WorldWideScience

Sample records for astatine 219

  1. Radiochemistry of astatine

    Energy Technology Data Exchange (ETDEWEB)

    Ruth, T J; Dombsky, M; D' Auria, J M; Ward, T E

    1988-01-01

    This monograph is a review of the literature through 1987 and covers the methods of producing the radioisotopes of astatine and the inorganic, nuclear, and organic chemistry of astatine. The discussion is limited to chemical and physical chemical properties of astatine. The monograph, after the introduction, is divided into chapters titled: production methods, nuclear spectroscopy, chemistry of astatine, separation and isolation (dry and wet), and selected procedures. 209 refs., 15 figs., 7 tabs. (DLC)

  2. Discovery of the astatine, radon, francium, and radium isotopes

    Energy Technology Data Exchange (ETDEWEB)

    Fry, C.; Thoennessen, M., E-mail: thoennessen@nscl.msu.edu

    2013-09-15

    Thirty-nine astatine, thirty-nine radon, thirty-five francium, and thirty-four radium isotopes have so far been observed; the discovery of these isotopes is described. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  3. Discovery of the astatine, radon, francium, and radium isotopes

    CERN Document Server

    Fry, C

    2012-01-01

    Currently, thirty-nine astatine, thirty-nine radon, thirty-five francium, and thirty-four radium isotopes have so far been observed; the discovery of these isotopes is discussed. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  4. Discovery of the astatine, radon, francium, and radium isotopes

    Science.gov (United States)

    Fry, C.; Thoennessen, M.

    2013-09-01

    Thirty-nine astatine, thirty-nine radon, thirty-five francium, and thirty-four radium isotopes have so far been observed; the discovery of these isotopes is described. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  5. Delayed and In-beam Spectroscopy on Francium and Astatine Nuclei at the Proton Drip Line

    Energy Technology Data Exchange (ETDEWEB)

    Uusitalo, J.; Jakobsson, U. [Department of Physics, University of Jyvaeskylae (Finland); Collaboration: RITU-Gamma Gollaboration

    2011-11-30

    Delayed and in-beam spectroscopy on francium and astatine nuclei at and beyond the proton drip line has been performed. In neutron deficient astatine nuclei a shift to deformed shapes as a function of decreasing neutron has been obtained. In neutron deficient francium isotope the same shift is evident.

  6. Delayed and In-beam Spectroscopy on Francium and Astatine Nuclei at the Proton Drip Line

    Science.gov (United States)

    Uusitalo, J.; Jakobsson, U.

    2011-11-01

    Delayed and in-beam spectroscopy on francium and astatine nuclei at and beyond the proton drip line has been performed. In neutron deficient astatine nuclei a shift to deformed shapes as a function of decreasing neutron has been obtained. In neutron deficient francium isotope the same shift is evident.

  7. Measurement of the first ionization potential of astatine by laser ionization spectroscopy

    CERN Document Server

    Rothe, S; Antalic, S; Borschevsky, A; Capponi, L; Cocolios, T E; De Witte, H; Eliav, E; Fedorov, D V; Fedosseev, V N; Fink, D A; Fritzsche, S; Ghys, L; Huyse, M; Imai, N; Kaldor, U; Kudryavtsev, Yu; Köster, U; Lane, J; Lassen, J; Liberati, V; Lynch, K M; Marsh, B A; Nishio, K; Pauwels, D; Pershina, V; Popescu, L; Procter, T J; Radulov, D; Raeder, S; Rajabali, M M; Rapisarda, E; Rossel, R E; Sandhu, K; Seliverstov, M D; Sjödin, A M; Van den Bergh, P; Van Duppen, P; Venhart, M; Wakabayashi, Y; Wendt K D A

    2013-01-01

    The radioactive element astatine exists only in trace amounts in nature. Its properties can therefore only be explored by study of smallest quantities of artificially produced isotopes or by performing theoretical calculations. One of the most important properties influencing the chemical behaviour is the energy required to remove one electron from the valence shell, referred to as the ionization potential. Here we use laser spectroscopy to probe the optical spectrum of astatine near the ionization threshold. The observed series of Rydberg states enabled the first determination of the ionization potential of the astatine atom, 9.317510(8) eV. New ab initio calculations were performed to support the experimental result. The measured value serves as a benchmark for quantum chemistry calculations of the properties of astatine as well as for the theoretical prediction of the ionization potential of super-heavy element 117, the heaviest homologue of astatine.

  8. Measurement of the first ionization potential of astatine by laser ionization spectroscopy.

    Science.gov (United States)

    Rothe, S; Andreyev, A N; Antalic, S; Borschevsky, A; Capponi, L; Cocolios, T E; De Witte, H; Eliav, E; Fedorov, D V; Fedosseev, V N; Fink, D A; Fritzsche, S; Ghys, L; Huyse, M; Imai, N; Kaldor, U; Kudryavtsev, Yuri; Köster, U; Lane, J F W; Lassen, J; Liberati, V; Lynch, K M; Marsh, B A; Nishio, K; Pauwels, D; Pershina, V; Popescu, L; Procter, T J; Radulov, D; Raeder, S; Rajabali, M M; Rapisarda, E; Rossel, R E; Sandhu, K; Seliverstov, M D; Sjödin, A M; Van den Bergh, P; Van Duppen, P; Venhart, M; Wakabayashi, Y; Wendt, K D A

    2013-01-01

    The radioactive element astatine exists only in trace amounts in nature. Its properties can therefore only be explored by study of the minute quantities of artificially produced isotopes or by performing theoretical calculations. One of the most important properties influencing the chemical behaviour is the energy required to remove one electron from the valence shell, referred to as the ionization potential. Here we use laser spectroscopy to probe the optical spectrum of astatine near the ionization threshold. The observed series of Rydberg states enabled the first determination of the ionization potential of the astatine atom, 9.31751(8) eV. New ab initio calculations are performed to support the experimental result. The measured value serves as a benchmark for quantum chemistry calculations of the properties of astatine as well as for the theoretical prediction of the ionization potential of superheavy element 117, the heaviest homologue of astatine.

  9. Spectroscopy of low-lying states in neutron-deficient astatine and francium nuclei

    Energy Technology Data Exchange (ETDEWEB)

    Jakobsson, U., E-mail: ulrjak@kth.se; Cederwall, B. [KTH, The Division of Nuclear Physics, AlbaNova University Center, SE-10691 Stockholm (Sweden); Uusitalo, J.; Auranen, K.; Badran, H.; Cox, D. M.; Grahn, T.; Greenlees, P. T.; Julin, R.; Juutinen, S.; Herzáň, A.; Konki, J.; Leino, M.; Mallaburn, M.; Pakarinen, J.; Papadakis, P.; Partanen, J.; Rahkila, P.; Sandzelius, M.; Sarén, J. [University of Jyvaskyla, Department of Physics, P.O. Box 35, FI-40014 University of Jyvaskyla (Finland); and others

    2015-10-15

    Low-lying states in neutron-deficient astatine and francium nuclei have been studied by means of in-beam and delayed spectroscopy. The 13/2{sup +} state has been observed in francium nuclei with a similar down-sloping trend as in neighbouring astatine and bismuth isotopes, as a function of decreasing neutron number. A systematic trend can also now be seen for the 1/2{sup +} state both in astatine and francium nuclei, where the level energy decreases steeply as a function of neutron number when moving further away from the neutron shell closure. This trend is very similar between astatine nuclei and their francium isotones. Moreover, shape coexistence has been observed between the 13/2{sup +} state and the spherical 9/2{sup −} ground state in {sup 203}Fr and {sup 205}Fr.

  10. Spectroscopy of low-lying states in neutron-deficient astatine and francium nuclei

    Science.gov (United States)

    Jakobsson, U.; Uusitalo, J.; Auranen, K.; Badran, H.; Cederwall, B.; Cox, D. M.; Grahn, T.; Greenlees, P. T.; Julin, R.; Juutinen, S.; HerzáÅ, A.; Konki, J.; Leino, M.; Mallaburn, M.; Pakarinen, J.; Papadakis, P.; Partanen, J.; Rahkila, P.; Sandzelius, M.; Sarén, J.; Scholey, C.; Sorri, J.; Stolze, S.

    2015-10-01

    Low-lying states in neutron-deficient astatine and francium nuclei have been studied by means of in-beam and delayed spectroscopy. The 13/2+ state has been observed in francium nuclei with a similar down-sloping trend as in neighbouring astatine and bismuth isotopes, as a function of decreasing neutron number. A systematic trend can also now be seen for the 1/2+ state both in astatine and francium nuclei, where the level energy decreases steeply as a function of neutron number when moving further away from the neutron shell closure. This trend is very similar between astatine nuclei and their francium isotones. Moreover, shape coexistence has been observed between the 13/2+ state and the spherical 9/2- ground state in 203Fr and 205Fr.

  11. Automated astatination of biomolecules - a stepping stone towards multicenter clinical trials

    DEFF Research Database (Denmark)

    Aneheim, Emma; Albertsson, Per; Bäck, Tom

    2015-01-01

    To facilitate multicentre clinical studies on targeted alpha therapy, it is necessary to develop an automated, on-site procedure for conjugating rare, short-lived, alpha-emitting radionuclides to biomolecules. Astatine-211 is one of the few alpha-emitting nuclides with appropriate chemical...

  12. Measurement of the first ionization potential of astatine by laser ionization spectroscopy

    NARCIS (Netherlands)

    Rothe, S.; Andreyev, A. N.; Antalic, S.; Borschevsky, A.; Capponi, L.; Cocolios, T. E.; De Witte, H.; Eliav, E.; Fedorov, D. V.; Fedosseev, V. N.; Fink, D. A.; Fritzsche, S.; Ghys, L.; Huyse, M.; Imai, N.; Kaldor, U.; Kudryavtsev, Yuri; Koester, U.; Lane, J. F. W.; Lassen, J.; Liberati, V.; Lynch, K. M.; Marsh, B. A.; Nishio, K.; Pauwels, D.; Pershina, V.; Popescu, L.; Procter, T. J.; Radulov, D.; Raeder, S.; Rajabali, M. M.; Rapisarda, E.; Rossel, R. E.; Sandhu, K.; Seliverstov, M. D.; Sjoedin, A. M.; Van den Bergh, P.; Van Duppen, P.; Venhart, M.; Wakabayashi, Y.; Wendt, K. D. A.

    The radioactive element astatine exists only in trace amounts in nature. Its properties can therefore only be explored by study of the minute quantities of artificially produced isotopes or by performing theoretical calculations. One of the most important properties influencing the chemical

  13. An attempt to explore the production routes of Astatine radionuclides: Theoretical approach

    OpenAIRE

    Maiti, Moumita; Lahiri, Susanta

    2008-01-01

    In order to fulfil the recent thrust of Astatine radionuclides in the field of nuclear medicine various production routes have been explored in the present work. The possible production routes of $^{209-211}$At comprise both light and heavy ion induced reactions at the bombarding energy range starting from threshold to maximum 100 MeV energy. For this purpose, we have used the nuclear reaction model codes TALYS, ALICE91 and PACE-II. Excitation functions of those radionuclides, produced throug...

  14. Synthesis and Evaluation of Astatinated N-[2-(Maleimido)ethyl]-3-(trimethylstannyl)benzamide Immunoconjugates

    DEFF Research Database (Denmark)

    Aneheim, Emma; Gustafsson, Anna; Albertsson, Per

    2016-01-01

    Effective treatment of metastasis is a great challenge in the treatment of different types of cancers. Targeted alpha therapy utilizes the short tissue range (50-100 μm) of α particles, making the method suitable for treatment of disseminated occult cancers in the form of microtumors or even sing...... of the in vivo distribution of the new immunoconjugate with other tin-based immunoconjugates in tumor-bearing mice, the MSB conjugation method was found to be a viable option for successful astatine labeling of different monoclonal antibodies....

  15. Laser photodetachment of radioactive ions: towards the determination of the electronegativity of astatine

    CERN Multimedia

    Rothe, Sebastian; Welander, Jakob Emanuel; Chrysalidis, Katerina; Day Goodacre, Thomas; Fedosseev, Valentine; Fiotakis, Spyridon; Forstner, Oliver; Heinke, Reinhard Matthias; Johnston, Karl; Kron, Tobias; Koester, Ulli; Liu, Yuan; Marsh, Bruce; Ringvall Moberg, Annie; Rossel, Ralf Erik; Seiffert, Christoph; Studer, Dominik; Wendt, Klaus; Hanstorp, Dag

    2017-01-01

    Negatively charged ions are mainly stabilized through the electron correlation effect. A measure of the stability of a negative ion is the electron affinity, which the energy gain by attaching an electron to a neutral atom. This fundamental quantity is, due to the almost general lack of bound excited states, the only atomic property that can be determined with high accuracy for negative ions. We will present the results of the first laser photodetachment studies of radioactive negative ions at CERN-ISOLDE. The photodetachment threshold for the radiogenic iodine isotope 128I was measured successfully, demonstrating the performance of the upgraded GANDALPH experimental beam line. The first detection of photo-detached astatine atoms marks a milestone towards the determination of the EA of this radioactive element.

  16. Complexation study on no-carrier-added astatine with insulin: A candidate radiopharmaceutical

    Energy Technology Data Exchange (ETDEWEB)

    Lahiri, Susanta [Chemical Sciences Division, Saha Institute of Nuclear Physics, 1/AF Bidhannagar, Kolkata 700 064 (India)], E-mail: susanta.lahiri@saha.ac.in; Roy, Kamalika [Chemical Sciences Division, Saha Institute of Nuclear Physics, 1/AF Bidhannagar, Kolkata 700 064 (India); Sen, Souvik [Berhampur Sadar Hospital, Berhampur, Murshidabad 742 101 (India)

    2008-12-15

    No-carrier-added astatine radionuclides produced in the {sup 7}Li-irradiated lead matrix were separated from bulk lead nitrate target by complexing At with insulin, followed by dialysis. The method offers simultaneous separation of At from lead as well as its complexation with insulin. The At-insulin complex might be a potential radiopharmaceutical in the treatment of hepatocellular carcinoma. The stability of At-insulin complex was checked by dialysis against deionized water and Ringer lactate (RL) solution. It has been found that the half-life of At-insulin complex is about {approx}12 h, when dialyzed against deionized water and is only 6 h, when dialyzed against RL solution having the same composition as blood serum. The 6 h half-life of this Insulin-At complex is perfect for killing cancer cells from external cell surfaces as the half-life of internalization of insulin molecule inside the cell is 7-12 h.

  17. Determination of the electron affinity of astatine and polonium by laser photodetachment

    CERN Multimedia

    We propose to conduct the first electron affinity (EA) measurements of the two elements astatine (At) and polonium (Po). Collinear photo-detachment spectroscopy will allow us to measure these quantities with an uncertainty limited only by the spectral line width of the laser. We plan to use negative ion beams of the two radioactive elements At and Po, which are only accessible on-line and at ISOLDE. The feasibility of our proposed method and the functionality of the experimental setup have been demonstrated at ISOLDE in off-line tests by the clear observation of the photo-detachment threshold for stable iodine. This proposal is based on our Letter of Intent I-148.

  18. Comment: 219 [Taxonomy Icon

    Lifescience Database Archive (English)

    Full Text Available Japanese medaka Oryzias latipes Oryzias_latipes_L.png 219.png Taxonomy icon (c) Database Center for Life Sci...ence licensed under CC Attribution2.1 Japan アイコン:メダカ HNI-Ⅱ系統バージョン bando 2010/02/15 15:31:07 2010/02/16 09:53:27 ...

  19. Adsorption of the astatine species on a gold surface: A relativistic density functional theory study

    Science.gov (United States)

    Demidov, Yuriy; Zaitsevskii, Andréi

    2018-01-01

    We report first-principle based studies of the adsorption interaction of astatine species on a gold surface. These studies are aimed primarily at the support and interpretation of gas chromatographic experiments with superheavy elements, tennessine (Ts, Z = 117), a heavier homologue of At, and possibly its pseudo-homologue nihonium (Nh, Z = 113). We use gold clusters with up to 69 atoms to simulate the adsorption sites and estimate the desorption energies of At & AtOH from a stable gold (1 1 1) surface. To describe the electronic structure of At -Aun and AtOH -Aun complexes, we combine accurate shape-consistent relativistic pseudopotentials and non-collinear two-component relativistic density functional theory. The predicted desorption energies of At and AtOH on gold are 130 ± 10 kJ/mol and 90 ± 10 kJ/mol, respectively. These results confirm the validity of the estimates derived from chromatographic data (147 ± 15 kJ/mol for At, and 100-10+20 kJ/mol for AtOH).

  20. ASTATINE-211 RADIOCHEMISTRY: THE DEVELOPMENT OF METHODOLOGIES FOR HIGH ACTIVITY LEVEL RADIOSYNTHESIS

    Energy Technology Data Exchange (ETDEWEB)

    MICHAEL R. ZALUTSKY

    2012-08-08

    Targeted radionuclide therapy is emerging as a viable approach for cancer treatment because of its potential for delivering curative doses of radiation to malignant cell populations while sparing normal tissues. Alpha particles such as those emitted by 211At are particularly attractive for this purpose because of their short path length in tissue and high energy, making them highly effective in killing cancer cells. The current impact of targeted radiotherapy in the clinical domain remains limited despite the fact that in many cases, potentially useful molecular targets and labeled compounds have already been identified. Unfortunately, putting these concepts into practice has been impeded by limitations in radiochemistry methodologies. A critical problem is that the synthesis of therapeutic radiopharmaceuticals provides additional challenges in comparison to diagnostic reagents because of the need to perform radio-synthesis at high levels of radioactivity. This is particularly important for {alpha}-particle emitters such as 211At because they deposit large amounts of energy in a highly focal manner. The overall objective of this project is to develop convenient and reproducible radiochemical methodologies for the radiohalogenation of molecules with the {alpha}-particle emitter 211At at the radioactivity levels needed for clinical studies. Our goal is to address two problems in astatine radiochemistry: First, a well known characteristic of 211At chemistry is that yields for electrophilic astatination reactions decline as the time interval after radionuclide isolation from the cyclotron target increases. This is a critical problem that must be addressed if cyclotrons are to be able to efficiently supply 211At to remote users. And second, when the preparation of high levels of 211At-labeled compounds is attempted, the radiochemical yields can be considerably lower than those encountered at tracer dose. For these reasons, clinical evaluation of promising 211At

  1. 219-S CORROSION STUDY

    Energy Technology Data Exchange (ETDEWEB)

    DIVINE JR; PARSONS GL

    2008-12-01

    A minor leak was detected in a drain line for Hood 2B located in the 222-S Laboratory. The line transfers radioactive waste, spent analytical standards, and chemicals used in various analytical procedures. Details are in the report provided by David Comstock, 2B NDE June 2008, work package LAB-WO-07-2012. Including the noted leak, the 222-S Laboratory has experienced two drain line leaks in approximately the last two years of operation. As a consequence, CH2M HILL Hanford Group, Inc. (CH2M HILL) requested the support of ChemMet, Ltd., PC (ChemMet) at the Hanford Site 222-S Laboratory. The corrosion expertise from ChemMet was required prior to preparation of a compatibility assessment for the 222-S Laboratory waste transfer system to assure the expected life of the piping system is extended as much as practicable. The system includes piping within the 222-S Laboratory and the 219-S Waste Storage and Transfer Facility and Operations Process. The ChemMet support was required for an assessment by 222-S staff to analyze what improvements to operational activities may be implemented to extend the tank/piping system life. This assessment will include a summary of the various material types, age, and locations throughout the facility. The assessment will also include a discussion of materials that are safe for drain line disposal on a regular basis, materials that are safe for disposal on a case-by-case basis including specific additional requirements such as flushing, neutralization to a specific pH, and materials prohibited from disposal. The assessment shall include adequate information for 222-S Laboratory personnel to make informed decisions in the future disposal of specific material types by discussing types of compatibility of system materials and potential wastes. The assessment is expected to contain some listing of acceptable waste materials but is not anticipated to be a complete or comprehensive list. Finally the assessment will encompass a brief discussion of

  2. An all-solid state laser system for the laser ion sources RILIS and in-source laser spectroscopy of astatine at ISOLDE/CERN

    Energy Technology Data Exchange (ETDEWEB)

    Rothe, Sebastian

    2012-09-24

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at CERN/ISOLDE by the addition of an all-solid state tunable titanium:sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE/CERN and at ISAC/TRIUMF radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.

  3. An all-solid state laser system for the laser ion source RILIS and in-source laser spectroscopy of astatine at ISOLDE, CERN

    CERN Document Server

    Rothe, Sebastian; Nörtershäuser, W

    This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at ISOLDE, CERN, by the addition of an all-solid state tuneable titanium: sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE, CERN, and at ISAC, TRIUMF, radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.

  4. 49 CFR 21.9 - Compliance information.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 1 2010-10-01 2010-10-01 false Compliance information. 21.9 Section 21.9 Transportation Office of the Secretary of Transportation NONDISCRIMINATION IN FEDERALLY-ASSISTED PROGRAMS OF THE DEPARTMENT OF TRANSPORTATION-EFFECTUATION OF TITLE VI OF THE CIVIL RIGHTS ACT OF 1964 § 21.9 Compliance information. (a) Cooperation and...

  5. 12 CFR 741.219 - Investment requirements.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 6 2010-01-01 2010-01-01 false Investment requirements. 741.219 Section 741.219 Banks and Banking NATIONAL CREDIT UNION ADMINISTRATION REGULATIONS AFFECTING CREDIT UNIONS... Unions That Also Apply to Federally Insured State-Chartered Credit Unions § 741.219 Investment...

  6. 49 CFR 107.219 - Processing.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false Processing. 107.219 Section 107.219 Transportation Other Regulations Relating to Transportation PIPELINE AND HAZARDOUS MATERIALS SAFETY ADMINISTRATION... PROCEDURES Preemption Waiver of Preemption Determinations § 107.219 Processing. (a) The Chief Counsel may...

  7. 49 CFR 219.17 - Construction.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Construction. 219.17 Section 219.17 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION, DEPARTMENT OF TRANSPORTATION CONTROL OF ALCOHOL AND DRUG USE General § 219.17 Construction. Nothing in this part— (a) Restricts...

  8. 22 CFR 219.140 - Employment.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Employment. 219.140 Section 219.140 Foreign... DEVELOPMENT § 219.140 Employment. No qualified handicapped person shall, on the basis of handicap, be subjected to discrimination in employment under any program or activity conducted by the agency. The...

  9. 49 CFR 571.219 - Standard No. 219; Windshield zone intrusion.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 6 2010-10-01 2010-10-01 false Standard No. 219; Windshield zone intrusion. 571.219 Section 571.219 Transportation Other Regulations Relating to Transportation (Continued) NATIONAL HIGHWAY TRAFFIC SAFETY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION FEDERAL MOTOR VEHICLE SAFETY STANDARDS Federal Motor Vehicle Safety Standards §...

  10. Dicty_cDB: SLJ219 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLJ219 (Link to dictyBase) - - - Contig-U15099-1 SLJ219Z (Link... to Original site) - - SLJ219Z 252 - - - - Show SLJ219 Library SL (Link to library) Clone ID SLJ219 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLJ2-A/SLJ219Q.Seq.d/ Representative seq. ID SLJ21...9Z (Link to Original site) Representative DNA sequence >SLJ219 (SLJ219Q) /CSM/SL/SLJ2-A/SLJ219Q.Seq.d/ XXXXX...2 (SLK462Q) /CSM/SL/SLK4-C/SLK462Q.Seq.d/ 416 e-116 SLJ219 (SLJ219Q) /CSM/SL/SLJ2-A/SLJ219Q.Seq.d/ 416 e-116

  11. 36 CFR 2.19 - Winter activities.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 1 2010-07-01 2010-07-01 false Winter activities. 2.19... RESOURCE PROTECTION, PUBLIC USE AND RECREATION § 2.19 Winter activities. (a) Skiing, snowshoeing, ice... designations or activity restrictions established under this section is prohibited. ...

  12. 36 CFR 219.9 - Revision.

    Science.gov (United States)

    2010-07-01

    ... System Land and Resource Management Planning The Framework for Planning § 219.9 Revision. (a) Application... is a review of the overall management of a unit of the National Forest System and an opportunity to... be appropriate for consideration (§ 219.4), any relevant inventories, new data, findings and...

  13. 31 CFR 800.219 - Parent.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Parent. 800.219 Section 800.219 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) OFFICE OF INVESTMENT SECURITY, DEPARTMENT OF THE TREASURY REGULATIONS PERTAINING TO MERGERS, ACQUISITIONS, AND TAKEOVERS BY...

  14. 24 CFR 1710.219 - Affirmation.

    Science.gov (United States)

    2010-04-01

    ... DEVELOPMENT (INTERSTATE LAND SALES REGISTRATION PROGRAM) LAND REGISTRATION Reporting Requirements § 1710.219... required by the rules and regulations of the Office of Interstate Land Sales Registration. (Date...

  15. 49 CFR 219.3 - Application.

    Science.gov (United States)

    2010-10-01

    ... TRANSPORTATION CONTROL OF ALCOHOL AND DRUG USE General § 219.3 Application. (a) General. Except as provided in... crosses into the United States from Canada or Mexico. (2) Unless otherwise provided by paragraph (b) of...

  16. Final Report for research grant "Development of Methods for High Specific Activity Labeling of Biomolecules Using Astatine-211 in Different Oxidation States"

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, D. Scott [Univ. of Washington, Seattle, WA (United States)

    2011-12-14

    The overall objective of this research effort was to develop methods for labeling biomolecules with higher oxidation state species of At-211. This was to be done in an effort to develop reagents that had higher in vivo stability than the present carbon-bonded At-211-labeled compounds. We were unsuccessful in that effort, as none of the approaches studied provided reagents that were stable to in vivo deastatination. However, we gained a lot of information about At-211 in higher oxidation states. The studies proved to be very difficult as small changes in pH and other conditions appeared to change the nature of the species that obtained (by HPLC retention time analyses), with many of the species being unidentifiable. The fact that there are no stable isotopes of astatine, and the chemistry of the nearest halogen iodine is quite different, made it very difficult to interpret results of some experiments. With that said, we believe that a lot of valuable information was obtained from the studies. The research effort evaluated: (1) methods for chemical oxidation of At-211, (2) approaches to chelation of oxidized At-211, and (3) approaches to oxidation of astatophenyl compounds. A major hurdle that had to be surmounted to conduct the research was the development of HPLC conditions to separate and identify the various oxidized species formed. Attempts to develop conditions for separation of iodine and astatine species by normal and reversed-phase TLC and ITLC were not successful. However, we were successful in developing conditions (from a large number of attempts) to separate oxidized forms of iodine ([I-125]iodide, [I-125]iodate and [I-125]periodate) and astatine ([At-211]astatide, [At-211]astatate, [At-211]perastatate, and several unidentified At-211 species). Information on the basic oxidation and characterization of At-211 species is provided under Objective 1. Conditions were developed to obtain new At-211 labeling method where At-211 is chelated with the DOTA and

  17. 36 CFR 219.4 - Identification and consideration of issues.

    Science.gov (United States)

    2010-07-01

    ... consideration of issues. 219.4 Section 219.4 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF... § 219.4 Identification and consideration of issues. (a) Origination of issues. Issues may originate from... Service conservation leadership initiatives; cooperatively developed landscape goals (§ 219.12(b...

  18. Dicty_cDB: CHR219 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHR219 (Link to dictyBase) - - - Contig-U16511-1 CHR219P (Link to Original site) CHR...219F 609 CHR219Z 786 CHR219P 1375 - - Show CHR219 Library CH (Link to library) Clone ID CHR...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CH/CHR2-A/CHR219Q.Seq.d/ Representative seq. ID CHR...219P (Link to Original site) Representative DNA sequence >CHR219 (CHR219Q) /CSM/CH/CHR2-A/CHR...ky**firs*ywswfkw**srrc*kprfirqircf*tsigsrrn*kprfgrscf*nhf*ir trsyssn*wsts*lyc*srnscss*inr*kcl*cllkhrtnittitt

  19. Radiological risk of actinon (/sup 219/Rn)

    Energy Technology Data Exchange (ETDEWEB)

    Crawford, D.J.

    1981-12-01

    The research reported was designed to provide information on the following subjects: (1) development of the functional relations between exposure to the /sup 219/Rn decay chain and pertinent health effects; (2) specification of the circumstances under which a significant concentration of the decay chain may occur; (3) recommendation of an exposure standard which will provide protection of the public from significant elevation of health effects; and (4) an assessment of the impact of /sup 219/Rn on determinations of the concentration of the /sup 222/Rn decay chain and/or its precursors.

  20. 36 CFR 219.20 - Ecological sustainability.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Ecological sustainability... Sustainability § 219.20 Ecological sustainability. To achieve ecological sustainability, the responsible official... diversity and species diversity are components of ecological sustainability. The planning process must...

  1. 36 CFR 219.1 - Purpose.

    Science.gov (United States)

    2010-07-01

    ... System Land and Resource Management Planning Purpose and Principles § 219.1 Purpose. (a) Land and... System include: The Organic Administration Act of 1897, as amended (16 U.S.C. 473 et seq.); the Multiple... resources of the National Forest System to fulfill the designated purposes of the national forests and...

  2. 48 CFR 219.800 - General.

    Science.gov (United States)

    2010-10-01

    ... (Acquisition, Technology, and Logistics) its authority under paragraph 8(a)(1)(A) of the Small Business Act (15... DEFENSE SOCIOECONOMIC PROGRAMS SMALL BUSINESS PROGRAMS Contracting With the Small Business Administration (The 8(a) Program) 219.800 General. (a) By Partnership Agreement (PA) between the Small Business...

  3. 36 CFR 219.3 - Overview.

    Science.gov (United States)

    2010-07-01

    .... An interdisciplinary, collaborative approach to planning may be achieved by engaging the skills and... Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE PLANNING National Forest System Land and Resource Management Planning The Framework for Planning § 219.3 Overview. (a) The...

  4. 36 CFR 219.30 - Plan documentation.

    Science.gov (United States)

    2010-07-01

    ..., of anticipated outcomes which may include anticipated uses, values, products, or services based on an... Forest Service budget and capacity should be based on recent funding levels; (3) A 2-year summary... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Plan documentation. 219.30...

  5. 36 CFR 219.6 - Proposed actions.

    Science.gov (United States)

    2010-07-01

    ... Section 219.6 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE PLANNING...-specific action, or both. (b) NEPA requirements. Unless otherwise provided by law, the responsible official must analyze the effects of the proposal and alternative(s) in conformance with Forest Service NEPA...

  6. 48 CFR 219.201 - General policy.

    Science.gov (United States)

    2010-10-01

    ... business goal has caused non-SDB firms in a particular North American Industry Classification System... OF DEFENSE SOCIOECONOMIC PROGRAMS SMALL BUSINESS PROGRAMS Policies 219.201 General policy. (d) For the defense agencies, the director of the Office of Small Business Programs must be appointed by, be...

  7. 32 CFR 219.109 - IRB review of research.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false IRB review of research. 219.109 Section 219.109...) MISCELLANEOUS PROTECTION OF HUMAN SUBJECTS § 219.109 IRB review of research. (a) An IRB shall review and have...) An IRB shall conduct continuing review of research covered by this policy at intervals appropriate to...

  8. 36 CFR 219.21 - Social and economic sustainability.

    Science.gov (United States)

    2010-07-01

    ... sustainability. 219.21 Section 219.21 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF... Economic Sustainability § 219.21 Social and economic sustainability. To contribute to economic and social sustainability, the responsible official involves interested and affected people in planning for National Forest...

  9. 36 CFR 219.19 - Ecological, social, and economic sustainability.

    Science.gov (United States)

    2010-07-01

    ... economic sustainability. 219.19 Section 219.19 Parks, Forests, and Public Property FOREST SERVICE..., Social, and Economic Sustainability § 219.19 Ecological, social, and economic sustainability. Sustainability, composed of interdependent ecological, social, and economic elements, embodies the Multiple-Use...

  10. 49 CFR 199.219 - Pre-duty use.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Pre-duty use. 199.219 Section 199.219 Transportation Other Regulations Relating to Transportation (Continued) PIPELINE AND HAZARDOUS MATERIALS SAFETY... Prevention Program § 199.219 Pre-duty use. Each operator shall prohibit a covered employee from using alcohol...

  11. 48 CFR 219.705-4 - Reviewing the subcontracting plan.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Reviewing the subcontracting plan. 219.705-4 Section 219.705-4 Federal Acquisition Regulations System DEFENSE ACQUISITION... Subcontracting Program 219.705-4 Reviewing the subcontracting plan. (d) Challenge any subcontracting plan that...

  12. 48 CFR 1852.219-75 - Small business subcontracting reporting.

    Science.gov (United States)

    2010-10-01

    ... subcontracting reporting. 1852.219-75 Section 1852.219-75 Federal Acquisition Regulations System NATIONAL... Provisions and Clauses 1852.219-75 Small business subcontracting reporting. As prescribed in 1819.708-70(b), insert the following clause: Small Business Subcontracting Reporting (MAY 1999) (a) The Contractor shall...

  13. 48 CFR 52.219-14 - Limitations on Subcontracting.

    Science.gov (United States)

    2010-10-01

    ... Subcontracting. 52.219-14 Section 52.219-14 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION....219-14 Limitations on Subcontracting. As prescribed in 19.508(e) or 19.811-3(e), insert the following clause: Limitations on Subcontracting (DEC 1996) (a) This clause does not apply to the unrestricted...

  14. 34 CFR 300.214-300.219 - [Reserved

    Science.gov (United States)

    2010-07-01

    ... 34 Education 2 2010-07-01 2010-07-01 false 300.214-300.219 Section 300.214-300.219 Education Regulations of the Offices of the Department of Education (Continued) OFFICE OF SPECIAL EDUCATION AND... DISABILITIES Local Educational Agency Eligibility §§ 300.214-300.219 ...

  15. 48 CFR 653.219 - Small business programs.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Small business programs. 653.219 Section 653.219 Federal Acquisition Regulations System DEPARTMENT OF STATE CLAUSES AND FORMS FORMS Prescription of Forms 653.219 Small business programs. ...

  16. 48 CFR 1353.219 - Small business programs.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Small business programs. 1353.219 Section 1353.219 Federal Acquisition Regulations System DEPARTMENT OF COMMERCE CLAUSES AND FORMS FORMS Prescription of Forms 1353.219 Small business programs. Use Form CD-570, Small Business Set...

  17. 49 CFR 219.501 - Pre-employment drug testing.

    Science.gov (United States)

    2010-10-01

    ... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION CONTROL OF ALCOHOL AND DRUG USE Pre-Employment Tests § 219.501 Pre... 49 Transportation 4 2010-10-01 2010-10-01 false Pre-employment drug testing. 219.501 Section 219... covered service, unless the employee has been administered a test for drugs with a result that did not...

  18. 20 CFR 219.23 - Evidence to prove death.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Evidence to prove death. 219.23 Section 219... EVIDENCE REQUIRED FOR PAYMENT Evidence of Age and Death § 219.23 Evidence to prove death. (a) Preferred evidence of death. The best evidence of a person's death is— (1) A certified copy of or extract from the...

  19. 29 CFR 825.219 - Rights of a key employee.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 3 2010-07-01 2010-07-01 false Rights of a key employee. 825.219 Section 825.219 Labor....219 Rights of a key employee. (a) An employer who believes that reinstatement may be denied to a key... recover its cost of health benefit premiums. A key employee's rights under FMLA continue unless and until...

  20. 48 CFR 52.219-22 - Small Disadvantaged Business Status.

    Science.gov (United States)

    2010-10-01

    .... Status as a small business and status as a small disadvantaged business for general statistical purposes... Business Status. 52.219-22 Section 52.219-22 Federal Acquisition Regulations System FEDERAL ACQUISITION... Clauses 52.219-22 Small Disadvantaged Business Status. As prescribed in 19.308(b), insert the following...

  1. An automated flow system incorporating in-line acid dissolution of bismuth metal from a cyclotron irradiated target assembly for use in the isolation of astatine-211

    Energy Technology Data Exchange (ETDEWEB)

    O’Hara, Matthew J.; Krzysko, Anthony J.; Niver, Cynthia M.; Morrison, Samuel S.; Owsley, Stanley L.; Hamlin, Donald K.; Dorman, Eric F.; Scott Wilbur, D.

    2017-04-01

    Astatine-211 (211At) is a promising cyclotron-produced radionuclide being investigated for use in targeted alpha therapy of blood borne and metastatic cancers, as well as treatment of tumor remnants after surgical resections. The isolation of trace quantities of 211At, produced within several grams of a Bi metal cyclotron target, involves a complex, multi-step procedure: (1) Bi metal dissolution in strong HNO3, (2) distillation of the HNO3 to yield Bi salts containing 211At, (3) dissolution of the salts in strong HCl, (4) solvent extraction of 211At from bismuth salts with diisopropyl ether (DIPE), and (5) back-extraction of 211At from DIPE into NaOH, leading to a purified 211At product. Step (1) has been addressed first to begin the process of automating the onerous 211At isolation process. A computer-controlled Bi target dissolution system has been designed. The system performs in-line dissolution of Bi metal from the target assembly using an enclosed target dissolution block, routing the resulting solubilized 211At/Bi mixture to the subsequent process step. The primary parameters involved in Bi metal solubilization (HNO3 concentration and influent flow rate) were optimized prior to evaluation of the system performance on replicate cyclotron irradiated targets. The results indicate that the system performs reproducibly, having nearly quantitative release of 211At from irradiated targets, with cumulative 211At recoveries that follow a sigmoidal function. The predictable nature of the 211At release profile allows the user to tune the system to meet target processing requirements.

  2. Reagents for astatination of biomolecules. 2. Conjugation of anionic boron cage pendant groups to a protein provides a method for direct labeling that is stable to in vivo deastatination.

    Science.gov (United States)

    Wilbur, D Scott; Chyan, Ming-Kuan; Hamlin, Donald K; Vessella, Robert L; Wedge, Timothy J; Hawthorne, M Frederick

    2007-01-01

    Cancer-targeting biomolecules labeled with 211At must be stable to in vivo deastatination, as control of the 211At distribution is critical due to the highly toxic nature of alpha-particle emission. Unfortunately, no astatinated aryl conjugates have shown in vivo stability toward deastatination when (relatively) rapidly metabolized proteins, such as monoclonal antibody Fab' fragments, are labeled. As a means of increasing the in vivo stability of 211At-labeled proteins, we have been investigating antibody conjugates of boron cage moieties. In this investigation, protein-reactive derivatives containing a nido-carborane (2), a bis-nido-carborane derivative (Venus Flytrap Complex, 3), and four 2-nonahydro-closo-decaborate(2-) derivatives (4-7) were prepared and conjugated with an antibody Fab' fragment such that subsequent astatination and in vivo tissue distributions could be obtained. To aid in determination of stability toward in vivo deastatination, the Fab'-borane conjugates were also labeled with 125I, and that material was coinjected with the 211At-labeled Fab'. For comparison, direct labeling of the Fab' with 125I and 211At was conducted. Direct labeling with Na[125I]I and Chloramine-T gave an 89% radiochemical yield. However, direct labeling of the Fab' with Na[211At]At and Chloramine-T resulted in a yield of Studies to optimize the closo-decaborate(2-) conjugates for protein labeling are underway.

  3. 32 CFR 219.117 - Documentation of informed consent.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Documentation of informed consent. 219.117... (CONTINUED) MISCELLANEOUS PROTECTION OF HUMAN SUBJECTS § 219.117 Documentation of informed consent. (a) Except as provided in paragraph (c) of this section, informed consent shall be documented by the use of a...

  4. 43 CFR 2.19 - When will bureaus waive fees?

    Science.gov (United States)

    2010-10-01

    ... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false When will bureaus waive fees? 2.19 Section... OF INFORMATION ACT Requests for Records under the FOIA § 2.19 When will bureaus waive fees? (a) Fees... documents sought in the request will likely contribute significantly to public understanding of the...

  5. 20 CFR 219.57 - Evidence of a parent's support.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Evidence of a parent's support. 219.57... EVIDENCE REQUIRED FOR PAYMENT Other Evidence Requirements § 219.57 Evidence of a parent's support. (a) The... Board will require other convincing evidence that the parent is receiving one-half of his or her support...

  6. 20 CFR 219.24 - Evidence of presumed death.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Evidence of presumed death. 219.24 Section... EVIDENCE REQUIRED FOR PAYMENT Evidence of Age and Death § 219.24 Evidence of presumed death. When a person cannot be proven dead but evidence of death is needed, the Board may presume he or she died at a certain...

  7. 49 CFR 219.901 - Retention of alcohol testing records.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Retention of alcohol testing records. 219.901... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION CONTROL OF ALCOHOL AND DRUG USE Recordkeeping Requirements § 219.901 Retention of alcohol testing records. (a) General requirement. In addition to the records required to be...

  8. 49 CFR 219.903 - Retention of drug testing records.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Retention of drug testing records. 219.903 Section... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION CONTROL OF ALCOHOL AND DRUG USE Recordkeeping Requirements § 219.903 Retention of drug testing records. (a) General requirement. In addition to the records required to be kept...

  9. 40 CFR 86.219-94 - CVS calibration.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 18 2010-07-01 2010-07-01 false CVS calibration. 86.219-94 Section 86.219-94 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED... Later Model Year Gasoline-Fueled New Light-Duty Vehicles, New Light-Duty Trucks and New Medium-Duty...

  10. 36 CFR 219.25 - Science advisory boards.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Science advisory boards. 219... PLANNING National Forest System Land and Resource Management Planning The Contribution of Science § 219.25 Science advisory boards. (a) National science advisory board. The Forest Service Deputy Chief for Research...

  11. 36 CFR 219.24 - Science consistency evaluations.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Science consistency evaluations. 219.24 Section 219.24 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE PLANNING National Forest System Land and Resource Management Planning The Contribution of Science...

  12. 48 CFR 1852.219-73 - Small business subcontracting plan.

    Science.gov (United States)

    2010-10-01

    ... Provisions and Clauses 1852.219-73 Small business subcontracting plan. As prescribed in 1819.708-70(a), insert the following provision: Small Business Subcontracting Plan (MAY 1999) (a) This provision is not... contain FAR clause 52.219-9, “Small Business Subcontracting Plan.” The apparent low bidder must submit the...

  13. 20 CFR 219.43 - Evidence of child's dependency.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Evidence of child's dependency. 219.43... EVIDENCE REQUIRED FOR PAYMENT Evidence of Relationship § 219.43 Evidence of child's dependency. (a) When the dependency requirement must be met. Usually the dependency requirement must be met at one of the...

  14. 14 CFR 21.9 - Replacement and modification articles.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Replacement and modification articles. 21.9... CERTIFICATION PROCEDURES FOR PRODUCTS AND PARTS General § 21.9 Replacement and modification articles. (a) If a person knows, or should know, that a replacement or modification article is reasonably likely to be...

