-negative mBC, particularly if patients wish to avoid alopecia or frequent intravenous administrations. Copyright © 2016 Elsevier Inc. All rights reserved.

  1. Synthesis of R-(+)- and S-(-)-8-hydroxy-2-(N,N-dipropylamino)-2[2-3H]tetralin. HCl (8-OH-DPAT) a 5HT1A receptor agonist

    International Nuclear Information System (INIS)

    Ackland, M.J.; Dring, L.G.; Jones, J.R.

    1991-01-01

    The title compounds were synthesised in 7 steps from 1,7-dihydroxynaphthalene as follows: 1,7-dihydroxynaphthalene was methylated and subjected to a Birch reduction to yield 8-methoxy-2-tetralone. Reductive amination with sodium cyanoboro[ 3 H]hydride and n-propylamine gave 8-methoxy-2-(n-propylamino)-[2- 3 H]tetralin which was acylated and reduced to give (±)8-methoxy-2-(N,N-dipropylamino)-[2 3 H]tetralin. Treatment with conc.HC1 gave (±)-8-hydroxy-2-(N,N-dipropylamino)-[2- 3 H]tetralin. The racemate was then resolved by chiral mobile phase chromatography. (author)

  2. Discovery of N-[2-[2-[[3-methoxy-4-(5-oxazolyl)phenyl]amino]-5-oxazolyl]phenyl]-N-methyl-4- morpholineacetamide as a novel and potent inhibitor of inosine monophosphate dehydrogenase with excellent in vivo activity.

    Science.gov (United States)

    Dhar, T G Murali; Shen, Zhongqi; Guo, Junqing; Liu, Chunjian; Watterson, Scott H; Gu, Henry H; Pitts, William J; Fleener, Catherine A; Rouleau, Katherine A; Sherbina, N Z; McIntyre, Kim W; Shuster, David J; Witmer, Mark R; Tredup, Jeffrey A; Chen, Bang-Chi; Zhao, Rulin; Bednarz, Mark S; Cheney, Daniel L; MacMaster, John F; Miller, Laura M; Berry, Karen K; Harper, Timothy W; Barrish, Joel C; Hollenbaugh, Diane L; Iwanowicz, Edwin J

    2002-05-23

    Inosine monophosphate dehydrogenase (IMPDH) is a key enzyme that is involved in the de novo synthesis of purine nucleotides. Novel 2-aminooxazoles were synthesized and tested for inhibition of IMPDH catalytic activity. Multiple analogues based on this chemotype were found to inhibit IMPDH with low nanomolar potency. One of the analogues (compound 23) showed excellent in vivo activity in the inhibition of antibody production in mice and in the adjuvant induced arthritis model in rats.

  3. Genome-wide association analysis of genetic generalized epilepsies implicates susceptibility loci at 1q43, 2p16.1, 2q22.3 and 17q21.32

    DEFF Research Database (Denmark)

    Steffens, M.; Leu, C.; Ruppert, A. K.

    2012-01-01

    Genetic generalized epilepsies (GGEs) have a lifetime prevalence of 0.3 and account for 2030 of all epilepsies. Despite their high heritability of 80, the genetic factors predisposing to GGEs remain elusive. To identify susceptibility variants shared across common GGE syndromes, we carried out a ...

  4. Efeitos da restrição energética para suínos na fase final de terminação sobre o desempenho, característica de carcaça e poluição ambiental - DOI: 10.4025/actascianimsci.v29i2.223 Effect of energy restriction for late finishing pigs on performance, carcass traits and environmental pollution - DOI: 10.4025/actascianimsci.v29i2.223

    Directory of Open Access Journals (Sweden)

