International Nuclear Information System (INIS)
Ruth, T.J.; Dombsky, M.; D'Auria, J.M.; Ward, T.E.
1988-01-01
This monograph is a review of the literature through 1987 and covers the methods of producing the radioisotopes of astatine and the inorganic, nuclear, and organic chemistry of astatine. The discussion is limited to chemical and physical chemical properties of astatine. The monograph, after the introduction, is divided into chapters titled: production methods, nuclear spectroscopy, chemistry of astatine, separation and isolation (dry and wet), and selected procedures. 209 refs., 15 figs., 7 tabs
Formation and decomposition of astatine molecules
International Nuclear Information System (INIS)
Takahashi, Naruto; Ishikuro, Mituhiro; Baba Hiroshi
1989-01-01
A method determining the boiling points of elementary astatine and astatine iodide has been developed (K. Otozai and N. Takahashi, Radio. Chim. Acta 31, (1982) 201). Further, it was concluded from the simple rule among the boiling point of elementary halogens and interhalogen compounds that elementary astatine might exist in diatomic molecules as the other halogens. In the present work the reaction mechanisms of elementary astatine with radioactive iodine and organic solvents were studied by means of radiogaschromatography in order to obtain further experimental evidences for diatomic astaine molecules. The following conclusions were obtained by the analysis of reaction kinetics. Two astatine atoms are lost from the elementary astatine fraction per each radioactive decay of astatine. The astatine radical or hot atom liberated by the decay of the complementary astatine atom immediately reacts with iodine or organic solvents. Thus formed astatine compounds decompose in turn due to the decay of astatine
Organic astatine compounds, their preparation and properties
Energy Technology Data Exchange (ETDEWEB)
Vasaros, L; Berei, K
1985-01-01
Aromatic astatine compounds of possible medical application were prepared by high energy substitutions, by astatine-halogen, and by electrophil astatine-hydrogen substitutions at the Joint Institute of Nuclear Researches, Dubna. Physico-chemical properties of organic astatine compounds such as boiling point and evaporation heat, and the refraction and dissociation energy of carbon-astatine bonds were determined experimentally by gas chromatography. The results are compared with extrapolated data. (V.N.). 41 refs.; 7 figs.; 5 tables.
Recent advances in the organic chemistry of astatine
International Nuclear Information System (INIS)
Berei, K.; Vasaros, L.
1994-03-01
Investigation on the chemical behaviour of astatine in the last decade are surveyed. The survey covers the physical and chemical properties of astatine, synthesis and identification of organic astatine compounds, their physicochemical properties. A special chapter is devoted to biomedical applications, including inorganic 211 At species, 211 At-labelled proteins and drugs. An extensive bibliography of the related literature is given. (N.T.) 129 refs.; 12 figs.; 14 tabs
Experimental and computational evidence of halogen bonds involving astatine
Guo, Ning; Maurice, Rémi; Teze, David; Graton, Jérôme; Champion, Julie; Montavon, Gilles; Galland, Nicolas
2018-03-01
The importance of halogen bonds—highly directional interactions between an electron-deficient σ-hole moiety in a halogenated compound and an acceptor such as a Lewis base—is being increasingly recognized in a wide variety of fields from biomedicinal chemistry to materials science. The heaviest halogens are known to form stronger halogen bonds, implying that if this trend continues down the periodic table, astatine should exhibit the highest halogen-bond donating ability. This may be mitigated, however, by the relativistic effects undergone by heavy elements, as illustrated by the metallic character of astatine. Here, the occurrence of halogen-bonding interactions involving astatine is experimentally evidenced. The complexation constants of astatine monoiodide with a series of organic ligands in cyclohexane solution were derived from distribution coefficient measurements and supported by relativistic quantum mechanical calculations. Taken together, the results show that astatine indeed behaves as a halogen-bond donor—a stronger one than iodine—owing to its much more electrophilic σ-hole.
Bibliography of astatine chemistry and biomedical applications
International Nuclear Information System (INIS)
Berei, K.; Vasaros, L.
1992-02-01
An overall bibliography is presented on astatine chemistry and on the biomedical applications of its 211 At isotope. The references were grouped in the following chapters: General reviews; Discovery, Natural Occurence; Nuclear Data; Preparation, Handling, Radiation Risk; Physico-chemical Properties; Astatine Compounds and Chemical Reactions; Biological Effects and Applications. Entries are sorted alphabetically by authors name in each chapter, and cross-references to other chapters are provided if appropriate. (R.P.)