  15. 36 CFR 219.29 - Limitation on timber harvest.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Limitation on timber harvest. 219.29 Section 219.29 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE... responsible official may sell timber from areas that are substantially affected by fire, wind, or other events...

  16. 48 CFR 219.705 - Responsibilities of the contracting officer under the subcontracting assistance program.

    Science.gov (United States)

    2010-10-01

    ... contracting officer under the subcontracting assistance program. 219.705 Section 219.705 Federal Acquisition... BUSINESS PROGRAMS The Small Business Subcontracting Program 219.705 Responsibilities of the contracting officer under the subcontracting assistance program. ...

  17. 36 CFR 219.5 - Information development and interpretation.

    Science.gov (United States)

    2010-07-01

    ... PLANNING National Forest System Land and Resource Management Planning The Framework for Planning § 219.5... consideration, the responsible official should review relevant information such as inventories, broad-scale...

  18. 49 CFR 219.11 - General conditions for chemical tests.

    Science.gov (United States)

    2010-10-01

    ... construed to authorize the use of physical coercion or any other deprivation of liberty in order to compel... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION CONTROL OF ALCOHOL AND DRUG USE General § 219.11 General conditions...

  19. 32 CFR 219.116 - General requirements for informed consent.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false General requirements for informed consent. 219... informed consent of the subject or the subject's legally authorized representative. An investigator shall... language understandable to the subject or the representative. No informed consent, whether oral or written...

  20. 48 CFR 219.704 - Subcontracting plan requirements.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Subcontracting plan... Subcontracting Program 219.704 Subcontracting plan requirements. (1) The goal for use of small disadvantaged... included in the small disadvantaged business goal in commercial items subcontracting plans. (2) In those...

  1. 48 CFR 1052.219-71 - Subcontracting Plan.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Subcontracting Plan. 1052... Subcontracting Plan. As prescribed in DTAR 1019.708-70(b), insert the following provision: Subcontracting Plan..., as prescribed in FAR 52.219-9. Use of the subcontracting plan outlined containe in Section J of this...

  2. 48 CFR 52.219-10 - Incentive Subcontracting Program.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Incentive Subcontracting....219-10 Incentive Subcontracting Program. As prescribed in 19.708(c)(1), insert the following clause: Incentive Subcontracting Program (OCT 2001) (a) Of the total dollars it plans to spend under subcontracts...

  3. 20 CFR 725.219 - Duration of entitlement; child.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Duration of entitlement; child. 725.219... of entitlement; child. (a) An individual is entitled to benefits as a child for each month beginning... month in which any one of the following events first occurs: (1) The child dies; (2) The child marries...

  4. 48 CFR 53.219 - Small Business Programs.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Small Business Programs... (CONTINUED) CLAUSES AND FORMS FORMS Prescription of Forms 53.219 Small Business Programs. (a) The following form may be used in reporting small disadvantaged business contracting data: OF 312 (10/00), Small...

  5. 49 CFR 219.502 - Pre-employment alcohol testing.

    Science.gov (United States)

    2010-10-01

    ... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION CONTROL OF ALCOHOL AND DRUG USE Pre-Employment Tests § 219.502 Pre... must comply with the following requirements: (1) It must conduct a pre-employment alcohol test before... the purpose of pre-employment alcohol testing (i.e., it must not test some covered employees and not...

  6. 48 CFR 52.219-9 - Small business subcontracting plan.

    Science.gov (United States)

    2010-10-01

    ... Clauses 52.219-9 Small business subcontracting plan. As prescribed in 19.708(b), insert the following clause: Small Business Subcontracting Plan (OCT 2010) (a) This clause does not apply to small business... business, and women-owned small business concerns. If the offeror is submitting an individual contract plan...

  7. 48 CFR 52.219-1 - Small Business Program Representations.

    Science.gov (United States)

    2010-10-01

    ... represents, for general statistical purposes, that it □ is, □ is not, a small disadvantaged business concern... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Small Business Program....219-1 Small Business Program Representations. As prescribed in 19.308(a)(1), insert the following...

  8. 48 CFR 552.219-72 - Preparation, Submission, and Negotiation of Subcontracting Plans.

    Science.gov (United States)

    2010-10-01

    ..., and Negotiation of Subcontracting Plans. 552.219-72 Section 552.219-72 Federal Acquisition Regulations... Text of Provisions and Clauses 552.219-72 Preparation, Submission, and Negotiation of Subcontracting... Negotiation of Subcontracting Plans (JUN 2005) (a) An offeror, other than a small business concern, submitting...

  9. 48 CFR 1852.219-82 - Limitation on subcontracting-STTR program.

    Science.gov (United States)

    2010-10-01

    ... subcontracting-STTR program. 1852.219-82 Section 1852.219-82 Federal Acquisition Regulations System NATIONAL... Provisions and Clauses 1852.219-82 Limitation on subcontracting—STTR program. As prescribed in 1819.7302(c), insert the following clause: Limitation on Subcontracting—STTR Program (OCT 2006) The Contractor shall...

  10. 48 CFR 1852.219-81 - Limitation on subcontracting-SBIR Phase II program.

    Science.gov (United States)

    2010-10-01

    ... subcontracting-SBIR Phase II program. 1852.219-81 Section 1852.219-81 Federal Acquisition Regulations System... CLAUSES Texts of Provisions and Clauses 1852.219-81 Limitation on subcontracting—SBIR Phase II program. As prescribed in 1819.7302(b), insert the following clause: Limitation on Subcontracting—SBIR Phase II Program...

  11. 48 CFR 52.219-16 - Liquidated Damages-Subcontracting Plan.

    Science.gov (United States)

    2010-10-01

    ...-Subcontracting Plan. 52.219-16 Section 52.219-16 Federal Acquisition Regulations System FEDERAL ACQUISITION... Clauses 52.219-16 Liquidated Damages—Subcontracting Plan. As prescribed in 19.708(b)(2), insert the following clause: Liquidated Damages—Subcontracting Plan (JAN 1999) (a) Failure to make a good faith effort...

  12. 48 CFR 552.219-71 - Notice to Offerors of Subcontracting Plan Requirements.

    Science.gov (United States)

    2010-10-01

    ... Subcontracting Plan Requirements. 552.219-71 Section 552.219-71 Federal Acquisition Regulations System GENERAL... and Clauses 552.219-71 Notice to Offerors of Subcontracting Plan Requirements. As prescribed in 519.708-70(a), insert the following provision: Notice to Offerors of Subcontracting Plan Requirements (JUN...

  13. 48 CFR 1852.219-80 - Limitation on subcontracting-SBIR Phase I program.

    Science.gov (United States)

    2010-10-01

    ... subcontracting-SBIR Phase I program. 1852.219-80 Section 1852.219-80 Federal Acquisition Regulations System... CLAUSES Texts of Provisions and Clauses 1852.219-80 Limitation on subcontracting—SBIR Phase I program. As prescribed in 1819.7302(a), insert the following clause: Limitation on Subcontracting—SBIR Phase I Program...

  14. 48 CFR 52.219-25 - Small Disadvantaged Business Participation Program-Disadvantaged Status and Reporting.

    Science.gov (United States)

    2010-10-01

    ... accomplished through using the Electronic Subcontracting Reporting System's Small Disadvantaged Business... Business Participation Program-Disadvantaged Status and Reporting. 52.219-25 Section 52.219-25 Federal... PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 52.219-25 Small Disadvantaged Business...

  15. 20 CFR 219.38 - Evidence of stepparent or stepchild relationship.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Evidence of stepparent or stepchild... RAILROAD RETIREMENT ACT EVIDENCE REQUIRED FOR PAYMENT Evidence of Relationship § 219.38 Evidence of... will ask for the evidence described in § 219.37 or § 219.39 which shows the person's natural or...

  16. 20 CFR 219.41 - Evidence of relationship of grandchild or stepgrandchild.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Evidence of relationship of grandchild or... RAILROAD RETIREMENT ACT EVIDENCE REQUIRED FOR PAYMENT Evidence of Relationship § 219.41 Evidence of..., the Board will require the kind of evidence described in §§ 219.36-219.38 that shows that child's...

  17. 40 CFR 80.219 - Designation and downstream requirements for GPA gasoline.

    Science.gov (United States)

    2010-07-01

    ... requirements for GPA gasoline. 80.219 Section 80.219 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) REGULATION OF FUELS AND FUEL ADDITIVES Gasoline Sulfur Geographic Phase-in Program § 80.219 Designation and downstream requirements for GPA gasoline. The requirements and...

  18. 36 CFR 219.23 - The role of science in assessments, analyses, and monitoring.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false The role of science in assessments, analyses, and monitoring. 219.23 Section 219.23 Parks, Forests, and Public Property FOREST... The Contribution of Science § 219.23 The role of science in assessments, analyses, and monitoring. (a...

  19. 49 CFR 219.611 - Test result indicating prohibited alcohol concentration; procedures.

    Science.gov (United States)

    2010-10-01

    ... concentration; procedures. 219.611 Section 219.611 Transportation Other Regulations Relating to Transportation... concentration; procedures. Procedures for administrative handling by the railroad in the event an employee's confirmation test indicates an alcohol concentration of .04 or greater are set forth in § 219.104. ...

  20. 49 CFR Appendix A to Part 219 - Schedule of Civil Penalties

    Science.gov (United States)

    2010-10-01

    ...,000 Subpart F—Pre-Employment Tests 219.501Pre-employment tests: (a) Failure to perform pre-employment... required program $5,000 $7,500 219.11General conditions for chemical tests: (b)(1) Employee unlawfully... or blood specimens provided for Federal testing were used for non-authorized testing 2,500 5,000 219...

  1. Diagnosis of a Family with the Novel -α(21.9) Thalassemia Deletion.

    Science.gov (United States)

    Long, Ju; Pang, Wanrong; Sun, Lei; Lao, Kegan; Weng, Xunjin; Ye, Xuehe; Wu, Suping; Song, Chuanlu; Wei, Xiaoying; Yan, Shanhuo

    2015-01-01

    The Qinzhou α-thalassemia (α-thal) or -α(21.9) deletion was first described at the Qinzhou Maternal and Child Health Care Hospital, Qinzhou, Guangxi, People's Republic of China (PRC) in 2013. The molecular biological mechanism by which this allele leads to α-thal involves the deletion of a 21.9 kb DNA fragment of the α-globin gene cluster (NG_000006.1), designated as -α(21.9). During routine screening, a new family with -α(21.9) was found by the research group. This is the first time that an adult patient with the -α(21.9)/αα genotype and a 6-month-old baby with the -α(21.9)/- -(SEA) (Southeast Asian) genotype were detected in one family. The discovery of this family demonstrates that there is a certain risk for the Qinzhou α-thal deletion in the southern regions of Guangxi Province, PRC. The detection of the adult patient with the -α(21.9)/αα genotype and the analysis of hematological data are important supplements for -α(21.9) research. Additionally, Hb Bart's (γ4) and Hb H (β4) were detected in the 6-month-old, confirming that the baby with the -α(21.9)/- -(SEA) genotype also carries Hb H disease. The analysis of this family verifies that the -α(21.9) deletion is an α(+)-thal allele.

  2. 20 CFR 219.40 - Evidence of relationship by equitable adoption-child.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Evidence of relationship by equitable adoption-child. 219.40 Section 219.40 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE... relationship by equitable adoption—child. (a) Preferred evidence. If the claimant is a person who claims to be...

  3. 25 CFR 166.219 - How do I acquire a permit through negotiation?

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false How do I acquire a permit through negotiation? 166.219... PERMITS Permit Requirements Obtaining A Permit § 166.219 How do I acquire a permit through negotiation? (a...) Upon the conclusion of negotiations with the Indian landowners or their representatives, and the...

  4. 48 CFR 652.219-70 - Department of State Subcontracting Goals.

    Science.gov (United States)

    2010-10-01

    ... Subcontracting Goals. 652.219-70 Section 652.219-70 Federal Acquisition Regulations System DEPARTMENT OF STATE... Department of State Subcontracting Goals. As prescribed in 619.708-70, insert a provision substantially the same as follows: Department of State Subcontracting Goals (APR 2004) (a) The offeror shall provide a...

  5. 48 CFR 3052.219-70 - Small Business subcontracting program reporting.

    Science.gov (United States)

    2010-10-01

    ... subcontracting program reporting. 3052.219-70 Section 3052.219-70 Federal Acquisition Regulations System... subcontracting program reporting. As prescribed in (HSAR) 48 CFR 3019.708-70(a), insert the following clause: Small Business Subcontracting Plan Reporting (JUN 2006) (a) The Contractor shall enter the information...

  6. 48 CFR 52.219-26 - Small Disadvantaged Business Participation Program-Incentive Subcontracting.

    Science.gov (United States)

    2010-10-01

    ... Business Participation Program-Incentive Subcontracting. 52.219-26 Section 52.219-26 Federal Acquisition... Program—Incentive Subcontracting. As prescribed in 19.1204(c), insert a clause substantially the same as the following: Small Disadvantaged Business Participation Program—Incentive Subcontracting (OCT 2000...

  7. 14 CFR 91.219 - Altitude alerting system or device: Turbojet-powered civil airplanes.

    Science.gov (United States)

    2010-01-01

    ...: Turbojet-powered civil airplanes. 91.219 Section 91.219 Aeronautics and Space FEDERAL AVIATION... system or device: Turbojet-powered civil airplanes. (a) Except as provided in paragraph (d) of this section, no person may operate a turbojet-powered U.S.-registered civil airplane unless that airplane is...

  8. 48 CFR 3052.219-71 - DHS mentor-protégé program.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 7 2010-10-01 2010-10-01 false DHS mentor-protégé program. 3052.219-71 Section 3052.219-71 Federal Acquisition Regulations System DEPARTMENT OF HOMELAND SECURITY, HOMELAND SECURITY ACQUISITION REGULATION (HSAR) CLAUSES AND FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses...

  9. 49 CFR 234.219 - Gate arm lights and light cable.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Gate arm lights and light cable. 234.219 Section... Maintenance, Inspection, and Testing Maintenance Standards § 234.219 Gate arm lights and light cable. Each gate arm light shall be maintained in such condition to be properly visible to approaching highway...

  10. 20 CFR 219.32 - Evidence of a common-law marriage.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Evidence of a common-law marriage. 219.32... EVIDENCE REQUIRED FOR PAYMENT Evidence of Relationship § 219.32 Evidence of a common-law marriage. (a) Preferred evidence. Evidence of a common-law marriage must give the reasons why the informant believes that...

  11. 20 CFR 219.30 - When evidence of marriage is required.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false When evidence of marriage is required. 219.30... EVIDENCE REQUIRED FOR PAYMENT Evidence of Relationship § 219.30 When evidence of marriage is required. (a) When an application is filed for benefits. Documentary evidence of marriage is required when an...

  12. 20 CFR 219.35 - Evidence that a marriage has ended.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Evidence that a marriage has ended. 219.35... EVIDENCE REQUIRED FOR PAYMENT Evidence of Relationship § 219.35 Evidence that a marriage has ended. (a) Preferred evidence. Preferred evidence that a marriage has ended is— (1) A certified copy of the decree of...

  13. 20 CFR 219.33 - Evidence of a deemed valid marriage.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Evidence of a deemed valid marriage. 219.33... EVIDENCE REQUIRED FOR PAYMENT Evidence of Relationship § 219.33 Evidence of a deemed valid marriage. (a) Preferred evidence. Preferred evidence of a deemed valid marriage is— (1) Evidence of a ceremonial marriage...

  14. 49 CFR 238.219 - Truck-to-car-body attachment.

    Science.gov (United States)

    2010-10-01

    ... section, the mass of the truck includes axles, wheels, bearings, the truck-mounted brake system... 49 Transportation 4 2010-10-01 2010-10-01 false Truck-to-car-body attachment. 238.219 Section 238... I Passenger Equipment § 238.219 Truck-to-car-body attachment. Passenger equipment shall have a truck...

  15. 48 CFR 2452.219-70 - Small business subcontracting plan compliance.

    Science.gov (United States)

    2010-10-01

    ... of Provisions and Clauses 2452.219-70 Small business subcontracting plan compliance. As prescribed in 2419.708(d), insert the following provision: Small Business Subcontracting Plan Compliance (FEB 2006... the clause at FAR 52.219-9, Small Business Subcontracting Plan. (c) The government will consider...

  16. 20 CFR 219.42 - When evidence of child's dependency is required.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false When evidence of child's dependency is required. 219.42 Section 219.42 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE... child's dependency is required. Evidence of a child's dependency on the employee is required when— (a...

  17. 30 CFR 219.416 - How will the qualified OCS revenues be allocated to coastal political subdivisions within the...

    Science.gov (United States)

    2010-07-01

    ... population bears to the population of all coastal political subdivisions in the producing State; (b) Twenty... allocated to coastal political subdivisions within the Gulf producing States? 219.416 Section 219.416... DISTRIBUTION AND DISBURSEMENT OF ROYALTIES, RENTALS, AND BONUSES Oil and Gas, Offshore § 219.416 How will the...

  18. MiR-219-5p Inhibits the Growth and Metastasis of Malignant Melanoma by Targeting BCL-2

    Directory of Open Access Journals (Sweden)

    Jianwen Long

    2017-01-01

    Full Text Available Malignant melanoma is a very dangerous tumor which is resistant to conventional therapy. MicroRNA exerts a vital function in promoting or inhibiting tumor development. The research has investigated the expression and function of miR-219-5p in melanoma. As a result, miR-219-5p expression was distinctly reduced in melanoma tissues and cell lines and was negatively correlated with Bcl-2 protein level in melanoma. Patients with low miR-219-5p level represented obviously a low overall survival in comparison with patients with high miR-219-5p level. The upregulation of miR-219-5p inhibited melanoma growth and metastasis and strengthened melanoma cells chemosensitivity by targeting Bcl-2. Therefore, the modulation of miR-219-5p expression may be a novel treatment strategy in melanoma.

  19. MicroRNA-219-5p exerts tumor suppressor function by targeting ROBO1 in glioblastoma.

    Science.gov (United States)

    Jiang, Yongmei; Yin, Lin; Jing, Huirong; Zhang, Hui

    2015-11-01

    Previous studies have shown that miR-219-5p is dysregulated and exerts tumor-suppressive effects in cancer development and progression. However, the molecular function and mechanism of miR-219-5p in glioblastoma growth and invasion are still unclear. In the present study, we show that miR-219-5p was downregulated in a panel of glioma tissues with different grades and in all the human glioma cell lines examined. Ectopic expression of miR-219-5p inhibited proliferation and invasion and induced apoptosis in vitro, and xenograft formation in vivo. ROBO1 was found to be a direct target of miR-219-5p, and when overexpressed in miR-219-5p-expressing glioma cells, was able to restore proliferative and invasive ability. Finally, in vivo investigation confirmed that miR-219-5p was a tumor suppressor that regulated ROBO1 expression. Taken together, these studies demonstrate that miR-219-5p inhibited cancer cell growth and invasion by direct targeting ROBO1, implicating miR-219-5p as an attractive candidate for cancer therapy.

  20. 38 CFR 21.219 - Supplies consisting of clothing, magazines and periodicals, and items which may be personally...

    Science.gov (United States)

    2010-07-01

    ... clothing, magazines and periodicals, and items which may be personally used by the veteran. 21.219 Section....219 Supplies consisting of clothing, magazines and periodicals, and items which may be personally used... will be supplied. (b) Furnishing magazines and periodicals. Appropriate past issues of magazines...

  1. 78 FR 35567 - Safety Zone; Lower Mississippi River, Mile Marker 219 to Mile Marker 229, in the Vicinity of Port...

    Science.gov (United States)

    2013-06-13

    ... Captain of the Port, New Orleans has implemented a safety zone from mile marker 219 to mile marker 225... SECURITY Coast Guard 33 CFR Part 165 RIN 1625-AA00 Safety Zone; Lower Mississippi River, Mile Marker 219 to Mile Marker 229, in the Vicinity of Port Allen Lock AGENCY: Coast Guard, DHS. ACTION: Temporary final...

  2. Page 1 An overview of fullerene chemistry 219 % Ph n-Buli % Ph ...

    Indian Academy of Sciences (India)

    An overview of fullerene chemistry 219. % Ph n-Buli % Ph THF washing % h. H —- Li F-T.--. THF THF (90:10). 383. 386 387 MeOH. Figure 110. Grafting of Cao onto polyethylene surface (Bergbreiter and Gray 1993). with diphenyl methyl groups react with n-BuLi, deprotonated to give a nucleophilic lithiated surface.

  3. Alpha decay properties of the semi-magic nucleus 219Np

    Science.gov (United States)

    Yang, H. B.; Ma, L.; Zhang, Z. Y.; Yang, C. L.; Gan, Z. G.; Zhang, M. M.; Huang, M. H.; Yu, L.; Jiang, J.; Tian, Y. L.; Wang, Y. S.; Wang, J. G.; Liu, Z.; Liu, M. L.; Duan, L. M.; Zhou, S. G.; Ren, Z. Z.; Zhou, X. H.; Xu, H. S.; Xiao, G. Q.

    2018-02-01

    The semi-magic nucleus 219Np was produced in the fusion reaction 187Re(36Ar, 4n)219Np at the gas-filled recoil separator SHANS (Spectrometer for Heavy Atoms and Nuclear Structure). A fast electronics system based on waveform digitizers was used in the data acquisition and the sampled pulses were processed by digital algorithms. The reaction products were identified using spatial and time correlations between the implants and subsequent α decays. According to the observed α-decay chain, an energy of Eα = 9039 (40) keV and a half-life of T1/2 =0.15-0.07 + 0.72 ms were determined for 219Np. The deduced proton binding energy of 219Np fits well into the systematics, which gives another evidence of that there is no sub-shell closure at Z = 92. The influence of the N = 126 shell closure on the stability of Np isotopes is discussed within the framework of α-decay reduced widths.

  4. 36 CFR 219.31 - Maintenance of the plan and planning records.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Maintenance of the plan and....31 Maintenance of the plan and planning records. (a) Each National Forest or Grassland Supervisor must maintain a complete set of the planning documents required under § 219.30 that constitute the plan...

  5. 48 CFR 219.1203 - Incentive subcontracting with small disadvantaged business concerns.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Incentive subcontracting... BUSINESS PROGRAMS Small Disadvantaged Business Participation Program 219.1203 Incentive subcontracting with small disadvantaged business concerns. The contracting officer shall encourage increased subcontracting...

  6. Occurrence of rhyolytic tuffs at deep sea drilling project site 219 on the Laccadive Ridge

    Digital Repository Service at National Institute of Oceanography (India)

    Siddiquie, H.N.; Sukheswala, R.N.

    most of the activity was subaqueous rather than subaerial. Similar acidic tuffs in the Deccan Traps have been reported particularly from the West Coast of India. The acidic tuffs at site 219 are of the same age as the Deccan Traps and may represent a...

  7. 20 CFR 219.31 - Evidence of a valid ceremonial marriage.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Evidence of a valid ceremonial marriage. 219... marriage. (a) Preferred evidence. Preferred evidence of a ceremonial marriage is— (1) A copy of the public record of the marriage, certified by the custodian of the record or by a Board employee; (2) A copy of a...

  8. 20 CFR 219.9 - Evidence, information, and records filed with the Board.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Evidence, information, and records filed with... RAILROAD RETIREMENT ACT EVIDENCE REQUIRED FOR PAYMENT General Evidence Requirements § 219.9 Evidence... persons who misrepresent the facts or make false statements to obtain payments for themselves or someone...

  9. 20 CFR 219.61 - Evidence of where the employee had a permanent home.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Evidence of where the employee had a... RAILROAD RETIREMENT ACT EVIDENCE REQUIRED FOR PAYMENT Other Evidence Requirements § 219.61 Evidence of where the employee had a permanent home. The Board will ask for the following evidence to establish the...

  10. 14 CFR 120.219 - Handling of test results, record retention, and confidentiality.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Handling of test results, record retention... AND OPERATIONS DRUG AND ALCOHOL TESTING PROGRAM Alcohol Testing Program Requirements § 120.219 Handling of test results, record retention, and confidentiality. (a) Retention of records. (1) General...

  11. 48 CFR 252.219-7004 - Small business subcontracting plan (test program).

    Science.gov (United States)

    2010-10-01

    ... AND CONTRACT CLAUSES Text of Provisions And Clauses 252.219-7004 Small business subcontracting plan... contract or subcontract. (b) The Offeror's comprehensive small business subcontracting plan and its... “Utilization of Small Business Concerns,” or (2) an approved plan required by this clause, shall be a material...

  12. 48 CFR 252.219-7003 - Small business subcontracting plan (DoD contracts).

    Science.gov (United States)

    2010-10-01

    ... AND CONTRACT CLAUSES Text of Provisions And Clauses 252.219-7003 Small business subcontracting plan...-9, Small Business Subcontracting Plan, clause of this contract. (a) Definitions. Historically black... division-wide commercial items subcontracting plans, the term small disadvantaged business, when used in...

  13. 48 CFR 852.219-9 - VA Small business subcontracting plan minimum requirements.

    Science.gov (United States)

    2010-10-01

    ... Provisions and Clauses 852.219-9 VA Small business subcontracting plan minimum requirements. As prescribed in subpart 819.709, insert the following clause: VA Small Business Subcontracting Plan Minimum Requirements... plan, the minimum goals for award of subcontracts to service-disabled veteran-owned small business...

  14. Sfragís and its metaphorical testimonial presence in 2 Timothy 2:19

    Directory of Open Access Journals (Sweden)

    Carlos Molina

    2011-03-01

    Full Text Available This article presented a metaphorical testimonial approach in the interpretation of 2 Timothy 2:19 and the use of sealing. As starting point, attention was given to the concept of ‘seal’ through the Old Testament and Ancient Near East. These periods attest the fact that sealing was also utilised in a figurative way as a sign of ownership, property and authenticity. Sfragís in 2 Timothy 2:19 describes the intimate relationship between Christ and his followers through the terms [foreign font omitted (personal and vital relationship that transcends in practice and [foreign font omitted (mainly an exterior knowledge]. These two vocables are in opposition to [foreign font omitted (to apostate from]. The message expressed in 2:19 exemplifies the principles that Christ lived by and he empowered his followers to stand by. Sfragís in 2 Timothy 2:19 is an imitatio Christi response against the [foreign font omitted] of moral standards and entertainment in the ancient Roman world. It includes a rapid contemporary reflection on practical faithfulness for today’s life.

  15. 36 CFR 219.11 - Monitoring and evaluation for adaptive management.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Monitoring and evaluation for... for Planning § 219.11 Monitoring and evaluation for adaptive management. (a) Plan monitoring strategy... plan decisions and characteristics of sustainability. (1) Monitoring and evaluation of ecological...

  16. 27 CFR 28.219 - Return of wine withdrawn for export with benefit of drawback.

    Science.gov (United States)

    2010-04-01

    ... marks on wines returned under this section shall be removed from the containers. (Sec. 201, Pub. L. 85... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Return of wine withdrawn... Exportation of Wine With Benefit of Drawback § 28.219 Return of wine withdrawn for export with benefit of...

  17. 41 CFR 302-3.219 - Is there a limit on how many times I may receive reimbursement for tour renewal travel?

    Science.gov (United States)

    2010-07-01

    ... many times I may receive reimbursement for tour renewal travel? 302-3.219 Section 302-3.219 Public Contracts and Property Management Federal Travel Regulation System RELOCATION ALLOWANCES RELOCATION....219 Is there a limit on how many times I may receive reimbursement for tour renewal travel? (a) If you...

  18. Conceptual design report, 219-S secondary containment upgrade, Project W-178

    Energy Technology Data Exchange (ETDEWEB)

    Beyer, J.J. [Kaiser Engineers Hanford Co., Richland, WA (United States)

    1993-05-01

    The 219-S Facility is located in the 200-West Area on the Hanford Site and was constructed in 1951. The facility receives and treats liquid, low-level mixed waste from the 222-S Laboratory prior to transfer of that waste to the SY Tank Farm. The 219-S Facility consists of Cell A containing Tanks 101 and 102 and Cell B containing Tank 103 and a spare space. Project W-178 will modify the 219-S Facility to bring it into compliance with the tank system standards in WAC 173-303-640. The secondary containment upgrade will consist of a stainless steel cell liner in both Cell A and the spare space in Cell B. Additionally, Cell B will be modified by taking Tank 103 out of service and installing a new tank: Tank 104. The construction work will be accomplished in phases to minimize service interruption to the 222-S Laboratory. The proposed design and construction method is the most cost effective of four alternatives evaluated during a value engineering session. Project W-178 is a fiscal year 1995 Line Item. Total estimated construction costs of the project are $2,600,000; other project costs are $710,000. The total project cost is $3,300,000.

  19. Differences in ABCA1 R219K Polymorphisms and Serum Indexes in Alzheimer and Parkinson Diseases in Northern China.

    Science.gov (United States)

    Ya, Lagai; Lu, Zuneng

    2017-09-25

    BACKGROUND ABCA1 R219K single-nucleotide polymorphisms (SNPs) was related to Alzheimer disease (AD) but not Parkinson disease (PD). Here, we analyzed the associations among ABCA1 R219K distribution, serum biomarkers, AD, and PD in a population in northern China. MATERIAL AND METHODS We used the Mini-Mental State Examination (MMSE) and the Hoehn and Yahr scale (H-Y) to evaluate AD and PD progression, separately. ABCA1 R219K was analyzed by matrix-assisted laser desorption ionization time of flight time mass spectrometry (MALDI-TOF-MS). Serum indexes were determined by enzyme-linked immunosorbent assay (ELISA). RESULTS ABCA1 R219K RR+RK genotype frequency in AD and PD patients was lower than that in normal controls (NC), while ABCA1 R219K KK genotype frequency was significantly higher. ABCA1 R219K RR genotype frequency in AD patients and NC was lower than that in PD patients, while ABCA1 R219K RK+KK genotype frequency was significantly higher. ABCA1 R219K RR genotype was positively correlated to MMSE value in AD patients, while ABCA1 R219K KK genotype was negatively correlated to H-Y value in PD patients. Serum factors were significantly different among AD and PD patients and NC. Serum ABCA1, ApoA1, ApoA2, ApoB, HDL, TC, IL-1β, IL-6, and TNF-α were significantly different between AD and PD patients. CONCLUSIONS ABCA1 R219K R allele was the risk factor inducing abnormal serum levels of ApoA2, LDL, and TG in AD patients, and abnormal levels of serum ABCA1, HDL, IL-1b, IL-6, and TNF-α in PD patients, while ABCA1 R219K K allele was the risk factor inducing lower ABCA1 in AD patients. IL-1β, IL-6, and TNF-α were negatively correlated to MMSE in AD patients but positively correlated to H-Y in PD patients, while HDL was positively related to H-Y in PD patients.

  20. Results of the GNSS receiver experiment OCAM-G on Ariane-5 flight VA 219

    OpenAIRE

    Hauschild, Andre; Markgraf, Markus; Montenbruck, Oliver; Pfeuffer, Horst; Dawidowicz, Elie; Rmili, Badr; Conde Reis, Alain

    2016-01-01

    The fifth Automated Transfer Vehicle was launched on 29 July 2014 with Ariane-5 flight VA 219 into orbit from Kourou, French Guiana. For the first time, the ascent of an Ariane rocket was independently tracked with a Global Navigation Satellite System (GNSS) receiver on this flight. The GNSS receiver experiment OCAM-G was mounted on the upper stage of the rocket. Its receivers tracked the trajectory of the Ariane-5 from lift-off until after the separation of the Automated Transfer Vehicle. Th...

  1. Polychlorinated biphenyls (PCB) analysis report for solid sample from 219S tank 104

    Energy Technology Data Exchange (ETDEWEB)

    Ross, G.A.

    1998-03-27

    A sample of solids was obtained from tank 104 of 219S via a peristaltic pump equipped with a stainless steel tube and Norprenel tubing (Phthalate free). The sample obtained in a glass jar with Teflon 2 lid, was analyzed for PCBs as Aroclor mixtures. A soxhlet extraction procedure was used to extract the Aroclors from the sample. Analysis was performed using dual column confirmation gas chromatography/electron capture detection (GC/ECD). The extraction method closely follows SW-846 method 3540C and the analysis follows SW-846 method.

  2. Astroglial MicroRNA-219-5p in the Ventral Tegmental Area Regulates Nociception in Rats.

    Science.gov (United States)

    Zhang, Song; Yang, Xiao-Na; Zang, Ting; Luo, Jun; Pan, Zhiqiang; Wang, Lei; Liu, He; Liu, Di; Li, Yan-Qiang; Zhang, Yao-Dong; Zhang, Hongxing; Ding, Hai-Lei; Cao, Jun-Li

    2017-09-01

    The authors previously reported that noncoding microRNA miR-219-5p is down-regulated in the spinal cord in a nociceptive state. The ventral tegmental area also plays critical roles in modulating nociception, although the underlying mechanism remains unknown. The authors hypothesized that miR-219-5p in the ventral tegmental area also may modulate nociception. The authors studied the bidirectional regulatory role of ventral tegmental area miR-219-5p in a rat complete Freund's adjuvant model of inflammatory nociception by measuring paw withdrawal latencies. Using molecular biology technologies, the authors measured the effects of astroglial coiled-coil and C2 domain containing 1A/nuclear factor κB cascade and dopamine neuron activity on the down-regulation of ventral tegmental area miR-219-5p-induced nociceptive responses. MiR-219-5p expression in the ventral tegmental area was reduced in rats with thermal hyperalgesia. Viral overexpression of ventral tegmental area miR-219-5p attenuated complete Freund's adjuvant-induced nociception from 7 days after complete Freund's adjuvant injection (paw withdrawal latencies: 6.09 ± 0.83 s vs. 3.96 ± 0.76 s; n = 6/group). Down-regulation of ventral tegmental area miR-219-5p in naïve rats was sufficient to induce thermal hyperalgesia from 7 days after lentivirus injection (paw withdrawal latencies: 7.09 ± 1.54 s vs. 11.75 ± 2.15 s; n = 8/group), which was accompanied by increased glial fibrillary acidic protein (fold change: 2.81 ± 0.38; n = 3/group) and reversed by intraventral tegmental area injection of the astroglial inhibitor fluorocitrate. The nociceptive responses induced by astroglial miR-219-5p down-regulation were inhibited by interfering with astroglial coiled-coil and C2 domain containing 1A/nuclear factor-κB signaling. Finally, pharmacologic inhibition of ventral tegmental area dopamine neurons alleviated this hyperalgesia. Down-regulation of astroglial miR-219-5p in ventral

  3. Hypothalamic miR-219 regulates individual metabolic differences in response to diet-induced weight cycling.

    Science.gov (United States)

    Schroeder, Mariana; Drori, Yonat; Ben-Efraim, Yair J; Chen, Alon

    2018-02-01

    Consumption of a low calorie diet is the most common approach to lose weight. While generally effective at first, it is frequently followed by a relapse where the pre-diet weight is regained, and often exceeded. This pattern of repeated weight loss/regain is referred to as weight cycling and the resulting metabolic response varies greatly between individuals. We attempted to address the issue of individual differences in the response to weight cycling in male mice. We first exposed adult wild type mice to repeated cycles of high/low fat food. Next, using a lentiviral approach, we knocked-down or over-expressed miR-219 in the ventromedial hypothalamus (VMH) of an additional mouse cohort and performed a full metabolic assessment. Exposure of wild type males to weight cycling resulted in the division of the cohort into subsets of resistant versus metabolic-syndrome-prone (MS) animals, which differed in their metabolic profile and hypothalamic miR-219 levels. Lentiviral knock-down of miR-219 in the VMH led to exacerbation of metabolic syndrome. In contrast, over-expression of miR-219 resulted in moderation of the metabolic syndrome phenotype. Our results suggest a role for miR-219 in the mediation of the metabolic phenotype resulting from repeated weight cycling. Copyright © 2018 The Authors. Published by Elsevier GmbH.. All rights reserved.

  4. Human prion protein (PrP) 219K is converted to PrPSc but shows heterozygous inhibition in variant Creutzfeldt-Jakob disease infection.

    Science.gov (United States)

    Hizume, Masaki; Kobayashi, Atsushi; Teruya, Kenta; Ohashi, Hiroaki; Ironside, James W; Mohri, Shirou; Kitamoto, Tetsuyuki

    2009-02-06

    Prion protein gene (PRNP) E219K is a human polymorphism commonly occurring in Asian populations but is rarely found in patients with sporadic Creutzfeldt-Jakob disease (CJD). Thus the polymorphism E219K has been considered protective against sporadic CJD. The corresponding mouse prion protein (PrP) polymorphism variant (mouse PrP 218K) is not converted to the abnormal isoform (PrP(Sc)) and shows a dominant negative effect on wild-type PrP conversion. To define the conversion activity of this human molecule, we herein established knock-in mice with human PrP 219K and performed a series of transmission experiments with human prions. Surprisingly, the human PrP 219K molecule was converted to PrP(Sc) in variant CJD infection, and the conversion occurred more efficiently than PrP 219E molecule. Notably the knock-in mice with PRNP codon 219E/K showed the least efficient conversion compared with their hemizygotes with PRNP codon 219E/0 or codon 219K/0, or homozygotes with PRNP codon 219E/E or codon 219K/K. This phenomenon indicated heterozygous inhibition. This heterozygous inhibition was observed also in knock-in mice with PRNP codon 129M/V genotype. In addition to variant CJD infection, the human PrP 219K molecule is conversion-competent in transmission experiments with sporadic CJD prions. Therefore, the protective effect of PRNP E219K against sporadic CJD might be due to heterozygous inhibition.

  5. 77 FR 62346 - Holiday CVS, L.L.C., d/b/a CVS/Pharmacy Nos. 219 and 5195; Denial of Request for Redactions

    Science.gov (United States)

    2012-10-12

    .../a CVS/Pharmacy Nos. 219 and 5195; Denial of Request for Redactions On August 31, 2012, I issued a... Holiday CVS, L.L.C., d/b/a CVS/Pharmacy Nos. 219 and 5195 (hereinafter, Respondents). Prior to publication... manner in which information was obtained for Respondents' pharmacy information management system...

  6. 48 CFR 1052.219-73 - Department of the Treasury Mentor-Protégé Program.

    Science.gov (United States)

    2010-10-01

    ... as defined in 13 CFR parts 121, 124, and 126. Developmental assistance is technical, managerial... DEPARTMENT OF THE TREASURY CLAUSES AND FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Texts of Provisions and Clauses 1052.219-73 Department of the Treasury Mentor-Protégé Program. As described in DTAR 1019...

  7. MicroRNA-219-5p functions as a tumor suppressor partially by targeting platelet-derived growth factor receptor alpha in colorectal cancer.

    Science.gov (United States)

    Xiong, G B; Zhang, G N; Xiao, Y; Niu, B Z; Qiu, H Z; Wu, B; Lin, G L; You, L; Shu, H

    2015-01-01

    Platelet-derived growth factor receptor (PDGFR) signaling pathway was involved in the progress of colorectal cancer (CRC). By using the bioinformatic system online, we found that PDGFRα is a potential target of miR-219-5p. However, the expression pattern and underlying mechanisms of miR-219-5p had not been elucidated in CRC. Herein, we first evaluated the expression of miR-219-5p in tumor tissues by real-time polymerase chain reaction. Next, we confirmed that PDGFRα is the target of miR-219-5p by using luciferase report. And then, we investigated the biological functions of miR-219-5p in vitro in cell proliferation and apoptosis as well as cell cycle by gain and loss of function strategies. Data shown that miR-219-5p is down-regulated in CRC tissues compared with the corresponding matched normal tissues. PDGFRα was a direct target of miR-219-5p. Overexpression of miR-219-5p could inhibit cell proliferation, promote cell apoptosis and induce cell cycle arrest at the G1 phase. Furthermore, miR-219-5p suppressed the activation of the phosphatidylinositol 3-kinase/Akt signaling pathway and downregulated G1 cell-cycle-related protein cyclin D1, cyclin-dependent kinase (CDK) 4, and CDK6. Taken together, our results demonstrate that miR-219-5p functions as a tumor suppressor partially by targeting PDGFRα in colorectal cancer.

  8. MicroRNA-219-2-3p functions as a tumor suppressor in gastric cancer and is regulated by DNA methylation.

    Directory of Open Access Journals (Sweden)

    Huizi Lei

    Full Text Available BACKGROUND AIMS: Gastric cancer is the most frequent gastrointestinal tumor in adults and is the most lethal form of human cancer. Despite of the improvements in treatments, the underlying mechanism of gastric carcinogenesis is not well known. To define novel modulators that regulate susceptibility to tumorgenesis, we focused on miR-219-2-3p. METHODS: Quantitative RT-PCR was employed to investigate the level of miR-219-2-3p in gastric cancer (GC tissues (n = 113 and their matched adjacent normal tissues (n = 113. In vitro cell proliferation, apoptosis assays, cell migration, and invasion assays were performed to elucidate biological effects of miR-219-2-3p. Since silencing of miRNA by promoter CpG island methylation may be an important mechanism in tumorgenesis, GC cells were treated with 5-aza-2'-deoxycytidine and trichostatin A, and expression changes of miR-219-2-3p were subsequently examined by quantitative RT-PCR. Finally, the methylation status of CpG island upstream of miR-219-2-3p was analyzed by methylation-specific PCR in GC tissues (n = 22. RESULTS: miR-219-2-3p was down-regulated in GC and cell lines. In addition, the experiments documented the lower expression of miR-219-2-3p in GC specimens with higher grade and later stage tumors. Meanwhile, miR-219-2-3p exerted antiproliferative, proapoptotic, and antimetastatic roles and reduced levels of p-ERK1/2 in GC cells. Furthermore, 5-aza-2'-deoxycytidine and trichostatin A increased the expression (~2 fold of miR-219-2-3p in GC cells. By methylation-specific PCR, DNA methylation in the upstream region of miR-219-2-3p was detected in both adjacent normal tissues and cancer tissues. As expected, the methylation level was considerably higher in the miR-219-2-3p down-regulated group than up-regulated group. CONCLUSIONS: miR-219-2-3p is potentially involved in gastric cancer progression and metastasis by regulating ERK1/2-related signal pathways, which may provide a novel therapeutic strategy

  9. Tank 103, 219-S Facility at 222-S Laboratory, analytical results for the final report

    Energy Technology Data Exchange (ETDEWEB)

    Fuller, R.K.