    Antonio Cláudio Furlan

    2007-11-01

    Full Text Available . Foram conduzidos dois experimentos com o objetivo de avaliar níveis de restrição energética (3.200, 2.960 e 2.720 kcal de EM kg-1, por meio da elevação da fibra dietéica (casca de arroz, para suínos abatidos com peso elevado. Experimento 1 - Foram utilizados 36 suínos (69,39 ± 5,38 kg. As variáveis estudadas (desempenho, carcaça e NUP foram agrupadas de acordo com o peso de abate (70 - 90 kg e 90 - 115 kg. Ao todo, foram abatidos 12 animais com peso de 87,55 ± 3,12 kg e 15 animais com peso de 115,41 ± 6,20 kg. Nenhuma das variáveis estudadas foi influenciada pelos diferentes níveis de EM. Experimento 2 - Foram utilizados 15 suínos machos (84,8 ± 4,5 kg, alojados em gaiolas de metabolismo. Houve aumento linear da produção total de fezes, matéria seca e matéria orgânica, com a redução do nível energético, contudo sem aumentar a excreção total de fósforo (P e nitrogênio (N. Houve redução do coeficiente de digestibilidade da MS e PB das raízes com a redução da energia (elevação da fibra, o que levou a redução do GDP e piora na CA. Os resultados sugerem que o abate de suínos com peso de até 115 kg é possível sem prejuízo do desempenho e das características da carcaça, independente do nível de EM das dietas, entretanto ocorre aumento na produção total de fezes com a redução da EM e aumento da fibra dietética sem, contudo, aumentar a excreção de N e P.Two trials were carried out to study the energy restriction (3200, 2960 and 2720 kcal of ME kg-1 for late finishing pigs, by means of adding dietary fiber (ground rice hull. Experiment I - 36 pigs were used (69.39 ア 5.38 kg. The variables studied (performance, carcass traits and PUN were separated according to the slaughter weight (70-90 kg and 90-115 kg. 12 pigs weighting 87.55 ア 3.12 kg and 15 pigs weighting 115.41 ア 6.20 kg were slaughtered. None of the variables studied were influenced by the different levels of ME. Experiment II -15 barrows were used (84.8 ア 4.5 kg and kept on metabolism crates. There was a linear increase of total feces, dry matter (DM and organic matter output, according to dietary energy reduction, without causing an increase in total phosphorous (P and nitrogen (N excretion. Digestibility coefficient of DM and crude protein decreased, which led to a decrease in daily weight gain and an increase in feed: gain ratio. Results suggest the possibility to slaughter high lean meat pigs, weighting up to 115 kg, without impairing performance and carcass traits, regardless dietary energy level. However, total feces output increased without causing an increase in N and P excretion, as ME decreased and crude fiber increased.

  5. AcEST: BP918435 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ++ + +S G + C C YQ Sbjct: 223 VWLPLMHRLAHVENVFHPVECSYCHCESMMGFRYRCQQCHNYQ 265 >sp|O70585|DTNB_MOUSE Dystrobr...P + A V + P+ C++ + +S G + C C YQ Sbjct: 223 VWLPLMHRLAHVENVFHPVECSYCHCESMMGFRYRCQ

  6. 78 FR 25348 - Petition for Waiver of Compliance

    Science.gov (United States)

    2013-04-30

    ... CFR Part 223, Safety Glazing Standards-Locomotives, Passenger Cars and Cabooses. FRA assigned the... requirements set forth in 49 CFR 223.11 for its locomotive LIRR 5, which was constructed by General Electric in...

  7. 75 FR 6613 - Endangered and Threatened Wildlife and Plants; Listing with Designation of Critical Habitat for...

    Science.gov (United States)

    2010-02-10

    ... University Montgomery, 7440 East Drive, Montgomery, Alabama, at the Taylor Center in conference room 223... Auburn University Montgomery, Taylor Center-conference room 223, 7440 East Drive, Montgomery, Alabama. We...

  8. Why Are Drugs So Hard to Quit?

    Medline Plus

    Full Text Available ... 12 Why Do People Lose Control Over Their Cocaine Use? - Duration: 2:23. National Institute on Drug ... 2:23 The Rise and Fall of the Cocaine High - Duration: 2:01. National Institute on Drug ...

  9. ORF Alignment: NC_002936 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... Length = 222 ... Query: 164 LGRHRLVCGDSTKAETFAVLLDDRKANLVITDPPYNVNYEGSAGKIKNDNMANDAFYNFL 223 ... ... ... LGRHRLVCGDSTKAETFAVLLDDRKANLVITDPPYNVNYEGSAGKIKNDNMANDAFYNFL Sbjct: 1 ... LGRHRL...VCGDSTKAETFAVLLDDRKANLVITDPPYNVNYEGSAGKIKNDNMANDAFYNFL 60 ... Query: 284 QHEPVLYGWKKSGKHQWYSGRKETTIWEFDKPKKNGDH

  10. ORF Alignment: NC_006351 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... Length = 70 ... Query: 223 RLDRALAAERSFTANSAHELRTPIAAALAQTQRLIXXXXXXXXXXXXXXXXGALHTLSRV 282 ... +L RAL AERSFTANSAHEL...RTPIAAALAQTQRLI ... ALH LSR+ Sbjct: 2 ... KLKRALEAERSFTANSAHELRTPIAAALAQTQRLIAETQDKAARDRGEQIEAALHRLSRL 61 ...

  11. 28 CFR 22.22 - Revelation of identifiable data.