Measurement of the first ionization potential of astatine by laser ionization spectroscopy
Rothe, S.; Andreyev, A. N.; Antalic, S.; Borschevsky, A.; Capponi, L.; Cocolios, T. E.; De Witte, H.; Eliav, E.; Fedorov, D. V.; Fedosseev, V. N.; Fink, D. A.; Fritzsche, S.; Ghys, L.; Huyse, M.; Imai, N.; Kaldor, U.; Kudryavtsev, Yuri; Köster, U.; Lane, J. F. W.; Lassen, J.; Liberati, V.; Lynch, K. M.; Marsh, B. A.; Nishio, K.; Pauwels, D.; Pershina, V.; Popescu, L.; Procter, T. J.; Radulov, D.; Raeder, S.; Rajabali, M. M.; Rapisarda, E.; Rossel, R. E.; Sandhu, K.; Seliverstov, M. D.; Sjödin, A. M.; Van den Bergh, P.; Van Duppen, P.; Venhart, M.; Wakabayashi, Y.; Wendt, K. D. A.
2013-01-01
The radioactive element astatine exists only in trace amounts in nature. Its properties can therefore only be explored by study of the minute quantities of artificially produced isotopes or by performing theoretical calculations. One of the most important properties influencing the chemical behaviour is the energy required to remove one electron from the valence shell, referred to as the ionization potential. Here we use laser spectroscopy to probe the optical spectrum of astatine near the ionization threshold. The observed series of Rydberg states enabled the first determination of the ionization potential of the astatine atom, 9.31751(8) eV. New ab initio calculations are performed to support the experimental result. The measured value serves as a benchmark for quantum chemistry calculations of the properties of astatine as well as for the theoretical prediction of the ionization potential of superheavy element 117, the heaviest homologue of astatine. PMID:23673620
Automated astatination of biomolecules - a stepping stone towards multicenter clinical trials
DEFF Research Database (Denmark)
Aneheim, Emma; Albertsson, Per; Bäck, Tom
2015-01-01
To facilitate multicentre clinical studies on targeted alpha therapy, it is necessary to develop an automated, on-site procedure for conjugating rare, short-lived, alpha-emitting radionuclides to biomolecules. Astatine-211 is one of the few alpha-emitting nuclides with appropriate chemical...... vector, which can guide the radiation to the cancer cells. Consequently, an appropriate method is required for coupling the nuclide to the vector. To increase the availability of astatine-211 radiopharmaceuticals for targeted alpha therapy, their production should be automated. Here, we present a method...... challenging, alpha-emitting radionuclide. In this work, we describe the process platform, and we demonstrate the production of both astaine-211, for preclinical use, and astatine-211 labelled antibodies....
DEFF Research Database (Denmark)
Aneheim, Emma; Gustafsson, Anna; Albertsson, Per
2016-01-01
Effective treatment of metastasis is a great challenge in the treatment of different types of cancers. Targeted alpha therapy utilizes the short tissue range (50-100 μm) of α particles, making the method suitable for treatment of disseminated occult cancers in the form of microtumors or even single...... to the antibody arbitrarily on lysine residues. By instead coupling astatine to disulfide bridges in the antibody structure, the immunoreactivity of the antibody conjugates could possibly be increased. Here, the disulfide-based conjugation was performed using a new coupling reagent, maleimidoethyl 3......-(trimethylstannyl)benzamide (MSB), and evaluated for chemical stability in vitro. The immunoconjugates were subsequently astatinated, resulting in both high radiochemical yield and high specific activity. The MSB-conjugate was shown to be stable with a long shelf life prior to the astatination. In a comparison...
The reaction of astatine with aromatic diazonium compounds
International Nuclear Information System (INIS)
Visser, G.W.M.; Diemer, E.L.
1982-01-01
Astatine reacts prefrentially with that type of aromatic diazonium salt that decomposes via a radical reaction channel (homolytic breakage of the C-N bond). The dediazonation with p-aminobenzoic acid and p-toluidine as model compounds was investigated through estatin produced in the 209 Bi(α,2n) 211 At reaction. (author)
International Nuclear Information System (INIS)
Sjoestroem, A.; Carlsson, J.; Lundqvist, H.; Koziorowski, J.