    1998-06-18

    This is the final report for the polychlorinated biphenyls analysis of Tank-103 (TK-103) in the 219-S Facility at 222-S Laboratory. Twenty 1-liter bottles (Sample numbers S98SO00074 through S98SO00093) were received from TK-103 during two sampling events, on May 5 and May 7, 1998. The samples were centrifuged to separate the solids and liquids. The centrifuged sludge was analyzed for PCBs as Aroclor mixtures. The results are discussed on page 6. The sample breakdown diagram (Page 114) provides a cross-reference of sample identification of the bulk samples to the laboratory identification number for the solids. The request for sample analysis (RSA) form is provided as Page 117. The raw data is presented on Page 43. Sample Description, Handling, and Preparation Twenty samples were received in the laboratory in 1-Liter bottles. The first 8 samples were received on May 5, 1998. There were insufficient solids to perform the requested PCB analysis and 12 additional samples were collected and received on May 7, 1998. Breakdown and sub sampling was performed on May 8, 1998. Sample number S98SO00084 was lost due to a broken bottle. Nineteen samples were centrifuged and the solids were collected in 8 centrifuge cones. After the last sample was processed, the solids were consolidated into 2 centrifuge cones. The first cone contained 9.7 grams of solid and 13.0 grams was collected in the second cone. The wet sludge from the first centrifuge cone was submitted to the laboratory for PCB analysis (sample number S98SO00102). The other sample portion (S98SO00103) was retained for possible additional analyses.

  10. L-type Calcium Channel Blockers Enhance Trafficking and Function of Epilepsy-associated α1(D219N) Subunits of GABA(A) Receptors.

    Science.gov (United States)

    Han, Dong-Yun; Guan, Bo-Jhih; Wang, Ya-Juan; Hatzoglou, Maria; Mu, Ting-Wei

    2015-09-18

    Gamma-aminobutyric acid type A (GABAA) receptors are the primary inhibitory ion channels in the mammalian central nervous system and play an essential role in regulating inhibition-excitation balance in neural circuits. The α1 subunit harboring the D219N mutation of GABAA receptors was reported to be retained in the endoplasmic reticulum (ER) and traffic inefficiently to the plasma membrane, leading to a loss of function of α1(D219N) subunits and thus idiopathic generalized epilepsy (IGE). We present the use of small molecule proteostasis regulators to enhance the forward trafficking of α1(D219N) subunits to restore their function. We showed that treatment with verapamil (4 μM, 24 h), an L-type calcium channel blocker, substantially increases the α1(D219N) subunit cell surface level in both HEK293 cells and neuronal SH-SY5Y cells and remarkably restores the GABA-induced maximal chloride current in HEK293 cells expressing α1(D219N)β2γ2 receptors to a level that is comparable to wild type receptors. Our drug mechanism study revealed that verapamil treatment promotes the ER to Golgi trafficking of the α1(D219N) subunits post-translationally. To achieve that, verapamil treatment enhances the interaction between the α1(D219N) subunit and β2 subunit and prevents the aggregation of the mutant protein by shifting the protein from the detergent-insoluble fractions to detergent-soluble fractions. By combining (35)S pulse-chase labeling and MG-132 inhibition experiments, we demonstrated that verapamil treatment does not inhibit the ER-associated degradation of the α1(D219N) subunit. In addition, its effect does not involve a dynamin-1 dependent endocytosis. To gain further mechanistic insight, we showed that verapamil increases the interaction between the mutant protein and calnexin and calreticulin, two major lectin chaperones in the ER. Moreover, calnexin binding promotes the forward trafficking of the mutant subunit. Taken together, our data indicate that

  11. [A novel double heterozygote of HBB c.[219T>A;220G>T]: gene diagnosis and pedigree analysis].

    Science.gov (United States)

    Lv, Jiezhong; Luo, Zhaofan; Fang, Jianpei; Du, Tao; Xue, Hongman; Liu, Yong; Zhang, Jianping

    2017-08-10

    To identify a novel hemoglobinopathy applied by direct sequencing and clone sequencing. EDTA anticoagulated blood of proband and his parents were analyzed by hematology analyzers and Capillarys hemoglobin electrophoresis (CE). Then thalassemia genetypes were screened by gap-PCR and reverse dot blot (RDB). Proband was suspected with abnormal hemoglobin combine alpha beta compound thalassemia. The mutation of beta-globin was identified by direct sequencing and clone sequencing. Hb analysis showed that probands Hb A2 variant was eluted in Z (C) zone and his father's in Z (A2) zone on CE,and proband's mother elevated HbA2 of 4.6%. Screened by RDB, the proband was CD71-72(+A) homozygote and showed the mismatch with his parents. Through direct sequencing and clone sequencing, we deduced that our proband inherited the mutations of HBB c.[219T>A;220G>T] from his father and inherited the Southeast-Asian deletion and HBB c.216-217insA from his mother. A novel double heterozygote of HBB c.[219T>A; 220G>T] was identified in south China. This mutation enriches the beta-thalassemia gene mutation spectrum in Chinese population.

  12. High frequency plant regeneration from mature seed of elite, recalcitrant Malaysian indica rice ( Oryza sativa L.) CV. MR 219.

    Science.gov (United States)

    Sivakumar, P; Law, Y S; Ho, C-L; Harikrishna, Jennifer Ann

    2010-09-01

    An efficient in vitro plant regeneration system was established for elite, recalcitrant Malaysian indica rice, Oryza sativa L. CV. MR 219 using mature seeds as explant on Murashige and Skoog and Chu N6 media containing 2,4-dichlorophenoxy acetic acid and kinetin either alone or in different combinations. L-proline, casein hydrolysate and L-glutamine were added to callus induction media for enhancement of embryogenic callus induction. The highest frequency of friable callus induction (84%) was observed in N6 medium containing 2.5 mg l(-1) 2,4-dichlorophenoxy acetic acid, 0.2 mg l(-1) kinetin, 2.5 mg l(-1) L-proline, 300 mg l(-1) casein hydrolysate, 20 mg l(-1) L-glutamine and 30 g l(-1) sucrose under culture in continuous lighting conditions. The maximum regeneration frequency (71%) was observed, when 30-day-old N6 friable calli were cultured on MS medium supplemented with 3 mg l(-1) 6-benzyl aminopurine, 1 mg l(-1) naphthalene acetic acid, 2.5 mg l(-1) L-proline, 300 mg l(-1) casein hydrolysate and 3% maltose. Developed shoots were rooted in half strength MS medium supplemented with 2% sucrose and were successfully transplanted to soil with 95% survival. This protocol may be used for other recalcitrant indica rice genotypes and to transfer desirable genes in to Malaysian indica rice cultivar MR219 for crop improvement.

  13. The beneficial endophyte Trichoderma hamatum isolate DIS 219b promotes growth and delays the onset of the drought response in Theobroma cacao.

    Science.gov (United States)

    Bae, Hanhong; Sicher, Richard C; Kim, Moon S; Kim, Soo-Hyung; Strem, Mary D; Melnick, Rachel L; Bailey, Bryan A

    2009-01-01

    Theobroma cacao (cacao) is cultivated in tropical climates and is exposed to drought stress. The impact of the endophytic fungus Trichoderma hamatum isolate DIS 219b on cacao's response to drought was studied. Colonization by DIS 219b delayed drought-induced changes in stomatal conductance, net photosynthesis, and green fluorescence emissions. The altered expression of 19 expressed sequence tags (ESTs) (seven in leaves and 17 in roots with some overlap) by drought was detected using quantitative real-time reverse transcription PCR. Roots tended to respond earlier to drought than leaves, with the drought-induced changes in expression of seven ESTs being observed after 7 d of withholding water. Changes in gene expression in leaves were not observed until after 10 d of withholding water. DIS 219b colonization delayed the drought-altered expression of all seven ESTs responsive to drought in leaves by > or = 3 d, but had less influence on the expression pattern of the drought-responsive ESTs in roots. DIS 219b colonization had minimal direct influence on the expression of drought-responsive ESTs in 32-d-old seedlings. By contrast, DIS 219b colonization of 9-d-old seedlings altered expression of drought-responsive ESTs, sometimes in patterns opposite of that observed in response to drought. Drought induced an increase in the concentration of many amino acids in cacao leaves, while DIS 219b colonization caused a decrease in aspartic acid and glutamic acid concentrations and an increase in alanine and gamma-aminobutyric acid concentrations. With or without exposure to drought conditions, colonization by DIS 219b promoted seedling growth, the most consistent effects being an increase in root fresh weight, root dry weight, and root water content. Colonized seedlings were slower to wilt in response to drought as measured by a decrease in the leaf angle drop. The primary direct effect of DIS 219b colonization was promotion of root growth, regardless of water status, and an

  14. 17 CFR 274.219 - Form N-17f-1, cover page for each certificate of accounting of securities and similar investments...

    Science.gov (United States)

    2010-04-01

    ... each certificate of accounting of securities and similar investments of a management investment company in the custody of a member of a national securities exchange, filed pursuant to rule 17f-1. 274.219... page for each certificate of accounting of securities and similar investments of a management...

  15. Al Andalus Ultra Trail: an observation of medical interventions during a 219-km, 5-day ultramarathon stage race.

    Science.gov (United States)

    Scheer, Bernd Volker; Murray, Andrew

    2011-09-01

    To record the injuries and health problems suffered by ultramarathon runners during a 219-km, 5-day stage race and to help race organizers plan medical provision for these events. Observational study. Al Andalus Ultra Trail 2010, in southern Spain. All 69 ultramarathon runners. Total numbers and percentages of each clinical encounter with a health professional and their respective health problems. Sixty-nine competitors started the race, and 39 runners were seen with a medical problem (56.5%). There were a total of 99 clinical encounters. The most common reasons for consulting were foot blisters (33.3%), followed by chafing (9.1%). Lower limb musculoskeletal injuries accounted for 22.2%, predominantly affecting the knee. This is the first report of a multistage ultramarathon race where medical coverage was present throughout and has reported on musculoskeletal, dermatological, and other medical problems. When providing medical coverage for stage events, the medical team needs to promote practices that minimize injury and address both running-related injuries and non-running-related injuries, taking account of environmental conditions.

  16. Generation of high-titre virus stocks using BrK.219, a B-cell line infected stably with recombinant Kaposi's sarcoma-associated herpesvirus.

    Science.gov (United States)

    Kati, Semra; Hage, Elias; Mynarek, Martin; Ganzenmueller, Tina; Indenbirken, Daniela; Grundhoff, Adam; Schulz, Thomas F

    2015-06-01

    Kaposi's sarcoma-associated herpesvirus (KSHV) is a gamma-2-lymphotropic human oncogenic herpesvirus associated with Kaposi's sarcoma (KS) and two B-cell lymphoproliferative diseases, primary effusion lymphoma (PEL) and multicentric Castleman's disease (MCD). KSHV establishes latency soon after infection in vivo and in vitro. Consequently, it is technically difficult to generate high-titre virus stocks required for infection experiments in tissue culture. Currently used methods of KSHV stock production involve induction of the lytic/productive cycle in PEL cell lines or in adherent cell lines harbouring recombinant KSHV genomes. In this study, the BJAB-derived B-cell line BrK.219, which is infected latently with a recombinant KSHV (rKSHV.219), is used to produce high-titre virus stocks. BrK.219 cells enter the lytic KSHV replication cycle upon cross-linking of B-cell receptors (BCRs) with anti-IgM antibodies without the need for additional, potentially toxic chemical inducers. High cell concentrations can be cultured and induced easily in spinner flasks, saving time and resources. The established protocol allows the generation of KSHV virus stocks with titres of up to 10(6) IU/ml in unconcentrated culture supernatants, representing a 10(3)-10(4)-fold improvement compared to conventional methods. Copyright © 2015 Elsevier B.V. All rights reserved.

  17. Infection of Domestic Dogs in Peru by Zoonotic Bartonella Species: A Cross-Sectional Prevalence Study of 219 Asymptomatic Dogs

    Science.gov (United States)

    Diniz, Pedro Paulo V. P.; Morton, Bridget A.; Tngrian, Maryam; Kachani, Malika; Barrón, Eduardo A.; Gavidia, Cesar M.; Gilman, Robert H.; Angulo, Noelia P.; Brenner, Elliott C.; Lerner, Richard; Chomel, Bruno B.

    2013-01-01

    Bartonella species are emerging infectious organisms transmitted by arthropods capable of causing long-lasting infection in mammalian hosts. Among over 30 species described from four continents to date, 15 are known to infect humans, with eight of these capable of infecting dogs as well. B. bacilliformis is the only species described infecting humans in Peru; however, several other Bartonella species were detected in small mammals, bats, ticks, and fleas in that country. The objective of this study was to determine the serological and/or molecular prevalence of Bartonella species in asymptomatic dogs in Peru in order to indirectly evaluate the potential for human exposure to zoonotic Bartonella species. A convenient sample of 219 healthy dogs was obtained from five cities and three villages in Peru. EDTA-blood samples were collected from 205 dogs, whereas serum samples were available from 108 dogs. The EDTA-blood samples were screened by PCR followed by nucleotide sequencing for species identification. Antibodies against B. vinsonii berkhoffii and B. rochalimae were detected by IFA (cut-off of 1∶64). Bartonella DNA was detected in 21 of the 205 dogs (10%). Fifteen dogs were infected with B. rochalimae, while six dogs were infected with B. v. berkhoffii genotype III. Seropositivity for B. rochalimae was detected in 67 dogs (62%), and for B. v. berkhoffii in 43 (40%) of the 108 dogs. Reciprocal titers ≥1∶256 for B. rochalimae were detected in 19% of dogs, and for B. v. berkhoffii in 6.5% of dogs. This study identifies for the first time a population of dogs exposed to or infected with zoonotic Bartonella species, suggesting that domestic dogs may be the natural reservoir of these zoonotic organisms. Since dogs are epidemiological sentinels, Peruvian humans may be exposed to infections with B. rochalimae or B. v. berkhoffii. PMID:24040427

  18. FVII, FVIIa and downstream markers of extrinsic pathway activation differ by EPCR Ser219Gly variant in healthy men

    Science.gov (United States)

    Ireland, Helen A; Cooper, Jackie A; Drenos, Fotios; Acharya, Jayshree; Mitchell, Jacqueline P.; Bauer, Kenneth A; Morrissey, James H; Esnouf, M Peter; Humphries, Stephen E

    2009-01-01

    Objective: To determine the effect of a variant in EPCR (Ser219Gly), previously shown to affect EPCR shedding, upon plasma FVII, FVIIa and downstream markers of activated coagulation. Methods: Statistical analysis was undertaken in ~2000 healthy middle aged men (NPHSII) Results: Higher soluble EPCR levels were confirmed for Gly allele carriers (p<0.0001). Significantly higher levels of FVII, FVIIa and downstream markers of activated coagulation in the extrinsic pathway (FIX activation pep {FIXpep}; FX activation pep {FXpep}), and prothrombin F1+2 (F1+2) were identified in baseline samples, in Gly carriers compared to Ser/Ser (p<=0.04 for trend). In repeat samples collected for up to five years, levels of FVII and F1+2 were higher in Gly allele carriers compared to Ser/Ser by (FVII: 6.9% CI 5.5-8.4 in Ser/Gly; and 23.4% CI 16.3-30.8 in Gly/Gly, p<0.0001), (F1+2: 8.1% CI 5.2-11.1 in Ser/Gly; 25.2% CI 11.8-40.3 in Gly/Gly, p<0.04), confirming reproducibility of findings at baseline. Molar ratios for FIXpep, FXpep and F1+2 to FVIIa were constant in Ser/Ser and Ser/Gly but tended to be higher in Gly/Gly, reaching statistical significance for FIXpep:FVIIa (p=0.04). Conclusions: These data suggest that higher levels of FVII and FVIIa circulate when EPCR shedding is greatest. Furthermore, these results suggest consequences for activation of extrinsic coagulation. PMID:19696402

  19. Infection of domestic dogs in peru by zoonotic bartonella species: a cross-sectional prevalence study of 219 asymptomatic dogs.

    Science.gov (United States)

    Diniz, Pedro Paulo V P; Morton, Bridget A; Tngrian, Maryam; Kachani, Malika; Barrón, Eduardo A; Gavidia, Cesar M; Gilman, Robert H; Angulo, Noelia P; Brenner, Elliott C; Lerner, Richard; Chomel, Bruno B

    2013-01-01

    Bartonella species are emerging infectious organisms transmitted by arthropods capable of causing long-lasting infection in mammalian hosts. Among over 30 species described from four continents to date, 15 are known to infect humans, with eight of these capable of infecting dogs as well. B. bacilliformis is the only species described infecting humans in Peru; however, several other Bartonella species were detected in small mammals, bats, ticks, and fleas in that country. The objective of this study was to determine the serological and/or molecular prevalence of Bartonella species in asymptomatic dogs in Peru in order to indirectly evaluate the potential for human exposure to zoonotic Bartonella species. A convenient sample of 219 healthy dogs was obtained from five cities and three villages in Peru. EDTA-blood samples were collected from 205 dogs, whereas serum samples were available from 108 dogs. The EDTA-blood samples were screened by PCR followed by nucleotide sequencing for species identification. Antibodies against B. vinsonii berkhoffii and B. rochalimae were detected by IFA (cut-off of 1∶64). Bartonella DNA was detected in 21 of the 205 dogs (10%). Fifteen dogs were infected with B. rochalimae, while six dogs were infected with B. v. berkhoffii genotype III. Seropositivity for B. rochalimae was detected in 67 dogs (62%), and for B. v. berkhoffii in 43 (40%) of the 108 dogs. Reciprocal titers ≥1∶256 for B. rochalimae were detected in 19% of dogs, and for B. v. berkhoffii in 6.5% of dogs. This study identifies for the first time a population of dogs exposed to or infected with zoonotic Bartonella species, suggesting that domestic dogs may be the natural reservoir of these zoonotic organisms. Since dogs are epidemiological sentinels, Peruvian humans may be exposed to infections with B. rochalimae or B. v. berkhoffii.

  20. Infection of domestic dogs in peru by zoonotic bartonella species: a cross-sectional prevalence study of 219 asymptomatic dogs.

    Directory of Open Access Journals (Sweden)

    Pedro Paulo V P Diniz

    Full Text Available Bartonella species are emerging infectious organisms transmitted by arthropods capable of causing long-lasting infection in mammalian hosts. Among over 30 species described from four continents to date, 15 are known to infect humans, with eight of these capable of infecting dogs as well. B. bacilliformis is the only species described infecting humans in Peru; however, several other Bartonella species were detected in small mammals, bats, ticks, and fleas in that country. The objective of this study was to determine the serological and/or molecular prevalence of Bartonella species in asymptomatic dogs in Peru in order to indirectly evaluate the potential for human exposure to zoonotic Bartonella species. A convenient sample of 219 healthy dogs was obtained from five cities and three villages in Peru. EDTA-blood samples were collected from 205 dogs, whereas serum samples were available from 108 dogs. The EDTA-blood samples were screened by PCR followed by nucleotide sequencing for species identification. Antibodies against B. vinsonii berkhoffii and B. rochalimae were detected by IFA (cut-off of 1∶64. Bartonella DNA was detected in 21 of the 205 dogs (10%. Fifteen dogs were infected with B. rochalimae, while six dogs were infected with B. v. berkhoffii genotype III. Seropositivity for B. rochalimae was detected in 67 dogs (62%, and for B. v. berkhoffii in 43 (40% of the 108 dogs. Reciprocal titers ≥1∶256 for B. rochalimae were detected in 19% of dogs, and for B. v. berkhoffii in 6.5% of dogs. This study identifies for the first time a population of dogs exposed to or infected with zoonotic Bartonella species, suggesting that domestic dogs may be the natural reservoir of these zoonotic organisms. Since dogs are epidemiological sentinels, Peruvian humans may be exposed to infections with B. rochalimae or B. v. berkhoffii.

  1. 76 FR 70336 - Airworthiness Directives; Rolls-Royce plc RB211-524G2-19; -524G2-T-19; -524G3-19; -524G3-T-19...

    Science.gov (United States)

    2011-11-14

    ... plc RB211-524G2-19; -524G2- T-19; -524G3-19; -524G3-T-19; 524H2-19; -524H2-T-19; -524H-36; and - 524H..., 2011. The Director of the Federal Register approved the incorporation by reference of Rolls-Royce plc... Information Rolls-Royce plc has issued Rolls-Royce plc Alert Service Bulletin No. RB.211-73-AG054, Revision 2...

  2. Morphological distinction of cervical nerve roots associated with motor function in 219 healthy volunteers: a multicenter prospective study.

    Science.gov (United States)

    Takeuchi, Mikinobu; Wakao, Norimitsu; Kamiya, Mitsuhiro; Osuka, Koji; Matsuo, Naoki; Terasawa, Toshiaki; Asai, Toshimasa; Takayasu, Masakazu

    2014-07-15

    A prospective study. To examine the diameter (mm), transverse diameter (mm), and cross-sectional area (mm²) of the C5, C6, and C7 nerve roots using ultrasonography. Each of the cervical nerve roots affected a different motor or sensory area. Although there were several studies that performed a detailed assessment of cervical nerve root anatomy in cadavers, only a few studies on the thickness of cervical nerve roots in living specimens have been performed. We examined whether the thickness of the C5, C6, and C7 nerve roots, as well as the area supplied by each of the roots, varied. All 219 subjects (99 males and 120 females; mean age, 47 ± 15 yr) were healthy volunteers. The diameter and the transverse diameter were measured via ultrasonography, and the cross-sectional area was calculated for each of the C5-C7 nerve roots. The following diameter measurements (right and left, respectively) were obtained: C5, 2.8 and 2.9 mm; C6, 3.6 and 3.8 mm; and C7, 3.3 and 3.4 mm. The following transverse diameter measurements were obtained (right and left, respectively): C5, 2.8 and 3.0 mm; C6, 3.7 and 3.8 mm; and C7, 3.5 and 3.4 mm. The following cross-sectional area measurements (right and left, respectively) were obtained: C5, 6.3 and 6.4 mm²; C6, 10.7 and 11.0 mm²; and C7, 8.8 and 8.8 mm². Based on the 3 measurement methods, the C5 nerve root was significantly thinner than the other 2 nerve roots (P < 0.001), and the C7 nerve root was smaller than the C6 nerve root (P = 0.001). The C5 nerve root was significantly thinner than the C6 and C7 cervical nerve roots. The fact that the C5 nerve is thinner may render it more susceptible to damage during cervical surgery.

  3. Dynamical decay process of {sup 219,} {sup 220}Ra{sup *} formed in {sup 10,} {sup 11}B+{sup 209}Bi reactions

    Energy Technology Data Exchange (ETDEWEB)

    Sawhney, G.; Sharma, M.K. [Thapar University, School of Physics and Materials Science, Punjab (India)

    2012-05-15

    The excitation functions for both the evaporation residue and fission have been calculated for {sup 10}B +{sup 209}Bi and {sup 11}B+{sup 209}Bi reactions forming compound systems {sup 219,220}Ra{sup *}, using the dynamical cluster-decay model (DCM) with effects of deformations and orientations of the nuclei included in it. In addition to this, the excitation functions for complete fusion (CF) are obtained by summing the fission cross-sections, neutron evaporation and charged particle evaporation residue cross-sections produced through the {alpha}xn and pxn (x = 2, 3, 4) emission channels for the {sup 219}Ra system at various incident centre-of-mass energies. Experimentally the CF cross-sections are suppressed and the observed suppression is attributed to the low binding energy of {sup 10,11}B which breaks up into charged fragments. The reported complete fusion (CF) and incomplete fusion (ICF) excitation functions for the {sup 219}Ra system are found to be nicely fitted by the calculations performed in the framework of DCM, without invoking a significant contribution from quasi-fission. Although DCM has been applied for a number of compound nucleus decay studies in the recent past, the same is being used here in reference to ICF and subsequent decay processes along with the CF process. Interestingly the main contribution to complete fusion cross-section comes from the fission cross-section at higher incident energies, which in DCM is found to consist of an asymmetric fission window, shown to arise due to the deformation and orientation effects of formation and decay fragments. (orig.)

  4. Corrective Action Investigation Plan for Corrective Action Unit 219: Septic Systems and Injection Wells, Nevada Test Site, Nevada, Rev. No.: 0

    Energy Technology Data Exchange (ETDEWEB)

    David A. Strand

    2005-01-01

    The Corrective Action Investigation Plan for Corrective Action Unit 219, Septic Systems and Injection Wells, has been developed in accordance with the ''Federal Facility Agreement and Consent Order'' (1996) that was agreed to by the State of Nevada, the U.S. Department of Energy, and the U.S. Department of Defense. The purpose of the investigation is to ensure that adequate data are collected to provide sufficient and reliable information to identify, evaluate, and select technically viable corrective actions. Corrective Action Unit 219 is located in Areas 3, 16, and 23 of the Nevada Test Site, which is 65 miles northwest of Las Vegas, Nevada. Corrective Action Unit 219 is comprised of the six Corrective Action Sites (CASs) listed below: (1) 03-11-01, Steam Pipes and Asbestos Tiles; (2) 16-04-01, Septic Tanks (3); (3) 16-04-02, Distribution Box; (4) 16-04-03, Sewer Pipes; (5) 23-20-01, DNA Motor Pool Sewage and Waste System; and (6) 23-20-02, Injection Well. These sites are being investigated because existing information on the nature and extent of potential contamination is insufficient to evaluate and recommend corrective action alternatives. Additional information will be obtained by conducting a corrective action investigation prior to evaluating corrective action alternatives and selecting the appropriate corrective action for each CAS. The results of the field investigation will support a defensible evaluation of viable corrective action alternatives that will be presented in the Corrective Action Decision Document.

  5. Corrective Action Decision Document/Closure Report for Corrective Action Unit 219: Septic Systems and Injection Wells, Nevada Test Site, Nevada, Rev. No.: 0

    Energy Technology Data Exchange (ETDEWEB)

    David Strand

    2006-05-01

    This Corrective Action Decision Document/Closure Report has been prepared for Corrective Action Unit (CAU) 219, Septic Systems and Injection Wells, in Areas 3, 16, and 23 of the Nevada Test Site, Nevada, in accordance with the ''Federal Facility Agreement and Consent Order'' (1996). Corrective Action Unit 219 is comprised of the following corrective action sites (CASs): (1) 03-11-01, Steam Pipes and Asbestos Tiles; (2) 16-04-01, Septic Tanks (3); (3) 16-04-02, Distribution Box; (4) 16-04-03, Sewer Pipes; (5) 23-20-01, DNA Motor Pool Sewage and Waste System; and (6) 23-20-02, Injection Well. The purpose of this Corrective Action Decision Document/Closure Report is to provide justification and documentation supporting the recommendation for closure of CAU 219 with no further corrective action beyond the application of a use restriction at CASs 16-04-01, 16-04-02, and 16-04-03. To achieve this, corrective action investigation (CAI) activities were performed from June 20 through October 12, 2005, as set forth in the CAU 219 Corrective Action Investigation Plan and Record of Technical Change No. 1. A best management practice was implemented at CASs 16-04-01, 16-04-02, and 16-04-03, and corrective action was performed at CAS 23-20-01 between January and April 2006. In addition, a use restriction will be applied to CASs 16-04-01, 16-04-02, and 16-04-03 to provide additional protection to Nevada Test Site personnel. The purpose of the CAI was to fulfill the following data needs as defined during the data quality objective (DQO) process: (1) Determine whether contaminants of concern (COCs) are present. (2) If COCs are present, determine their nature and extent. (3) Provide sufficient information and data to complete appropriate corrective actions. The CAU 219 dataset from the investigation results was evaluated based on the data quality indicator parameters. This evaluation demonstrated the quality and acceptability of the dataset for use in fulfilling

  6. Leptin receptor isoform 219.1: an example of protein evolution by LINE-1-mediated human-specific retrotransposition of a coding SVA element.

    Science.gov (United States)

    Damert, Annette; Löwer, Johannes; Löwer, Roswitha

    2004-04-01

    Phylogenetically new insertions of repetitive sequences may contribute to genome evolution by altering the function of preexisting proteins. One example is the SVA sequence, which forms the C-terminal coding exon of the human leptin receptor isoform 219.1. Here, we report that the SVA insertion into the LEPR locus has occurred after divergence of humans and chimpanzees. The SVA element was inserted into a Hal-1/LINE element present in all monkeys and apes tested. Structural features point toward an integration event that was mediated by the L1 protein machinery acting in trans. Thus, our findings add evidence to the hypothesis that retrotransposition events are a driving force in genomic evolution and that the presence or absence of specific retroelements are one distinguishing feature that separates humans from chimpanzees.

  7. Primary and secondary cutaneous CD30(+) lymphoproliferative disorders: a report from the Dutch Cutaneous Lymphoma Group on the long-term follow-up data of 219 patients and guidelines for diagnosis and treatment

    NARCIS (Netherlands)

    Bekkenk, M. W.; Geelen, F. A.; van Voorst Vader, P. C.; Heule, F.; Geerts, M. L.; van Vloten, W. A.; Meijer, C. J.; Willemze, R.

    2000-01-01

    To evaluate our diagnostic and therapeutic guidelines, clinical and long-term follow-up data of 219 patients with primary or secondary cutaneous CD30(+) lymphoproliferative disorders were evaluated. The study group included 118 patients with lymphomatoid papulosis (LyP; group 1), 79 patients with

  8. Primary and secondary cutaneous CD30(+) lymphoproliferative disorders : a report from the Dutch Cutaneous Lymphoma Group on the long-term follow-up data of 219 patients and guidelines for diagnosis and treatment

    NARCIS (Netherlands)

    Bekkenk, MW; Geelen, FAMJ; Vader, PCV; Heule, F; Geerts, ML; van Vloten, WA; Meijer, CJLM; Willemze, R

    2000-01-01

    To evaluate our diagnostic and therapeutic guidelines, clinical and long-term follow-up data of 219 patients with primary or secondary cutaneous CD30(+) lympho proliferative disorders were evaluated. The study group included 118 patients with lymphomatoid papulosis (LyP; group 1), 79 patients with

  9. Long-Term Trends in Esophageal Candidiasis Prevalence and Associated Risk Factors with or without HIV Infection: Lessons from an Endoscopic Study of 80,219 Patients.

    Directory of Open Access Journals (Sweden)

    Yuta Takahashi

    Full Text Available The prevalence of candida esophagitis (CE might be changing in an era of highly active antiretroviral therapy (HAART among HIV-infected patients or today's rapidly aging society among non-HIV-infected patients. However, few studies have investigated long-term CE trends, and CE risk factors have not been studied in a large sample, case-control study. This study aimed to determine long-term trends in CE prevalence and associated risk factors for patients with or without HIV infection.Trends in CE prevalence were explored in a cohort of 80,219 patients who underwent endoscopy between 2002 and 2014. Risks for CE were examined among a subcohort of 6,011 patients. In risk analysis, we assessed lifestyles, infections, co-morbidities, immunosuppressants, and proton-pump inhibitors (PPIs. All patients were tested for HIV, hepatitis B or C virus, and syphilis infection. For HIV-infected patients, sexual behavior, CD4 cell count, history of HAART were also assessed.CE prevalence was 1.7% (1,375/80,219 in all patients, 9.8% (156/1,595 in HIV-infected patients, and 1.6% (1,219/78,624 in non-HIV-infected patients. CE prevalence from 2002-2003 to 2012-2014 tended to increase in non-HIV-infected patients (0.6% to 2.5%; P<0.01 and decrease in HIV-infected patients (13.6% to 9.0%; P=0.097. Multivariate analysis revealed increasing age (odds ratio [OR], 1.02; p=0.007, HIV infection (OR, 4.92; p<0.001, and corticosteroid use (OR, 5.90; p<0.001 were significantly associated with CE, and smoking (OR, 1.32; p=0.085 and acetaminophen use (OR, 1.70; p=0.097 were marginally associated. No significant association was found with alcohol consumption, hepatitis B or C virus, syphilis, diabetes mellitus, cardiovascular disease, cerebrovascular disease, chronic kidney disease, liver cirrhosis, anticancer, or PPIs use. In HIV-infected patients, CD4 cell count <100/μL (OR, 4.83; p<0.001 and prior HAART (OR, 0.35; p=0.006 were independently associated with CE, but

  10. Long-Term Trends in Esophageal Candidiasis Prevalence and Associated Risk Factors with or without HIV Infection: Lessons from an Endoscopic Study of 80,219 Patients.

    Science.gov (United States)

    Takahashi, Yuta; Nagata, Naoyoshi; Shimbo, Takuro; Nishijima, Takeshi; Watanabe, Koji; Aoki, Tomonori; Sekine, Katsunori; Okubo, Hidetaka; Watanabe, Kazuhiro; Sakurai, Toshiyuki; Yokoi, Chizu; Kobayakawa, Masao; Yazaki, Hirohisa; Teruya, Katsuji; Gatanaga, Hiroyuki; Kikuchi, Yoshimi; Mine, Sohtaro; Igari, Toru; Takahashi, Yuko; Mimori, Akio; Oka, Shinichi; Akiyama, Junichi; Uemura, Naomi

    2015-01-01

    The prevalence of candida esophagitis (CE) might be changing in an era of highly active antiretroviral therapy (HAART) among HIV-infected patients or today's rapidly aging society among non-HIV-infected patients. However, few studies have investigated long-term CE trends, and CE risk factors have not been studied in a large sample, case-control study. This study aimed to determine long-term trends in CE prevalence and associated risk factors for patients with or without HIV infection. Trends in CE prevalence were explored in a cohort of 80,219 patients who underwent endoscopy between 2002 and 2014. Risks for CE were examined among a subcohort of 6,011 patients. In risk analysis, we assessed lifestyles, infections, co-morbidities, immunosuppressants, and proton-pump inhibitors (PPIs). All patients were tested for HIV, hepatitis B or C virus, and syphilis infection. For HIV-infected patients, sexual behavior, CD4 cell count, history of HAART were also assessed. CE prevalence was 1.7% (1,375/80,219) in all patients, 9.8% (156/1,595) in HIV-infected patients, and 1.6% (1,219/78,624) in non-HIV-infected patients. CE prevalence from 2002-2003 to 2012-2014 tended to increase in non-HIV-infected patients (0.6% to 2.5%; P<0.01) and decrease in HIV-infected patients (13.6% to 9.0%; P=0.097). Multivariate analysis revealed increasing age (odds ratio [OR], 1.02; p=0.007), HIV infection (OR, 4.92; p<0.001), and corticosteroid use (OR, 5.90; p<0.001) were significantly associated with CE, and smoking (OR, 1.32; p=0.085) and acetaminophen use (OR, 1.70; p=0.097) were marginally associated. No significant association was found with alcohol consumption, hepatitis B or C virus, syphilis, diabetes mellitus, cardiovascular disease, cerebrovascular disease, chronic kidney disease, liver cirrhosis, anticancer, or PPIs use. In HIV-infected patients, CD4 cell count <100/μL (OR, 4.83; p<0.001) and prior HAART (OR, 0.35; p=0.006) were independently associated with CE, but sexual

  11. CHARACTERIZATION OF THE K2-19 MULTIPLE-TRANSITING PLANETARY SYSTEM VIA HIGH-DISPERSION SPECTROSCOPY, AO IMAGING, AND TRANSIT TIMING VARIATIONS

    Energy Technology Data Exchange (ETDEWEB)

    Narita, Norio; Hori, Yasunori; Kusakabe, Nobuhiko; Takeda, Yoichi; Tamura, Motohide [Astrobiology Center, 2-21-1 Osawa, Mitaka, Tokyo, 181-8588 (Japan); Hirano, Teruyuki [Department of Earth and Planetary Sciences, Tokyo Institute of Technology, 2-12-1 Ookayama, Meguro-ku, Tokyo 152-8551 (Japan); Fukui, Akihiko; Yanagisawa, Kenshi [Okayama Astrophysical Observatory, National Astronomical Observatory of Japan, Asakuchi, Okayama 719-0232 (Japan); Sanchis-Ojeda, Roberto [Department of Astronomy, University of California, Berkeley, CA 94720 (United States); Winn, Joshua N. [Department of Physics, and Kavli Institute for Astrophysics and Space Research, Massachusetts Institute of Technology, Cambridge, MA 02139 (United States); Ryu, Tsuguru; Onitsuka, Masahiro [National Astronomical Observatory of Japan, 2-21-1 Osawa, Mitaka, Tokyo, 181-8588 (Japan); Kudo, Tomoyuki [Subaru Telescope, 650 North A’ohoku Place, Hilo, HI 96720 (United States); Delrez, Laetitia; Gillon, Michael; Jehin, Emmanuel [Institut d’Astrophysique et de Géophysique, Université de Liège, Allée du 6 Août 17, Bat. B5C, B-4000 Liège (Belgium); McCormac, James [Department of Physics, University of Warwick, Gibbet Hill Road, Coventry CV4 7AL (United Kingdom); Holman, Matthew [Smithsonian Astrophysical Observatory, 60 Garden Street, Cambridge, MA 02138 (United States); Izumiura, Hideyuki, E-mail: norio.narita@nao.ac.jp [SOKENDAI (The Graduate University for Advanced Studies), 2-21-1 Osawa, Mitaka, Tokyo, 181-8588 (Japan)

    2015-12-10

    K2-19 (EPIC201505350) is an interesting planetary system in which two transiting planets with radii ∼7 R{sub ⊕} (inner planet b) and ∼4 R{sub ⊕} (outer planet c) have orbits that are nearly in a 3:2 mean-motion resonance. Here, we present results of ground-based follow-up observations for the K2-19 planetary system. We have performed high-dispersion spectroscopy and high-contrast adaptive-optics imaging of the host star with the HDS and HiCIAO on the Subaru 8.2 m telescope. We find that the host star is a relatively old (≥8 Gyr) late G-type star (T{sub eff} ∼ 5350 K, M{sub s} ∼ 0.9 M{sub ⊙}, and R{sub s} ∼ 0.9 R{sub ⊙}). We do not find any contaminating faint objects near the host star that could be responsible for (or dilute) the transit signals. We have also conducted transit follow-up photometry for the inner planet with KeplerCam on the FLWO 1.2 m telescope, TRAPPISTCAM on the TRAPPIST 0.6 m telescope, and MuSCAT on the OAO 1.88 m telescope. We confirm the presence of transit timing variations (TTVs), as previously reported by Armstrong and coworkers. We model the observed TTVs of the inner planet using the synodic chopping formulae given by Deck and Agol. We find two statistically indistinguishable solutions for which the period ratios (P{sub c}/P{sub b}) are located slightly above and below the exact 3:2 commensurability. Despite the degeneracy, we derive the orbital period of the inner planet P{sub b} ∼ 7.921 days and the mass of the outer planet M{sub c} ∼ 20 M{sub ⊕}. Additional transit photometry (especially for the outer planet) as well as precise radial-velocity measurements would be helpful to break the degeneracy and to determine the mass of the inner planet.

  12. Subarachnoid Transplant of the Human Neuronal hNT2.19 Serotonergic Cell Line Attenuates Behavioral Hypersensitivity without Affecting Motor Dysfunction after Severe Contusive Spinal Cord Injury

    Directory of Open Access Journals (Sweden)

    Mary J. Eaton

    2011-01-01

    Full Text Available Transplant of cells which make biologic agents that can modulate the sensory and motor responses after spinal cord injury (SCI would be useful to treat pain and paralysis. To address this need for clinically useful human cells, a unique neuronal cell line that synthesizes and secretes/releases the neurotransmitter serotonin (5HT was isolated. Hind paw tactile allodynia and thermal hyperalgesia induced by severe contusive SCI were potently reversed after lumbar subarachnoid transplant of differentiated cells, but had no effect on open field motor scores, stride length, foot rotation, base of support, or gridwalk footfall errors associated with the SCI. The sensory effects appeared 1 week after transplant and did not diminish during the 8-week course of the experiment when grafts were placed 2 weeks after SCI. Many grafted cells were still present and synthesizing 5HT at the end of the study. These data suggest that the human neuronal serotonergic hNT2.19 cells can be used as a biologic minipump for receiving SCI-related neuropathic pain, but likely requires intraspinal grafts for motor recovery.

  13. In-Source Laser Spectroscopy with the Laser Ion Source and Trap: First Direct Study of the Ground-State Properties of ^{217,219}Po

    Directory of Open Access Journals (Sweden)

    D. A. Fink

    2015-02-01

    Full Text Available A Laser Ion Source and Trap (LIST for a thick-target, isotope-separation on-line facility has been implemented at CERN ISOLDE for the production of pure, laser-ionized, radioactive ion beams. It offers two modes of operation, either as an ion guide, which performs similarly to the standard ISOLDE resonance ionization laser ion source (RILIS, or as a more selective ion source, where surface-ionized ions from the hot ion-source cavity are repelled by an electrode, while laser ionization is done within a radio-frequency quadrupole ion guide. The first physics application of the LIST enables the suppression of francium contamination in ion beams of neutron-rich polonium isotopes at ISOLDE by more than 1000 with a reduction in laser-ionization efficiency of only 20. Resonance ionization spectroscopy is performed directly inside the LIST device, allowing the study of the hyperfine structure and isotope shift of ^{217}Po for the first time. Nuclear decay spectroscopy of ^{219}Po is performed for the first time, revealing its half-life, α-to-β-decay branching ratio, and α-particle energy. This experiment demonstrates the applicability of the LIST at radioactive ion-beam facilities for the production and study of pure beams of exotic isotopes.

  14. Final Report for grant entitled "Production of Astatine-211 for U.S. Investigators"

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, Daniel Scott

    2012-12-12

    Alpha-particle emitting radionuclides hold great promise in the therapy of cancer, but few alpha-emitters are available to investigators to evaluate. Of the alpha-emitters that have properties amenable for use in humans, 211At is of particular interest as it does not have alpha-emitting daughter radionuclides. Thus, there is a high interest in having a source of 211At for sale to investigators in the US. Production of 211At is accomplished on a cyclotron using an alpha-particle beam irradiation of bismuth metal. Unfortunately, there are few cyclotrons available that can produce an alpha particle beam for that production. The University of Washington has a cyclotron, one of three in the U.S., that is currently producing 211At. In the proposed studies, the things necessary for production and shipment of 211At to other investigators will be put into place at UW. Of major importance is the efficient production and isolation of 211At in a form that can be readily used by other investigators. In the studies, production of 211At on the UW cyclotron will be optimized by determining the best beam energy and the highest beam current to maximize 211At production. As it would be very difficult for most investigators to isolate the 211At from the irradiated target, the 211At-isolation process will be optimized and automated to more safely and efficiently obtain the 211At for shipment. Additional tasks to make the 211At available for distribution include obtaining appropriate shipping vials and containers, putting into place the requisite standard operating procedures for Radiation Safety compliance at the levels of 211At activity to be produced / shipped, and working with the Department of Energy, Isotope Development and Production for Research and Applications Program, to take orders, make shipments and be reimbursed for costs of production and shipment.