    Science.gov (United States)

    2010-07-01

    ... STATISTICAL INFORMATION § 22.22 Revelation of identifiable data. (a) Except as noted in paragraph (b) of this section, research and statistical information relating to a private person may be revealed in identifiable... sections 223(a)(12)(A), 223(a)(13), 223(a)(14), and 243 of the Juvenile Justice and Delinquency Prevention...

  12. 75 FR 28772 - Acquisition Regulation: Access to and Ownership of Records

    Science.gov (United States)

    2010-05-24

    ... Integration of Environment, Safety, and Health into Work Planning and Execution clause at 48 CFR 952.223-71... of Environment, Safety and Health into work Planning and Execution clause at 952.223-71 or the... Integration of Environment, Safety, and Health into Work Planning and Execution clause at 48 CFR 952.223-71 or...

  13. Glomerular filtration rate after alpha-radioimmunotherapy with 211At-MX35-F(ab')2: a long-term study of renal function in nude mice

    DEFF Research Database (Denmark)

    Back, T.; Haraldsson, B.; Hultborn, R

    2009-01-01

    of the glomerular filtration rate (GFR). The renal toxicity was evaluated at levels close to the dose limit for the bone marrow and well within the range for therapeutic efficacy on tumors. Astatinated MX35-F(ab')(2) monoclonal antibodies were administered intravenously to nude mice. Both non-tumor-bearing animals...... manifested late. Examination of the kidney sections showed histologic changes that were overall subdued. Following alpha-RIT with (211)At-MX35-F(ab')(2) at levels close to the dose limit of severe myelotoxicity, the effects found on renal function were relatively small, with only minor to moderate reductions...... in GFR. These results suggest that a mean absorbed dose to the kidneys of approximately 10 Gy is acceptable, and that the kidneys would not be the primary dose-limiting organ in systemic alpha-RIT when using (211)At-MX35-F(ab')(2) Udgivelsesdato: 2009/12...

  14. New developments of the in-source spectroscopy method at RILIS/ISOLDE

    CERN Document Server

    Marsh, B A; Imai, N; Seliverstov, M D; Rothe, S; Sels, S; Capponi, L; Rossel, R E; Franchoo, S; Wendt, K; Focker, G J; Kalaninova, Z; Sjoedin, A M; Popescu, L; Nicol, T; Huyse, M; Radulov, D; Atanasov, D; Kesteloot, N; Borgmann, Ch; Cocolios, T E; Lecesne, N; Ghys, L; Pauwels, D; Rapisarda, E; Kreim, S; Liberati, V; Wolf, R N; Andel, B; Schweikhard, L; Lane, J; Derkx, X; Kudryavtsev, Yu; Zemlyanoy, S G; Fedosseev, V N; Lynch, K M; Rosenbusch, M; Van Duppen, P; Lunney, D; Manea, V; Barzakh, A E; Andreyev, A N; Truesdale, V; Flanagan, K T; Molkanov, P L; Koester, U; Van Beveren, C; Wienholtz, F; Goodacre, T Day; Antalic, S; Bastin, B; De Witte, H; Fink, D A; Fedorov, D V

    2013-01-01

    At the CERN ISOLDE facility, long isotope chains of many elements are produced by proton-induced reactions in target materials such as uranium carbide. The Resonance Ionization Laser Ion Source (RILIS) is an efficient and selective means of ionizing the reaction products to produce an ion beam of a chosen isotope. Coupling the RILIS with modern ion detection techniques enables highly sensitive studies of nuclear properties (spins, electromagnetic moments and charge radii) along an isotope chain, provided that the isotope shifts and hyperfine structure splitting of the atomic transitions can be resolved. At ISOLDE the campaign to measure the systematics of isotopes in the lead region (Pb, Bi, Tl and Po) has been extended to include the gold and astatine isotope chains. Several developments were specifically required for the feasibility of the most recent measurements: new ionization schemes (Po, At); a remote controlled narrow line-width mode of operation for the RILIS Ti:sapphire laser (At, Au, Po); isobar fr...

  15. Chemical concentration of a new natural spontaneously fissionable nuclide from solutions with low salt background

    International Nuclear Information System (INIS)

    Korotkin, Yu.S.; Ter-Akop'yan, G.M.; Popeko, A.G.; Drobina, T.P.; Zhuravleva, E.L.

    1982-01-01

    The results of experiments on further concentration of a new natural spontaneously fissionable nuclide, the concentrates of which form the Cheleken geothermal brines have been obtained, are presented. The conclusions are drown about the chemical nature of a new spontaneously fissionable nuclide. It is a chalcophile element which copreipitates with sulphides of copper, lead, arsenic and mercury from weakly acid solutions. The behaviour of the new nuclide in sulphide systems in many respects is similar to the behaviour of polonium, astatine and probably of bismuth. The most probable stable valence of the new nuclide varies from +1 up to +3. The data available on the chemical behaviour of the new nuclide as well as the analysis over contamination by spontaneously fissionable isotopes permit to state that the new natural spontaneously fissionable nuclide does not relate to the known isotopes

  16. Is Electronegativity a Useful Descriptor for the 'Pseudo-Alkali-Metal' NH4?

    International Nuclear Information System (INIS)

    Whiteside, Alexander; Xantheas, Sotiris S.; Gutowski, Maciej S.