2003-01-01
A method for direct astatine labeling of proteins has been investigated. Binding sites for astatine were created by coupling of a nido-carborane derivative to a protein, the human epidermal growth factor (hEGF), using two different conjugation methods - by glutaraldehyde cross-linking or by introduction of sulfohydryl groups by Traut's reagent with subsequent linking of ANC-1 with m-maleimidobenzoyl-N-hydroxysulfosuccinimide ester. The conjugates were astatinated using the Chloramine-T method in high yield. The best labeling was obtained by the glutaraldehyde conjugate with an average yield of 68 ± 9%. In vitro stability tests indicated that the glutaraldehyde conjugated label was as stable as hEGF labeled with astatobenzoate. (author)
Some aspects of the organic, biological and inorganic chemistry of astatine
International Nuclear Information System (INIS)
Visser, G.W.M.
1982-01-01
Astatine has no stable isotopes and the radioactive isotopes with half-lives sufficiently long for chemical experiments ( 209 At, 210 At, 211 At) must be produced artificially with a cyclotron or with a high energy accelerator by spallation of Th. This thesis deals with the synthesis and chemistry of At-compounds and the determination of some of their properties. (C.F.)
International Nuclear Information System (INIS)
Nestor, M.; Anniko, M.; Persson, M.; Dongen, G.A.M.S. van; Jensen, H.J.; Lundqvist, H.; Tolmachev, V.
2005-01-01
The purpose of this study was to analyse the properties of the astatinated chimeric MAb (cMAb) U36 as a conjugate to selectively target and eradicate head and neck squamous cell carcinoma (HNSCC). cMAb U36 was labelled with 211 At via the linker N-succinimidyl 4-(trimethylstannyl)benzoate (SPMB). The quality of the conjugate was extensively evaluated for binding and internalisation capacity, and compared with 125 I-SPMB-cMAb U36. The cellular toxicity of the astatinated conjugate was assessed in two types of in vitro growth assay and compared with 131 I-labelled cMAb U36 (directly labelled). Comparisons between 211 At-cMAb U36 and 125 I-cMAb U36 demonstrated an optimal functional capacity of the labelled products. Immunoreactivity and affinity assays showed high immunoreactive fractions (>93%), and an affinity in good agreement between the astatinated and iodinated antibodies. For both conjugates, specific binding to HNSCC cells could be demonstrated, as well as some internalisation. Retention of the astatinated conjugate was just slightly lower than for the iodinated conjugate and still reasonable for therapeutic use (31±2% vs 42.6±1.0% at 22 h), demonstrating no adverse effects from astatination of the antibody. Studies on cellular toxicity demonstrated a dose-dependent and antigen-specific cellular toxicity for 211 At-cMAb U36, with about 10% cell survival at 50 decays per cell. The 131 I-labelled conjugate was not as efficient, with a surviving cell fraction of about 50% at 55 decays per cell. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Nestor, M.; Anniko, M. [Uppsala University, Unit of Otolaryngology and Head and Neck Surgery, Department of Surgical Sciences, Uppsala (Sweden); Persson, M. [Uppsala University, Unit of Urology, Department of Surgical Sciences, Uppsala (Sweden); Uppsala University, Unit of Biomedical Radiation Science, Department of Oncology, Radiology and Clinical Immunology, Uppsala (Sweden); Dongen, G.A.M.S. van [Vrije Universiteit Medical Center, Department of Otolaryngology/Head and Neck Surgery, Amsterdam (Netherlands); Jensen, H.J. [Righshospitalet, PET and Cyclotron Unit, Department of Clinical Physiology and Nuclear Medicine, Copenhagen (Denmark); Lundqvist, H.; Tolmachev, V. [Uppsala University, Unit of Biomedical Radiation Science, Department of Oncology, Radiology and Clinical Immunology, Uppsala (Sweden)
2005-11-01
The purpose of this study was to analyse the properties of the astatinated chimeric MAb (cMAb) U36 as a conjugate to selectively target and eradicate head and neck squamous cell carcinoma (HNSCC). cMAb U36 was labelled with {sup 211}At via the linker N-succinimidyl 4-(trimethylstannyl)benzoate (SPMB). The quality of the conjugate was extensively evaluated for binding and internalisation capacity, and compared with {sup 125}I-SPMB-cMAb U36. The cellular toxicity of the astatinated conjugate was assessed in two types of in vitro growth assay and compared with {sup 131}I-labelled cMAb U36 (directly labelled). Comparisons between {sup 211}At-cMAb U36 and {sup 125}I-cMAb U36 demonstrated an optimal functional capacity of the labelled products. Immunoreactivity and affinity assays showed high immunoreactive fractions (>93%), and an affinity in good agreement between the astatinated and iodinated antibodies. For both conjugates, specific binding to HNSCC cells could be demonstrated, as well as some internalisation. Retention of the astatinated conjugate was just slightly lower than for the iodinated conjugate and still reasonable for therapeutic use (31{+-}2% vs 42.6{+-}1.0% at 22 h), demonstrating no adverse effects from astatination of the antibody. Studies on cellular toxicity demonstrated a dose-dependent and antigen-specific cellular toxicity for {sup 211}At-cMAb U36, with about 10% cell survival at 50 decays per cell. The {sup 131}I-labelled conjugate was not as efficient, with a surviving cell fraction of about 50% at 55 decays per cell. (orig.)