  15. Production of Astatine-211 at the Duke University Medical Center for its regional distribution

    Energy Technology Data Exchange (ETDEWEB)

    Zalutsky, Michael [Duke University Medical Center, Durham, NC (United States)

    2016-01-01

    Systemic targeted radiation therapy and radioimmunotherapy continue to be important tools in the treatment of certain cancers. Because of their high energy and short path length, alpha particle emitters such as 211At are more effective than either external beam x- ray or in vivo beta radiation in delivering potentially curative doses of radiation. The limited clinical trials that have been conducted to date have yielded encouraging responses in some patients, e.g., malignant brain tumors. In order to escalate the additional necessary research and development in radiochemistry, radiobiology and efficacy evaluation of alpha particle radiotherapeutics, it is universally agreed that access to an affordable, reliable supply of 211At is warranted. In conjunction with the Department of Energy's intent to enhance stable and radioactive isotope availability for research applications, it is the primary objective of this project to improve 211At production and purification capabilities at Duke so that this radionuclide can be supplied to researchers at other institutions throughout the US.The most widely used 211At production method involves the α,2n reaction on Bismuth using a cyclotron with beams ≤ 28 MeV. Yields can be enhanced with use of an internal target that allows for a higher alpha fluence plus efficient heat dissipation in the target. Both of these items are in place at Duke; however, in order to support production for multi-institutional use, irradiation campaigns in excess of 50 µAp and four hours duration will be needed. Further, post-irradiation processing equipment is lacking that will enable the distribution process. Financial support is sought for i) a shielded, ventilated processing/containment hood; ii) development of a post-irradiation target retrieval system; iii) fabrication of a 211At distillation and recovery module and iv) a performance review and, where needed, an enhancement of seven major subsystems that comprise the CS-30 Cyclotron. With these modifications in place, routine production of ≥200 mCi of At-211 should be readily achievable, given our methodological development of At-211 target preparation, internal target irradiation and dry distillation to recover the radionuclide.

  16. Probabilistic risk assessment: Number 219

    Energy Technology Data Exchange (ETDEWEB)

    Bari, R.A.

    1985-11-13

    This report describes a methodology for analyzing the safety of nuclear power plants. A historical overview of plants in the US is provided, and past, present, and future nuclear safety and risk assessment are discussed. A primer on nuclear power plants is provided with a discussion of pressurized water reactors (PWR) and boiling water reactors (BWR) and their operation and containment. Probabilistic Risk Assessment (PRA), utilizing both event-tree and fault-tree analysis, is discussed as a tool in reactor safety, decision making, and communications. (FI)

  17. Potential Population-Level Nutritional Impact of Replacing Whole and Reduced-Fat Milk With Low-Fat and Skim Milk Among US Children Aged 2?19?Years

    OpenAIRE

    Rehm, Colin D; Drewnowski, Adam; Monsivais, Pablo

    2015-01-01

    Objective Dietary guidance emphasizes plain low-fat and skim milk over whole, reduced-fat, and flavored milk (milk eligible for replacement [MER]). The objective of this study was to evaluate the population-level impact of such a change on energy, macronutrient and nutrient intakes, and diet cost. Design Cross-sectional modeling study. Setting Data from the 2001?2002 and 2003?2004 National Health and Nutrition Examination Survey. Participants A total of 8,112 children aged 2?19?years. Main Ou...

  18. Evaluation of Novel Wet Chemistry Separation and Purification Methods to Facilitate Automation of Astatine-­211 Isolation

    Energy Technology Data Exchange (ETDEWEB)

    Wilbur, Daniel Scott [Univ. of Washington, Seattle, WA (United States)

    2016-07-19

    This research is a collaborative effort between the research groups of the PIs, Dr. D. Scott Wilbur in the Department of Radiation Oncology at the University of Washington (UW) and Matthew O’Hara at the Pacific Northwest National Laboratory (PNNL). In this report only those studies conducted at UW and the budget information from UW will be reported. A separate progress and financial report will be provided by PNNL. This final report outlines the experiments (Tasks) conducted and results obtained at UW from July 1, 2013 thru June 30, 2016 (2-­year project with 1 year no-­cost extension). The report divides the information on the experiments and results obtained into the 5 specific objectives of the research efforts and the Tasks within those objectives. This format is used so that it is easy to see what has been accomplished in each area. A brief summary of the major findings from the studies is provided below. Summary of Major Findings from Research/Training Activities at UW: Anion and cation exchange columns did not provide adequate 211At capture and/or extraction results under conditions studied to warrant further evaluation; PEG-­Merrifield resins containing mPEG350, mPEG750, mPEG2000 and mPEG5000 were synthesized and evaluated; All of the mPEG resins with different sized mPEG moieties conjugated gave similar 211At capture (>95%) from 8M HCl solutions and release with conc. NH4OH (~50-­80%), but very low quantities were released when NaOH was used as an eluent; Capture and release of 211At when loading [211At]astatate appeared to be similar to that of [211At]astatide on PEG columns, but further studies need to be conducted to confirm that; Capture of 211At on PEG columns was lower (e.g. 80-­90%) from solutions of 8M HNO3, but higher capture rates (e.g. 99%) can be obtained when 10M HNO3 is mixed with an equal quantity of 8M HCl; Addition of reductants to the 211At solutions did not appear to change the percent capture, but may have an effect on the % extracted; There was some indication that the PEG-­Merrifield resins could be saturated (perhaps with Bi) resulting in lower capture percentages, but more studies need to be done to confirm that; A target dissolution chamber, designed and built at PNNL, works well with syringe pumps so it can be used in an automated system; Preliminary semi-­automated 211At isolation studies have been conducted with full-scale target dissolution and 211At isolation using a PEG column on the Hamilton automated system gave low overall recoveries, but HNO3 was used (rather than HCl) for loading the 211At and flow rates were not optimized; Results obtained using PEG columns are high enough to warrant further development on a fully automated system; Results obtained also indicate that additional studies are warranted to evaluate other types of columns for 211At separation from bismuth, which allow use of HNO3/HCl mixtures for loading and NaOH for eluting 211At. Such a column could greatly simplify the overall isolation process and make it easier to automate.

  19. Phosphorylations of Serines 21/9 in Glycogen Synthase Kinase 3α/β Are Not Required for Cell Lineage Commitment or WNT Signaling in the Normal Mouse Intestine.

    Directory of Open Access Journals (Sweden)

    Fiona Hey

    Full Text Available The WNT signalling pathway controls many developmental processes and plays a key role in maintenance of intestine renewal and homeostasis. Glycogen Synthase Kinase 3 (GSK3 is an important component of the WNT pathway and is involved in regulating β-catenin stability and expression of WNT target genes. The mechanisms underpinning GSK3 regulation in this context are not completely understood, with some evidence suggesting this occurs through inhibitory N-terminal serine phosphorylation in a similar way to GSK3 inactivation in insulin signaling. To investigate this in a physiologically relevant context, we have analysed the intestinal phenotype of GSK3 knockin mice in which N-terminal serines 21/9 of GSK3α/β have been mutated to non-phosphorylatable alanine residues. We show that these knockin mutations have very little effect on overall intestinal integrity, cell lineage commitment, β-catenin localization or WNT target gene expression although a small increase in apoptosis at villi tips is observed. Our results provide in vivo evidence that GSK3 is regulated through mechanisms independent of N-terminal serine phosphorylation in order for β-catenin to be stabilised.

  20. Potential for Cell-Transplant Therapy with Human Neuronal Precursors to Treat Neuropathic Pain in Models of PNS and CNS Injury: Comparison of hNT2.17 and hNT2.19 Cell Lines

    Directory of Open Access Journals (Sweden)

    Mary J. Eaton

    2012-01-01

    Full Text Available Effective treatment of sensory neuropathies in peripheral neuropathies and spinal cord injury (SCI is one of the most difficult problems in modern clinical practice. Cell therapy to release antinociceptive agents near the injured spinal cord is a logical next step in the development of treatment modalities. But few clinical trials, especially for chronic pain, have tested the potential of transplant of cells to treat chronic pain. Cell lines derived from the human neuronal NT2 cell line parentage, the hNT2.17 and hNT2.19 lines, which synthesize and release the neurotransmitters gamma-aminobutyric acid (GABA and serotonin (5HT, respectively, have been used to evaluate the potential of cell-based release of antinociceptive agents near the lumbar dorsal (horn spinal sensory cell centers to relieve neuropathic pain after PNS (partial nerve and diabetes-related injury and CNS (spinal cord injury damage in rat models. Both cell lines transplants potently and permanently reverse behavioral hypersensitivity without inducing tumors or other complications after grafting. Functioning as cellular minipumps for antinociception, human neuronal precursors, like these NT2-derived cell lines, would likely provide a useful adjuvant or replacement for current pharmacological treatments for neuropathic pain.

  1. Gas chromatography-mass spectrometric analysis of oxidative reactions of [19,19-(2)H(2)]19-hydroxy-3-deoxy androgens by placental aromatase. bsence of a deuterium-isotope effect.

    Science.gov (United States)

    Nagaoka, Masao; Numazawa, Mitsuteru

    2005-11-01

    Aromatase is a cytochrome P-450 enzyme complex that catalyzes the conversion of androst-4-ene-3,17-dione (AD) to estrone through three sequential oxidations of the 19-methyl group. 3-DeoxyAD (1) and its 5-ene isomer 4 are potent and good competitive aromatase inhibitors, which are converted by aromatase to the aldehyde derivatives 3 and 6, respectively, through 19-hydroxy intermediates 2 and 5, respectively. To study the deuterium isotope effect on the conversions of 19-ols 2 and 5 into the corresponding 19-als 3 and 6, we initially synthesized [19,19-(2)H(2)]19-ols 2 and 5 starting from the corresponding non-labeled 19-als 3 and 6 through NaB(2)H(4) reduction of the 19-aldehyde group, followed by oxidation with pyridinium dichromate, and a subsequent NaB(2)H(4) reduction. Approximately 1:1 mixtures of non-labeled (d(0)) and deuterated (d(2)) 19-ols 2 and 5 were separately incubated with human placental microsomes in the presence of NADPH under an air atmosphere, and deuterium contents of the recovered substrates and the 19-aldehyde products were determined by gas chromatography-mass spectrometry. In each experiment, the ratio of d(0) to d(2) of the recovered substrate along with that of d(0) to d(1) of the product were identical to the d(0) to d(2) ratio of the employed substrate irrespective of the incubation time, indicating that the 19-oxygenations of the 3-deoxy steroids 2 and 5 proceeded without a detectable isotope effect, as seen in the aromatization sequence of the natural substrate AD.

  2. Potential population-level nutritional impact of replacing whole and reduced-fat milk with low-fat and skim milk among US children aged 2-19 years.

    Science.gov (United States)

    Rehm, Colin D; Drewnowski, Adam; Monsivais, Pablo

    2015-01-01

    Dietary guidance emphasizes plain low-fat and skim milk over whole, reduced-fat, and flavored milk (milk eligible for replacement [MER]). The objective of this study was to evaluate the population-level impact of such a change on energy, macronutrient and nutrient intakes, and diet cost. Cross-sectional modeling study. Data from the 2001-2002 and 2003-2004 National Health and Nutrition Examination Survey. A total of 8,112 children aged 2-19 years. Energy, macronutrient, and micronutrient intake before and after replacement of MER with low-fat or skim milk. Survey-weighted linear regression models. Milk eligible for replacement accounted for 46% of dairy servings. Among MER consumers, replacement with skim or low-fat milk would lead to a projected reduction in energy of 113 (95% confidence interval [CI], 107-119) and 77 (95% CI, 73-82) kcal/d and percent energy from saturated fat by an absolute value of 2.5% of total energy (95% CI, 2.4-2.6) and 1.4% (95% CI, 1.3-1.5), respectively. Replacement of MER does not change diet costs or calcium and potassium intake. Substitution of MER has the potential to reduce energy and total and saturated fat intake with no impact on diet costs or micronutrient density. The feasibility of such replacement has not been examined and there may be negative consequences if replacement is done with non-nutrient-rich beverages. Copyright © 2015. Published by Elsevier Inc.

  3. 12 CFR 219.4 - Exceptions.

    Science.gov (United States)

    2010-01-01

    ...) Investigation of financial institution or its noncustomer. Financial records sought by a government authority in connection with a lawful proceeding, investigation, examination, or inspection directed at the financial... this part. (j) General Accounting Office requests. Financial records sought by the General Accounting...

  4. 36 CFR 219.7 - Plan decisions.

    Science.gov (United States)

    2010-07-01

    ... management actions necessary for the achievement of desired conditions and objectives and compliance with... and terrestrial habitat characteristics. (b) Objectives. These plan decisions are concise statements... spending levels as appropriate. Objectives include an estimate of the time and resources needed for their...

  5. Publications | Page 219 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    This thesis aims to better understand the sexual and reproductive health of young women married during their adolescence, in a marginalized Muslim community in a predominantly... Using Technology to Document Violations: Enabling Sex Worker Communities to Document Violence Against Them in India and Cambodia ...

  6. 48 CFR 219.1005 - Applicability.

    Science.gov (United States)

    2010-10-01

    ... construction projects or military family housing projects are exempt from the Small Business Competitiveness... OF DEFENSE SOCIOECONOMIC PROGRAMS SMALL BUSINESS PROGRAMS Small Business Competitiveness... prohibited under the Small Business Competitiveness Demonstration Program, when an ESB set-aside is not...

  7. Publications | Page 219 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Ivoire (CdI) joins 17 other countries in Africa that have instituted truth commissions in an attempt to deal with their fractured pasts. And whereas truth commissions can be important mechanisms through which... Public access to ICTs : sculpting ...

  8. 32 CFR 219.102 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... or other body authorized under applicable law to consent on behalf of a prospective subject to the... procedures by which data are gathered (for example, venipuncture) and manipulations of the subject or the...

  9. 36 CFR 219.36 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... aquatic ecosystems. Natural disturbances include, among others, drought, floods, wind, fires, insects, and... variability that species and ecosystems have experienced. Desired condition: A statement describing a common..., and processes of ecosystems including the diversity of plant and animal communities and the productive...

  10. May2007 EAST AFRICAN MEDICAL JOURNAL 219

    African Journals Online (AJOL)

    2007-05-05

    May 5, 2007 ... Finney (11) was used to determine CD50 and CD97. Results are expressed as mean +/ — s.e.m. Significance was p <0.05. RESULTS. Behavioural response: Fresh khat produced significant differences in behaviour between the different treatment groups in locomotion, rearing and circling and ANOVA ...

  11. 32 CFR 219.115 - IRB records.

    Science.gov (United States)

    2010-07-01

    ... research proposals reviewed, scientific evaluations, if any, that accompany the proposals, approved sample... abstaining; the basis for requiring changes in or disapproving research; and a written summary of the... least 3 years, and records relating to research which is conducted shall be retained for at least 3...

  12. Reference: 219 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available on. Phosphatidylinositol (PtdIns)(4,5)P(2) is one of the best characterized PIs; studies... homologs are found in nonplant genomes. High-performance liquid chromatography studies show that unstressed

  13. 36 CFR 219.2 - Principles.

    Science.gov (United States)

    2010-07-01

    ... planning to guide management of the National Forest System is to maintain or restore ecological... spatial scales necessary for sustainability. (4) Planning includes the monitoring and evaluation of the... interdependence of national forests and grasslands with economies and communities. (2) Planning fosters strategies...

  14. 32 CFR 219.107 - IRB membership.

    Science.gov (United States)

    2010-07-01

    ... subjects, such as children, prisoners, pregnant women, or handicapped or mentally disabled persons, consideration shall be given to the inclusion of one or more individuals who are knowledgeable about and...

  15. 40 CFR 21.9 - Appeals.

    Science.gov (United States)

    2010-07-01

    ... applicant aggrieved by a determination of a Regional Administrator under § 21.5 may appeal in writing to the... determination from which an appeal is taken; Provided, That the Deputy Administrator may, on good cause shown... Regional Administrator to be in error. (d) The Deputy Administrator shall act upon such appeal within 60...

  16. Publications | Page 219 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    IDRC works with developing-country researchers and institutions to build local capacity through funding, knowledge sharing, and training. Through books, articles, research publications, and studies, we aim to widen the impact of our investment and advance development research. We share the results of our funded ...

  17. 49 CFR 219.5 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... service in the United States subject to the hours of service laws (49 U.S.C. ch. 211) during a duty tour, whether or not the person has performed or is currently performing such service, and any person who... based on the cost of acquiring a new unit for comparable service. Reportable injury means an injury...

  18. 22 CFR 219.103 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... example, auxiliary aids useful for persons with impaired vision include readers, Brailled materials, audio...” includes, but is not limited to, such diseases and conditions as orthopedic, visual, speech, and hearing... fundamental alteration in its nature; or (2) With respect to any other program or activity, a handicapped...

  19. 12 CFR 219.3 - Cost reimbursement.

    Science.gov (United States)

    2010-01-01

    ... Operator” job categories (SOC Code Number 43-4199 and 43-9011) (or any successor job categories); (B) the median hourly rate for the “first-line supervisors/managers of office” job category (SOC Code Number 43...: Photocopy, per page $0.25 Paper copies of microfiche, per frame 0.25 Duplicate Microfiche, per microfiche 0...

  20. X-ray reflectivity and interfacial tension study of the structure and phase behavior of the interface between water and mixed surfactant solutions of CH3(CH2)19OH and CF3(CF2)7(CH2)2OH in hexane.

    Science.gov (United States)

    Pingali, Sai Venkatesh; Takiue, Takanori; Luo, Guangming; Tikhonov, Aleksey M; Ikeda, Norihiro; Aratono, Makoto; Schlossman, Mark L

    2005-01-27

    The interface between water and mixed surfactant solutions of CH(3)(CH(2))(19)OH and CF(3)(CF(2))(7)(CH(2))(2)OH in hexane was studied with interfacial tension and X-ray reflectivity measurements. Measurements of the tension as a function of temperature for a range of total bulk surfactant concentrations and for three different values of the molal ratio of fluorinated to total surfactant concentration (0.25, 0.28, and 0.5) determined that the interface can be in three different monolayer phases. The interfacial excess entropy determined for these phases suggests that two of the phases are condensed single surfactant monolayers of CH(3)(CH(2))(19)OH and CF(3)(CF(2))(7)(CH(2))(2)OH. By studying four different compositions as a function of temperature, X-ray reflectivity was used to determine the structure of these monolayers in all three phases at the liquid-liquid interface. The X-ray reflectivity measurements were analyzed with a layer model to determine the electron density and thickness of the headgroup and tailgroup layers. The reflectivity demonstrates that phases 1 and 2 correspond to an interface fully covered by only one of the surfactants (liquid monolayer of CH(3)(CH(2))(19)OH in phase 1 and a solid condensed monolayer of CF(3)(CF(2))(7)(CH(2))(2)OH in phase 2). This was determined by analysis of the electron density profile as well as by direct comparison to reflectivity studies of the liquid-liquid interface in systems containing only one of the surfactants (plus hexane and water). The liquid monolayer of CH(3)(CH(2))(19)OH undergoes a transition to the solid monolayer of CF(3)(CF(2))(7)(CH(2))(2)OH with increasing temperature. Phase 3 and the transition regions between phases 1 and 2 consist of a mixed monolayer at the interface that contains domains of the two surfactants. In phase 3 the interface also contains gaseous regions that occupy progressively more of the interface as the temperature is increased. The reflectivity determined the coverage of

  1. Astatine-211 conjugated to an anti-CD20 monoclonal antibody eradicates disseminated B-cell lymphoma in a mouse model

    Energy Technology Data Exchange (ETDEWEB)

    Green, Damian J.; Shadman, Mazyar; Jones, Jon C.; Frayo, Shani; Kenoyer, Aimee L.; Hylarides, Mark; Hamlin, Donald K.; Wilbur, D. Scott; Balkan, Ethan R.; Lin, Yukang; Miller, Brian W.; Frost, Sophia; Gopal, Ajay K.; Orozco, Johnnie J.; Gooley, Ted; Laird, Kelley L.; Till, B. G.; Back, Tom; Sandmaier, B. M.; Pagel, John M.; Press, Oliver W.

    2015-03-26

    Alpha emitting radionuclides release a large amount of energy within a few cell diameters and may be particularly effective for radioimmunotherapy targeting minimal residual disease (MRD) conditions in which micrometastatic disease satellites are broadly distributed. To evaluate this hypothesis, 211At conjugated 1F5 mAb (anti-CD20) was studied in both bulky lymphoma tumor xenograft and MRD animal models. Superior treatment responses to 211At conjugated 1F5 mAb were evident in the MRD setting. Lymphoma xenograft tumor bearing animals treated with doses of up to 48µCi of anti-CD20 211At-decaborate [211At-B10-1F5] experienced modest responses (0% cures but 2-3-fold prolongation of survival compared to negative controls). In contrast, 70% of animals in the MRD lymphoma model demonstrated complete eradication of disease when treated with 211At-B10-1F5 at a radiation dose that was less than one-third (15 µCi) of the highest dose given to xenograft animals. Tumor progression among untreated control animals in both models was uniformly lethal. After 130 days, no significant renal or hepatic toxicity is observed in the cured animals receiving 15 µCi of 211At-B10-1F5. These findings suggest that in a MRD lymphoma model, where isolated cells and tumor microclusters prevail, α-emitters may be uniquely efficacious.

  2. Dicty_cDB: SFD219 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sae68c10.y1 Gm-c1064 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1064-3212 5' similar to TR:O65744...sq98c12.y1 Gm-c1049 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1049-1199 5' similar to TR:O65744...sg79d05.y1 Gm-c1007 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1007-2626 5' similar to TR:O65744...saf75f12.y1 Gm-c1078 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1078-2184 5' similar to TR:O65744...sa37e09.y1 Gm-c1004 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1004-1505 5' similar to TR:O24653

  3. Dicty_cDB: SSD219 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available LYLYYT SGEKKDIPFVPKFAPAFNPKTAGSHSGTKGAKGVVKSKHG*ik*******ii*yits*st fqsysnsthyhyhhiqnlkpkkkkkkkkkkklynnc--- ...YLYYT SGEKKDIPFVPKFAPAFNPKTAGSHSGTKGAKGVVKSKHG*ik*******ii*yits*st fqsysnsthyhyhhiqnlkpkkkkkkkkkkklynn

  4. 48 CFR 1552.219-70 - Mentor-Protege Program.

    Science.gov (United States)

    2010-10-01

    ... SDBs; and to aid in the achievement of goals for the use of SDBs in subcontracting activities under EPA... achieving the developmental assistance objectives under each agreement, including whether the objectives of...

  5. Skid Resistant Runway Surfaces. Design Manual. 21.9

    Science.gov (United States)

    1981-12-01

    values of coefficient of friction. f. Flushing (Bleeding). The migration of excessive bitumen to the pavement surface as a result of poor mix design...from construction techniques, such as plastic texturing, the siliceous particle content predominantly influences the skid quality of concrete pavement...Gabbro -- Granite -- Porphyry If crushed stone from one of those groups is not available or economically feasible, crushed siliceous gravel may be

  6. 219-IJBCS-Article-Dr R N -Nwaoguikpe

    African Journals Online (AJOL)

    RHUMSIKI

    are: Telferia occidentalis WAS (600±0.1), BUS (242±0.11), FAS (175±0.11) and CAE (2890±0.1); Allium cepa, WAS (1225±0.1), BUS ..... to their normal morphology is due to increased oxygen affinity. It can be inferred that these vegetables/ spices can provide profound nutritional and antisickling effectiveness for the ...

  7. Dicty_cDB: SSF219 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available DSNGAYVTMDDNDQKILLAIFNELKSPXPTPTNQIRVNTKDSYFTAHFIGDINSELFKXI DKVITWNPITTKVKECDSLQKLFIKYSKXI*cv*ciknk*invff*v...DSNGAYVTMDDNDQKILLAIFNELKSPXPTPTNQIRVNTKDSYFTAHFIGDINSELFKXI DKVITWNPITTKVKECDSLQKLFIKYSKXI*cv*ciknk*invff*v

  8. 49 CFR 1544.219 - Carriage of accessible weapons.

    Science.gov (United States)

    2010-10-01

    ... SECURITY ADMINISTRATION, DEPARTMENT OF HOMELAND SECURITY CIVIL AVIATION SECURITY AIRCRAFT OPERATOR SECURITY... the identity of the armed LEO is known to the appropriate personnel who are responsible for security... each armed LEO, including FAM's. Under circumstances described in the security program, the aircraft...

  9. All projects related to | Page 219 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2017-09-29

    The rapid growth of peri-urban areas in Southeast Asia is characterized by a lack of basic services, unplanned built environments, and relatively weak governments. End Date: September 29, 2017. Topic: ADAPTATION, Capacity building, Climate change, EDUCATION, STRATEGIC PLANNING, RISK MANAGEMENT, ...

  10. Dicty_cDB: SLB219 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available TARQEAERLEQMARGELERQKIIDEAKNEESRSKLVQLQAQSAAVESTGQAVAEARARAE AAIIEAESEIKQARLSTRAIEIEALSEIENLKAKHIVEIQHIKSLNNLELIKAKESATIE...TARQEAERLEQMARGELERQKIIDEAKNEESRSKLVQLQAQSAAVESTGQAVAEARARAE AAIIEAESEIKQARLSTRAIEIEALSEIENLKAKHIVEIQHIKSLNNLELIKAKESATIE

  11. Dicty_cDB: VSF219 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 0.009 2 BU042820 |BU042820.1 PP_LEa0014B11f Peach developing fruit mesocarp Prunus persica cDNA clone PP_LE...a0014B11f, mRNA sequence. 52 0.010 1 BU041769 |BU041769.1 PP_LEa0010G24f Peach developing...32.1 PP_LEa0019F12f Peach developing fruit mesocarp Prunus persica cDNA clone PP_LEa0019F12f, mRNA sequence.

  12. 29 CFR 1910.219 - Mechanical power-transmission apparatus.

    Science.gov (United States)

    2010-07-01

    ... engine or for running adjustment may be provided at the flywheel of gas or oil engines. A slot opening... be done, openings with hinged or sliding self-closing covers shall be provided. All points not... “U” type guard is permissible. (2) Engine rooms. In engine rooms a guardrail, preferably with...

  13. 49 CFR 219.205 - Specimen collection and handling.

    Science.gov (United States)

    2010-10-01

    ... via air express, air freight or equivalent means. The railroad must maintain and document secure chain of custody of the kit from release by the medical facility to delivery for transportation, as...

  14. 48 CFR 552.219-73 - Goals for Subcontracting Plan.

    Science.gov (United States)

    2010-10-01

    ... veteran-owned small business concerns; and (4) Review the offeror's description of its strategies..., small disadvantaged, women-owned, veteran-owned, and service-disabled veteran-owned small business... veteran-owned small business concerns to participate as subcontractors in the performance of this contract...

  15. 24 CFR 884.219 - Overcrowded and underoccupied units.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false Overcrowded and underoccupied units... Overcrowded and underoccupied units. If HUD or the PHA, as the case may be, determines that a Contract unit... Contract unit is larger than appropriate for the size of the Family in occupancy, housing assistance...

  16. Dicty_cDB: VHD219 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available QPSAHSDAAF*sfdvgssyh ceaeftkcwivhpltrnvswv*tvvrqvsftlllsivcviva*fstrgtvmpdhwsvglf dkivtcryhpldng*tplsqnpf*krkpnalecec... ceaeftkcwivhpltrnvswv*tvvrqvsftlllsivcviva*fstrgtvmpdhwsvglf dkivtcryhpldng*tplsqnpf*krkpnalececcr*h*vvgggp

  17. 75 FR 219 - Availability of Funds and Collection of Checks

    Science.gov (United States)

    2010-01-05

    .... FOR FURTHER INFORMATION CONTACT: Jeffrey S. H. Yeganeh, Financial Services Manager (202/728-5801), or Joseph P. Baressi, Financial Services Project Leader (202/452-3959), Division of Reserve Bank Operations... payable by or at or through a bank located in the same Federal Reserve check-processing region as the...

  18. 47 CFR 90.219 - Use of signal boosters.

    Science.gov (United States)

    2010-10-01

    ... Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) SAFETY AND SPECIAL RADIO SERVICES PRIVATE LAND... effective radiated power (ERP) of the unit to a maximum of 5 watts under all conditions. Class B broadband signal boosters are limited to 5 watts ERP for each authorized frequency that the booster is designed to...

  19. Dicty_cDB: SSC219 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available update 1997. 9. 4 Translated Amino Acid sequence ---ASAADQLKYSIIFRNMNGTIANKGSVRIDMQSSFTSNGPVWLDLKAQLNGVKGNSTI... hsffxfyiilcilitlylcyfih*kkiplffle Frame B: ---ASAADQLKYSIIFRNMNGTIANKGSVRIDMQSSFTSNGPVWLDLKAQLNGVKGNSTI

  20. 30 CFR 219.410 - What does this subpart contain?

    Science.gov (United States)

    2010-07-01

    ..., Louisiana, Mississippi, and Texas (collectively identified as the Gulf producing States); to eligible coastal political subdivisions within those States; and to the Land and Water Conservation Fund. Shared... coastal protection, including conservation, coastal restoration, hurricane protection, and infrastructure...

  1. 48 CFR 1852.219-79 - Mentor requirements and evaluation.

    Science.gov (United States)

    2010-10-01

    ... companies and nonprofit agencies employing the blind or severely handicapped as defined in 41 CFR chapter 51. (b) NASA will evaluate the contractor's performance on the following factors. If this contract...

  2. Dicty_cDB: SLF219 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available mold (D.discoideum) transposable element Tdd-1 right terminal repeat and flanks. 293 e-158 5 M11340 |M11340...K03070 |K03070.1 Slime mold (D.discoideum) DIRS-1 right inverted terminal repeat, clone CP19-1. 226 e-119...K03072 |K03072.1 Slime mold (D.discoideum) DIRS-1 right inverted terminal repeat, clone SB63. 238 e-114...K03068 |K03068.1 Slime mold (D.discoideum) DIRS-1 right inverted terminal repeat, clone GM45. 167 e-110

  3. Dicty_cDB: VFB219 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ( AY785660 |pid:none) Trypanosoma cruzi strain Dm 28 c c... 405 e-111 AY785657_1( AY785657 |pid:none) Trypanosoma cruzi strain Colomb...ian... 405 e-111 protein update 2009. 6.17 PSORT psg: 0.

  4. Dicty_cDB: VFA219 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available alignments: (bits) Value N BD092935 |BD092935.1 Methods and compositions for synthesis of long chain polyunsaturated...acids in plants. 1213 0.0 3 BD082645 |BD082645.1 Methods and compositions for synthesis of long chain polyunsaturated...polyunsaturated fatty acids. 1213 0.0 3 BD082630 |BD082630.1 Methods and compositions for synthesis of long chain poly-unsaturated

  5. Worldwide Report Law of the Sea No. 219

    Science.gov (United States)

    1983-02-07

    proposed restraint in utilizing these resources in an area running an equal distance east and west of the sector line. Norway rejected this because...3) ?*^W ~rtT^) r: (6) *’f-r / ) ’if;- ’’-?.•..;’"•’■ I .;i^!#-:..’ "Ill I--3000 M 40C0M imjl^O) 1 - 5000M ■b’JOOK Figure 2. Concept of

  6. 24 CFR 200.219 - Content of certification.

    Science.gov (United States)

    2010-04-01

    ... finance agencies in which the principal has been or is now a principal; (2) For a period beginning 10... an employee's immediate household as defined by HUD's Standards of Conduct in 24 CFR 0.735-205(c); (5...

  7. 12 CFR 219.23 - Recordkeeping and reporting requirements.

    Science.gov (United States)

    2010-01-01

    ... usefulness in criminal, tax, or regulatory investigations or proceedings. These regulations are codified at... these records in criminal, tax, or regulatory investigations or proceedings and the effect the recordkeeping will have on the cost and efficiency of the payment system. These regulations are codified at 31...

  8. Dicty_cDB: SHL219 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available |DY889811.1 CeleSEQ6761 Cunninghamella elegans pBluescript (EcoRI-XhoI) Cunninghamella elegans cDNA clone...|DY889772.1 CeleSEQ11980 Cunninghamella elegans pBluescript (EcoRI-XhoI) Cunninghamella elegans cDNA clone...|DY890935.1 CeleSEQ7425 Cunninghamella elegans pBluescript (EcoRI-XhoI) Cunninghamella elegans cDNA clone...|DY887441.1 CeleSEQ3766 Cunninghamella elegans pBluescript (EcoRI-XhoI) Cunninghamella elegans cDNA clone...|DY888936.1 CeleSEQ6366 Cunninghamella elegans pBluescript (EcoRI-XhoI) Cunninghamella elegans cDNA clone

  9. 34 CFR 685.219 - Public Service Loan Forgiveness Program.

    Science.gov (United States)

    2010-07-01

    ... organization that is publicly funded and whose principal activities pertain to crime prevention, control or reduction of crime, or the enforcement of criminal law. Military service, for uniformed members of the U.S... interest law services, early childhood education (including licensed or regulated child care, Head Start...

  10. 12 CFR 219.21 - Authority, purpose and scope.

    Science.gov (United States)

    2010-01-01

    ... transaction or class of transactions to the extent that the Treasury has determined that 31 CFR 103.33(e) or (f) do not apply to that person, transaction, or class of persons or transactions. These... determined to have a high degree of usefulness in criminal, tax or regulatory investigations or proceedings. ...

  11. 219-IJBCS-Article-Dr R N -Nwaoguikpe

    African Journals Online (AJOL)

    RHUMSIKI

    improvement in the Fe2+/Fe3+ ratio, these vegetables/extracts would nonetheless provide adequate nutritional and antisickling effectiveness necessary for the ... nutrition and this has yielded promising results( Ekeke, 1997; Uzoegwu ,1995). It is ..... Allium vegetables in cancer prevention. In. Nutritional Oncology, Haber D,.

  12. 21 CFR 2.19 - Methods of analysis.

    Science.gov (United States)

    2010-04-01

    ... latest edition (13th Ed., 1980) of their publication “Official Methods of Analysis of the Association of Official Analytical Chemists,” and the supplements thereto (“Changes in Methods” as published in the March issues of the “Journal of the Association of Official Analytical Chemists”), which are incorporated by...

  13. Dicty_cDB: CHI219 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SSYPNKKFLSDQYINGESIIFNPEISINPIPTSGGKTPMIGYFLLDGFESEKLLSDSNND FFHYDPVNGSTIDYLIDLPSGCKSFKIFDFLSTKSLSTIKYLQPILSSKKPYEFDNNDNN...SSYPNKKFLSDQYINGESIIFNPEISINPIPTSGGKTPMIGYFLLDGFESEKLLSDSNND FFHYDPVNGSTIDYLIDLPSGCKSFKIFDFLSTKSLSTIKYLQPILSSKKPYEFDNNDNN

  14. Publications | Page 219 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Le CRDI collabore avec les chercheurs et les établissements des pays en développement au renforcement des capacités locales par le truchement du financement, de la mise en commun des connaissances et de la formation. Avec nos livres, nos articles, nos publications de recherche et nos études, nous visons à ...

  15. 49 CFR 219.101 - Alcohol and drug use prohibited.

    Science.gov (United States)

    2010-10-01

    ... are grouped as follows: marijuana, narcotics (such as heroin and codeine), stimulants (such as cocaine... that are required to be distributed only by a medical practitioner's prescription or other...

  16. Dicty_cDB: SHE219 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 4e-23 AF016833_1( AF016833 |pid:none) Homo sapiens maltase-glucoamylase ... 111 5e-23 EU937530_1( EU937530...Mus musculus sucrase-isomaltase mR... 110 9e-23 ( O43451 ) RecName: Full=Maltase-glucoamylase, intestinal;...sucrase-isomaltase (SI) mRNA, comp... 105 2e-21 ( P23739 ) RecName: Full=Sucrase-isomaltase, intestinal;...BC116452_1( BC116452 |pid:none) Homo sapiens sucrase-isomaltase (a... 102 2e-20 protein update 2009. 4.17 PSORT

  17. (sfragís) and its metaphorical testimonial presence in 2 Timothy 2:19

    African Journals Online (AJOL)

    2010-10-12

    Oct 12, 2010 ... It becomes clear from the previous that the 'atheism' accusations, for which Christians were persecuted, could well have been caused by their negative thoughts and writings on the worship of the emperor or the gods. The. Roman state was both established and protected by these institutions. Schüssler ...

  18. 36 CFR 219.12 - Collaboration and cooperatively developed landscape goals.

    Science.gov (United States)

    2010-07-01

    ..., facilitator, or participant. The responsible official must provide early and frequent opportunities for people... variety of individual choice; (v) Achieve a balance between population and resource use which will permit high standards of living and a wide sharing of life's amenities; and (vi) Enhance the quality of...

  19. 49 CFR 219.201 - Events for which testing is required.

    Science.gov (United States)

    2010-10-01

    ... injury resulting from the hazardous material release (e.g., from fire, explosion, inhalation, or skin... cause and severity of which are wholly attributable to a natural cause (e.g., flood, tornado, or other... made, and the person making the decision. (iv) Any estimates of railroad property damage made by...

  20. (sfragís) and its metaphorical testimonial presence in 2 Timothy 2:19

    African Journals Online (AJOL)

    2010-10-12

    Oct 12, 2010 ... is craftily designed in video games and movies. But, on the contrary, Christians are called to present their minds and bodies: as a living sacrifice, holy, acceptable to God, which is your reasonable service and do not be conformed to this world, but be transformed by the renewing of your mind, that you may ...

  1. 36 CFR 219.22 - The overall role of science in planning.

    Science.gov (United States)

    2010-07-01

    ... should provide for independent, scientific peer reviews of the use of science in planning. Independent... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false The overall role of science... AGRICULTURE PLANNING National Forest System Land and Resource Management Planning The Contribution of Science...

  2. 32 CFR 219.101 - To what does this policy apply?

    Science.gov (United States)

    2010-07-01

    ..., such as (i) research on regular and special education instructional strategies, or (ii) research on the... subjects' financial standing, employability, or reputation. (3) Research involving the use of educational... to those programs or procedures; or (iv) Possible changes in methods or levels of payment for...

  3. 48 CFR 752.219-70 - USAID Mentor-Protégé Program.

    Science.gov (United States)

    2010-10-01

    ... developmental assistance. Protégé firms are small business as defined in 13 CFR parts 121, 124, and 126. (c... DEVELOPMENT CLAUSES AND FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Texts of Provisions and Clauses 752...: USAID Mentor-Protégé Program (July 13, 2007) (a) Large and small business are encouraged to participate...

  4. 7 CFR 2.19 - Under Secretary for Food, Nutrition, and Consumer Services.

    Science.gov (United States)

    2010-01-01

    ... selecting food that supplies a nutritionally adequate diet. (ii) Develop family food plans at different... Federal food programs. (vi) Coordinate nutrition education promotion and professional education projects... 7 Agriculture 1 2010-01-01 2010-01-01 false Under Secretary for Food, Nutrition, and Consumer...

  5. 49 CFR Appendix C to Part 219 - Post-Accident Testing Specimen Collection

    Science.gov (United States)

    2010-10-01

    ... railroad representatives handling the box shall document chain of custody of the shipping box and shall... chain of custody, it is best if a single collector handles both collections from a given employee. g... and date each blood tube label at the place provided. 4. Skip to STEP 5 and initiate chain of custody...

  6. 20 CFR 219.34 - When evidence that a marriage has ended is required.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false When evidence that a marriage has ended is... a marriage has ended is required. Evidence of how a previous marriage ended may be required to determine whether a later marriage is valid. If a widow or widower remarried after the employee's death and...

  7. SUBTASK 2.19 – OPERATIONAL FLEXIBILITY OF CO2 TRANSPORT AND STORAGE

    Energy Technology Data Exchange (ETDEWEB)

    Jensen, Melanie; Schlasner, Steven; Sorensen, James; Hamling, John

    2014-12-31

    Carbon dioxide (CO2) is produced in large quantities during electricity generation and by industrial processes. These CO2 streams vary in terms of both composition and mass flow rate, sometimes substantially. The impact of a varying CO2 stream on pipeline and storage operation is not fully understood in terms of either operability or infrastructure robustness. This study was performed to summarize basic background from the literature on the topic of operational flexibility of CO2 transport and storage, but the primary focus was on compiling real-world lessons learned about flexible operation of CO2 pipelines and storage from both large-scale field demonstrations and commercial operating experience. Modeling and pilot-scale results of research in this area were included to illustrate some of the questions that exist relative to operation of carbon capture and storage (CCS) projects with variable CO2 streams. It is hoped that this report’s real-world findings provide readers with useful information on the topic of transport and storage of variable CO2 streams. The real-world results were obtained from two sources. The first source consisted of five full-scale, commercial transport–storage projects: Sleipner, Snøhvit, In Salah, Weyburn, and Illinois Basin–Decatur. These scenarios were reviewed to determine the information that is available about CO2 stream variability/intermittency on these demonstration-scale projects. The five projects all experienced mass flow variability or an interruption in flow. In each case, pipeline and/or injection engineers were able to accommodate any issues that arose. Significant variability in composition has not been an issue at these five sites. The second source of real- world results was telephone interviews conducted with experts in CO2 pipeline transport, injection, and storage during which commercial anecdotal information was acquired to augment that found during the literature search of the five full-scale projects. The experts represented a range of disciplines and hailed from North America and Europe. Major findings of the study are that compression and transport of CO2 for enhanced oil recovery (EOR) purposes in the United States has shown that impurities are not likely to cause transport problems if CO2 stream composition standards are maintained and pressures are kept at 10.3 MPa or higher. Cyclic, or otherwise intermittent, CO2 supplies historically have not impacted in-field distribution pipeline networks, wellbore integrity, or reservoir conditions. The U.S. EOR industry has demonstrated that it is possible to adapt to variability and intermittency in CO2 supply through flexible operation of the pipeline and geologic storage facility. This CO2 transport and injection experience represents knowledge that can be applied in future CCS projects. A number of gaps in knowledge were identified that may benefit from future research and development, further enhancing the possibility for widespread application of CCS. This project was funded through the Energy & Environmental Research Center–U.S. Department of Energy Joint Program on Research and Development for Fossil Energy-Related Resources Cooperative Agreement No. DE-FC26-08NT43291. Nonfederal funding was provided by the IEA Greenhouse Gas R&D Programme.

  8. 219 Enumah et al., Afr J Tradit Complement Altern Med. (2016) 13(3 ...

    African Journals Online (AJOL)

    physical and mental illnesses (Bodeker 2007). .... and non-state actors, religious institutions, media, physician networks, and other entities—and the efficacy of mganga in assuming this role as ... religious leaders, patients and other personnel—were recruited using affiliations with the Swahili Resource Center, Family Health.

  9. 36 CFR 223.219 - Sustainable harvest of special forest products.

    Science.gov (United States)

    2010-07-01

    ... making their sustainability determination and establishing monitoring time frames consistent with... on International Trade in Endangered Species may be authorized. (c) Monitoring of established harvest... Forest Service shall monitor the effects of harvesting on the sustainability of special forest products...