    2011-01-01

    Molecular ions in the form of 'pseudo-atoms' are common structural motifs in chemistry, with properties that are transferrable between different compounds. We have determined the electronegativity of the 'pseudo-alkali metal' ammonium (NH4) and evaluated its reliability as a descriptor in comparison to the electronegativities of the alkali metals. The computed properties of its binary complexes with astatine and of selected borohydrides confirm the similarity of NH4 to the alkali metal atoms, although the electronegativity of NH4 is relatively large in comparison to its cationic radius. We paid particular attention to the molecular properties of ammonium (angular anisotropy, geometric relaxation, and reactivity), which can cause deviations from the behaviour expected of a conceptual 'true alkali metal' with this electronegativity. These deviations allow for the discrimination of effects associated with the polyatomic nature of NH4.

  17. Boiling points of the superheavy elements 117 and 118

    International Nuclear Information System (INIS)

    Takahashi, N.

    2001-01-01

    It has been shown that the relativistic effect on the electrons reveal in the heavy element region. What kind of changes will appear in the heavy elements because of the relativistic effects? Can we observe the changes? We observed that the boiling points of astatine and radon are lower than that extrapolated values from lighter elements in the same groups. Systematic behavior of the elements on the boiling point was examined and a new method for the estimation of the boiling points of the superheavy elements in the halogen and rare gases has been found. The estimated values of the elements 117 and 118 are 618 and 247 K, respectively which are considerably lower than those obtained until now. If these values are correct the production of the superheavy elements with heavy ions reaction may be affected. Further, the chemical properties may be fairly different from the lighter elements. (author)

  18. Alpha particle induced DNA damage and repair in normal cultured thyrocytes of different proliferation status

    DEFF Research Database (Denmark)

    Lyckesvärd, Madeleine Nordén; Delle, Ulla; Kahu, Helena

    2014-01-01

    Childhood exposure to ionizing radiation increases the risk of developing thyroid cancer later in life and this is suggested to be due to higher proliferation of the young thyroid. The interest of using high-LET alpha particles from Astatine-211 ((211)At), concentrated in the thyroid by the same...... mechanism as (131)I [1], in cancer treatment has increased during recent years because of its high efficiency in inducing biological damage and beneficial dose distribution when compared to low-LET radiation. Most knowledge of the DNA damage response in thyroid is from studies using low-LET irradiation...... and much less is known of high-LET irradiation. In this paper we investigated the DNA damage response and biological consequences to photons from Cobolt-60 ((60)Co) and alpha particles from (211)At in normal primary thyrocytes of different cell cycle status. For both radiation qualities the intensity...

  19. Crystal structure of chlorido{[3-(eta(5)-cyclopenta-dienyl)-2,2,3-trimethyl-1-phenylbutylidene]azanido-kappa N}[eta(2)(N,O)-N,N-dimethylhydroxyl-aminato]titanium(IV), C20H27ClN2OTi

    Czech Academy of Sciences Publication Activity Database

    Večeřa, M.; Gyepes, R.; Lamač, Martin

    2017-01-01

    Roč. 232, č. 3 (2017), s. 457-459 ISSN 1433-7266 R&D Projects: GA ČR(CZ) GA14-08531S Institutional support: RVO:61388955 Keywords : crystal structure * C20H27ClN2OTi * physical chemistry Subject RIV: CA - Inorganic Chemistry OBOR OECD: Inorganic and nuclear chemistry Impact factor: 0.152, year: 2016

  20. Prenatal diagnosis and molecular cytogenetic characterization of a derivative chromosome der(18;18(q10;q10del(18(q11.1q12.1del(18(q22.1q22.3 presenting as apparent isochromosome 18q in a fetus with holoprosencephaly

    Directory of Open Access Journals (Sweden)

    Chih-Ping Chen

    2011-06-01

    Conclusion: Concomitant monosomy 18p and trisomy 18q can be associated with holoprosencephaly and abnormal maternal serum screening results. Array-comparative genomic hybridization, fluorescence in situ hybridization, and quantitative fluorescent polymerase chain reaction are useful in genetic counseling of prenatally detected isochromosomes by providing information on the origin and genetic components of the isochromosome.