International Nuclear Information System (INIS)
Lindegren, S.; Andersson, H.; Baeck, T.; Jacobsson, L.; Karlsson, B.; Skarnemark, G.
2001-01-01
Monoclonal antibodies C215, reactive with colorectal carcinomas, and MOv18, reactive with most of the ovarian carcinomas, were radiohalogenated with [ 211 At]astatine. The radiohalogen was conjugate coupled to antibodies via the intermediate labelling reagent N-succinimidyl-3-(trimethylstannyl)benzoate (m-MeATE) in a two-step, single-pot reaction. Optimisation of the labelling of the reagent was achieved using N-iodosuccinimide, NIS, as the oxidising agent. The yields ranged from 69-95% in the labelling of 0.1-1.0 nmole of the m-MeATE precursor. Subsequent conjugation to antibodies resulted in yields of 58±7%. In vitro binding to tumour cells showed that the immunoreactivity of both antibodies was retained after astatine labelling
211At-Rh(16-S4-diol) complex as a precursor for astatine radiopharmaceuticals
International Nuclear Information System (INIS)
Pruszynski, M.; Bilewicz, A.
2006-01-01
211 At is one of the most promising radionuclides in α-radioimmunotherapy (α-RIT). Unfortunately, biomolecules labeled by direct electrophilic astatination are unstable due to the rapid loss of 211 At under both in vitro and in vivo conditions. The present paper describes the results of our studies on attaching At - to the rhodium(III) complex with thioether ligand: 1,5,9,13-etrathiacyclohexadecane-3,11-diol (16-S4-diol). Rh 3+ was chosen as a moderately soft metal cation which should form very strong bonds with soft At - anions, but first of all because of the kinetic inertness of low spin rhodium(III) d 6 complexes. The 16-S4-diol ligand was selected due to formation of stable complexes with Rh 3+ . The experiments related to optimization of the reaction conditions were performed with the 131 I, basing on a chemical similarity of I - to At - . The experiments with 211 At were then carried out under the conditions found optimal for I - . The preliminary results are promising, and indicate a possibility for astatination of biomolecules by using the 211 At-Rh(16-S4-diol) complex
Czech Academy of Sciences Publication Activity Database
Sjostrom, A.; Tolmachev, V.; Lebeda, Ondřej; Koziorowski, J.; Carlsson, J.; Lundqvist, H.
2003-01-01
Roč. 256, č. 7 (2003), s. 191-197 ISSN 0236-5731 R&D Projects: GA AV ČR KSK4055109 Keywords : neutron-capture therapy * astatine-211 Subject RIV: CH - Nuclear ; Quantum Chemistry Impact factor: 0.472, year: 2003
International Nuclear Information System (INIS)
Rothe, Sebastian
2012-01-01
This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at CERN/ISOLDE by the addition of an all-solid state tunable titanium:sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE/CERN and at ISAC/TRIUMF radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.
Rothe, Sebastian; Nörtershäuser, W
This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at ISOLDE, CERN, by the addition of an all-solid state tuneable titanium: sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE, CERN, and at ISAC, TRIUMF, radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.
Energy Technology Data Exchange (ETDEWEB)
Rothe, Sebastian
2012-09-24
This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at CERN/ISOLDE by the addition of an all-solid state tunable titanium:sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE/CERN and at ISAC/TRIUMF radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.
Determination of the electron affinity of astatine and polonium by laser photodetachment
We propose to conduct the first electron affinity (EA) measurements of the two elements astatine (At) and polonium (Po). Collinear photo-detachment spectroscopy will allow us to measure these quantities with an uncertainty limited only by the spectral line width of the laser. We plan to use negative ion beams of the two radioactive elements At and Po, which are only accessible on-line and at ISOLDE. The feasibility of our proposed method and the functionality of the experimental setup have been demonstrated at ISOLDE in off-line tests by the clear observation of the photo-detachment threshold for stable iodine. This proposal is based on our Letter of Intent I-148.