  10. Codon 219 polymorphism of PRNP in healthy caucasians and Creutzfeldt-Jakob disease patients

    Energy Technology Data Exchange (ETDEWEB)

    Petraroli, R.; Pocchiari, M. [Instituto Superiore di Sanita, Rome (Italy)

    1996-04-01

    A number of point and insert mutations of the PrP gene (PRNP) have been linked to familial Creutzfeldt-Jakob disease (CJD) and Gerstmann-Straussler-Scheinker disease (GSS). Moreover, the methionine/valine homozygosity at the polymorphic codon 129 of PRNP may cause a predisposition to sporadic and iatrogenic CJD or may control the age at onset of familial cases carrying either the 144-bp insertion or codon 178, codon 198, and codon 210 pathogenic mutations in PRNP. In addition, the association of methionine or valine at codon 129 and the point mutation at codon 178 on the same allele seem to play an important role in determining either fatal familial insomnia or CJD. However, it is noteworthy that a relationship between codon 129 polymorphism and accelerated pathogenesis (early age at onset or shorter duration of the disease) has not been seen in familial CJD patients with codon 200 mutation or in GSS patients with codon 102 mutation, arguing that other, as yet unidentified, gene products or environmental factors, or both, may influence the clinical expression of these diseases. 17 refs.

  11. 48 CFR 52.219-23 - Notice of Price Evaluation Adjustment for Small Disadvantaged Business Concerns.

    Science.gov (United States)

    2010-10-01

    ... disadvantaged business concerns in the United States or its outlying areas. This paragraph does not apply to... items manufactured or produced by small business concerns in the United States or its outlying areas... database maintained by the Small Business Administration (PRO-Net). (2) It has submitted a completed...

  12. 14 CFR 417.219 - Data loss flight time and planned safe flight state analyses.

    Science.gov (United States)

    2010-01-01

    ... along the nominal trajectory from liftoff through that point during nominal flight when the minimum... otherwise protected area for the remainder of the launch; (2) The launch vehicle achieves orbital insertion...

  13. 48 CFR 1852.219-77 - NASA Mentor-Protégé Program.

    Science.gov (United States)

    2010-10-01

    ... must qualify as certified small disadvantaged business concerns, women-owned small business concerns..., Historically Black Colleges and Universities, minority institutions of higher education, meeting the... for voluntary participation and successful performance in the Mentor-Protégé Program, in accordance...

  14. 48 CFR 52.219-8 - Utilization of small business concerns.

    Science.gov (United States)

    2010-10-01

    ... disadvantaged business in the database maintained by the Small Business Administration (PRO-Net). Veteran-owned... small business concerns, veteran-owned small business concerns, service-disabled veteran-owned small..., components, and related services for major systems. It is further the policy of the United States that its...

  15. : tous les projets | Page 219 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Date de début : 5 mars 2012. End Date: 31 août 2014. Sujet: URBAN YOUTH, CRIME PREVENTION, YOUTH UNREST, ORGANIZED CRIME, VIOLENCE, MARGINALISM. Région: Guatemala, North and Central America, Honduras, El Salvador, South America. Programme: Gouvernance et justice. Financement total : CA$ ...

  16. 32 CFR 219.119 - Research undertaken without the intention of involving human subjects.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Research undertaken without the intention of... undertaken without the intention of involving human subjects. In the event research is undertaken without the intention of involving human subjects, but it is later proposed to involve human subjects in the research...

  17. 25 CFR 2.19 - Action by Area Directors and Education Programs officials on appeal.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Action by Area Directors and Education Programs officials... Programs officials on appeal. (a) Area Directors, Area Education Programs Administrators, Agency...—Indian Affairs/Director (Indian Education Programs) shall render written decisions in all cases appealed...

  18. Morphological and biochemical responses of Oryza sativa L. (cultivar MR219) to ion beam irradiation*

    Science.gov (United States)

    Ling, Anna Pick Kiong; Ung, Ying Chian; Hussein, Sobri; Harun, Abdul Rahim; Tanaka, Atsushi; Yoshihiro, Hase

    2013-01-01

    Objective: Heavy ion beam, which has emerged as a new mutagen in the mutation breeding of crops and ornamental plants, is expected to result in the induction of novel mutations. This study investigates the morphological and biochemical responses of Oryza sativa toward different doses of carbon ion beam irradiation. Methods: In this study, the dry seeds of O. sativa were irradiated at 0, 20, 40, 60, 80, 100, and 120 Gy, followed by in-vitro germination under controlled conditions. Morphological and biochemical studies were conducted to investigate the morphological and physiological responses of O. sativa towards ion beam irradiation. Results: The study demonstrated that low doses (10 Gy) of ion beam have a stimulating effect on the height, root length, and fresh weight of the plantlets but not on the number of leaves. Meanwhile, doses higher than 10 Gy caused reductions in all the morphological parameters studied as compared to the control samples. The highest total soluble protein content [(2.11±0.47) mg/g FW] was observed in plantlets irradiated at 20 Gy. All irradiated plantlets were found to have 0.85% to 58.32% higher specific activity of peroxidase as compared to the control samples. The present study also revealed that low doses of ion beam (10 and 20 Gy) had negligible effect on the total chlorophyll content of O. sativa plantlets while 40 Gy had a stimulating effect on the chlorophyll content. Plantlets irradiated between 40 to 120 Gy were shown to be 0.38% to 9.98% higher in total soluble nitrogen content which, however, was not significantly different from the control samples. Conclusions: Carbon ion beam irradiation administered at low to moderate doses of 10 to 40 Gy may induce O. sativa mutants with superior characteristics. PMID:24302713

  19. Morphological and biochemical responses of Oryza sativa L. (cultivar MR219) to ion beam irradiation.

    Science.gov (United States)

    Ling, Anna Pick Kiong; Ung, Ying Chian; Hussein, Sobri; Harun, Abdul Rahim; Tanaka, Atsushi; Yoshihiro, Hase

    2013-12-01

    Heavy ion beam, which has emerged as a new mutagen in the mutation breeding of crops and ornamental plants, is expected to result in the induction of novel mutations. This study investigates the morphological and biochemical responses of Oryza sativa toward different doses of carbon ion beam irradiation. In this study, the dry seeds of O. sativa were irradiated at 0, 20, 40, 60, 80, 100, and 120 Gy, followed by in-vitro germination under controlled conditions. Morphological and biochemical studies were conducted to investigate the morphological and physiological responses of O. sativa towards ion beam irradiation. The study demonstrated that low doses (10 Gy) of ion beam have a stimulating effect on the height, root length, and fresh weight of the plantlets but not on the number of leaves. Meanwhile, doses higher than 10 Gy caused reductions in all the morphological parameters studied as compared to the control samples. The highest total soluble protein content [(2.11 ± 0.47) mg/g FW] was observed in plantlets irradiated at 20 Gy. All irradiated plantlets were found to have 0.85% to 58.32% higher specific activity of peroxidase as compared to the control samples. The present study also revealed that low doses of ion beam (10 and 20 Gy) had negligible effect on the total chlorophyll content of O. sativa plantlets while 40 Gy had a stimulating effect on the chlorophyll content. Plantlets irradiated between 40 to 120 Gy were shown to be 0.38% to 9.98% higher in total soluble nitrogen content which, however, was not significantly different from the control samples. Carbon ion beam irradiation administered at low to moderate doses of 10 to 40 Gy may induce O. sativa mutants with superior characteristics.

  20. 36 CFR 219.28 - Determination of land suitable for timber harvest.

    Science.gov (United States)

    2010-07-01

    ... justified by the ecological, social, or economic benefits considering physical, economic, and other pertinent factors to the extent feasible. Lands where timber production is not established as a plan... production considering physical, economic, and other pertinent factors to the extent feasible. Based on this...

  1. 28 CFR 2.219 - Maximum terms of imprisonment and supervised release.

    Science.gov (United States)

    2010-07-01

    ... years. 22-401 [22-501] Assault: with intent to kill/rob/poison, to commit sex abuse (1st or 2nd degree) or child sex abuse 3 years (10 years if SOR) 2 years. 22-401, 4502 [22-501, 3202] Assault: with... years. 22-2803(b) [22-2903] Carjacking: armed * 5 years 5 years. 22-3002 [22-4102] Sex abuse 1st degree...

  2. 48 CFR 352.219-70 - Mentor-protégé program.

    Science.gov (United States)

    2010-10-01

    ... businesses, or woman-owned businesses; and (iii) have a Mentor-Protégé agreement approved by HHS' OSDBU; and... terms, conditions, and responsibilities of the mentor-protégé relationship. (End of provision) ...

  3. Yeast Interacting Proteins Database: YPL031C, YPL219W [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available ting the cellular response to nutrient levels and environmental conditions and progression through the cell ...e cellular response to nutrient levels and environmental conditions and progression through the cell cycle R

  4. MicroRNA-219 modulates NMDA receptor-mediated neurobehavioral dysfunction

    DEFF Research Database (Denmark)

    Kocerha, Jannet; Faghihi, Mohammad Ali; Lopez-Toledano, Miguel A

    2009-01-01

    N-methyl-D-aspartate (NMDA) glutamate receptors are regulators of fast neurotransmission and synaptic plasticity in the brain. Disruption of NMDA-mediated glutamate signaling has been linked to behavioral deficits displayed in psychiatric disorders such as schizophrenia. Recently, noncoding RNA...

  5. 48 CFR 1552.219-71 - Procedures for Participation in the EPA Mentor-Protege Program.

    Science.gov (United States)

    2010-10-01

    ... disadvantaged individuals as subcontractors, suppliers, and ultimately as prime contractors; to establish a mutually beneficial relationship between these concerns and EPA's large business prime contractors... for each proposed Mentor-Protege relationship: (1) Information on the offeror's ability to provide...

  6. La Desercion Escolar en los Niveles de Sexto y Noveno Grado: Una Comparacion Entre Zonas Rurales y Urbanas. Boletin 219 (The Educational Desertion in the 6th and 9th Grades: A Comparison Between Rural and Urban Zones. Bulletin 219).

    Science.gov (United States)

    Lopez, Maria I. Hernandez; And Others

    In 1962 and again in 1965, a group of sixth and ninth grade students in selected schools in four Puerto Rican communities were interviewed to investigate the factors influencing students' decision to withdraw from school before completing twelfth grade and to identify some characteristics of dropouts. Of 616 students interviewed in 1962, 20.9% of…

  7. Cusculium (Plin. XVI 22, coscus (Chiron 237 and coccolubis (Colum. III 2.19: Mediterranean substrate and Latin form

    Directory of Open Access Journals (Sweden)

    Benjamín García-Hernández

    2014-12-01

    Full Text Available Cusculium, a hapax used by Pliny in its accusative form, has a Pre-Roman base (cuscu- that is found throughout western Mediterranean countries; the same root appears in coscus, referring to certain types of worm. Given its Latin ending, the word could be used to designate both the tree (cusculius «kermes oak» and its acorns (cusculium. Coccolubis is a compound adjective, the first element of which is the diminutive of coccum («grain of kermes», which carries the same Mediterranean root as the previous word. Given its use as an epithet for a type of vine, its second element may be seen to contain the base of the noun uua. Its original form may have therefore been coccoluuis («of red grape». The Navarran term cuzculubita («oak apple», however, suggests that a Pre-Roman compound may have existed.

  8. Enhancing somatic embryogenesis of Malaysian rice cultivar MR219 using adjuvant materials in a high-efficiency protocol

    DEFF Research Database (Denmark)

    Rambod, Abiri; Maziah, Mahmood; Shaharuddin, Noor Azmi

    2017-01-01

    of different explants was identified. Subsequently, the effects of different auxins, cytokinins, l-proline, casein hydrolysate and potassium metasilicate concentrations on the callus proliferation and regeneration were considered. For the callogenesis phase, 2 mg L−1of 2,4-D and roots were chosen as the best...

  9. 75 FR 25844 - Class Deviation From FAR 52.219-7, Notice of Partial Small Business Set-Aside

    Science.gov (United States)

    2010-05-10

    ...: Defense Logistics Agency, DoD. ACTION: Notice. SUMMARY: This is to notify interested parties of a proposed... for Defense Logistics Agency (DLA), Defense Energy Support Center (DESC) bulk fuels solicitations and... DAR Case 90-922. The current deviation established a methodology for partial small business set-aside...

  10. Modern prostate brachytherapy. Prostate specific antigen results in 219 patients with up to 12 years of observed follow-up.

    Science.gov (United States)

    Ragde, H; Korb, L J; Elgamal, A A; Grado, G L; Nadir, B S

    2000-07-01

    The purported lack of long term modern prostate brachytherapy outcome data continues to lead many physicians to recommend other, more traditional treatments. This concern for long term results has encouraged the authors to supplement their earlier 10-year follow-up of patients receiving brachytherapy; in the process, an additional 77 patients (> 50%) were added to the original cohort, and the follow-up time was increased by 2 years. Between January 1987 and September 1989, 229 patients with T1-T3 prostate carcinoma underwent transperineal prostate brachytherapy using iodine-125 (I-125). No patient received adjuvant hormone therapy. The median Gleason sum was 5 (range, 2-10). Of these patients, 147 were determined to have a high probability of organ-confined disease and were treated solely with an I-125 implant. The remaining 82 patients were determined to be at increased risk for extracapsular disease and received pelvic external beam radiation in addition to brachytherapy. All patients were followed continuously. Failure was defined as a positive biopsy, radiographic evidence of metastases, or three consecutive rises in prostate specific antigen (PSA) levels as defined by the American Society for Therapeutic Radiology and Oncology (ASTRO) consensus article. Excluding deaths from intercurrent disease, the median follow-up was 122 months (range, 18-144 months). Fourteen patients were excluded from analysis due to insufficient follow-up. Adopting the ASTRO definition of failure resulted in minimal change in survival when compared with the authors' previous study, which used a PSA level > 0.5 ng/mL as the failure point. Observed 10-year disease free survival (DFS) for the entire cohort was 70%. In the brachytherapy only group, the observed 10-year DFS was 66%, whereas those patients treated with the addition of external pelvic radiation achieved a DFS of 79%. None of the patients who were followed for the full 12 years failed between Years 10 and 12. Only 25% of the failures observed occurred > 5 years after treatment, thus confirming the durability of brachytherapy. Prostate brachytherapy provides excellent long term disease control with few late failures reported in the authors' program. The addition of external beam radiation appears to confer survival advantages in selected patients. Using the ASTRO failure criteria for long term follow-up resulted in no significant difference compared with using a PSA failure point of 0.5 ng/mL. Copyright 2000 American Cancer Society.

  11. 76 FR 16526 - Airworthiness Directives; Pratt & Whitney JT8D-209, -217, -217A, -217C, and -219 Series Turbofan...

    Science.gov (United States)

    2011-03-24

    ... within 500 hours TIS since (1.130 N.m). last inspection. Less than 10 LB-IN (1.130 N.m) but One to six... TIS since (1.130 N.m). last inspection. Less than 10 LB-IN (1.130 N.m) but One to six Repeat torque... This AD (n) Whenever a refurbished or used blade is intermixed with new blades in a rotor, use the...

  12. 75 FR 38052 - Airworthiness Directives; Pratt & Whitney JT8D-209, -217, -217A, -217C, and -219 Series Turbofan...

    Science.gov (United States)

    2010-07-01

    ... (1.130 N.m) One to six....... Repeat torque but greater than or equal to inspection within 5 LB-IN (0... TIS since last inspection. Less than 10 LB-IN (1.130 N.m) One to six....... Repeat torque but greater... This AD (n) Whenever a refurbished or used blade is intermixed with new blades in a rotor, use the...

  13. Rubric for Evaluating Reading/Language Arts Instructional Materials for Kindergarten to Grade 5. REL 2017-219

    Science.gov (United States)

    Foorman, Barbara R.; Smith, Kevin G.; Kosanovich, Marcia L.

    2017-01-01

    The implementation of effective instructional materials, such as a core reading program, by a qualified teacher is an important part of improving students' reading achievement. But selecting those instructional materials can be time-consuming. Regional Educational Laboratory (REL) Southeast created this rubric for evaluating reading/language arts…

  14. Lithium-vanadium advanced blanket development. ITER final report on U.S. contribution: Task T219/T220

    Energy Technology Data Exchange (ETDEWEB)

    Smith, D.L.; Mattas, R.F. [comps.

    1997-07-01

    The objective of this task is to develop the required data base and demonstrate the performance of a liquid lithium-vanadium advanced blanket design. The task has two main activities related to vanadium structural material and liquid lithium system developments. The vanadium alloy development activity included four subtasks: (1.1) baseline mechanical properties of non irradiated base metal and weld metal joints; (1.2) compatibility with liquid lithium; (1.3) material irradiation tests; and (1.4) development of material manufacturing and joining methods. The lithium blanket technology activity included four subtasks: (2.1) electrical insulation development and testing for liquid metal systems; (2.2) MHD pressure drop and heat transfer study for self-cooled liquid metal systems; (2.3) chemistry of liquid lithium; and (2.4) design, fabrication and testing of ITER relevant size blanket mockups. A summary of the progress and results obtained during the period 1995 and 1996 in each of the subtask areas is presented in this report.

  15. 75 FR 53533 - Procedures for the Handling of Retaliation Complaints Under Section 219 of the Consumer Product...

    Science.gov (United States)

    2010-08-31

    ...: Occupational Safety and Health Administration, Labor. ACTION: Interim Final rule; request for comments. SUMMARY... Health Administration, U.S. Department of Labor, Room N-3610, 200 Constitution Avenue, NW., Washington... economy, productivity, competition, jobs, the environment, public health or safety, or State, local, or...

  16. Characterization of Nitrogen Uptake Pattern in Malaysian Rice MR219 at Different Growth Stages Using 15N Isotope

    Directory of Open Access Journals (Sweden)

    Mohammad Mu’az Hashim

    2015-09-01

    Full Text Available Nitrogen (N use efficiency is usually less than 50%, and it remains a major problem in rice cultivation. Controlled release fertilizer (CRF technology is one of the well-known efforts to overcome this problem. The efficiency of CRF, however, is very much dependent on the timing of nutrient release. This study was conducted to determine the precise time of N uptake by rice as a guideline to develop efficient CRF. Fertilizer N uptake by rice at different growth stages was investigated by using 15N isotopic technique. Rice was planted in pots, with 15N urea as N source at the rate of 120 kg/hm2. Potassium and phosphorus were applied at the same rate of 50 kg/hm2. Standard agronomic practices were employed throughout the growing periods. Rice plants were harvested every two weeks until maturation at the 14th week and analyzed for total N and 15N content. Nitrogen derived from fertilizer was calculated. Total N uptake in plants consistently increased until the 11th week. After that, it started to plateau and finally declined. Moreover, N utilization by rice plants peaked at 50%, which occurred during the 11th week after transplanting. N derived from fertilizer in rice plants were in the range of 18.7% to 40.0% in all plant tissues. The remaining N was derived from soil. Based on this study, N release from CRF should complete by the 11th week after planting to ensure the maximum fertilizer N uptake by rice plants. Efficient CRF should contribute to higher N derived from fertilizer which also resultedin a higher total N uptake by rice plants, increasing the potential of rice to produce higher yield while at the same time of reducing loss.

  17. 50 CFR 226.219 - Critical habitat for the Southern Distinct Population Segment of North American Green Sturgeon...

    Science.gov (United States)

    2010-10-01

    ... of Werner Cut and Rock Slough at 37°58′14″ N./121°35′41″ W.); Italian Slough (all reaches upstream from 37°51′39″ N./121°34′53″ W.); Rock Slough (all reaches upstream from the junction with the Old...″ N./122°4′18″ W.); Arroyo Corte Madera del Presidio (37°53′43″ N./122°31′48″ W.); Black John Slough...

  18. 77 FR 40494 - Procedures for the Handling of Retaliation Complaints Under Section 219 of the Consumer Product...

    Science.gov (United States)

    2012-07-10

    ... under Section 105(c) of the Federal Mine Safety and Health Act of 1977, which protects miners from... employer had eliminated the employee's position); Michaud v. BSP Transport, Inc., ARB Nos. 97-113, 1997 WL...

  19. 32 CFR 219.103 - Assuring compliance with this policy-research conducted or supported by any Federal Department or...

    Science.gov (United States)

    2010-07-01

    ... accept the existence of a current assurance, appropriate for the research in question, on file with the..., declaration, or statement of ethical principles, or a statement formulated by the institution itself. This... institutional officials, and the department or agency head of (i) any unanticipated problems involving risks to...

  20. Derivation of Soil Screening Guidelines for Gross Alpha/Beta Radioactivity for United States Air Force Deployment Sites

    Science.gov (United States)

    2007-04-19

    the emission of 7 alpha particles and 4 beta particles. Three radionuclides ( francium -223, astatine-215, and polonium-211) are not listed below...no no Uranium-233 159,200 y alpha yes no Thorium-229 7,300 y alpha yes no Radium-225 14.9 d beta no no Actinium-225 10.0 d alpha no no Francium

  1. δ37Cl : the geochemistry of chlorine isotopes

    NARCIS (Netherlands)

    Eggenkamp, H.G.M.

    1994-01-01

    In this thesis the geochemistry of the stable isotopes of chlorine will be examined. Chlorine is one of the halogens, the seventh group in the periodic system of elements. This group consists of five elements, fluorine, chlorine, bromine, iodine, and astatine.

  2. δ³⁷Cl : the geochemistry of chlorine isotopes

    NARCIS (Netherlands)

    Eggenkamp, H.G.M.

    1994-01-01

    In this thesis the geochemistry of the stable isotopes of chlorine will be examined. Chlorine is one of the halogens, the seventh group in the periodic system of elements. This group consists of five elements, fluorine, chlorine, bromine, iodine, and astatine. This thesis presents the first chlorine

  3. SPECT assay of radiolabeled monoclonal antibodies. Final performance report, March 1992--November 1995

    Energy Technology Data Exchange (ETDEWEB)

    Jaszczak, R.J.

    1995-12-01

    Research is described in the following areas: development and evaluation quantitatively of reconstruction algorithms with improved compensations for attenuation, scatter, and geometric collimator response; evaluation of single photon emission computed tomography (SPECT) quantification of iodine 123 and astatine 211; and the development and evaluation of SPECT pinhole imaging for low and medium energy photons.

  4. Pathology of 219 human cadaver eyes with 1-piece or 3-piece hydrophobic acrylic intraocular lenses: capsular bag opacification and sites of square-edged barrier breach.

    Science.gov (United States)

    Ness, Peter J; Werner, Liliana; Maddula, Surekha; Davis, Don; Zaugg, Brian; Stringham, Jack; Burrow, Michael; Yeh, Oliver

    2011-05-01

    To assess capsular bag opacification and sites of initial posterior capsule opacification (PCO) in human cadaver eyes with square-edged 1-piece or 3-piece hydrophobic acrylic intraocular lenses (IOLs). John A. Moran Eye Center, University of Utah, Salt Lake City, Utah, USA. Experimental study. Eyes were immersed in 10% formalin after enucleation and had anterior segment scanning with very-high-frequency ultrasound (Artemis). After the eyes were sectioned at the equator, gross examination of the anterior segment was performed from the posterior aspect to assess capsular bag opacification, anterior capsule coverage of the IOL edge, and IOL fixation. Selected eyes had histopathologic examination. One hundred nineteen eyes with 1-piece IOLs and 100 with 3-piece IOLs were included in the analyses of capsular bag opacification. There was no difference in central (P=.29) or peripheral (P=.76) PCO. In 63 of 84 eyes with a 1-piece IOL and peripheral PCO, the optic-haptic junction was the site of initiation. In eyes with a 3-piece IOL, initial peripheral PCO was observed at nearly the same rate whether there was full 360-degree anterior capsulorhexis overlap of the optic or no overlap (P=.13). In the latter, the site of PCO initiation was in areas lacking capsulorhexis coverage in 46% of eyes. There was no difference in central or peripheral PCO between 1-piece and 3-piece hydrophobic acrylic IOLs. With 1-piece IOLs, PCO tended to start at the optic-haptic junctions. With 3-piece IOLs, full anterior capsule coverage did not produce a statistically significant benefit with respect to PCO prevention. Copyright © 2011 ASCRS and ESCRS. Published by Elsevier Inc. All rights reserved.

  5. Improving Lowland Rice (O. sativa L. cv. MR219) Plant Growth Variables, Nutrients Uptake, and Nutrients Recovery Using Crude Humic Substances

    Science.gov (United States)

    Palanivell, Perumal; Ahmed, Osumanu Haruna; Ab Majid, Nik Muhamad; Jalloh, Mohamadu Boyie; Susilawati, Kasim

    2015-01-01

    High cation exchange capacity and organic matter content of crude humic substances from compost could be exploited to reduce ammonia loss from urea and to as well improve rice growth and soil chemical properties for efficient nutrients utilization in lowland rice cultivation. Close-dynamic air flow system was used to determine the effects of crude humic substances on ammonia volatilization. A pot experiment was conducted to determine the effects of crude humic substances on rice plant growth, nutrients uptake, nutrients recovery, and soil chemical properties using an acid soil mixed with three rates of crude humic substances (20, 40, and 60 g pot−1). Standard procedures were used to evaluate rice plant dry matter production, nutrients uptake, nutrients recovery, and soil chemical properties. Application of crude humic substances increased ammonia volatilization. However, the lowest rate of crude humic substances (20 g pot−1) significantly improved total dry matter, nutrients uptake, nutrients recovery, and soil nutrients availability compared with crude humic substances (40 and 60 g pot−1) and the normal fertilization. Apart from improving growth of rice plants, crude humic substances can be used to ameliorate acid soils in rice cultivation. The findings of this study are being validated in our ongoing field trials. PMID:25977938

  6. Proceedings of US/Japan workshop, Q219 on high heat flux components and plasma surface interactions for next fusion devices

    Energy Technology Data Exchange (ETDEWEB)

    Ulrickson, M.A.; Stevens, P.L.; Hino, T.; Hirohata, Y. [eds.

    1996-12-01

    This report contains the viewgraphs from the proceedings of US/Japan Workshop on High Heat Flux Components and Plasma Surface Interactions for Next Fusion Devices. Some of the general topics covered by this report are: PFC/PSI in tokamak and helical devices; development of high heat flux components; PSIS and plasma facing materials;tritium; and material damage.

  7. Improving Lowland Rice (O. sativaL. cv. MR219) Plant Growth Variables, Nutrients Uptake, and Nutrients Recovery Using Crude Humic Substances

    National Research Council Canada - National Science Library

    Palanivell, Perumal; Ahmed, Osumanu Haruna; Ab Majid, Nik Muhamad; Jalloh, Mohamadu Boyie; Susilawati, Kasim

    2015-01-01

    .... A pot experiment was conducted to determine the effects of crude humic substances on rice plant growth, nutrients uptake, nutrients recovery, and soil chemical properties using an acid soil mixed...

  8. 48 CFR 3052.219-72 - Evaluation of prime contractor participation in the DHS mentor-protégé program.

    Science.gov (United States)

    2010-10-01

    ... source selection factor or subfactor, the offeror shall provide a signed letter of mentor-protégé agreement approval from the DHS Office of Small Business and Disadvantaged Business Utilization (OSDBU...

  9. Third quarterly report and final report within the counterpart subcontract no. 97/219: Support to the National Cleaner Production Centre, Tanzania

    DEFF Research Database (Denmark)

    Jørgensen, Michael Søgaard

    1999-01-01

    The report analyses barriers and incentivres to cleaner production in Tanznaia based on experiences in three demonstration projects with around 25 companies.An outline for a policy study on cleaner production in Tanzania and for the strengthening of cleaner production in Tanzania is given....

  10. Revista MEDICINA - Vol. 30 No. 4 (83 - Diciembre 2008 219 Editorial Atención Primaria en Salud (APS. Una estrategia para mejorar la cobertura y la calidad.

    Directory of Open Access Journals (Sweden)

    Gustavo Malagón Londoño

    2008-12-01

    Full Text Available

    Con razón ha tomado fuerza la estrategia de atención primaria, ante las dificultades que han surgido para el cumplimiento de los enunciados originales de los sistemas de seguridad social en salud, no solamente de Colombia, sino de la mayoría de los países incluyendo los más desarrollados. Los propósitos de equidad, cobertura universal y calidad no han logrado alcanzar las metas propuestas
    por dificultades en el desarrollo del proceso en parte por las malas interpretaciones de los enunciados
    iniciales de la Ley, o por una reglamentación inconsistente y debilidad en el seguimiento y vigilancia estricta por parte de los organismos del Estado.
     
    A partir de la década del 50 del pasado siglo, terminado el conflicto bélico mundial, se aprecia como característica de todos los países un aumento notable de los índices de pobreza, aumento de la
    morbilidad, a tiempo que disminuyen los niveles de atención de la salud. A pesar del concepto prevalente de que transcurridas las grandes hecatombes surgen las mejores soluciones para borrar experiencias anteriores y marcar una notable reacción a lo vivido recientemente, aspectos como el de la atención de la
    salud han ofrecido una lenta evolución y la añorada obertura total ha encontrado todo tipo de tropiezos.
    Esto, desde luego, ha significado un espectacular freno al desarrollo económico. 

  11. 77 FR 62316 - Holiday CVS, L.L.C., d/b/a CVS/Pharmacy Nos. 219 and 5195; Decision and Order

    Science.gov (United States)

    2012-10-12

    ... two physicians, Dr. Anthony Wicks and Dr. Ronald Lynch, who no longer held their DEA registrations and... ``30 milligram tablets are scored right down the middle, and it's quite easy to break them in half...

  12. P2-19: The Effect of item Repetition on Item-Context Association Depends on the Prior Exposure of Items

    Directory of Open Access Journals (Sweden)

    Hongmi Lee

    2012-10-01

    Full Text Available Previous studies have reported conflicting findings on whether item repetition has beneficial or detrimental effects on source memory. To reconcile such contradictions, we investigated whether the degree of pre-exposure of items can be a potential modulating factor. The experimental procedures spanned two consecutive days. On Day 1, participants were exposed to a set of unfamiliar faces. On Day 2, the same faces presented on the previous day were used again in half of the participants, whereas novel faces were used for the other half. Day 2 procedures consisted of three successive phases: item repetition, source association, and source memory test. In the item repetition phase, half of the face stimuli were repeatedly presented while participants were making male/female judgments. During the source association phase, both the repeated and the unrepeated faces appeared in one of the four locations on the screen. Finally, participants were tested on the location in which a given face was presented during the previous phase and reported the confidence of their memory. Source memory accuracy was measured as the percentage of correct non-guess trials. As results, we found a significant interaction between prior exposure and repetition. Repetition impaired source memory when the items had been pre-exposed on Day 1, while it led to greater accuracy in novel ones. These results show that pre-experimental exposure can modulate the effects of repetition on associative binding between an item and its contextual information, suggesting that pre-existing representation and novelty signal interact to form new episodic memory.

  13. Reliability and measurement error of frontal and horizontal 3D spinal motion parameters in 219 patients with chronic low back pain

    DEFF Research Database (Denmark)

    Harsted, Steen; Mieritz, Rune M; Bronfort, Gert

    2016-01-01

    mechanical LBP, classified as either Quebec Task Force group 1, 2, 3 or 4 were included, and kinematics of the lumbar spine were sampled during standardized spinal lateral flexion and rotation motion using a 6-df instrumented spatial linkage system. Test-retest reliability and measurement error were...

  14. Height of US-born non-Hispanic children and adolescents ages 2-19, born 1942-2002 in the NHANES samples.

    Science.gov (United States)

    Komlos, John; Breitfelder, Ariane

    2008-01-01

    We examine the height of non-Hispanic US-born children born 1942-2002 on the basis of all NHES and NHANES data sets available. We use the CDC 2000 reference values to convert height into height-for-age z-scores stratified by gender. We decompose deviations from the reference values into an age-effect and a secular trend effect and find that after an initial increase in the 1940s, heights experienced a downward cycle to reach their early 1950s peak again only c. 2 decades later. After the early 1970s, heights increased almost continuously until the present. Girls born in 2002 are estimated to be 0.35sigma and boys are 0.39sigma above their 1971 values implying an increase of approximately 2.5 cm between birth cohorts 1971 and 2002 as an average of all ages (Table 3). Age effects are also substantial-pointing to faster tempo of growth. Girls are c. 0.23sigma taller at age 11 and boys 0.15sigma taller at age 13 than reference values (Fig. 3). This translates into an age effect of approximately 1.7 and 1.3 cm, respectively. Hence, the combined estimated trend and age-effects are substantially larger than those reported hitherto. The 2-decade stagnation in heights and the upward trend beginning in the early 1970s confirm the upswing in adult heights born c. 1975-1983, and imply that adults are likely to continue to increase in height. We find the expected positive correlation between height and family income, but income does not affect the secular trend or the age effects markedly. (c) 2007 Wiley-Liss, Inc.

  15. Reliability and measurement error of frontal and horizontal 3D spinal motion parameters in 219 patients with chronic low back pain

    DEFF Research Database (Denmark)

    Harsted, Steen; Mieritz, Rune M; Bronfort, Gert

    2016-01-01

    BACKGROUND: In order for measurements to be clinically useful, data on psychometric conditions such as reliability should be available in the population for which the measurements are intended to be used. This study comprises a test-retest design separated by 7 to 14 days, and evaluates the intra...

  16. One of the closest exoplanet pairs to the 3.2 mean motion resonance: K2-19b and c

    National Research Council Canada - National Science Library

    Armstrong, David J; Santerne, Alexandre; Veras, Dimitri; Barros, Susana C. C; Demangeon, Olivier; Lillo-Box, Jorge; McCormac, James; Osborn, Hugh P; Tsantaki, Maria; Almenara, Jose-Manuel; Barrado, David; Boisse, Isabelle; Bonomo, Aldo S; Brown, David J. A; Bruno, Giovanni; Cerda, Javiera Rey; Courcol, Bastien; Deleuil, Magali; Diaz, Rodrigo F; Doyle, Amanda P; Hebrard, Guillaume; Kirk, James; Lam, Kristine W. F; Pollacco, Don L; Rajpurohit, Arvind; Spake, Jessica; Walker, Simon R

    2015-01-01

    ...), orbiting a K dwarf extremely close to the 3: 2 mean motion resonance. The two planets each show transits, sometimes simultaneously owing to their proximity to resonance and the alignment of conjunctions. Results...

  17. Effects of Multisystemic Therapy through Midlife: A 21.9-Year Follow-Up to a Randomized Clinical Trial with Serious and Violent Juvenile Offenders

    Science.gov (United States)

    Sawyer, Aaron M.; Borduin, Charles M.

    2011-01-01

    Objective: Although current evidence suggests that the positive effects of multisystemic therapy (MST) on serious crime reach as far as young adulthood, the longer term impact of MST on criminal and noncriminal outcomes in midlife has not been evaluated. In the present study, the authors examined a broad range of criminal and civil court outcomes…

  18. 75 FR 32773 - Auction of 218-219 MHz Service and Phase II 220 MHz Service Licenses Scheduled for December 7...

    Science.gov (United States)

    2010-06-09

    ... licenses covering a total of 727 Cellular Market Areas (CMAs). ii. Phase II 220 MHz Service Licenses 4... three percent will be more effective in deterring defaults. Given the history of these services and the...

  19. $\\beta$-delayed fission, laser spectroscopy and shape-coexistence studies with radioactive At beams

    CERN Multimedia

    We propose to study the $\\beta$-delayed fission, laser spectroscopy and radioactive decay of the newly available pure beams of neutron-deficient and neutron-rich astatine (Z=85) isotopes. The fission probability and the fission fragment distribution of the even-even isotopes $^{194,196}$Po following the $\\beta$-decay of the isotopes $^{194,196}$At will be studied with the Windmill setup. In-source laser spectroscopy will be performed on the entire astatine isotopic chain, using a combination of the Windmill setup, ISOLTRAP MR-ToF and ISOLDE Faraday. Radioactive decay data will be acquired at the Windmill setup throughout those studies and contribute to the global understanding of the phenomenon of shape coexistence in the neutron-deficient lead region.

  20. Production cross section of At radionuclides from $^{7}$Li+$^{\\textrm{nat}}$Pb and $^{9}$Be+$^{\\textrm{nat}}$Tl reactions

    CERN Document Server

    Maiti, Moumita

    2011-01-01

    Earlier we reported theoretical studies on the probable production of astatine radionuclides from $^{6,7}$Li and $^{9}$Be-induced reactions on natural lead and thalliun targets, respectively. For the first time, in this report, production of astatine radionuclides has been investigated experimentally with two heavy ion induced reactions: $^{9}$Be+$^{\\textrm{nat}}$Tl and $^{7}$Li+$^{\\textrm{nat}}$Pb. Formation cross sections of the evaporation residues, $^{207,208,209,210}$At, produced in (HI, xn) channel, have been measured by the stacked-foil technique followed by the off-line $\\gamma$-spectrometry at the low incident energies ($<$50 MeV). Measured excitation functions have been explained in terms of compound nuclear reaction mechanism using Weisskopf-Ewing and Hauser-Feshbach model. Absolute cross section values are lower than the respective theoretical predictions.

  1. Production cross section of At radionuclides from 7Li+natPb and 9Be+natTl reactions

    Science.gov (United States)

    Maiti, Moumita; Lahiri, Susanta

    2011-12-01

    Earlier we reported theoretical studies on the probable production of astatine radionuclides from 6,7Li- and 9Be-induced reactions on natural lead and thallium targets, respectively. The production of astatine radionuclides were investigated experimentally with two heavy-ion-induced reactions: 9Be + natTl and 7Li + natPb. Formation cross sections of the evaporation residues, 207,208,209,210At, produced in the (HI,xn) channel, were measured by the stacked-foil technique followed by off-line γ spectrometry at low incident energies (<50 MeV). Measured excitation functions were interpreted in terms of a compound nuclear reaction mechanism using Weisskopf-Ewing and Hauser-Feshbach models. Measured cross-section values are lower than the respective theoretical predictions.

  2. Radiohalogenation of biomolecules. An experimental study on radiohalogen preparation, precursor synthesis, radiolabeling and biodistribution

    Energy Technology Data Exchange (ETDEWEB)

    Koziorowski, J

    1998-10-01

    Radiohalogens are widely used in nuclear medicine, both as tool for diagnostic in vivo imaging, and in radionuclide therapy. This study deals with the use of radiohalogens; separation, precursor synthesis, labeling and biological behavior. The focus is on {sup 211}At and {sup 124}I, the former being a candidate for nuclide therapy and the latter potentially useful for diagnostic imaging and Auger-electron based radiotherapy. For astatine the separation, labeling and some biological behavior is described, and for iodine the latter two. Astatine was separated from an irradiated bismuth target by dry distillation. A novel cryotrap was developed for the isolation of astatine and subsequent synthesis of radiolabeled compounds. 5-[{sup 211}At]astato-2`-deoxyuridine (AUdR) and N-succinimidyl-4-[{sup 211}At]astatobenzoate (SAB) were synthesized in 95% respectively 90% radiochemical yields. The former is incorporated into DNA of proliferating cells and can therefore be used as an endoradiotherapeutic agent. The latter is a conjugate for the astatination of proteins. Human epidermal growth factor (hEGF) was tagged with astatine using three approaches: a) direct labeling of native hEGF, b) conjugation with SAB, and c) direct labeling of an hEGF - 7-(3-aminopropyl)-7,8-dicarba-nido-undecaborate(1-) conjugate. The overall labeling yields were 3.5% for direct labeling, 44% for SAB and 70% for the hEGF-nido-carborane conjugate. A new route to N-succinimidyl 3- and 4- [{sup 124}I]iodobenzoate, two reagents for radioiodination of proteins is described affording 90% radiochemical yield. Three radioiodinated analogs of PK11195, 1-(2-chlorophenyl)-N-methyl-N-(1-methylpropyl)isoquinoline-3-carboxyam ide, a peripheral-type benzodiazepine receptor antagonist, were synthesized. All three analogs were obtained in >90% radiochemical yield. Synthesis and application of 5-[{sup 124}I]iodo-2`-deoxyuridine (IUdR) is presented. The closo-dodecaborate anion was evaluated as prosthetic group for

  3. Thermosalinograph data of the Hawaii Ocean Time-series (HOT) program in the North Pacific 100 Miles North of Oahu, Hawaii for Cruises HOT219-227 during 2010 (NCEI Accession 0087988)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The HOT program makes repeated observations of the physics, biology and chemistry at a site approximately 100 km north of Oahu, Hawaii. Two stations are visited...

  4. Application of solar energy to the supply of industrial process hot water: preliminary design and performance report. Volume I. Technical report. Aerotherm report TR-76-219. [For can washing at Campbell Soup Plant in Sacramento

    Energy Technology Data Exchange (ETDEWEB)

    None

    1976-10-14

    The design and performance of a solar hot water system for can washing at the Campbell Soup Plant in Sacramento, California, are presented. The collector field is located on the roof of the finished products warehouse of the Campbell Soup Sacramento plant. Water is supplied from a 3.8 cm (1/sup 1///sub 2/ in.) supply line which is located directly below an existing roof access hatch. A supply pipe will be brought up through that hatch. The water flow will then be split into two manifold lines which supply the dual rows of flat plate collectors. The preheated water from the flat plates is then passed into six sets of parallel connected concentrators. Each set consist of eight 1.83 x 3.05 m (6 x 10 foot) modules connected in series. The water from these units is gathered in a 3.8 cm (1/sup 1///sub 2/ in.) insulated pipe which transports it to the storage tank. This pipe will be attached to an existing pipe run until it reaches the can washing building. From there the pipe will follow the can washing building around to the storage tank. The storage tank is a 75,200 1 (20,000 gal) steel tank which is coated internally with a USDA approved phenolic liner. The outside of the tank is insulated. A 2.2 kw (3 hp) motor is used to pump the stored water for the tank into the can washing line. Detail drawings and descriptions of the collector field, installation, piping, controls, data acquisition equipment, and roof structure are included. Furthermore, a program schedule with equipment and manpower costs for successfully completing Phase II of this contract is included. Also included is an organization chart of the Phase II program personnel. (WHK)

  5. Potential for Cell-Transplant Therapy with Human Neuronal Precursors to Treat Neuropathic Pain in Models of PNS and CNS Injury: Comparison of hNT2.17 and hNT2.19 Cell Lines

    Science.gov (United States)

    2012-01-01

    technology [207]. Any consortium would evaluate how these novel ethical issues in emerging technologies are ad- dressed under current oversight and...animal care, and euthanasia were performed in accordance with the Laboratory Animal Welfare Act, Guide for the Care and Use of Laboratory Animals (National...rat chow and water ad lib on a 12/12 hr light/dark cycle. All surgical interventions, pre- and postsurgical animal care, and euthanasia were performed

  6. Comment on ;Evolution of high-pressure mafic granulites and pelitic gneisses from NE Madagascar: Tectonic implications;. Tectonophysics, 662, 219-242 (2015) by Ishwar-Kumar et al.

    Science.gov (United States)

    Goncalves, Philippe; Brandt, Sönke; Nicollet, Christian; Tucker, Robert

    2017-05-01

    Determining the possible tectonic regimes active during the Neoproterozoic is crucial for the knowledge of the evolution of the super-continent Gondwana. In Madagascar, that occupies a key position in Gondwana, there is an on-going debate regarding the location of possible suture zones and the implications in terms of paleo-geography. Recognizing high-pressure to ultra-high pressure conditions in mafic rocks is commonly viewed as a strong argument for paleo-subduction zones. Ishwar-Kumar et al. (2015) report unusual high pressure conditions (24 kbar) in Neoproterozoic to Cambrian rocks from North-Central Madagascar (Andriamena Complex). They propose a geodynamic model in which exhumation of the high pressure terranes from up to 80 km to 40 km occurred via vertical extrusion during the collision of various crustal blocks after subduction and closure of an oceanic domain during the formation of Gondwana in the late Neoproterozoic to Cambrian. We question this model and in particular the (ultra-)high pressure conditions reported, because their estimation is based on a misinterpretation of the petrography and inaccurate thermodynamic modeling for the crucial metabasite sample. The authors suggest that garnet-quartz coronas around orthopyroxene and ilmenite coexist with clinopyroxene. The postulated garnet-clinopyroxene-quartz assemblage is interpreted to document an eclogite facies overprint. However, the presence of abundant plagioclase in the sample and the lack of high jadeite content in clinopyroxene clearly refute the postulated eclogite facies conditions. According to the presented photographs clinopyroxene is part of the rock matrix. We therefore suggest that the sample represents a common two-pyroxene granulite, formed at mid- to low-pressure granulite facies conditions of > 700 °C and Madagascar, this interpretation is not justified by the data presented by Ishwar-Kumar et al. (2015).

  7. Petrographic atlas characterisation of aggregates regarding potential reactivity to alkalis : RILEM TC 219-ACS recommended guidance AAR-1.2, for use with the RILEM AAR-1.1 petrographic examination method

    CERN Document Server

    Ribeiro, Maria; Broekmans, Maarten; Sims, Ian

    2016-01-01

    This RILEM AAR 1.2 Atlas is complementary to the petrographic method described in RILEM AAR 1.1. It is designed and intended to assist in the identification of alkali-reactive rock types in concrete aggregate by thin-section petrography. Additional issues include: • optical thin-section petrography conforming to RILEM AAR 1.1 is considered the prime assessment method for aggregate materials, being effective regarding cost and time. Unequivocal identification of minerals in very-fine grained rock types may however require use of supplementary methods. • the atlas adheres to internationally adopted schemes for rock classification and nomenclature, as recommended in AAR 1.1. Thus, rock types are classified as igneous, sedimentary or metamorphic based upon mineral content, microstructure and texture/fabric. • in addition, the atlas identifies known alkali-reactive silica types in each rock type presented. It also identifies consistent coincidence between certain lithologies and silica types; however, it ref...

  8. RILEM recommendations for the prevention of damage by alkali-aggregate reactions in new concrete structures state-of-the-art report of the RILEM technical committee 219-ACS

    CERN Document Server

    Sims, Ian

    2016-01-01

    This book contains the full set of RILEM Recommendations which have been produced to enable engineers, specifiers and testing houses to design and produce concrete which will not suffer damage arising from alkali reactions in the concrete. There are five recommended test methods for aggregates (designated AAR-1 to AAR-5), and an overall recommendation which describes how these should be used to enable a comprehensive aggregate assessment (AAR-0). Additionally, there are two Recommended International Specifications for concrete (AAR-7.1 & 7.2) and a Preliminary International Specification for dams and other hydro structures (AAR-7.3), which describe how the aggregate assessment can be combined with other measures in the design of the concrete to produce a concrete with a minimised risk of developing damage from alkali-aggregate reactions.

  9. Alpha particle induced DNA damage and repair in normal cultured thyrocytes of different proliferation status

    DEFF Research Database (Denmark)

    Lyckesvärd, Madeleine Nordén; Delle, Ulla; Kahu, Helena

    2014-01-01

    Childhood exposure to ionizing radiation increases the risk of developing thyroid cancer later in life and this is suggested to be due to higher proliferation of the young thyroid. The interest of using high-LET alpha particles from Astatine-211 ((211)At), concentrated in the thyroid by the same...... mechanism as (131)I [1], in cancer treatment has increased during recent years because of its high efficiency in inducing biological damage and beneficial dose distribution when compared to low-LET radiation. Most knowledge of the DNA damage response in thyroid is from studies using low-LET irradiation...

  10. Gclust Server: 95063 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 95063 CEL_D1022.7_71984671 Cluster Sequences Related Sequences(219) 1284 aka-1: A Kinase Anchor...d Sequences(219) Sequence length 1284 Representative annotation aka-1: A Kinase Anchor

  11. Grids of Agricultural Pesticide Use in the Conterminous United States, 1997

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — This spatial dataset consists of 219 1-kilometer (km) resolution grids depicting estimated agricultural use of 219 pesticides in 1997 for the conterminous United...

  12. 48 CFR 1819.7302 - NASA contract clauses.

    Science.gov (United States)

    2010-10-01

    ... to Public Law 97-219 (the Small Business Innovation Development Act of 1982). (b) Contracting... pursuant to Public Law 97-219 (the Small Business Innovation Development Act of 1982). (c) Contracting... Law 97-219 (the Small Business Innovation Development Act of 1982). (d) Contracting officers shall...

  13. EFFECT OF MECHANICAL PROPERTIES OF MARTENSITE AND LOADING RATE ON DUAL PHASE STEELS

    Directory of Open Access Journals (Sweden)

    Ali BAYRAM

    1998-03-01

    Full Text Available In this study, steel sheet materials were used in order to obtain dual-phase steel. Specimens for this purpose have been annealed in ferrite + astatine regions at the temperatures of 740, 760, 800 and 820 °C. The specimens were annealed at the different temperatures with corresponding times 20, 40 and 60 minutes and quenched into water. As a result of this dual-phase steels at different ferrite + martensite ratio were produced. Sheet specimens were tested at the range of loading rates of 10, 50 and 259 mm/min. Strength properties of dual-phase steels were investigated depending on annealing temperature, ratio of martensite and loading rate.

  14. New developments of the in-source spectroscopy method at RILIS/ISOLDE

    CERN Document Server

    Marsh, B A; Imai, N; Seliverstov, M D; Rothe, S; Sels, S; Capponi, L; Rossel, R E; Franchoo, S; Wendt, K; Focker, G J; Kalaninova, Z; Sjoedin, A M; Popescu, L; Nicol, T; Huyse, M; Radulov, D; Atanasov, D; Kesteloot, N; Borgmann, Ch; Cocolios, T E; Lecesne, N; Ghys, L; Pauwels, D; Rapisarda, E; Kreim, S; Liberati, V; Wolf, R N; Andel, B; Schweikhard, L; Lane, J; Derkx, X; Kudryavtsev, Yu; Zemlyanoy, S G; Fedosseev, V N; Lynch, K M; Rosenbusch, M; Van Duppen, P; Lunney, D; Manea, V; Barzakh, A E; Andreyev, A N; Truesdale, V; Flanagan, K T; Molkanov, P L; Koester, U; Van Beveren, C; Wienholtz, F; Goodacre, T Day; Antalic, S; Bastin, B; De Witte, H; Fink, D A; Fedorov, D V

    2013-01-01

    At the CERN ISOLDE facility, long isotope chains of many elements are produced by proton-induced reactions in target materials such as uranium carbide. The Resonance Ionization Laser Ion Source (RILIS) is an efficient and selective means of ionizing the reaction products to produce an ion beam of a chosen isotope. Coupling the RILIS with modern ion detection techniques enables highly sensitive studies of nuclear properties (spins, electromagnetic moments and charge radii) along an isotope chain, provided that the isotope shifts and hyperfine structure splitting of the atomic transitions can be resolved. At ISOLDE the campaign to measure the systematics of isotopes in the lead region (Pb, Bi, Tl and Po) has been extended to include the gold and astatine isotope chains. Several developments were specifically required for the feasibility of the most recent measurements: new ionization schemes (Po, At); a remote controlled narrow line-width mode of operation for the RILIS Ti:sapphire laser (At, Au, Po); isobar fr...

  15. Nuclear and in-source laser spectroscopy with the ISAC yield station

    Energy Technology Data Exchange (ETDEWEB)

    Kunz, Peter, E-mail: pkunz@triumf.ca; Bricault, Pierre; Dombsky, Marik; Lassen, Jens; Teigelhöfer, Andrea; Heggen, Henning [TRIUMF, 4004 Wesbrook Mall, Vancouver, British Columbia V6T 2A3 (Canada); Andreoiu, Corina; Wong, Fiona [Department of Chemistry, Simon Fraser University, Burnaby, British Columbia V5A 1S6 (Canada)

    2014-05-15

    A new decay station has been built for the ISAC facility at TRIUMF for the rapid and reliable characterization of radioactive ion beam (RIB) compositions and intensities with the capability of simultaneously collecting α, β, and γ decay data from RIB with intensities between a few and ≈10{sup 11} ions per second. It features user-friendly control, data acquisition, and analysis software. The analysis of individual decay time structures allows the unambiguous assignment of α and γ lines even with substantial isobaric contamination present. The capability for accurate half-life measurements is demonstrated with the example of {sup 46}K. The coupling of the yield station to the laser ion source, TRILIS, allows the correlation of radiometric data with automated laser frequency scans. First results of in-source laser spectroscopy measurements on astatine are discussed.

  16. Nuclear and in-source laser spectroscopy with the ISAC yield station.

    Science.gov (United States)

    Kunz, Peter; Andreoiu, Corina; Bricault, Pierre; Dombsky, Marik; Lassen, Jens; Teigelhöfer, Andrea; Heggen, Henning; Wong, Fiona

    2014-05-01

    A new decay station has been built for the ISAC facility at TRIUMF for the rapid and reliable characterization of radioactive ion beam (RIB) compositions and intensities with the capability of simultaneously collecting α, β, and γ decay data from RIB with intensities between a few and ≈10(11) ions per second. It features user-friendly control, data acquisition, and analysis software. The analysis of individual decay time structures allows the unambiguous assignment of α and γ lines even with substantial isobaric contamination present. The capability for accurate half-life measurements is demonstrated with the example of (46)K. The coupling of the yield station to the laser ion source, TRILIS, allows the correlation of radiometric data with automated laser frequency scans. First results of in-source laser spectroscopy measurements on astatine are discussed.

  17. Dietary exposure to benzoates (E210-E213), parabens (E214-E219), nitrites (E249-E250), nitrates (E251-E252), BHA (E320), BHT (E321) and aspartame (E951) in children less than 3 years old in France.

    Science.gov (United States)

    Mancini, F R; Paul, D; Gauvreau, J; Volatier, J L; Vin, K; Hulin, M

    2015-01-01

    This study aimed to estimate the exposure to seven additives (benzoates, parabens, nitrites, nitrates, BHA, BHT and aspartame) in children aged less than 3 years old in France. A conservative approach, combining individual consumption data with maximum permitted levels, was carried out for all the additives. More refined estimates using occurrence data obtained from products' labels (collected by the French Observatory of Food Quality) were conducted for those additives that exceeded the acceptable daily intake (ADI). Information on additives' occurrence was obtained from the food labels. When the ADI was still exceeded, the exposure estimate was further refined using measured concentration data, if available. When using the maximum permitted level (MPL), the ADI was exceeded for benzoates (1.94 mg kg(-1) bw day(-1)), nitrites (0.09 mg kg(-1) bw day(-1)) and BHA (0.39 mg kg(-1) bw day(-1)) in 25%, 54% and 20% of the entire study population respectively. The main food contributors identified with this approach were current foods as these additives are not authorised in specific infant food: vegetable soups and broths for both benzoates and BHA, delicatessen and meat for nitrites. The exposure estimate was significantly reduced when using occurrence data, but in the upper-bound scenario the ADI was still exceeded significantly by the age group 13-36 months for benzoates (2%) and BHA (1%), and by the age group 7-12 months (16%) and 13-36 months (58%) for nitrites. Measured concentration data were available exclusively for nitrites and the results obtained using these data showed that the nitrites' intake was below the ADI for all the population considered in this study. These results suggest that refinement of exposure, based on the assessment of food levels, is needed to estimate the exposure of children to BHA and benzoates for which the risk of exceeding the ADI cannot be excluded when using occurrence data.

  18. Erratum: The article „Morphometric analysis of collagen and inflammatory cells in periodontal disease” [Morfometrijska analiza kolagena i inflamatornih ćelija u periodontalnoj bolesti]. Vojnosanit pregl 2015; 72(3: 219-224. (DOI:10.2298/VSP130627076G

    Directory of Open Access Journals (Sweden)

    Editorial

    2017-01-01

    Full Text Available The authors and their affiliations were listed as follows: Ranko Golijanin*†, Bojan Kujundžić†, Zoran Milosavljević‡, Dragan R. Milovanovi槆†, Zlatibor Andjelković║, Miroslav Obrenović¶, Radivoje Nikolić**†† *Department of Dentistry, ‡Department of Histology and Embriology, §Department of Pharmacology and Toxicology, **Department of Surgery, Faculty of Medical Sciences, University of Kragujevac, Kragujevac, Serbia; †Faculty of Dental Medicine, ¶Faculty of Medicine, University of East Sarajevo, Foča, Republic of Srpska, Bosnia and Herzegovina; ††Clinical Center “Kragujevac”, Kragujevac, Serbia Listed the authors and their affiliations should read as: Ranko Golijanin*†, Bojan Kujundžić†, Zoran Milosavljević‡, Dragan R. Milovanovi槆†, Zlatibor Andjelković║, Miroslav Obrenović¶, Radivoje Nikolić**†† *Department of Dentistry, ‡Department of Histology and Embriology, §Department of Pharmacology and Toxicology, **Department of Surgery, Faculty of Medical Sciences, University of Kragujevac, Kragujevac, Serbia; ║Department of Histology, Faculty of Medicine, University of Priština, Kosovska Mitrovica, Serbia; †Faculty of Dental Medicine, ¶Faculty of Medicine, University of East Sarajevo, Foča, Republic of Srpska, Bosnia and Herzegovina; ††Clinical Center “Kragujevac”, Kragujevac, Serbia Link to the corrected article 10.2298/VSP130627076G

  19. RESEÑA DE: CASTRO, Demetrio (coord.): Líderes para el pueblo republicano: liderazgo político en el republicanismo español del siglo XIX. Pamplona, UPNA, 2015, 219 pp. ISBN: 978-8-9769-296-0.

    OpenAIRE

    Magda Berges Giral

    2016-01-01

    La obra que nos ocupa difunde un proyecto de investigación iniciado en el 2008 bajo el título «Estilos de liderazgo político. Un estudio de caso: el republicanismo español en la segunda mitad del siglo XIX» dirigido por Demetrio Castro. El resultado ha sido una obra colectiva entre seis autores, la mayoría especializados en historia del pensamiento político contemporáneo. Seis investigaciones donde el tema central es el proceso de liderazgo. Se trata, por tanto, de una incursión en el concept...

  20. RESEÑA DE: CASTRO, Demetrio (coord.: Líderes para el pueblo republicano: liderazgo político en el republicanismo español del siglo XIX. Pamplona, UPNA, 2015, 219 pp. ISBN: 978-8-9769-296-0.

    Directory of Open Access Journals (Sweden)

    Magda Berges Giral

    2016-05-01

    Full Text Available La obra que nos ocupa difunde un proyecto de investigación iniciado en el 2008 bajo el título «Estilos de liderazgo político. Un estudio de caso: el republicanismo español en la segunda mitad del siglo XIX» dirigido por Demetrio Castro. El resultado ha sido una obra colectiva entre seis autores, la mayoría especializados en historia del pensamiento político contemporáneo. Seis investigaciones donde el tema central es el proceso de liderazgo. Se trata, por tanto, de una incursión en el concepto de liderazgo a modo de continuación de lo que fueron los análisis políticos en las ciencias sociales del ámbito anglosajón, aprovechando el auge del género biográfico y desde la perspectiva de la historia política. 

  1. Radiopharmaceutical chemistry of targeted radiotherapeutics, part 4: Strategies for211At labeling at high activities and radiation doses of211At α-particles.

    Science.gov (United States)

    Pozzi, Oscar R; Zalutsky, Michael R

    2017-03-01

    Alpha particles are radiation of high energy and short range, properties that can lead to radiolysis-mediated complications in labeling chemistry at the high radioactivity levels required for clinical application. In previous papers in this series, we have shown that radiation dose has a profound effect on the astatine species that are present in the labeling reaction and their suitability for the synthesis of N-succinimidyl 3-[ 211 At]astatobenzoate. The purpose of this study was to evaluate the effects of adding N-chlorosuccinimide (NCS) to the methanol solution used for initial isolation of 211 At after distillation, a process referred to as 211 At stabilization, on 211 At chemistry after exposure to high radiation doses. High performance liquid chromatography was used to evaluate the distribution of 211 At species present in methanol in the 500-65,000Gy radiation dose range and the synthesis of SAB from N-succinimidyl 3-(tri-n-butylstannyl)benzoate in the 500-120,000Gy radiation dose range using different 211 At timeactivity combinations under conditions with/without 211 At stabilization. In the absence of NCS stabilization, a reduced form of astatine, At(2), increased with increasing radiation dose, accounting for about half the total activity by about 15,000Gy, while with stabilization, At(2) accounted for 60,000Gy. SAB yields without stabilization rapidly declined with increasing dose, falling to ~20% at about 5000Gy while with stabilization, yields >80% were obtained with 211 At solutions stored for more than 23h and receiving radiation doses >100,000Gy. Adding NCS to the methanol solution used for initial isolation of 211 At is a promising strategy for countering the deleterious effects of radiolysis on 211 At chemistry. This strategy could facilitate the ability to perform 211 At labeling at sites remote from its production and at the high activity levels required for clinical applications. Copyright © 2016 Elsevier Inc. All rights reserved.

  2. ORF Alignment: NC_002935 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available erium ... diphtheriae] ... Length = 254 ... Query: 160 LDKDMPTNTFADVAGADEAIDELHEIKDFLEDPTRYEALGAK...IPRGVLLYGPPGTGKTLL 219 ... LDKDMPTNTFADVAGADEAIDELHEIKDFLEDPTRYEALGAKIPRGV...LLYGPPGTGKTLL Sbjct: 1 ... LDKDMPTNTFADVAGADEAIDELHEIKDFLEDPTRYEALGAKIPRGVLLYGPPGTGKTLL 60 ... Query: 280 XXXXXXH

  3. Modélisation pluie-débit en région tropicale humide : application des réseaux de neurones sur quatre stations hydrométriques du Bandama Blanc (Bada, Marabadiassa, Tortiya et Bou situées au Nord de la Côte d'Ivoire. Thèse de l'Université de Cocody (Côte d'Ivoire, 2007, 219 p.

    Directory of Open Access Journals (Sweden)

    Yao Blaise Koffi

    2009-12-01

    Full Text Available La relation pluie-débit fait l'objet de nombreuses études, à cause de son importance dans la mise en œuvre de nombreux projets de développement. La communauté scientifique, dans le souci de faire face aux problèmes d'eau, tels que les inondations et les sècheresses, utilise différents modèles. Mais ces modèles sont généralement confrontés à la non-linéarité de la relation pluie-débit. Dans le cas du Bandama Blanc, objet de cette étude, cette non-linéarité est accentuée par la présence de plusieurs barrages à vocation agro-pastorale situés dans la partie nord de la zone d'étude et qui utilisent les eaux de ce fleuve. Ce mémoire de thèse traite donc de la modélisation des débits mensuels du Bandama Blanc, aux stations de Bada, Marabadiassa, Tortiya et Bou, à l'aide des réseaux de neurones, déjà éprouvés dans ce contexte de relation non-linéaire. Elle projette de fournir des outils plus robustes aux hydrologues africains pour la simulation et la prévision des débits des rivières jaugées. Pour atteindre cet objectif, deux Perceptrons Multicouches entraînés avec l'algorithme de la rétropropagation de l'erreur ont été construits. Le premier modèle a été utilisé seulement en simulation et le second en simulation et en prévision. Le modèle conceptuel GR2M, a été utilisé pour valider les résultats obtenus avec les réseaux de neurones. Pour cette étude, une importante base de données climatiques (pluie et température et hydrométriques (débits mensuels a été utilisée. Les résultats obtenus sont forts satisfaisants et nettement supérieurs à ceux obtenus avec le modèle conceptuel global GR2M. En effet, les réseaux de neurones parviennent à expliquer plus de 70 % de la variation des débits, avec des coefficients de corrélation de Pearson qui excèdent 0,80. Cependant ces modèles arrivent difficilement à simuler et à faire la prévision des débits extrêmes (étiages et crues, à cause probablement du nombre réduit de données à notre disposition et de la séparation des bases de calage et de validation.The rainfall-runoff relationship is the subject of many studies because of its importance in the implementation of many development projects. The scientific community, in order to cope with water problems such as floods and droughts, used different models. But these models are usually faced with the non-linearity of the rainfall-runoff relationship. In the case of the Bandama Blanc purpose of this study, this non-linearity is enhanced by the presence of several agro-pastoral dams located in the northern part of the study area and using the waters of this river. This thesis therefore deals with the modeling of flows of Bandama Blanc hydrometric stations (Bada Marabadiassa, Tortiya and Bou using neural networks already experienced in the context of non-linear relationship. It plans to provide more robust tools to African hydrologist in the simulation and forecasting of river flows. To achieve this goal, two Multilayer Perceptrons trained with the backpropagation algorithm of error have been built. The first model was used only in simulation and the second in simulation and prediction. The conceptual model GR2M was used to validate the results obtained with neural networks. An extensive database climate (rainfall and temperature and river monthly flow was used in this study. The results obtained are very satisfactory and well above those obtained with the overall conceptual model GR2M. Indeed, neural networks are able to explain more than 70% of the variation in rates, with Pearson correlation coefficients exceeding 0.80. However, these models have difficulty to simulate and predict extremes flow probably because of the reduced number of data at our disposal and separation of bases calibration and validation.

  4. How Alzheimer's Changes the Brain

    Medline Plus

    Full Text Available ... 232,361 views 57:30 Imaging Dementia-Mayo Clinic - Duration: 2:19. Mayo Clinic 16,456 views 2:19 Mechanisms and secrets ... Language: English Location: United States Restricted Mode: Off History Help Loading... Loading... Loading... About Press Copyright Creators ...

  5. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    More Details Fulltext PDF. pp 204-218 General Article. Sir Alfred Bray Kempe-An Amateur Kinematician · A K Mallik · More Details Fulltext PDF. pp 218-218 General Article. Errata · More Details Fulltext PDF. pp 219-219 Science Smiles. Science Smiles · Ayan Guha · More Details Fulltext PDF. pp 220-237 General Article.

  6. 75 FR 65439 - Defense Federal Acquisition Regulation Supplement; Electronic Subcontracting Reporting System

    Science.gov (United States)

    2010-10-25

    ... Supplement; Electronic Subcontracting Reporting System AGENCY: Defense Acquisition Regulations System... Electronic Subcontracting Reporting System (eSRS). The FAR has been revised to reflect use of the eSRS... Subcontracting Reporting System. This DFARS interim rule amends sections 219.708 and 252.219 to provide DoD...

  7. EST Table: FS796393 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FS796393 E_FL_ffbm_21B24_F_0 10/09/28 89 %/219 aa ref|NP_001040143.1| perilipin [Bo...mbyx mori] gb|ABD36152.1| perilipin [Bombyx mori] 10/09/09 37 %/219 aa FBpp0083847|Lsd-1-PC 10/08/29 n.h 10/

  8. CPAP Tips

    Medline Plus

    Full Text Available ... 3 Tips for Sleeping With a CPAP - Duration: 2:02. WebMD 42,375 views 2:02 About to spend my first night using ... 534 views 4:39 CPAP Mask Tutorial - Duration: 2:19. somnomedics 35,554 views 2:19 CPAP ...

  9. 48 CFR 4.1202 - Solicitation provision and contract clause.

    Science.gov (United States)

    2010-10-01

    ...: (a) 52.203-2, Certificate of Independent Price Determination. (b) 52.203-11, Certification and... Low Bids. (k) 52.219-19, Small Business Concern Representation for the Small Business Competitiveness... the Small Business Competitiveness Demonstration Program. (m) 52.219-22, Small Disadvantaged Business...

  10. 75 FR 13265 - National Board for Education Sciences

    Science.gov (United States)

    2010-03-19

    .... ADDRESSES: 80 F Street, NW., Room 100, Washington, DC 20208. FOR FURTHER INFORMATION CONTACT: Norma Garza..., DC 20208; phone: (202) 219-2195; fax: (202) 219- 1466; e-mail: Norma[email protected] . Individuals who...:30 p.m. A final agenda will be available from Norma Garza (see contact information above) on March 29...

  11. 75 FR 53280 - National Board for Education Sciences

    Science.gov (United States)

    2010-08-31

    ... CONTACT: Norma Garza, Executive Director, National Board for Education Sciences, 555 New Jersey Ave., NW., Room 602K, Washington, DC 20208; phone: (202) 219-2195; fax: (202) 219-1466; e-mail: Norma[email protected] alternative format) should notify Norma Garza no later than September 20. We will attempt to meet requests for...

  12. Dicty_cDB: Contig-U05025-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available actin mRNA, co... 219 4e-56 FJ372563_1( FJ372563 |pid:none) Sedum alfredii isolate Heact1 acti... 219 4e-56...actin ge... 218 9e-56 FJ372564_1( FJ372564 |pid:none) Sedum alfredii isolate Nhea

  13. Microbiological Assessment of Housekeeping Practices and ...

    African Journals Online (AJOL)

    The highest numbers of isolated organisms (% occurrence) were 42.0%, 21.9%, 21.9% and 14.3% for the Karra batch abattoir, RCCG Canaan land batch abattoir, Odo-eran slaughter slab and Ikenne line abattoir respectively. The following organisms were identified from the pure isolates contained in the samples from the ...

  14. Distance Support In-Service Engineering for the High Energy Laser

    Science.gov (United States)

    2015-03-01

    215 Table 21. UCC Analysis Output for Nagios Core v4.0.8 ..............................................219 Table...22. UCC Analysis Output for Nagios Plugins v2.0.3 ..........................................219 Table 23. COCOMO II Tool Input Data...centers, computing equipment, and environmental controls. After performing an AoA, FOSS alternative solutions were determined to be feasible: Nagios

  15. GETDB: 112502 [GETDB

    Lifescience Database Archive (English)

    Full Text Available arsus, AIII rings internal - - comment1:C, comment2:19A d1 d2 - - - Show 112502 D...known as - Original Comments comment1:C, comment2:19A Disc (Image) d1 d2 Disc (number) 2 Embryo (Image) - Em

  16. 47 CFR 95.801 - Scope.

    Science.gov (United States)

    2010-10-01

    ... 218-219 MHz Service General Provisions § 95.801 Scope. This subpart sets out the regulations governing the licensing and operation of a 218-219 MHz system. This subpart supplements part 1, subpart F of... 47 Telecommunication 5 2010-10-01 2010-10-01 false Scope. 95.801 Section 95.801 Telecommunication...

  17. 36 CFR 215.12 - Decisions and actions not subject to appeal.

    Science.gov (United States)

    2010-07-01

    ... objection process of § 219.32 or the administrative appeal and review procedures of part 217 in effect prior... 10, section 18. (c) Preliminary findings made during planning and/or analysis processes on a project... to either the objection process of § 219.32 or the administrative appeal and review procedures of...

  18. EST Table: FS921919 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FS921919 E_FL_fwgP_03B24_F_0 10/09/28 73 %/219 aa ref|NP_001161908.1| cuticular pro... aa AGAP000986-PA Protein|X:18926157:18929877:-1|gene:AGAP000986 10/09/10 67 %/200 aa gnl|Amel|GB13470-PA 10/09/10 73 %/219

  19. Dicty_cDB: Contig-U06096-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available |||||||||||| Sbjct: 64 gaaatngatgntncaacnccaacaatggctgcaaanattttttnnccnttttcaattggt 123 Query: 124 ggnaatgttggngatgntacaacnccna...ctt 154 ||||||||||||||||||||||||||||||| Sbjct: 124 ggnaatgttggngatgntacaacnccnactt 154 Sc...us Query: 219 atcncaacnatnncaacaacnaactgaatcagaattacnaccnattcaaa 268 |||||||||||||||||||||||||||||||||||||||...||||||||||| Sbjct: 219 atcncaacnatnncaacaacnaactgaatcagaattacnaccnattcaaa 268 >Contig-U11917-1 (Contig-U1191...atgntncaacnccaacaatggctgcaaanattttttnnccnttttcaattggt 147 Query: 124 ggnaatgttggngatgntacaacnccnacttnaaaanaa

  20. Journal of Chemical Sciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Chemical Sciences; Volume 119; Issue 3. Issue front cover thumbnail. Volume 119, Issue 3. May 2007, pages 219-274. pp 219-230. Engineering macrocyclic figure-eight motif · V Haridas Harinder Singh Yogesh K Sharma Kashmiri Lal · More Details Abstract Fulltext PDF. The design and ...

  1. 47 CFR 95.853 - Frequency segments.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 5 2010-10-01 2010-10-01 false Frequency segments. 95.853 Section 95.853... SERVICES 218-219 MHz Service Technical Standards § 95.853 Frequency segments. There are two frequency segments available for assignment to the 218-219 MHz Service in each service area. Frequency segment A is...

  2. CPAP Tips

    Medline Plus

    Full Text Available ... 3 Tips for Sleeping With a CPAP - Duration: 2:02. WebMD 44,809 views 2:02 Airing: the first hoseless, maskless, micro-CPAP ... 569 views 6:50 CPAP Mask Tutorial - Duration: 2:19. somnomedics 36,067 views 2:19 How ...

  3. EST Table: FY019119 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FY019119 rbmov24e02 11/11/04 93 %/220 aa gb|ABD36107.1| enoyl-CoA hydratase precurs...or 1 [Bombyx mori] 11/11/04 66 %/219 aa FBpp0170190|DmojGI20973-PA 11/11/04 58 %/219 aa T05G5.6#CE00318#WBGe...ne00001155#locus:ech-6#Enoyl-CoA hydratase#status:Confirmed#UniProt:P34559#protein_id:CAA 81594.1 11/11/04 60 %/219... aa AGAP011833-PA Protein|3L:33896030:33897085:1|gene:AGAP011833 11/11/04 66 %/219... aa gnl|Amel|GB18498-PA 11/11/04 68 %/219 aa gi|91088159|ref|XP_971757.1| PREDICTED: similar to cycl

  4. Alpha particle emitters in medicine

    Energy Technology Data Exchange (ETDEWEB)

    Fisher, D.R.

    1989-09-01

    Radiation-induced cancer of bone, liver and lung has been a prominent harmful side-effect of medical applications of alpha emitters. In recent years, however, the potential use of antibodies labeled with alpha emitting radionuclides against cancer has seemed promising because alpha particles are highly effective in cell killing. High dose rates at high LET, effectiveness under hypoxic conditions, and minimal expectancy of repair are additional advantages of alpha emitters over antibodies labeled with beta emitting radionuclides for cancer therapy. Cyclotron-produced astatine-211 ({sup 211}At) and natural bismuth-212 ({sup 212}Bi) have been proposed and are under extensive study in the United States and Europe. Radium-223 ({sup 223}Ra) also has favorable properties as a potential alpha emitting label, including a short-lived daughter chain with four alpha emissions. The radiation dosimetry of internal alpha emitters is complex due to nonuniformly distributed sources, short particle tracks, and high relative specific ionization. The variations in dose at the cellular level may be extreme. Alpha-particle radiation dosimetry, therefore, must involve analysis of statistical energy deposition probabilities for cellular level targets. It must also account fully for nonuniform distributions of sources in tissues, source-target geometries, and particle-track physics. 18 refs., 4 figs.

  5. α decay of the very neutron-deficient isotopes 197-199Fr

    Science.gov (United States)

    Kalaninová, Z.; Andreyev, A. N.; Antalic, S.; Heßberger, F. P.; Ackermann, D.; Andel, B.; Drummond, M. C.; Hofmann, S.; Huyse, M.; Kindler, B.; Lane, J. F. W.; Liberati, V.; Lommel, B.; Page, R. D.; Rapisarda, E.; Sandhu, K.; Šáro, Š.; Thornthwaite, A.; Van Duppen, P.

    2013-04-01

    Decay properties of the very neutron-deficient isotopes 197-199Fr were studied at the velocity filter Separator for Heavy Ion reaction Products (SHIP) at GSI in Darmstadt. The isotopes were produced in the 2n-4n evaporation channels of the fusion-evaporation reaction 60Ni+141Pr → 201Fr*. Improved α-decay properties of 199Fr were determined and the possible existence of two α-decaying states in this nucleus is discussed. For the isotope 198Fr a broad α-decay energy distribution was detected in the range of (7470-7930) keV and two α-decaying states were observed with half-lives of 1.1(7) and 15(3) ms. The new isotope 197Fr was identified based on the observation of one α-decay chain yielding Eα=7728(15) keV and T1/2=0.6-0.3+3.0 ms. The systematics of reduced α-decay widths are presented for neutron-deficient francium, radon, and astatine isotopes.

  6. Nuclear Data Evaluation for Mass Chain A=217:Odd-Proton Nuclei.

    Directory of Open Access Journals (Sweden)

    Sherif S Nafee

    Full Text Available Thallium (81(217Tl, Bismuth (83(217Bi, Astatine (85(217At, Francium (87(217Fr, Actinium (89(217Ac and Protactinium (91(217Pa are of odd-proton numbers among the mass chain A = 217. In the present work, the half-lives and gamma transitions for the six nuclei have been studied and adopted based on the recently published interactions or unevaluated nuclear data sets XUNDL. The Q (α has been updated based on the recent published work of the Atomic Mass Evaluation AME2012 as well. Moreover, the total conversion electrons as well as the K-Shell to L-Shell, L-Shell to M-Shell and L-Shell to N-Shell Conversion Electron Ratios have been calculated using BrIcc code v2.3. An updated skeleton decay scheme for each of the above nuclei has been presented here. The decay hindrance factors (HF calculated using the ALPHAD program, which is available from Brookhaven National Laboratory's website, have been calculated for the α- decay data sets for (221Fr-, (221Ac- and (221Pa-α-decays.

  7. Nuclear Data Evaluation for Mass Chain A=217:Odd-Proton Nuclei.

    Science.gov (United States)

    Nafee, Sherif S; Shaheen, Salem A; Al-Ramady, Amir M

    2016-01-01

    Thallium (81(217)Tl, Bismuth (83(217)Bi), Astatine (85(217)At), Francium (87(217)Fr), Actinium (89(217)Ac) and Protactinium (91(217)Pa) are of odd-proton numbers among the mass chain A = 217. In the present work, the half-lives and gamma transitions for the six nuclei have been studied and adopted based on the recently published interactions or unevaluated nuclear data sets XUNDL. The Q (α) has been updated based on the recent published work of the Atomic Mass Evaluation AME2012 as well. Moreover, the total conversion electrons as well as the K-Shell to L-Shell, L-Shell to M-Shell and L-Shell to N-Shell Conversion Electron Ratios have been calculated using BrIcc code v2.3. An updated skeleton decay scheme for each of the above nuclei has been presented here. The decay hindrance factors (HF) calculated using the ALPHAD program, which is available from Brookhaven National Laboratory's website, have been calculated for the α- decay data sets for (221)Fr-, (221)Ac- and (221)Pa-α-decays.

  8. On the theory of time dilation in chemical kinetics

    Science.gov (United States)

    Baig, Mirza Wasif

    2017-10-01

    The rates of chemical reactions are not absolute but their magnitude depends upon the relative speeds of the moving observers. This has been proved by unifying basic theories of chemical kinetics, which are transition state theory, collision theory, RRKM and Marcus theory, with the special theory of relativity. Boltzmann constant and energy spacing between permitted quantum levels of molecules are quantum mechanically proved to be Lorentz variant. The relativistic statistical thermodynamics has been developed to explain quasi-equilibrium existing between reactants and activated complex. The newly formulated Lorentz transformation of the rate constant from Arrhenius equation, of the collision frequency and of the Eyring and Marcus equations renders the rate of reaction to be Lorentz variant. For a moving observer moving at fractions of the speed of light along the reaction coordinate, the transition state possess less kinetic energy to sweep translation over it. This results in the slower transformation of reactants into products and in a stretched time frame for the chemical reaction to complete. Lorentz transformation of the half-life equation explains time dilation of the half-life period of chemical reactions and proves special theory of relativity and presents theory in accord with each other. To demonstrate the effectiveness of the present theory, the enzymatic reaction of methylamine dehydrogenase and radioactive disintegration of Astatine into Bismuth are considered as numerical examples.

  9. SPECT assay of radiolabeled monoclonal antibodies. Progress report, September 1, 1992--August 24, 1993

    Energy Technology Data Exchange (ETDEWEB)

    Jaszczak, R.J.

    1993-08-20

    The overall goal of this project is to improve the effectiveness of single photon emission computed tomography (SPECT) to image and quantify radiolabeled monoclonal antibodies. During the past year, we have made significant progress toward this goal, and this report summarizes that work. Our efforts have been mainly directed along three fronts. First, we have developed and tested new reconstruction methods including three-dimensional iterative algorithms that model non-uniform attenuation and distance-dependent detector response. Both fan beam and parallel beam collimator geometries have been modeled and novel ways of improving the efficiency of the computationally intensive methods have been introduced. Second, an ultra-high resolution, small field-of-view pinhole collimator has been constructed and evaluated. Reconstructed spatial resolution of 1 to 3 mm (FWHM) has been achieved in phantom scans with a useful field-of-view of 9 to 10 cm. Finally, we have investigated the ability of SPECT to image and quantify astatine-211 distributions. Reconstructed images of phantom data demonstrated quantitative accuracy to within 10% with proper attenuation and scatter compensation.

  10. New developments of the in-source spectroscopy method at RILIS/ISOLDE

    Science.gov (United States)

    Marsh, B. A.; Andel, B.; Andreyev, A. N.; Antalic, S.; Atanasov, D.; Barzakh, A. E.; Bastin, B.; Borgmann, Ch.; Capponi, L.; Cocolios, T. E.; Day Goodacre, T.; Dehairs, M.; Derkx, X.; De Witte, H.; Fedorov, D. V.; Fedosseev, V. N.; Focker, G. J.; Fink, D. A.; Flanagan, K. T.; Franchoo, S.; Ghys, L.; Huyse, M.; Imai, N.; Kalaninova, Z.; Köster, U.; Kreim, S.; Kesteloot, N.; Kudryavtsev, Yu.; Lane, J.; Lecesne, N.; Liberati, V.; Lunney, D.; Lynch, K. M.; Manea, V.; Molkanov, P. L.; Nicol, T.; Pauwels, D.; Popescu, L.; Radulov, D.; Rapisarda, E.; Rosenbusch, M.; Rossel, R. E.; Rothe, S.; Schweikhard, L.; Seliverstov, M. D.; Sels, S.; Sjödin, A. M.; Truesdale, V.; Van Beveren, C.; Van Duppen, P.; Wendt, K.; Wienholtz, F.; Wolf, R. N.; Zemlyanoy, S. G.

    2013-12-01

    At the CERN ISOLDE facility, long isotope chains of many elements are produced by proton-induced reactions in target materials such as uranium carbide. The Resonance Ionization Laser Ion Source (RILIS) is an efficient and selective means of ionizing the reaction products to produce an ion beam of a chosen isotope. Coupling the RILIS with modern ion detection techniques enables highly sensitive studies of nuclear properties (spins, electromagnetic moments and charge radii) along an isotope chain, provided that the isotope shifts and hyperfine structure splitting of the atomic transitions can be resolved. At ISOLDE the campaign to measure the systematics of isotopes in the lead region (Pb, Bi, Tl and Po) has been extended to include the gold and astatine isotope chains. Several developments were specifically required for the feasibility of the most recent measurements: new ionization schemes (Po, At); a remote controlled narrow line-width mode of operation for the RILIS Ti:sapphire laser (At, Au, Po); isobar free ionization using the Laser Ion Source Trap, LIST (Po); isobar selective particle identification using the multi-reflection time-of-flight mass separator (MR-ToF MS) of ISOLTRAP (Au, At). These are summarized as part of an overview of the current status of the in-source resonance ionization spectroscopy setup at ISOLDE.

  11. Studies of Stable Octupole Deformations in the Radium Region

    CERN Multimedia

    2002-01-01

    The purpose of the present project is to locate and identify states in the atomic nuclei possessing stable pearshaped octupole deformation. Such states, formally related to the structures known in molecular physics, manifest themselves as families of parity doublets in odd nuclei.\\\\ \\\\ The best possibilities for observing stable octupole deformations are offered in the Ra-region. Both theoretical calculations and experimental indications support such expectations. Such indications are the non-observation of two-phonon octupole vibrational states in the ISOLDE studies of the even-even radium nuclei, and the reversed sign of the decoupling factor of the ground state band in |2|2|5Ra observed in the single-neutron transfer reactions. In order to establish the predicted strong E1 and E3-transitions between the parity doublets in odd nuclei with stable octupole deformations it is proposed to study conversion electrons in odd-mass francium radium and radon isotopes following the @b-decay of francium and astatine. \\...

  12. Tumor Immunotargeting Using Innovative Radionuclides

    Directory of Open Access Journals (Sweden)

    Françoise Kraeber-Bodéré

    2015-02-01

    Full Text Available This paper reviews some aspects and recent developments in the use of antibodies to target radionuclides for tumor imaging and therapy. While radiolabeled antibodies have been considered for many years in this context, only a few have reached the level of routine clinical use. However, alternative radionuclides, with more appropriate physical properties, such as lutetium-177 or copper-67, as well as alpha-emitting radionuclides, including astatine-211, bismuth-213, actinium-225, and others are currently reviving hopes in cancer treatments, both in hematological diseases and solid tumors. At the same time, PET imaging, with short-lived radionuclides, such as gallium-68, fluorine-18 or copper-64, or long half-life ones, particularly iodine-124 and zirconium-89 now offers new perspectives in immuno-specific phenotype tumor imaging. New antibody analogues and pretargeting strategies have also considerably improved the performances of tumor immunotargeting and completely renewed the interest in these approaches for imaging and therapy by providing theranostics, companion diagnostics and news tools to make personalized medicine a reality.

  13. Evaluating 99mTc Auger electrons for targeted tumor radiotherapy by computational methods.

    Science.gov (United States)

    Tavares, Adriana Alexandre S; Tavares, João Manuel R S

    2010-07-01

    Technetium-99m (99mTc) has been widely used as an imaging agent but only recently has been considered for therapeutic applications. This study aims to analyze the potential use of 99mTc Auger electrons for targeted tumor radiotherapy by evaluating the DNA damage and its probability of correct repair and by studying the cellular kinetics, following 99mTc Auger electron irradiation in comparison to iodine-131 (131I) beta minus particles and astatine-211 (211At) alpha particle irradiation. Computational models were used to estimate the yield of DNA damage (fast Monte Carlo damage algorithm), the probability of correct repair (Monte Carlo excision repair algorithm), and cell kinetic effects (virtual cell radiobiology algorithm) after irradiation with the selected particles. The results obtained with the algorithms used suggested that 99mTc CKMMX (all M-shell Coster-Kroning--CK--and super-CK transitions) electrons and Auger MXY (all M-shell Auger transitions) have a therapeutic potential comparable to high linear energy transfer 211At alpha particles and higher than 131I beta minus particles. All the other 99mTc electrons had a therapeutic potential similar to 131I beta minus particles. 99mTc CKMMX electrons and Auger MXY presented a higher probability to induce apoptosis than 131I beta minus particles and a probability similar to 211At alpha particles. Based on the results here, 99mTc CKMMX electrons and Auger MXY are useful electrons for targeted tumor radiotherapy.

  14. Radiobromination of humanized anti-HER2 monoclonal antibody trastuzumab using N-succinimidyl 5-bromo-3-pyridinecarboxylate, a potential label for immunoPET

    Energy Technology Data Exchange (ETDEWEB)

    Mume, Eskender [Organic Chemistry, Department of Chemistry, Uppsala University, S-751 24 Uppsala (Sweden); Orlova, Anna [Affibody AB, S-161 02 Bromma (Sweden); Malmstroem, Per-Uno [Division of Urology, Department of Surgical Sciences, Uppsala University, S-751 85 Uppsala (Sweden); Lundqvist, Hans [Unit of Biomedical Radiation Sciences, Rudbeck Laboratory, Uppsala University, S-751 85 Uppsala (Sweden); Sjoeberg, Stefan [Organic Chemistry, Department of Chemistry, Uppsala University, S-751 24 Uppsala (Sweden); Tolmachev, Vladimir [Unit of Biomedical Radiation Sciences, Rudbeck Laboratory, Uppsala University, S-751 85 Uppsala (Sweden)]. E-mail: vladimir.tolmachev@bms.uu.se

    2005-08-01

    Combining the specificity of radioimmunoscintigraphy and the high sensitivity of PET in an in vivo detection technique could improve the quality of nuclear diagnostics. Positron-emitting nuclide {sup 76}Br (T {sub 1/2}=16.2 h) might be a possible candidate for labeling monoclonal antibodies (mAbs) and their fragments, provided that the appropriate labeling chemistry has been established. For internalizing antibodies, such as the humanized anti-HER2 monoclonal antibody, trastuzumab, radiobromine label should be residualizing, i.e., ensuring that radiocatabolites are trapped intracellularly after the proteolytic degradation of antibody. This study evaluated the chemistry of indirect radiobromination of trastuzumab using N-succinimidyl 5-(tributylstannyl)-3-pyridinecarboxylate. Literature data indicated that the use of this method provided residualizing properties for iodine and astatine labels on some antibodies. An optimized 'one-pot' procedure produced an overall labeling efficiency of 45.5{+-}1.2% over 15 min. The bromine label was stable under physiological and denaturing conditions. The labeled trastuzumab retained its capacity to bind specifically to HER2-expressing SKOV-3 ovarian carcinoma cells in vitro (immunoreactivity more than 75%). However, in vitro cell test did not demonstrate that the radiobromination of trastuzumab using N-succinimidyl 5-bromo-3-pyridinecarboxylate improves cellular retention of radioactivity in comparison with the use of N-succinimidyl 4-bromobenzoate.

  15. Development and radiotherapeutic application of /sup 211/At-labeled radiopharmaceuticals. Progress report, March 1, 1981-February 28, 1982

    Energy Technology Data Exchange (ETDEWEB)

    Adelstein, S.J.; Zalutsky, M.; Bloomer, W.

    1981-01-01

    This project is concerned with developing the potential of alpha-emitting radionuclides as agents for radiotherapy. Alpha-emitters seem ideally suited for his application because their high linear energy transfer and short range permit the deposition of considerable energy in a very small volume of tissue. Unlike the beta particles of /sup 131/I which have a range of about 1 to 2 mm in tissue, 5 to 7 MeV alpha particles would traverse only a few cell diameters. Among the available alpha-emitters, /sup 211/At appears most promising for therapeutic applications because, (1) it has some chemical similarities to iodine, an element that can readily be incorporated into numerous proteins and peptides, (2) it has a half-life that is long enough to permit chemical manipulation yet short enough to minimize destruction of healthy cells due to degradation of the label over time, (3) it can be produced conveniently using a cyclotron, and (4) alpha emission is associated with 100% of its decays with no accompanying beta emission. In the past year the evaluation of an astatine-tellurium colloid as an agent for the destruction of malignant ascites has been completed. The therapeutic efficacy of /sup 211/At-tellurium colloid has been compared with that of several beta-emitting radiocolloids. Studies on the application of monoclonal antibodies as carriers for selective delineation and destruction of malignant cell populations have also been initiated.

  16. Silver impregnated nanoparticles of titanium dioxide as carriers for {sup 211}At

    Energy Technology Data Exchange (ETDEWEB)

    Cedrowska, Edyta; Lyczko, Monika; Piotrowska, Agata; Bilewicz, Aleksander [Institute of Nuclear Chemistry and Technology, Warsaw (Poland); Stolarz, Anna; Trcinska, Agnieszka [Warsaw Univ. (Poland). Heavy Ion Lab.; Szkliniarz, Katarzyna [Silesia Univ. Katowice (Poland). Inst. of Physics; Was, Bogdan [Polish Academy of Science, Cracow (Poland). Inst. of Nuclear Physics

    2016-08-01

    The {sup 211}At radioisotope exhibits very attractive nuclear properties for application in radionuclide therapy. Unfortunately use of {sup 211}At is limited, because astatine as the heaviest halogen forms weak bond with carbon atoms in the biomolecules which makes {sup 211}At bioconjugates unstable in physiological conditions. In our work we propose a new solution for binding of {sup 211}At which consists of using nanoparticles of titanium dioxide modified with silver atoms as carriers for {sup 211}At. Ag{sup +} cations have been absorbed on the nanometer-sized TiO{sub 2} particles (15 and 32 nm) through ion exchange process and were reduced in Tollens' reaction. The obtained TiO{sub 2}-Ag nanoparticles were labeled with {sup 211}At. It was found that labeling yields were almost quantitative under reducing conditions, while under oxidizing conditions they dropped to about 80%. The labeled nanoparticles exhibited very high stability in physiological salt, PBS buffer, solutions of peptides (0.001 M cysteine, 0.001 M glutathione) and in human blood serum. To make TiO{sub 2}/Ag nanoparticles well dispersed in water and biocompatible their surface was modified with a silane coupling agent containing poly(ethyleneglycol) molecules. The developed functionalization approach will allow us to attach biomolecules to the TiO{sub 2}/Ag surface.

  17. Study of Neutron-Deficient $^{202-205}$Fr Isotopes with Collinear Resonance Ionization Spectroscopy

    CERN Document Server

    De Schepper, Stijn; Cocolios, Thomas; Budincevic, Ivan

    The scope of this master’s thesis is the study of neutron-deficient $^{202−205}$Fr isotopes. These isotopes are inside the neutron-deficient lead region, a region that has shown evidence of shape coexistence. For this thesis, this discussion is limited to the phenomenon where a low lying excited state has a different shape than the ground state. Shape coexistence is caused by intruder states. These are single-particle Shell Model states that are perturbed in energy due to the interaction with a deformed core. In the neutron-deficient lead region the main proton intruder orbit is the 3s$_{1/2}$orbit. When going towards more neutron-deficient isotopes, deformation increases. The $\\pi3s_{1/2}$orbit will rise in energy and will eventually become the ground state in odd- A bismuth (Z=83) isotopes. It is also observed in odd-A astatine (Z=85) isotopes, already in less neutron-deficient nuclei. The same phenomenon is expected to be present francium (Z=87) isotopes already at $^{199}$Fr. Although it is currently ...

  18. Yeast-expressed recombinant protein of the receptor-binding domain in SARS-CoV spike protein with deglycosylated forms as a SARS vaccine candidate.

    Science.gov (United States)

    Chen, Wen-Hsiang; Du, Lanying; Chag, Shivali M; Ma, Cuiqing; Tricoche, Nancy; Tao, Xinrong; Seid, Christopher A; Hudspeth, Elissa M; Lustigman, Sara; Tseng, Chien-Te K; Bottazzi, Maria Elena; Hotez, Peter J; Zhan, Bin; Jiang, Shibo

    2014-01-01

    Development of vaccines for preventing a future pandemic of severe acute respiratory syndrome (SARS) caused by SARS coronavirus (SARS-CoV) and for biodefense preparedness is urgently needed. Our previous studies have shown that a candidate SARS vaccine antigen consisting of the receptor-binding domain (RBD) of SARS-CoV spike protein can induce potent neutralizing antibody responses and protection against SARS-CoV challenge in vaccinated animals. To optimize expression conditions for scale-up production of the RBD vaccine candidate, we hypothesized that this could be potentially achieved by removing glycosylation sites in the RBD protein. In this study, we constructed two RBD protein variants: 1) RBD193-WT (193-aa, residues 318-510) and its deglycosylated forms (RBD193-N1, RBD193-N2, RBD193-N3); 2) RBD219-WT (219-aa, residues 318-536) and its deglycosylated forms (RBD219-N1, RBD219-N2, and RBD219-N3). All constructs were expressed as recombinant proteins in yeast. The purified recombinant proteins of these constructs were compared for their antigenicity, functionality and immunogenicity in mice using alum as the adjuvant. We found that RBD219-N1 exhibited high expression yield, and maintained its antigenicity and functionality. More importantly, RBD219-N1 induced significantly stronger RBD-specific antibody responses and a higher level of neutralizing antibodies in immunized mice than RBD193-WT, RBD193-N1, RBD193-N3, or RBD219-WT. These results suggest that RBD219-N1 could be selected as an optimal SARS vaccine candidate for further development.

  19. Somatotypes of Nigerian athletes of several sports.

    Science.gov (United States)

    Mathur, D N; Toriola, A L; Igbokwe, N U

    1985-01-01

    Somatotype ratings and percentage body fat of 131 elite Nigerian male athletes, average 24.2 years of age, and belonging to badminton (n = 18), basketball (n = 30), field hockey (n = 24), handball (n = 16), judo (n = 18), and soccer (n = 25) teams were determined. Basketball, handball and soccer players were taller and heavier, and had low percent fat values as compared with the other athletic groups. Judokas and hockey players were endomesomorphs. Other sports groups were predominantly ectomesomorphs. Images p219-a p219-b p219-c PMID:4092144

  20. AcEST: DK951267 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ties = 17/35 (48%), Positives = 23/35 (65%) Frame = -3 Query: 219 LYTGDFSLGALYTGG...8 Score = 37.0 bits (84), Expect = 0.97 Identities = 17/35 (48%), Positives = 23/35 (65%) Frame = -3 Query: ...%), Positives = 23/35 (65%) Frame = -3 Query: 219 LYTGDFSLGALYTGGLYSGAFSLGALYSGGLVTGL 115 L TG + GAL TGG ++G...its (80), Expect = 2.8 Identities = 16/35 (45%), Positives = 23/35 (65%) Frame = -3 Query: 219 LYTGDFSLGALYT... Score = 34.7 bits (78), Expect = 4.8 Identities = 16/35 (45%), Positives = 22/35 (62%) Frame = -3 Query: 21

  1. Staged collision and damage data. Volume 1: Report for accident reconstruction of thirty (30) test vehicles

    Science.gov (United States)

    Hand, D. H.

    1981-01-01

    The test vehicles were impacted tested for compliance with FMVSS 212/219/301-75. As a parallel nonconflicting effort, the test vehicles were instrumented with accelerometers to measure vehicle accelerator resultants.

  2. EST Table: FS898177 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available 52 %/219 aa gnl|Amel|GB11154-PA 10/09/10 55 %/220 aa gi|91079562|ref|XP_966370.1| PREDICTED: similar to iodotyrosine dehalogenase 1, partial [Tribolium castaneum] BY930739 ftes ...

  3. South African Journal of Education - Vol 21, No 4 (2001)

    African Journals Online (AJOL)

    Transformation, diversity and organisational change within institutions of higher education · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. B.D. Norris, 219-221 ...

  4. Oceanographic data acquired in support of the June 1980 study of the upwelling center off Point Sur, California (NODC Accession 9000024)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The Current, Temperature and Depth (CTD) data were collected by Naval Postgraduate School from Coastal Waters of California between 2-19 June, 1980 using ship...

  5. Clean Hands Count

    Medline Plus

    Full Text Available ... hand hygiene and empower patients to play a role in their care by asking or reminding healthcare providers to clean their hands. See: ... Hand Washing For Nurses - Duration: 2:57. Kevin Gorin 213,219 views ...

  6. Neonatal Anaplasma platys infection in puppies: Further evidence for possible vertical transmission

    Czech Academy of Sciences Publication Activity Database

    Matei, I.A.; Stuen, S.; Modrý, David; Degan, A.; D'Amico, G.; Mihalca, A. D.

    2017-01-01

    Roč. 219, 1 January (2017), s. 40-41 ISSN 1090-0233 Institutional support: RVO:60077344 Keywords : Anaplasma platys * canine * vertical transmission Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.802, year: 2016

  7. Study of antibiotic prescribing among dental practitioners in Shiraz, Islamic Republic of Iran

    National Research Council Canada - National Science Library

    Vessal, G; Khabiri, A; Mirkhani, H; Cookson, B D; Askarian, M

    2011-01-01

    .... This study evaluated the knowledge and practices of dental practitioners in the city of Shiraz, Islamic Republic of Iran regarding their therapeutic use of antibiotics for patients with dentoalveolar infections. Of 219 (48.6...

  8. AcEST: BP911926 [AcEST

    Lifescience Database Archive (English)

    Full Text Available phen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipm...2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A

  9. AcEST: BP918897 [AcEST

    Lifescience Database Archive (English)

    Full Text Available phen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipm...2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A

  10. Antibiotic resistance genes, integrons and multiple antibiotic resistance in thirty-five serotypes of Salmonella enterica isolated from humans and animals in the UK

    National Research Council Canada - National Science Library

    Randall, L P; Cooles, S W; Osborn, M K; Piddock, L J V; Woodward, M J

    2004-01-01

    .... Some strains were resistant to ampicillin (91), chloramphenicol (85), gentamicin (2), kanamycin (14), spectinomycin (81), streptomycin (119), sulfadiazine (127), tetracycline (108) and trimethoprim (45); 219 strains were susceptible to all antibiotics...

  11. Drug: D09952 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available ACE VTHQGLSSPV TKSFNRGEC (Disulfide bridge: 23-93; 139-199; H130-L219, Dimer) Peptide Treatment of Alzheim...er's disease monoclonal antibody beta-amyloid CAS: 1178862-65-1 PubChem: 124490631 ...

  12. Head and Neck Cancers

    Science.gov (United States)

    ... 18 ). People working in certain jobs in the construction, metal, textile, ceramic, logging, and food industries may ... endemic betel quid chewing area. Journal of Oral Pathology and Medicine 2002; 31(4):213–219. [PubMed ...

  13. Fulltext PDF

    Indian Academy of Sciences (India)

    sriranga

    Page 1. 219. RESONANCE │ March 2011. GENERAL │ ARTICLE. Email for Correspondence: ionguha@gmail.com. Science Smiles. Ayan Guha. Your Honor, I have proof that this accused linkage traced that 'bone' graffiti on the painting.

  14. The Collin dynamometer: History of the development of an instrument for measuring physical and mental strength

    Czech Academy of Sciences Publication Activity Database

    Nicolas, S.; Vobořil, Dalibor

    2017-01-01

    Roč. 117, č. 2 (2017), s. 173-219 ISSN 0003-5033 Institutional support: RVO:68081740 Keywords : Collin dynamometer * experimental psychology * history of psychology Subject RIV: AN - Psychology Impact factor: 0.358, year: 2016

  15. Acoustic characterization of seafloor habitats on the western continental shelf of India

    Digital Repository Service at National Institute of Oceanography (India)

    Chakraborty, B.; Mahale, V.; Navelkar, G.S.; Rao, B.R.; Desai, R.G.P.; Ingole, B.S.; Janakiraman, G.

    continental shelf of India. Journal of Sound and Vibration, 219: 51?62. Chakraborty, B., Kaustubha, R., Hegde, A., and Pereira, A. 2001. Acoustic seafloor sediment classification using self organizing feature maps. IEEE Transactions on Geoscience Remote...

  16. AcEST: BP921038 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lip....2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro

  17. Disease: H00561 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available nsufficiency of HDAC4 causes brachydactyly mental retardation syndrome, with brachydactyly type E, developmental delays, and behavior...al problems. Am J Hum Genet 87:219-28 (2010) PMID:7847374 (description, gene) Wilso

  18. Doctoral Theses in Library and Information Science Completed in Indian Universities, 2001-2007

    Science.gov (United States)

    Mestri, D. D.

    2008-01-01

    Provides a complete listing and analysis of 219 doctoral theses submitted to the departments of library and information science (DLIS) in 45 Indian universities between January 2001 and December 2007. (Contains 10 tables.)

  19. Astronomy: Ring detected around a dwarf planet

    Science.gov (United States)

    Sickafoose, Amanda A.

    2017-10-01

    Observations of the distant dwarf planet Haumea constrain its size, shape and density, and reveal an encircling planetary ring. The discovery suggests that rings are not as rare in the Solar System as previously thought. See Letter p.219

  20. 75 FR 12749 - Ocean Transportation Intermediary License Reissuances

    Science.gov (United States)

    2010-03-17

    ... Date reissued 015530N Distinction Cargo Management February 15, 2010. Inc., Cargo Bldg. 9, Suite 255..., 2010. Logistic, (USA) Inc., 219 Stuyvesant Avenue, Lyndhurst, NJ 01071. 021870N AKM International, LLC...

  1. 75 FR 12674 - Amendment of Jet Routes and VOR Federal Airways in the Vicinity of Gage, OK

    Science.gov (United States)

    2010-03-17

    ... September 15, 2009, is amended as follows: Paragraph 2004 Jet Routes. * * * * * J-26 From Ciudad Juarez... Ciudad Juarez, Mexico, via El Paso, TX; INT El Paso 070 and Pinon, NM, 219 radials; Pinon; Chisum, NM...

  2. Cadmium, Lead, and Other Metals in Relation to Semen Quality: Human Evidence for Molybdenum as a Male Reproductive Toxicant

    National Research Council Canada - National Science Library

    John D. Meeker; Mary G. Rossano; Bridget Protas; Michael P. Diamond; Elizabeth Puscheck; Douglas Daly; Nigel Paneth; Julia J. Wirth

    2008-01-01

    ...) among 219 men recruited through two infertility clinics. We used multiple statistical approaches to assess relationships between metals and semen quality while accounting for important covariates and various metals. Results...

  3. Laboratory based degradation of light crude oil by aquatic ...

    African Journals Online (AJOL)

    STORAGESEVER

    2009-08-18

    Bratislava), 46: 219-. 228. Neely NS, Walsh JS, Gillespie DP, Schanf FJ (1981). Remedial actions at uncontrolled waste sites in land disposal of hazardous wastes. Proceedings of 7th Annual Research Symposium, Philadelphia In:.

  4. 77 FR 15566 - Private Transfer Fees

    Science.gov (United States)

    2012-03-16

    ... University Hospital, 488 U.S. 204, 219 (Scalia, J., concurring) (emphasis in original). If a vested right is... ``hyperbolic discounting.'' See Bar-Gill, Seduction by Plastic, 98 Nw. U. L. Rev. 1373, 1396-99 (2004...

  5. 188 An Empirical Investigation of Value-Chain Analysis and ...

    African Journals Online (AJOL)

    User

    -chain analysis is a concept from strategic management, which was first ..... Corporate. Strategy: Evidence from Japan", Management Accounting. Research, 7, (2); 219 46. Donelan, J. G. and Kaplan, E. A. (1990) "Value Chain Analysis: A ...

  6. Dicty_cDB: SLA608 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 2.19 Translated Amino Acid sequence hlewycnyrrlvsqpfvvifv*lhffhiiews*tnittng*LTWNGIRLTPFYDMKEMRA KVEGYIKDINA...quence (All Frames) Frame A: hlewycnyrrlvsqpfvvifv*lhffhiiews*tnittng*LTWNGIRLTPFYDMKEMRA KVEGYIKDINANITELRN...ng*vkhqlvslvnstlmv tkhlvklllklkvh*lqlqlvvlflwfvi--- Frame C: pgmvl*lpaigesticgdirltpflsyhrmelneyhhkwlthlewys

  7. Cinema and the Great War - Andrew Kelly, 1997. History by Hollywood. The use and abuse of the American past - Robert Brant Toplin, 1996

    NARCIS (Netherlands)

    Kester, Bernadette

    1998-01-01

    textabstractReview of: Cinema and the Great War. Andrew Kelly, Londen, New York (Routledge), 1997, 219 p.History by Hollywood. The use and abuse of the American past. Robert Brant Toplin, Chicago (Urbana), 1996, 267 p.

  8. A complete degradation of organophosphates by microwave-assisted hydrolysis

    Czech Academy of Sciences Publication Activity Database

    Jansa, Petr; Čechová, Lucie; Janeba, Zlatko

    2016-01-01

    Roč. 3, č. 3 (2016), s. 219-226 ISSN 2213-3356 R&D Projects: GA MV VG20102015046 Institutional support: RVO:61388963 Keywords : organophosphates * microwave irradiation * hydrolysis Subject RIV: CC - Organic Chemistry

  9. 75 FR 28019 - Resmethrin; Notice of Receipt of Requests to Voluntarily Cancel Certain Pesticide Registrations

    Science.gov (United States)

    2010-05-19

    ..., recreational, and residential areas to control flying and crawling insects. All remaining resmethrin end use... reproduction 2.1.7 Hershberger (rat) 2.1.8 Female Pubertal (rat) 2.1.9 Male pubertal (rat) 2.1.10...

  10. Molecular and biological characterization of a new Tomato mild yellow leaf curl Aragua virus strain producing severe symptoms in tomato.

    Science.gov (United States)

    Romay, Gustavo; Chirinos, Dorys T; Geraud-Pouey, Francis; Gillis, Annika; Mahillon, Jacques; Desbiez, Cécile; Bragard, Claude

    2017-12-01

    Tomato mild yellow leaf curl Aragua virus (ToMYLCV) is a begomovirus first reported infecting tomato (Solanum lycopersicum) and milkweed (Euphorbia heterophylla) in Venezuela. In this study, a ToMYLCV isolate (Zulia-219) was completely sequenced and its host range was evaluated. The DNA-A and DNA-B components of isolate Zulia-219 showed 93 and 85% nucleotide sequence identity with the respective counterparts of the ToMYLCV type strain. According to current demarcation criteria for begomovirus species, Zulia-219 is a new strain of ToMYLCV. Interestingly, tomato plants inoculated with ToMYLCV Zulia-219 displayed severe symptoms, including severe chlorotic leaf curling, in contrast to mild symptoms associated with the type strain of this begomovirus. These results indicate potential risks associated with this new ToMYLCV strain for tomato production in Venezuela.

  11. Lordosis - lumbar

    Science.gov (United States)

    ... spine. Much less common causes in children include: Achondroplasia , a disorder of bone growth that causes the ... Carson BS, Rigamonti D, Ahn ES. Achondroplasia and other dwarfisms. ... PA: Elsevier Saunders; 2011:chap 219. Mistovich RJ, Spiegel ...

  12. Molecular hematology

    National Research Council Canada - National Science Library

    Provan, Drew; Gribben, John

    2010-01-01

    ... The molecular basis of hemophilia, 219 Paul LF Giangrande 4 The genetics of acute myeloid leukemias, 42 Carolyn J Owen & Jude Fitzgibbon 19 The molecular basis of von Willebrand disease, 233 Luciano Baronc...

  13. Das Wörterbuch als Grammatik?

    OpenAIRE

    Wellmann, Hans

    1996-01-01

    Das Wörterbuch als Grammatik? - In: Das Lernerwörterbuch Deutsch als Fremdsprache in der Diskussion / hrsg. von Irmhild Barz ... - Heidelberg : Winter, 1996. - S. 219-241. - (Sprache - Literatur und Geschichte ; 12)

  14. 40 CFR 80.166 - Carburetor deposit control performance test and test fuel guidelines.

    Science.gov (United States)

    2010-07-01

    ... Code of Regulations. (2) “A Vehicle Test Technique for Studying Port Fuel Injector Deposits—A...-1981”, Coordinating Research Council, CRC Report No. 529, Coordinating Research Council Inc. (CRC), 219...

  15. Veterinary Laboratory Services Study - 1976.

    Science.gov (United States)

    1976-09-01

    requirement for special skills in food chemistry and animal disease diagnosis plus the continuing shortage of 92B enlis ted personnel indicate that key...to provide proper supervision and perform required bench ‘work in this major workload area. Sufficient technicians with laboratory skills in...Chorionic Gonadotropin 475 730 17 1,222 UCG or Human Pregnancy 147 42 189 Tularemia 332 332 OX—19 211 211 Salmonella 219 219 Trichinella 17 17 Venipuncture

  16. Sediment Dynamics in a Vegetated Tidally Influenced Interdistributary Island: Wax Lake, Louisiana

    Science.gov (United States)

    2017-07-01

    34Interdecadal Changes in the ENSO-Monsoon System." Journal of Climate 12: 2679–2690. Torres, R., and R. Styles. 2007. "Effects of Topographic...and Development Center 3909 Halls Ferry Road Vicksburg, MS 39180-6199 Under Work Unit ERDC-219CDR-14-TT-Sediment Management , “Section 219 Center...44 3.5.1 Bed elevation change .................................................................................................. 45 3.5.2

  17. Flow Cytometry Techniques in Radiation Biology

    Science.gov (United States)

    1988-06-01

    FORCES RAOIOSIOLOGY Toxicology Letters, 43 (1988) 219-233 RESEARCH IMSTITUTE 219Elsevier SCIENTIFIC REPORTSR88-42 TXL 02046 Flow cytometry techniques ...in radiation biology Kenneth F. McCarthy and Martha L. Hale Radiation Biochemistry Department, Armed Forces Radiobiology Research Institute, Bethesda...marrow hematopoietic cells [2,31. In the past, ef- forts to isolate the HSC used physical techniques such as density gradient centrifugation in isotonic

  18. Pharmaceutical and pharmacokinetic characterization of a novel sublingual buprenorphine/naloxone tablet formulation in healthy volunteers.

    Science.gov (United States)

    Fischer, Andreas; Jönsson, Martin; Hjelmström, Peter

    2015-01-01

    Bitter taste, as well as dissolve time, presents a significant challenge for the acceptability of formulations for oral transmucosal drug delivery. To characterize a novel sublingual tablet formulation of buprenorphine/naloxone with regards to pharmacokinetics, dissolve time and formulation acceptability. Dry mixing techniques were employed to produce a small and fast dissolving buprenorphine/naloxone sublingual tablet formulation, OX219 (Zubsolv®), using sucralose and menthol as sweetener and flavor to mask the bitter taste of the active ingredients. Two cross-over studies were performed in healthy volunteers to evaluate pharmacokinetics, dissolve time and acceptability of OX219 5.7/1.4 mg tablets compared to the commercially available buprenorphine/naloxone formulations Suboxone® tablets and films (8/2 mg). Buprenorphine exposure was equivalent in OX219 and Suboxone tablets. Sublingual dissolve times were significantly shorter for OX219 than for Suboxone tablets and were similar to Suboxone films. The OX219 formulation received significantly higher subjective ratings for taste and overall acceptability than both Suboxone formulations. OX219 was preferred over Suboxone tablet and film formulations by 77.4% and 88.9% of subjects, respectively. A sublingual tablet formulation with an improved acceptability has been successfully developed.

  19. Milestone Weight Loss Goals (Weight Normalization and Remission of Obesity) after Gastric Bypass Surgery: Long-Term Results from the University of Michigan.

    Science.gov (United States)

    Lager, Corey J; Esfandiari, Nazanene H; Subauste, Angela R; Kraftson, Andrew T; Brown, Morton B; Cassidy, Ruth B; Bellers, Darlene; Lockwood, Amy L; Varban, Oliver A; Oral, Elif A

    2017-07-01

    Rates of weight normalization and obesity remission after Roux-en-Y gastric bypass (GB) are unknown. This study evaluated weight loss, rates of achieving body mass index (BMI) weight and BMI at baseline, 2 and 6 months, and annually at 1-7 years in 219 patients undergoing GB at the University of Michigan from January 2008 to November 2010. Follow-up was excellent for a population traditionally associated with high attrition rates with data availability of 157/219, 145/219, 144/219, 134/219, 123/219, 82/161, and 29/64 patients at 1-7 years, respectively. Mean baseline BMI was 47.0 kg/m2. Weight normalization (BMI obesity (BMI weight normalization are low after GB; however, a large number of patients achieved BMI weight loss and excess weight loss are both quite high in the entire cohort and this is likely associated with significant health benefits, our results still underscore the need to address obesity with intensive clinical attention earlier in its course.

  20. Isolation and characterization of a novel endoglucanase from a Bursaphelenchus xylophilus metagenomic library.

    Directory of Open Access Journals (Sweden)

    Lin Zhang

    Full Text Available A novel gene (designated as cen219 encoding endoglucanase was isolated from a Bursaphelenchus xylophilus metagenomic library by functional screening. Sequence analysis revealed that cen219 encoded a protein of 367 amino acids. SDS-PAGE analysis of purified endoglucanase suggested that Cen219 was a monomeric enzyme with a molecular mass of 40 kDa. The optimum temperature and pH for endoglucanase activity of Cen219 was separately 50 °C and 6.0. It was stable from 30 to 50 °C, and from pH 4.0 to 7.0. The activity was significantly enhanced by Mn(2+ and dramatically reduced by detergent SDS and metals Fe(3+, Cu(2+ or Hg(2+. The enzyme hydrolyzed a wide range of β-1, 3-, and β-1, 4-linked polysaccharides, with varying activities. Activities towards microcrystalline cellulose and filter paper were relatively high, while the highest activity was towards oat gum. The Km and Vmax of Cen219 towards CMC was 17.37 mg/ml and 333.33 U/mg, respectively. The findings have an insight into understanding the molecular basis of host-parasite interactions in B. xylophilus species. The properties also make Cen219 an interesting enzyme for biotechnological application.

  1. Optimizing MIBG therapy of neuroendocrine tumors: preclinical evidence of dose maximization and synergy

    Energy Technology Data Exchange (ETDEWEB)

    Mairs, Rob J. [Department of Radiation Oncology, University of Glasgow, Glasgow (United Kingdom)], E-mail: r.mairs@beatson.gla.ac.uk; Boyd, Marie [Department of Radiation Oncology, University of Glasgow, Glasgow (United Kingdom)

    2008-08-15

    [{sup 131}I]meta-Iodobenzylguanidine ([{sup 131}I]MIBG) has been used for the therapy of tumors of neuroectodermal origin since the 1980s. Its role in the management of these malignancies remains controversial because of the large variation in response rates. Appreciation of the mode of conveyance of [{sup 131}I]MIBG via the noradrenaline transporter into malignant cells and of factors that influence the activity of the uptake mechanism has indicated various ways in which the effectiveness of this type of targeted radiotherapy may be improved. Experimental observations indicate that radiolabeling of MIBG to high specific activity reduced the amount of cold competitor, thereby increasing tumor dose and minimizing pressor effects. We observed supra-additive tumor cell kill and inhibition of tumor growth following combined topotecan and [{sup 131}I]MIBG treatment. The improved efficacy is related to topotecan's increased disruption of DNA repair. Radiation damage to targeted tumors may also be enhanced by the use of the {alpha}-particle emitter [{sup 211}At]astatine rather than {sup 131}I as radiolabel. Furthermore, recent experimental findings indicate that [{sup 123}I]MIBG may have therapeutic potential over and above its utility as an imaging agent. It has recently been demonstrated that potent cytotoxic bystander effects were induced by the intracellular concentration of [{sup 131}I]MIBG, [{sup 123}I]MIBG or meta-[{sup 211}At]astatobenzylguanidine. Identification of the nature of bystander factors could be exploited to maximize the specificity and potency of MIBG-targeted radiotherapy. By employing a range of strategies, there are good prospects for the improvement of the [{sup 131}I]MIBG therapy of neuroectodermal tumors.

  2. Immuno-vectorization of radioelements emitters of alpha particles: a new therapy in cancerology; Immunovectorisation de radioelements emetteurs de particules alpha: une nouvelle voie therapeutique en cancerologie

    Energy Technology Data Exchange (ETDEWEB)

    Bourgeois, M

    2007-05-15

    The radio-immunotherapy is an anti cancerous therapy which consists in vectorising with immuno-specific agents very radio toxic radioelements on tumors or in their environment to destroy them. The first part of this report presents the different characteristics of antibodies as well as their means of production under monoclonal shapes specifically steered against a tumoral antigen of interest. The second part of this report replaces the importance of the immunological vectors in the context of the nuclear medicine. It is notably described that the different methods which allow to radio-label the vector, as well as the different ways of optimization which were envisaged to improve the targeting of radioelements on a tumor. These different developments allow to define the potential place of the alpha radio-immunotherapy in treatments and so re-place the interest of the experimental part. If the radio-immunotherapy, using beta emitters isotopes as the {sup 131}iodine or the{sup 90}yttrium, is today current in anti cancerous therapy, it finds limits because of the disintegration characteristics of the isotopes it uses. Indeed, compared with alpha particles, the beta particles deposit less energy by unit of length in the crossed material.The experimental part of this report aims at studying the feasibility of the coupling between an immunological vector and an alpha emitter isotope.The different tests led on the bismuth 213, the bismuth 212, the lead 212 and the astatine 211 demonstrated that the fixation of these radionuclides was possible. This research theme is strengthened by the construction in Nantes of a cyclotron with high energy ( A.R.R.O.N.A.X.) and the optimization of the obtained promising results should allow a therapeutic use in oncology of the alpha radio-immunotherapy. (N.C.)

  3. Locoregional therapy with α-emitting trastuzumab against peritoneal metastasis of human epidermal growth factor receptor 2-positive gastric cancer in mice.

    Science.gov (United States)

    Li, Huizi Keiko; Morokoshi, Yukie; Nagatsu, Kotaro; Kamada, Tadashi; Hasegawa, Sumitaka

    2017-08-01

    Peritoneal metastasis of gastric cancer (PMGC) is incurable and thus has an extremely poor prognosis. We have found, however, that locoregionally administered trastuzumab armed with astatine-211 ((211) At-trastuzumab) is effective against human epidermal growth factor receptor 2 (HER2)-positive PMGC in a xenograft mouse model. We first observed that (211) At-trastuzumab can specifically bind and effectively kill NCI-N87 (N87) cells, which are HER2-positive human metastatic GC cells, both in vitro and in s.c. tumors. We established a PMGC mouse model using N87 xenografts stably expressing luciferase to test α-particle radioimmunotherapy with (211) At-trastuzumab against PMGC. Biodistribution analysis in this PMGC mouse model revealed that the i.p. administration of (211) At-trastuzumab (1 MBq) was a more efficient means of delivery of (211) At into metastatic tumors than i.v. injection; the maximum tumor uptake with i.p. administration was over 60% injected dose per gram of tissue (%ID/g) compared to approximately 18%ID/g with i.v. injection. Surprisingly, a single i.p. injection of (211) At-trastuzumab (1 MBq) was sufficient to completely eradicate intraperitoneally disseminated HER2-positive GC xenografts in two of six treated mice by inducing DNA double-strand breaks, and to drastically reduce the tumor burden in another three mice. No bodyweight loss, leukocytopenia, or significant biochemical changes in liver or kidney function were observed in the treatment group. Accordingly, locoregionally administered (211) At-trastuzumab significantly prolonged the survival time of HER2-positive PMGC mice compared with control treatments. Our results provide a proof-of-concept demonstration that locoregional therapy with (211) At-trastuzumab may offer a new treatment option for HER2-positive PMGC. © 2017 The Authors. Cancer Science published by John Wiley & Sons Australia, Ltd on behalf of Japanese Cancer Association.

  4. Grain Sterility in relation to Dry Mass Production and Distribution in Rice (Oryza sativa L.

    Directory of Open Access Journals (Sweden)

    Adam B. Puteh

    2014-01-01

    Full Text Available The experiment was conducted to investigate potential causes of grain sterility in widely cultivated rice variety in Malaysia, MR219 and its two mutant lines (RM311 and RM109 by examining the source-sink relations. RM311 produced increased dry matter yield both at heading and maturity and also showed higher grain yield with greater proportion of grain sterility than the other two genotypes (RM109 and MR219 resulting in the lowest harvest index (49.68%. In contrast, harvest index was greater in RM109 (53.34% and MR219 (52.76% with less grain sterility percentage than MR311 indicating that dry matter partitioning to economic yield was better in RM109 and MR219 than in MR311. Results indicated that dry matter allocation per spikelet from heading to maturity was important for reducing grain sterility in rice. The greater above-ground crop dry matter per spikelet was observed in RM109 and MR219 as compared to high dry matter producing genotype; RM311 implies that poor grain filling may not have resulted from dry matter production or source limitation. These findings suggest that grain sterility or poor grain filling in rice is the result of poor translocation and partitioning of assimilates into grains (sink rather than of limited biomass production or source limitation.

  5. The Shift of the Intestinal Microbiome in the Innate Immunity-Deficient Mutant rde-1 Strain of C. elegans upon Orsay Virus Infection

    Directory of Open Access Journals (Sweden)

    Yuanyuan Guo

    2017-05-01

    Full Text Available The status of intestinal microbiota is a determinant of host health. However, the alteration of the gut microbiota caused by the innate immune response to virus infection is unclear. Caenorhabditis elegans and its natural virus Orsay provide an excellent model of host–virus interactions. We evaluated the intestinal microbial community complexity of the wild-type N2 and the innate immunity-deficient mutant rde-1 (ne219 strains of C. elegans upon Orsay virus infection. The gut microbiota diversity was decreased in rde-1 (ne219 mutant animals, and a large number of genes were associated with the difference between infected and uninfected rde-1 (ne219 mutant animals. Therefore, this study provides the first evaluation of the alterations caused by Orsay virus on intestinal microbiota in wildtype and innate immunity-deficient animals using C. elegans as the model species. Our findings indicate that virus infection may alters the microbiome in animals with defective immune response.

  6. Geohydrology of test well USW H-3, Yucca Mountain, Nye County, Nevada

    Science.gov (United States)

    Thordarson, William; Rush, F.E.; Waddell, S.J.

    1985-01-01

    Test well USW H-3 is one of several wells drilled in the southwestern part of the Nevada Test Site for hydraulic testing, hydrologic monitoring, and geophysical logging. The work was performed in cooperation with the U.S. Department of Energy. The rocks penetrated by the well to a total depth of 1,219 meters were volcanic tuffs of Tertiary age. The most transmissive zone in this well is in the upper part of the Tram Member of the Crater Flat Tuff that was penetrated at a depth from 809 to 841 meters; transmissivity is about 7 x 10 -1 meter squared per day. The remainder of the rocks penetrated between the depths of 841 to 1,219 meters have a transmissivity of about 4 x 10 -1 meter squared per day and are predominatly in the Tram Member of the Crater Flat Tuff and the Lithic Ridge Tuff in the depths from 841 to 1,219 meters. (USGS)

  7. Dicty_cDB: Contig-U14988-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available omplete ... 219 2e-55 AF289696_1( AF289696 |pid:none) Wolbachia endosymbiont of Spalan... 219 2e-55 AF289698_1( AF289698 |pid:none) Wolbachia endosymbiont of Spalangi... 219 2e-55 AY898806_1( AY898... 217 8e-55 AF289703_1( AF289703 |pid:none) Wolbachia endosymbiont of Spalangi... 217 8e-55 DQ093830_1( DQ093... |pid:none) Wolbachia endosymbiont of Spalangi... 214 5e-54 DQ520266_1( DQ520266 |pid:none) Vibrio parahaemo...one) Wolbachia endosymbiont of Spalangi... 212 3e-53 AB119059_1( AB119059 |pid:none) Nannochloris bacillaris

  8. Fort Greely Missile Range Reference Atmosphere. Part 2

    Science.gov (United States)

    1971-07-10

    38500 35357.3 22.13 - .- 82058 3027-785- 38750 35604.9 220.27 3.0&19032 4.642213? 302.881 -3--39000 38852;4r 3925u 39190.0 225.50 2.8247$53 4.3067220...296#496 38500 38357.3 219.17 2.9280668 4,6542304 296.776 38750 38604.9 219.58 2.1173257 4.4697921 297.055 39000 38852.4 219.99 2.7109?72 462930014...I-25g2&2 It fill =33500 33401.9 232,26 7#2209$36 10.8309906 305.510 -1’*o &.- 232" ?t ’a£mo.* U ISO ins-al 34000 1369T.8 233.17 6*713964, 10.031005

  9. Medical Surveillance Monthly Report. Volume 18, Number 9

    Science.gov (United States)

    2011-09-01

    care and the administration of rabies immune glob- ulin (RIG) and rabies vaccine , are highly eff ective in preventing progression of the infection...exposure to rabies ”, ICD- 9-CM: V01.5, and rabies post-exposure prophylaxis treatments from immuniza- tion records (i.e., rabies vaccine , rabies ...No. % No. % No. % “Exposure to rabies ” (V01.5) 219 169 77.2 48 21.9 2 0.9 1 0 . 0 . 1 . Rabies vaccine 1,681 1,475 87.7 169 10.1 37 2.2 117 99

  10. Monolithic Hybrid and Passive Mode-Locked 40GHz Quantum Dot Laser Diodes

    DEFF Research Database (Denmark)

    Thompson, M. G.; Larsson, David; Rae, A. R.

    2006-01-01

    For the first time hybrid and passive mode-locking jitter performance is investigated in 40GHz quantum-dot mode-locked lasers. Record low passive mode-locking jitter of 219fs is presented, along with promising hybrid mode-locking results of 124fs.......For the first time hybrid and passive mode-locking jitter performance is investigated in 40GHz quantum-dot mode-locked lasers. Record low passive mode-locking jitter of 219fs is presented, along with promising hybrid mode-locking results of 124fs....

  11. Association of apolipoprotein E promoter polymorphisms with bone structural traits is modified by dietary saturated fat intake - the Cardiovascular Risk in Young Finns study.

    Science.gov (United States)

    Tolonen, Sanna; Mikkilä, Vera; Laaksonen, Marika; Sievänen, Harri; Mononen, Nina; Hernesniemi, Jussi; Vehkalahti, Kimmo; Viikari, Jorma; Raitakari, Olli; Kähönen, Mika; Lehtimäki, Terho

    2011-05-01

    Association of apolipoprotein E (APOE) ε4 allele with peripheral quantitative computed tomography (pQCT) bone traits at the distal and shaft sites of the radius and tibia was evaluated in the Young Finns Cohort (n=1777). We also analyzed the interactions of the APOE promoter polymorphisms (-219G/T rs405509 and +113G/C rs440446) and bone traits within the APOE ε3/ε3 genotype (n=1025 and n=1013, respectively), and investigated the gene-environment interactions on bone traits with longitudinal saturated fatty acids (SAFA) intake. Differences between the ε4 allele carriers and noncarriers were modest and mostly nonsignificant. Within the APOE promoter -219G/T polymorphism, cortical strength index (CSI) and compressive bone strength index (BSI) at the distal radius (linear, P=0.003 and P=0.05, respectively) and tibia (linear, P=0.01 and P=0.03, respectively), and CSI at the tibial shaft (linear, P=0.04) decreased towards the -219T/T genotype in women. In men, total cross-sectional areas at the radial site and stress-strain index (SSI) at the radial shaft (linear, P=0.03 and P=0.04 and P=0.05, respectively) increased, and conversely cortical bone density and CSI at the radial shaft (linear, P=0.005 and P=0.05, respectively) and CSI at the tibial shaft (linear, P=0.03) decreased towards the -219T/T genotype. In the highest SAFA tertile, women with the -219T/T genotype had the smallest total area and SSI at the radial shaft (P=0.01 and P=0.02, respectively). Subjects with the APOE +113C/C genotype shared similar bone traits as subjects with the APOE -219T/T genotype. In conclusion, APOE genotypes -219T/T and +113C/C could be genetic markers for cortical bone strength. Furthermore, high longitudinal SAFA intake seems to be more detrimental to bone in women with the -219T/T and +133C/C genotypes than others. Copyright © 2011 Elsevier Inc. All rights reserved.

  12. β-decay studies of neutron-rich Tl, Pb, and Bi isotopes

    Science.gov (United States)

    Morales, A. I.; Benzoni, G.; Gottardo, A.; Valiente-Dobón, J. J.; Blasi, N.; Bracco, A.; Camera, F.; Crespi, F. C. L.; Corsi, A.; Leoni, S.; Million, B.; Nicolini, R.; Wieland, O.; Gadea, A.; Lunardi, S.; Górska, M.; Regan, P. H.; Podolyák, Zs.; Pfützner, M.; Pietri, S.; Boutachkov, P.; Weick, H.; Grebosz, J.; Bruce, A. M.; Núñez, J. Alcántara; Algora, A.; Al-Dahan, N.; Ayyad, Y.; Alkhomashi, N.; Allegro, P. R. P.; Bazzacco, D.; Benlliure, J.; Bowry, M.; Bunce, M.; Casarejos, E.; Cortes, M. L.; Bacelar, A. M. Denis; Deo, A. Y.; de Angelis, G.; Domingo-Pardo, C.; Doncel, M.; Dombradi, Zs.; Engert, T.; Eppinger, K.; Farrelly, G. F.; Farinon, F.; Farnea, E.; Geissel, H.; Gerl, J.; Goel, N.; Gregor, E.; Habermann, T.; Hoischen, R.; Janik, R.; Klupp, S.; Kojouharov, I.; Kurz, N.; Mandal, S.; Menegazzo, R.; Mengoni, D.; Napoli, D. R.; Naqvi, F.; Nociforo, C.; Prochazka, A.; Prokopowicz, W.; Recchia, F.; Ribas, R. V.; Reed, M. W.; Rudolph, D.; Sahin, E.; Schaffner, H.; Sharma, A.; Sitar, B.; Siwal, D.; Steiger, K.; Strmen, P.; Swan, T. P. D.; Szarka, I.; Ur, C. A.; Walker, P. M.; Wollersheim, H.-J.

    2014-01-01

    The fragmentation of relativistic uranium projectiles has been exploited at the Gesellschaft für Schwerionenforschung laboratory to investigate the β decay of neutron-rich nuclei just beyond 208Pb. This paper reports on β-delayed γ decays of 211-213Tl, 215Pb, and 215-219Bi de-exciting states in the daughters 211-213Pb, 215Bi, and 215-219Po. The resulting partial level schemes, proposed with the help of systematics and shell-model calculations, are presented. The role of allowed Gamow-Teller and first-forbidden β transitions in this mass region is discussed.

  13. β -decay studies of neutron-rich Tl, Pb, and Bi isotopes

    OpenAIRE

    Morales, A. I.; Benzoni, G.; Gottardo, A.; Valiente-Dobon, J. J.; Blasi, N.; Bracco, A.; Camera, F.; Crespi, F. C. L.; Corsi, A.; Leoni, S.; Million, B.; Nicolini, R.; Wieland, O.; Gadea, A.; Lunardi, S.

    2014-01-01

    The fragmentation of relativistic uranium projectiles has been exploited at the Gesellschaft für Schwerionenforschung laboratory to investigate the β decay of neutron-rich nuclei just beyond 208Pb. This paper reports on β-delayed γ decays of 211–213Tl, 215Pb, and 215–219Bi de-exciting states in the daughters 211–213Pb, 215Bi, and 215–219Po. The resulting partial level schemes, proposed with the help of systematics and shell-model calculations, are presented. The role of allowed Gamow-Teller a...

  14. EST Table: FS819190 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FS819190 E_FL_fmgV_03F01_R_0 10/09/28 99 %/223 aa ref|NP_001040233.1| ATP synthase ...[Bombyx mori] gb|ABD36284.1| ATP synthase [Bombyx mori] 10/09/10 89 %/219 aa FBpp0153691|DgriGH19785-PA 10/08/29 83 %/219... aa H28O16.1d#CE36263#WBGene00010419#status:Confirmed#UniProt:Q9XXK1#pr otein_id:CAF31480.1 10/

  15. Modelling of Molecular Structures and Properties. Proceedings of the International Meeting of Physical Chemistry on Modeling of Molecular Structures and Properties in Physical Chemistry and Biophysics Organized by the Division de Chimie Physique of the Societe Francaise de Chimie Held in Nancy, France on 11-15 September 1989

    Science.gov (United States)

    1990-01-01

    widely recognized that alkali graphite compounds are active as hydrogenation catalysts for unsaturated hydrocarbons.5 These materials are also known...to catalyze polymerization in a variety of unsaturated organic compounds.6 The most interesting structural aspect of these reactions is that the...intrainolecular ll-bonds (see fig.3a-b), one of them connecting the lactone ring and the sugar moiety. 0 0 1.191 0 𔃺 2.19A 2.1.9k Figure 3. Aiphotericin

  16. Grain Sterility in relation to Dry Mass Production and Distribution in Rice (Oryza sativa L.)

    OpenAIRE

    Puteh, Adam B.; M. Monjurul Alam Mondal; Mohd Razi Ismail; Mohammad Abdul Latif

    2014-01-01

    The experiment was conducted to investigate potential causes of grain sterility in widely cultivated rice variety in Malaysia, MR219 and its two mutant lines (RM311 and RM109) by examining the source-sink relations. RM311 produced increased dry matter yield both at heading and maturity and also showed higher grain yield with greater proportion of grain sterility than the other two genotypes (RM109 and MR219) resulting in the lowest harvest index (49.68%). In contrast, harvest index was greate...

  17. Resposta de plantas micropropagadas de abacaxizeiro à inoculação de bactérias diazotróficas em casa de vegetação Response of pineapple plantlets to inoculation with diazotrophic bacteria in greenhouse

    Directory of Open Access Journals (Sweden)

    Olmar Baller Weber

    2003-12-01

    Full Text Available O objetivo deste trabalho foi selecionar e avaliar bactérias diazotróficas isoladas de abacaxizeiro (Ananas comosus (L. Merril no desenvolvimento de cultivares micropropagadas da mesma espécie em casa de vegetação. Plantas da cultivar Perolera foram submetidas à inoculação com Asaia bogorensis (AB219 e cultivadas em tubetes, durante 145 dias, com as misturas: casca de arroz carbonizada, folha de carnaubeira triturada e vermicomposto; casca de arroz carbonizada, pó da casca do coco maduro e vermicomposto; casca de arroz carbonizada, vermiculita e vermicomposto. Plantas da cultivar Primavera receberam inóculos com o AB219 e bactérias relacionadas a Burkholderia cepacia (AB202 e AB213, enquanto plantas das cultivares Pérola e Smooth Cayenne receberam AB219 e AB213, sendo cultivadas, por 140 dias, em tubetes com a mistura de vermicomposto e vermiculita. A colonização dos abacaxizeiros pelas bactérias diazotróficas foi confirmada. As plantas da cultivar Perolera cresceram melhor em casca de arroz carbonizada, vermiculita e vermicomposto e responderam positivamente ao AB219. Já as plantas da cultivar Primavera não apresentaram resposta significativa à inoculação com AB219, AB202 e AB213. Houve incremento de 23,1% a 38,5% na matéria seca de raízes das plantas da cultivar Pérola na presença de AB213 e AB219, respectivamente. A presença de AB213 incrementou em 15,2% a matéria seca da parte aérea das plantas da cultivar Smooth Cayenne. Os resultados revelam a eficiência de bactérias diazotróficas na promoção do crescimento de abacaxizeiros.The objective of this work was to select and to evaluate isolates of diazotrophic bacteria associated to pineapple (Ananas comosus (L. Merril plants in the development of micropropagated plantlets of cultivars pineapple in greenhouse. Plantlets from the Perolera cultivar have been submitted to inoculation with Asaia bogorensis (AB219 and were cultivated during 145 days on the following

  18. Sociocultural Influences on Body Image Concerns of Young Chinese Males

    Science.gov (United States)

    Jackson, Todd; Chen, Hong

    2008-01-01

    This research assessed the extent to which sociocultural factors implicated in explanations of weight dissatisfaction among young Western females extend to sources of body image concern in emerging adult and adolescent males from the People's Republic of China. In Study 1, 219 Mainland Chinese male university students completed measures of stature…

  19. Journal of Biosciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Biosciences. Subhash C Lakhotia. Articles written in Journal of Biosciences. Volume 29 Issue 3 September 2004 pp 219-224. Commentary: Epigenetics of heterochromatin · Subhash C Lakhotia · More Details Fulltext PDF. Volume 32 Issue 3 April 2007 pp 429-431. Foreword · Subhash C ...

  20. On a cryogenic noble gas ion catcher

    NARCIS (Netherlands)

    Dendooven, P; Purushothaman, S; Gloos, K

    2006-01-01

    In situ purification of the gas used as stopping medium in a noble gas ion catcher by operating the device at low temperatures of 60-150 K was investigated. Alpha-decay recoil ions from a Ra-223 source served as energetic probes. The combined ion survival and transport efficiencies for Rn-219 ions

  1. A Survey of Community-Based Rehabilitation Programs: Goals, Outcomes, Consumers, Finances, and Changes.

    Science.gov (United States)

    Botterbusch, Karl F.; Miller, John W.

    This report discusses the outcomes of a study that examined the present state of 124 community-based rehabilitation programs (CRP) and future trends. Results indicated: (1) the typical CRP served an average of 219 consumers daily and had total revenues of $5.262 million; (2) more than 60 percent of the CRPs offered programs in the following areas:…

  2. Transformation, diversity and organisational change within ...

    African Journals Online (AJOL)

    ... person, the need to establish an equitable and effective education system has become a top priority. This requires a transformation process that will necessitate the management of diversity, and organisational changes within our institutions of higher education. (South African Journal of Education: 2001 21(4): 219-221) ...

  3. 48 CFR 52.244-6 - Subcontracts for Commercial Items.

    Science.gov (United States)

    2010-10-01

    ... clauses in subcontracts for commercial items: (i) 52.203-13, Contractor Code of Business Ethics and... Recovery Act. (iii) 52.219-8, Utilization of Small Business Concerns (MAY 2004) (15 U.S.C. 637(d)(2) and (3... subcontracts to small business concerns) exceeds $650,000 ($1.5 million for construction of any public facility...

  4. Increasing trends in childlessness in recent birth cohorts - a registry-based study of the total Danish male population born from 1945 to 1980

    DEFF Research Database (Denmark)

    Priskorn, Lærke; Holmboe, Stine; Jacobsen, R

    2012-01-01

    . The proportion of childless men at age 45 increased from 14.8% to 21.9% in the same birth cohorts. Assisted reproductive technology (ART) seemed to compensate partly for the lower fertility and to reduce the proportion of childless men. In contrast, recent reports on corresponding birth cohorts of Danish women...

  5. File list: His.Liv.10.AllAg.Liver [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available His.Liv.10.AllAg.Liver mm9 Histone Liver Liver SRX591723,SRX591725,SRX591727,SRX219...0338,SRX100343 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/His.Liv.10.AllAg.Liver.bed ...

  6. Arctic driftwood reveals unexpectedly rich fungal diversity

    Czech Academy of Sciences Publication Activity Database

    Blanchette, R.A.; Held, B.W.; Hellmann, L.; Millman, L.; Büntgen, Ulf

    2016-01-01

    Roč. 23, OCT (2016), s. 58-65 ISSN 1754-5048 R&D Projects: GA MŠk(CZ) EE2.3.20.0248 Institutional support: RVO:67179843 Keywords : Ascomycota * Basidiomycota * Biodegradation * Community ecology * Greenland * Iceland * its * Russia * Soft rot * Taxonomy * Wood decay Subject RIV: EH - Ecology, Behaviour Impact factor: 3.219, year: 2016

  7. Modified hydroxyethyl starch protects cells from oxidative damage

    Czech Academy of Sciences Publication Activity Database

    Filippov, Sergey K.; Sergeeva, O. Yu.; Vlasov, P. S.; Zavyalova, M. S.; Belostotskaya, G. B.; Garamus, V. M.; Khrustaleva, R. S.; Štěpánek, Petr; Domnina, N. S.

    2015-01-01

    Roč. 134, 10 December (2015), s. 314-323 ISSN 0144-8617 R&D Projects: GA ČR(CZ) GC15-10527J Institutional support: RVO:61389013 Keywords : hydroxyethyl starch * antioxidant * volume expander Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 4.219, year: 2015

  8. 77 FR 20598 - Defense Federal Acquisition Regulation Supplement: Solicitation Provisions and Contract Clauses...

    Science.gov (United States)

    2012-04-05

    ... clause 52.203-13, Contractor Code of Business Ethics and Conduct, including solicitations and contracts...: Clause 252.219-7003, Small Business Subcontracting Plan; provision 252.225-7000, Buy American Act-Balance..., distributive impacts, and equity). E.O. 13563 emphasizes the importance of quantifying both costs and benefits...

  9. Mapping forest aboveground biomass using airborne hyperspectral and LiDAR data in the mountainous conditions of Central Europe

    Czech Academy of Sciences Publication Activity Database

    Brovkina, Olga; Novotný, Jan; Cienciala, E.; Zemek, František; Russ, R.

    2017-01-01

    Roč. 100, Mar (2017), s. 219-230 ISSN 0925-8574 R&D Projects: GA MŠk(CZ) LO1415; GA MŠk OC09001 Institutional support: RVO:67179843 Keywords : biomass estimation * spruce * beech * airborne remote sensing * tree level * plot level Subject RIV: EH - Ecology, Behaviour Impact factor: 2.914, year: 2016

  10. Download this PDF file

    African Journals Online (AJOL)

    (2016) 13(3):219-229 http://dx.doi.org/10.4314/ajtcam.v13i3.26. 'THEY CALL US KILLERS': AN EXPLORATION OF HERBAL, SPIRITUAL AND WESTERN. MEDICAL PRACTICES IN MOMBASA, KENYA. Z. O. Enumah1*, Mohamed Y. Rafiq2, Wossen Ayele3. 1Johns Hopkins University School of Medicine, Doctor's Lounge, ...

  11. El rol de las familias españolas con hijos con discapacidad en la inclusión educativa. Una mirada histórico-normativa

    Directory of Open Access Journals (Sweden)

    Fran J. García-García

    2016-12-01

    Full Text Available García-García, F. J. y López-Torrijo, M. (2016: “El rol de las familias españolas con hijos con discapacidad en la inclusión educativa. Una mirada histórico-normativa”. Revista Española de Discapacidad, 4 (2: 219-233.

  12. European Bat Lyssaviruses, the Netherlands

    NARCIS (Netherlands)

    Poel, van der W.H.M.; Heide, van der R.; Verstraten, E.R.A.M.; Kramps, J.A.

    2005-01-01

    To study European bat lyssavirus (EBLV) in bat reservoirs in the Netherlands, native bats have been tested for rabies since 1984. For all collected bats, data including species, age, sex, and date and location found were recorded. A total of 1,219 serotine bats, Eptesicus serotinus, were tested, and

  13. Capacity Building and Livelihoods Improvement of Women Fish ...

    African Journals Online (AJOL)

    About (93.8%) indicated prompt attendance to meeting once a month. Larger percentage (75.0%, n=24) remitted their loan timely compared to (25.0%, n=8) on periodical. Most members activities financed involved marketing and trading such as fish (94.0%, n=30) and grains (84.0%, n=27). Cooperative members (21.9%) ...

  14. Sólo tú sabrás que hacer con esto

    Directory of Open Access Journals (Sweden)

    José Eduardo Jaramillo Zuluaga

    2004-01-01

    Full Text Available La cuarta batería. Gentes en menguante. Eduardo Zalamea Borda. Prólogo de Juan Gustavo Cobo Borda. Transcripción de Angelina Araújo Vélez. Coda de Juan Díaz Zalamea Villegas, Bogotá, 2001, 219 págs.

  15. A Meta-Analysis Examining the Impact of Computer-Assisted Instruction on Postsecondary Statistics Education: 40 Years of Research

    Science.gov (United States)

    Larwin, Karen; Larwin, David

    2011-01-01

    The present meta-analysis is a comprehensive investigation of the effectiveness of computer-assisted instruction (CAI) on student achievement in postsecondary statistics education across a forty year period of time. The researchers calculated an overall effect size of 0.566 from 70 studies, for a total of 219 effect-size measures from a sample of…

  16. Development of citizen participation in Central and Eastern Europe after the EU enlargement and economic crises

    Czech Academy of Sciences Publication Activity Database

    Guasti, Petra

    2016-01-01

    Roč. 49, č. 3 (2016), s. 219-231 ISSN 0967-067X R&D Projects: GA ČR GA16-04885S Institutional support: RVO:68378025 Keywords : Civil society * Civic participation * Democratization Subject RIV: AO - Sociology, Demography Impact factor: 0.607, year: 2016

  17. 77 FR 43353 - Renewal of Agency Information Collection for Tribal Self-Governance Program

    Science.gov (United States)

    2012-07-24

    ... Bureau of Indian Affairs Renewal of Agency Information Collection for Tribal Self- Governance Program... for Tribal Self-Governance Program authorized by OMB Control Number 1076-0143. This information...-Governance, 1951 Constitution Avenue NW., Mail Stop 355-G SIB, Washington, DC 20240; telephone: (202) 219...

  18. 75 FR 53565 - Adjustment of Appendices to the Dairy Tariff-Rate Import Quota Licensing Regulation for the 2010...

    Science.gov (United States)

    2010-09-01

    ... conjunction with U.S. Customs and Border Protection, U.S. Department of Homeland Security, monitors their use...,312 1,674,999 DRIED SKIM MILK (NOTE 7) 5,261,000 Australia 600,076 Canada 219,565 Any Country 4,441.../WHEY (NOTE 12)......... 11,000 213,981 [[Page 53566

  19. ORF Alignment: NC_002607 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available m sp. NRC-1] gb|AAG19044.1| phosphoesterase; Ppe ... [Halobacterium sp. NRC-1] sp|Q9HRW4|MRE11_HALN1 ...DNA ... double-strand break repair protein mre11 ... Length = 219 ... Query: 1 ... MARVIHTGDTHLGYQQ

  20. Epidemiologic Consultation No. 14-HK-OB1U-09 Investigation of Homicides at Fort Carson, Colorado November 2008 - May 2009

    Science.gov (United States)

    2009-07-01

    Implementation (2-19 Dec 08). (4) Phase N: Data Analysis at USACHPPM (8 Dec 08-30 Jan 09). (5) Phase V: Synthesis of findings and Outbrief generation at...4) Of the illicit drug positive tests from Soldiers in the Index BCT, approximately 60 percent were for cocaine, amphetamines, methamphetamines , and

  1. Biodegradation of spilled diesel fuel in agricultural soil: Effect of humates, zeolite, and bioaugmentation

    Czech Academy of Sciences Publication Activity Database

    Kuráň, P.; Trögl, J.; Nováková, J.; Pilařová, V.; Dáňová, P.; Pavlorková, J.; Kozler, J.; Novák, František; Popelka, J.

    -, č. 642427 (2014) ISSN 1537-744X Grant - others:GA MPO(CZ) FR-TI1/456 Institutional support: RVO:60077344 Keywords : biodegradation * spilled diesel fuel * agricultural soil Subject RIV: DK - Soil Contamination ; De-contamination incl. Pesticides Impact factor: 1.219, year: 2013 http://dx.doi.org/10.1155/2014/642427

  2. The results of CO2 laser surgery in patients with oral leukoplakia : a 25 year follow

    NARCIS (Netherlands)

    van der Hem, PS; Nauta, JM; van der Wal, JE; Roodenburg, JLN

    Oral leukoplakia, is an important premalignant Lesion of the oral mucosa. We treat this Lesion prophylactically with CO2 laser evaporation. In the period from 1976 to 2001, a group of 200 patients with 282 oral leukoplakias were treated by CO2 laser evaporation. In a follow up period of 1-219 months

  3. AcEST: DK946873 [AcEST

    Lifescience Database Archive (English)

    Full Text Available bit) - E-value - Report BLASTX 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro....2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang,

  4. AcEST: DK945720 [AcEST

    Lifescience Database Archive (English)

    Full Text Available bit) - E-value - Report BLASTX 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro....2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang,

  5. Author Index

    Indian Academy of Sciences (India)

    Narlikar Jayant V. see Pecker Jean-Claude, 1. Om Vats Hari see Iyer, K. N., 219; Geo-effectiveness of Solar Wind Extremes,. 227. Omar, A. The Tully–Fisher Relations of the Eridanus Group of Galaxies, 7. Pandey, K. see Narain, U., 93. Pant, P. see Joshi Bhuwan, 151; Research Facilities for Solar Astronomy at ARIES,. 293.

  6. Antioxidant properties of volatile oils obtained from Artemisia taurica ...

    African Journals Online (AJOL)

    PERFECT XP SP3

    2014-01-20

    Jan 20, 2014 ... by Flavonoids. Biosci. Biotechnol. Biochem. 63(10):1787-1999. Nielson PV, Rios R (2000). Inhibition of Fungal Growth on Bread by. Volatile Components from Spices and Herb and the Possible. Aplication in Active Packaging with Special Emphas on Mustard. Essential Oil. Int. J. Food Microbiol. 60:219-229 ...

  7. Microvascular complications in South African patients with long ...

    African Journals Online (AJOL)

    The prevalence of complications and the clinical and biochemical parameters were evaluated for type 1 and type 2 diabetes and for each ethnic group. Results. Of the 219 patients, 47 had type 1 OM (36 blacks, 11 Indians) and 172 were classified as type 2 OM (96 blacks, 76 Indians). The mean age of onset of OM wa later ...

  8. Healthy first-degree relatives of patients with type 1 dabetes exhibit significant differences in basal gene expression pattern of immunocompetent cells compared to controls: expression pattern as predeterminant of autoimmune diabetes

    Czech Academy of Sciences Publication Activity Database

    Štechová, K.; Kolář, Michal; Blatný, R.; Halbhuber, Z.; Včeláková, J.; Hubáčková, M.; Petruželková, L.; Sumnik, Z.; Obermannová, B.; Pithová, P.; Staviková, V.; Krivjanská, M.; Neuwirth, Aleš; Kalousková, S.; Filipp, Dominik

    2012-01-01

    Roč. 75, č. 2 (2012), s. 210-219 ISSN 0300-9475 R&D Projects: GA MŠk 2B08066 Institutional research plan: CEZ:AV0Z50520514 Keywords : type 1 diabetes * microarray analysis * pathogenesis Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.199, year: 2012

  9. Mercaptobenzothiazole on gold biosensor systems for organophosphate and carbamate pesticide compounds

    CSIR Research Space (South Africa)

    Somerset, VS

    2010-05-01

    Full Text Available 2003:114). 148 Figure 2.18 Potential-time pulses in Differential Pulse Voltammetry (DPV) (Zanello 2003:111). 150 Figure 2.19 A typical voltammogram in Differential Pulse Voltammetry (DPV) (Zanello 2003:112). 151 Figure 2.20 Comparison...

  10. Effect of Cryphonectria parasitica toxin on lipid peroxidation and ...

    African Journals Online (AJOL)

    Also, ultrastructural changes of organelles were observed under transmission electron microscope. The results show that the EL and the MDA content increased notably when leaves were treated with Cp-toxin for 72 h, and the content of MDA and EL was 4.36 and 2.19 times that of the control samples, respectively.

  11. Palmyra Atoll Site 15P 8/11/2006 48-49M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Palmyra Atoll, site 15P (05 52.219N, 162 02.697W), between 48 and 49 meters along a permanent transect.

  12. Palmyra Atoll Site 15P 8/11/2006 22-23M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Palmyra Atoll, site 15P (05 52.219N, 162 02.697W), between 22 and 23 meters along a permanent transect.

  13. Spatial heterogeneity of cellulolytic activity and fungal communities within individual decomposing Quercus petraea leaves

    Czech Academy of Sciences Publication Activity Database

    Navrátilová, Diana; Větrovský, Tomáš; Baldrian, Petr

    27 Part A, JUNE (2017), s. 125-133 ISSN 1754-5048 R&D Projects: GA ČR GA13-06763S; GA MŠk(CZ) LD15086 Institutional support: RVO:61388971 Keywords : Cellulose decomposition * Cellobiohydrolase * Enzyme activity Subject RIV: EE - Microbiology, Virology Impact factor: 3.219, year: 2016

  14. Differetial degradation of oak (Quercus petraea) leaf litter by litter-decomposing basidiomycetes

    Czech Academy of Sciences Publication Activity Database

    Steffen, K. T.; Cajthaml, Tomáš; Šnajdr, Jaroslav; Baldrian, Petr

    2007-01-01

    Roč. 158, č. 5 (2007), s. 447-455 ISSN 0923-2508 R&D Projects: GA ČR GA526/05/0168; GA MŠk LC06066 Institutional research plan: CEZ:AV0Z50200510 Keywords : biopolymers * carbohydrate * laccase Subject RIV: EE - Microbiology, Virology Impact factor: 2.219, year: 2007

  15. Osekere et al

    African Journals Online (AJOL)

    PUBLICATIONS1

    fore application. A few (31.6 %) of the respondents put on the full personal protective costume during insecticide application and 21.9% do not use any protection. ..... agement Act of the Laws of Ghana that no per- son should use pesticides without PPE (Ghana. Laws, 2014). But this law has been totally ig- nored. According ...

  16. QTL list: [PGDBj Registered plant list, Marker list, QTL list, Plant DB link and Genome analysis methods[Archive

    Lifescience Database Archive (English)

    Full Text Available QT75160 Solanum lycopersicum Solanaceae ... Seed quality_salt stress Salt I_mean germ...ination rate (reciprocal of the mean germination time; MGT-1) 2,3 ... Chr11 9.0-17.8 2.19 ... 10.1111/j.1365-3040.2011.02463.x 22074055

  17. The Multigroup Ethnic Identity Measure (MEIM): Psychometric Review and Further Validity Testing.

    Science.gov (United States)

    Ponterotto, Joseph G.; Gretchen, Denise; Utsey, Shawn O.; Stacuzzi, Thomas; Saya, Robert, Jr.

    2002-01-01

    Studied the psychometric strengths of the Multigroup Ethnic Identity Measure (J. Phinney, 1992) through a review of 12 studies using this measure, a confirmatory factor analysis of the measure (n=219 high school students), and a readability analysis. Findings show Phinney's two-factor model is a better fit than a global model. (SLD)

  18. Palmyra Atoll Site 15P 3/31/2004 48-49M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Palmyra Atoll, site 15P (05 52.219N, 162 02.697W), between 48 and 49 meters along a permanent transect.

  19. Palmyra Atoll Site 15P 3/31/2004 59-60M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Palmyra Atoll, site 15P (05 52.219N, 162 02.697W), between 59 and 60 meters along a permanent transect.

  20. Palmyra Atoll Site 15P 3/31/2004 89-90M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Palmyra Atoll, site 15P (05 52.219N, 162 02.697W), between 89 and 90 meters along a permanent transect.

  1. Palmyra Atoll Site 15P 3/31/2004 98-99M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Palmyra Atoll, site 15P (05 52.219N, 162 02.697W), between 98 and 99 meters along a permanent transect.

  2. Palmyra Atoll Site 15P 3/31/2004 35-36M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Palmyra Atoll, site 15P (05 52.219N, 162 02.697W), between 35 and 36 meters along a permanent transect.

  3. Palmyra Atoll Site 15P 3/31/2004 47-48M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Palmyra Atoll, site 15P (05 52.219N, 162 02.697W), between 47 and 48 meters along a permanent transect.

  4. Palmyra Atoll Site 15P 3/31/2004 44-45M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Palmyra Atoll, site 15P (05 52.219N, 162 02.697W), between 44 and 45 meters along a permanent transect.

  5. Palmyra Atoll Site 15P 3/31/2004 9-10M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Palmyra Atoll, site 15P (05 52.219N, 162 02.697W), between 9 and 10 meters along a permanent transect.

  6. Palmyra Atoll Site 15P 3/31/2004 7-8M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Palmyra Atoll, site 15P (05 52.219N, 162 02.697W), between 7 and 8 meters along a permanent transect.

  7. Baltisakslaste kunstivaramud Poznani Rahvusmuuseumis : peatükk ühe rahvusgrupi ajaloost / Anne Lõugas

    Index Scriptorium Estoniae

    Lõugas, Anne, 1951-

    1998-01-01

    Eestiga seotud vanema kunsti kogu on kujunenud välja eri ajaetappidel ja eri allikatest. Käsitletakse 1939-1944 Eestist väljaviidud kunstiteoseid, kirjandust baltisakslaste ümberasumisest. Poznani Rahvusmuuseumis asuvate Eestiga seotud baltisaksa maalide nimekiri lk. 205-219

  8. 78 FR 23491 - National Forest System Land Management Planning; Correction

    Science.gov (United States)

    2013-04-19

    ... Forest Service 36 CFR Part 219 RIN 0596-AB86 National Forest System Land Management Planning; Correction...-1104. FOR FURTHER INFORMATION CONTACT: Ecosystem Management Coordination staff's Planning Specialist... management plans (the planning rule). The National Forest Management Act (NFMA) at 16 U.S.C. 1604(g)(3)(D...

  9. 77 FR 44144 - National Forest System Land Management Planning; Correction

    Science.gov (United States)

    2012-07-27

    ... Forest Service 36 CFR Part 219 RIN 0596-AD02 National Forest System Land Management Planning; Correction...) published a National Forest System land management planning rule in the Federal Register, on April 9, 2012... Coordination staff's Planning Specialist Regis Terney at 202-205-1552. SUPPLEMENTARY INFORMATION: Background...

  10. AcEST: DK945539 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ndro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped BLAST and PSI-....2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Web

  11. AcEST: DK946819 [AcEST

    Lifescience Database Archive (English)

    Full Text Available dro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped BLAST and PSI-B...2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Web

  12. Antibiotic Sensitivity Patterns of Microbial Isolates from the Urine of ...

    African Journals Online (AJOL)

    Results: The incidence of urinary tract infection in pregnancy was 6.2%. The commonest organisms isolated were Escherichia coli (42.2%), Staphylococcus aureus (21.9%), Klebsiella spp (12.8%), unspecified coliform organisms (11.7%) and Streptococcus faecalis (4.2%). Nitrofurantoin (83.7%), gentamicin (61.2%) and ...

  13. Small-Scale Family Poultry Production As A Substantial Source Of ...

    African Journals Online (AJOL)

    The data collected were analyzed using frequency counts, percentages and ranking. The result showed that the 3 most available and preferred species of poultry were local chicken (47.5%), layer birds (21.9%) and broilers (17.5%). Most of the respondents agreed that although productivity of local fowl had fallen compared ...

  14. Cohabitation and premarital sex amongst Christian youth in South ...

    African Journals Online (AJOL)

    2011-08-02

    Aug 2, 2011 ... God] by not only identifying cohabitation and premarital sex amongst the youth as missionary frontiers to be ... cohabitation and premarital sex in South Africa, biblical perspectives regarding human sexuality and the ..... Psychology of religion 15(3), 199−219. doi:10.1207/s15327582ijpr1503_2. Musick, K.

  15. 48 CFR 226.370-8 - Goals and incentives for subcontracting with HBCU/MIs.

    Science.gov (United States)

    2010-10-01

    ... subcontracting with HBCU/MIs. 226.370-8 Section 226.370-8 Federal Acquisition Regulations System DEFENSE... subcontracting with HBCU/MIs. (a) In reviewing subcontracting plans submitted under the clause at FAR 52.219-9, Small Business Subcontracting Plan, the contracting officer shall— (1) Ensure that the contractor...

  16. 48 CFR 970.1907-1 - Subcontracting plan requirements.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Subcontracting plan... Small Business Concerns 970.1907-1 Subcontracting plan requirements. Pursuant to the clause at 48 CFR 52.219-9, Small Business Subcontracting Plan, which is required for all management and operating...

  17. 77 FR 10665 - General Services Administration Acquisition Regulation; Acquisition-Related Thresholds

    Science.gov (United States)

    2012-02-23

    ...-related thresholds, the GSAR clause at 552.219-71, Notice to Offerors of Subcontracting Plan Requirements... Negotiation of Subcontracting Plans, is revised by removing ``$500,000'' and ``$1,000,000'' and replacing the... of Subcontracting Plan Requirements. * * * * * Notice to Offereors of Subcontracting Plan...

  18. Effect of different drying techniques on the volatile compounds ...

    African Journals Online (AJOL)

    constituents of thyme (Thymus vulgaris L) and sage. (Salvia officinalis L). Food Chem 1997; 59: 219-227. 19. Dahmoune F, Boulekbache L, Moussi K, Aoun O, Spigno. G, Madani K. Valorization of Citrus limon residues for the recovery of antioxidants: Evaluation and optimization of microwave and ultrasound application to ...

  19. Governance, marketing and innovations in Beninese pineapple supply chains : a survey of smallholder farmers in South Benin

    NARCIS (Netherlands)

    Arinloye, D.D.A.A.

    2013-01-01

    The main goal of the study was to identify an innovative approach that could overcome market quality and price information asymmetry issues in pineapple supply chain in Benin. Two case studies were conducted in Benin and Ghana, with an in-depth survey of 219 farmers in Benin. The study mapped the

  20. Partnered Decisions? U.S. Couples and Medical Help-Seeking for Infertility

    Science.gov (United States)

    Johnson, Katherine M.; Johnson, David R.

    2009-01-01

    We examined male partners' influence on the decision to seek medical help for infertility using the National Study of Fertility Barriers. Building upon an existing help-seeking framework, we incorporated characteristics of both partners from 219 heterosexual couples who had ever perceived a fertility problem. In logistic regression analyses, we…

  1. 2017-2018 Travel Expense Reports for Barbara Lucille Trenholm ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Airfare: $436.15. Other. Transportation: $98.00. Accommodation: $361.85. Meals and. Incidentals: $219.51. Other: $0.00. Total: $1,115.51. Comments: From her residence in Fredericton, NB. 2017-2018 Travel Expense Reports for. Barbara Lucille Trenholm, Governor,. Chairperson of the Finance and Audit. Committee.

  2. Nutritional Assessment of Children with Handicapping Conditions.

    Science.gov (United States)

    Brown, Judith E.; And Others

    1979-01-01

    Discusses the methods and results of a nutritional assessment involving 64 noninstitutionalized children (ages 2-19 years) with various types of handicapping conditions. It is explained that, in general, children were smaller in weight and height than average and frequently consumed unbalanced diets. (Author/PHR)

  3. AcEST: DK946508 [AcEST

    Lifescience Database Archive (English)

    Full Text Available it) - E-value - Report BLASTX 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejan...2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang,

  4. AcEST: DK947237 [AcEST

    Lifescience Database Archive (English)

    Full Text Available it) - E-value - Report BLASTX 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejan...2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang,

  5. AcEST: DK945411 [AcEST

    Lifescience Database Archive (English)

    Full Text Available it) - E-value - Report BLASTX 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejan...2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang,

  6. AcEST: DK947284 [AcEST

    Lifescience Database Archive (English)

    Full Text Available bit) - E-value - Report BLASTX 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Aleja....2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang,

  7. AcEST: BP920082 [AcEST

    Lifescience Database Archive (English)

    Full Text Available .2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang,... - Definition - Align length - Score (bit) - E-value - Report BLASTX 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas

  8. New JLab/Hall A Deeply Virtual Compton Scattering results

    OpenAIRE

    Defurne, Maxime; DVCS, Hall A

    2014-01-01

    New data points for unpolarized Deeply Virtual Compton Scattering cross sections have been extracted from the E00-110 experiment at Q$^2$=1.9~GeV$^2$ effectively doubling the statistics available in the valence region. A careful study of systematic uncertainties has been performed.

  9. New JLab/Hall A Deeply Virtual Compton Scattering results

    CERN Document Server

    Defurne, Maxime

    2015-01-01

    New data points for unpolarized Deeply Virtual Compton Scattering cross sections have been extracted from the E00-110 experiment at Q$^2$=1.9 GeV$^2$ effectively doubling the statistics available in the valence region. A careful study of systematic uncertainties has been performed.

  10. A Comparison Study of 9th Graders in the U.S. and Albania

    Science.gov (United States)

    Garo, Sofokli

    2008-01-01

    The purpose of this research is to compare American and Albanian students' achievement in Algebra 1 and to identify the educational practices that influence students' achievement in each country. The study compared algebraic solving abilities of 242 ninth-grade American students in Grand Forks (U.S.) and 219 students in Durres (Albania). The data…

  11. Evaluation of 11 polycyclic aromatic hydrocarbon metabolites in urine of Czech mothers and newborns

    Czech Academy of Sciences Publication Activity Database

    Urbancová, K.; Lanková, D.; Rössner ml., Pavel; Rössnerová, Andrea; Švecová, Vlasta; Tomaniová, M.; Veleminský Jr., M.; Šrám, Radim; Hajslová, J.; Pulkrabová, J.

    2016-01-01

    Roč. 577, jan (2016), s. 212-219 ISSN 0048-9697 R&D Projects: GA ČR(CZ) GA13-13458S Institutional support: RVO:68378041 Keywords : U-HPLC-MS/MS * OH-PAHs * Czech Republic Subject RIV: DN - Health Impact of the Environment Quality Impact factor: 4.900, year: 2016

  12. 38 CFR 21.5820 - Educational assistance.

    Science.gov (United States)

    2010-07-01

    ... (CONTINUED) VOCATIONAL REHABILITATION AND EDUCATION Educational Assistance Test Program Payments-Educational... the 2003-04 standard academic year the amount of this assistance may not exceed $4,219. (2) The amount of educational assistance payable to a servicemember, veteran, spouse or dependent child of a living...

  13. Intestinal Parasites among Waste-Handlers in Jos Metropolitan Area ...

    African Journals Online (AJOL)

    Parasite egg intensity was, however, low with Ascaris lumbricoides showing 86,226 +795 eggs per gram (epg),Ancylostoma duodenale 17,352+156 epg, Trichuris trichiura 1295+219 epg and Hymenolepis nana 265+44 epg. Waste disposal workers are at high risk of infection with different species of intestinal parasites.

  14. Brief Report: Inter-Relationship between Emotion Regulation, Intolerance of Uncertainty, Anxiety, and Depression in Youth with Autism Spectrum Disorder

    Science.gov (United States)

    Cai, Ru Ying; Richdale, Amanda L.; Dissanayake, Cheryl; Uljarevic, Mirko

    2018-01-01

    The aim of this study was to examine the inter-relationship between emotion regulation (ER), intolerance of uncertainty (IU), and symptoms of anxiety and depression in adolescents and young adults diagnosed with autism spectrum disorder (ASD). Sixty-one individuals aged 14-24 years (M[subscript age] = 18.19; SD[subscript age] = 2.19) completed the…

  15. Circumstances Surrounding Male Sexual Assault and Rape: Findings from the National Violence against Women Survey

    Science.gov (United States)

    Light, David; Monk-Turner, Elizabeth

    2009-01-01

    Much work in the area of male sexual assault and rape relies on small clinical samples. From these samples, researchers reported that most male victims were physically injured during the attack and that penetration occurred. This work rests on a subsample of 219 men from the 1994-1996 Violence and Threats of Violence Against Women and Men in the…

  16. Outcome after discontinuation of infliximab in patients with inflammatory bowel disease in clinical remission

    DEFF Research Database (Denmark)

    Steenholdt, Casper; Molazahi, Akbar; Ainsworth, Mark Andrew

    2012-01-01

    -center, retrospective study of all patients with a primary response to IFX who discontinued IFX therapy while in steroid-free remission. Relapse was defined as reintroduction of treatment with a biologic, systemic steroid or surgery. Results. Of 219, 53 (24%) CD patients, and 28 of 97 (30%) UC patients discontinued IFX...

  17. 75 FR 60782 - Notice of Regulatory Waiver Requests Granted for the Second Quarter of Calendar Year 2010

    Science.gov (United States)

    2010-10-01

    ... construction of a 71 unit apartment complex to serve independent elderly residents in Elverson, PA. The... Plan regulations, a grantee may amend its plan in order to change its allocation priorities, to carry... improved security upgrades for the elderly residents of the project. Nature of Requirement: Section 219.220...

  18. A critical look at health

    African Journals Online (AJOL)

    An analysis of coping in a middle aged community sample. Journal of Health & Social Behaviour 1980;21:219-239. 10. Reisine S, Fifield J. Family work demands, employment demands and depressive symp- toms in women with rheumatoid arthritis. Women. & Health 1995;22:25-45. 11. Hough ES, Brumitt GA, Templin TN.

  19. Adolescents\\' Risky Sexual Behaviour and Efficacy of Psycho ...

    African Journals Online (AJOL)

    Adolescents\\' Risky Sexual Behaviour and Efficacy of Psycho-Education Intervention Programme amoung Secondary School Students in Oyo State. GA Adejuwon, PO Olapegba, AO Taiwo. Abstract. No Abstract Available African Journal for the Psychological Study of Social Issues Vol.7(2) 2004: 205-219. Full Text:.

  20. Prevalence of adverse drug reactions in adult patients on anti ...

    African Journals Online (AJOL)

    Results: Systematic random sampling was used to pick 350 patients' files. There were 219 recorded adverse drug reactions in 170 (48.6%) patients (some patients had more than one adverse drug reaction). Peripheral neuropathy was the most common adverse drug reaction with a prevalence of 28.9% followed by lipid ...