International Nuclear Information System (INIS)
Eichler, B.; Son Chun, K.
1985-01-01
In order to investigate the adsorption of astatine and radon on a palladium surface some on- and off-line thermochromatographic experiments were carried out with 210 At and 220 Rn tracers. The partial molar adsorption enthalpy for zero covering was found to be ΔH/sub a//sup 0, loc./(At) = -(15S +- 10) kJ mole -1 and ΔH/sub a//sup 0, mob./(Rn) = -(37 +- 4) kJ mole -1 . The results are compared with theoretical and experimental values for other elements of the sixth period. The adsorption behaviour of At is in conformity with that of the p-metals on a palladium surface. (author)
International Nuclear Information System (INIS)
Otozai, K.; Takahashi, N.
1982-01-01
After astatine (0) was mixed with 131 I 2 containing carrier I 2 , the sample was analyzed by means of radiogaschromatography and the peaks due to I 2 , AtI and At 2 were observed. Further, the boiling points were estimated from the retention volume in terms of the semi-empirical theory on gas chromatography. The boiling points of I 2 , AtI and At 2 were 457 +- 2,486 +- 2 and 503 +- 3K, respectively. The boiling point of At 2 obtained in the present work is far smaller than that expected by the extrapolation of lighter halogens. (orig.)
Rothe, Sebastian; Welander, Jakob Emanuel; Chrysalidis, Katerina; Day Goodacre, Thomas; Fedosseev, Valentine; Fiotakis, Spyridon; Forstner, Oliver; Heinke, Reinhard Matthias; Johnston, Karl; Kron, Tobias; Koester, Ulli; Liu, Yuan; Marsh, Bruce; Ringvall Moberg, Annie; Rossel, Ralf Erik; Seiffert, Christoph; Studer, Dominik; Wendt, Klaus; Hanstorp, Dag
2017-01-01
Negatively charged ions are mainly stabilized through the electron correlation effect. A measure of the stability of a negative ion is the electron affinity, which the energy gain by attaching an electron to a neutral atom. This fundamental quantity is, due to the almost general lack of bound excited states, the only atomic property that can be determined with high accuracy for negative ions. We will present the results of the first laser photodetachment studies of radioactive negative ions at CERN-ISOLDE. The photodetachment threshold for the radiogenic iodine isotope 128I was measured successfully, demonstrating the performance of the upgraded GANDALPH experimental beam line. The first detection of photo-detached astatine atoms marks a milestone towards the determination of the EA of this radioactive element.
2010-10-01
... 46 Shipping 1 2010-10-01 2010-10-01 false Fees. 10.219 Section 10.219 Shipping COAST GUARD... Requirements for All Merchant Mariner Credentials § 10.219 Fees. (a) Use table 10.219(a) of this section to calculate the mandatory fees for MMCs and associated endorsements. Table 10.219(a) Fees If you apply for And...
Andreyev, Andrei
2013-01-01
Part I: $\\beta$-delayed fission, laser spectroscopy and shape-coexistence studies with astatine beams; Part II: Delineating the island of deformation in the light gold isotopes by means of laser spectroscopy
2010-10-01
... 47 Telecommunication 2 2010-10-01 2010-10-01 false [Reserved] 25.219 Section 25.219 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES SATELLITE COMMUNICATIONS Technical Standards § 25.219 [Reserved] ...
Complexation study on no-carrier-added astatine with insulin: A candidate radiopharmaceutical
Energy Technology Data Exchange (ETDEWEB)
Lahiri, Susanta [Chemical Sciences Division, Saha Institute of Nuclear Physics, 1/AF Bidhannagar, Kolkata 700 064 (India)], E-mail: susanta.lahiri@saha.ac.in; Roy, Kamalika [Chemical Sciences Division, Saha Institute of Nuclear Physics, 1/AF Bidhannagar, Kolkata 700 064 (India); Sen, Souvik [Berhampur Sadar Hospital, Berhampur, Murshidabad 742 101 (India)
2008-12-15
No-carrier-added astatine radionuclides produced in the {sup 7}Li-irradiated lead matrix were separated from bulk lead nitrate target by complexing At with insulin, followed by dialysis. The method offers simultaneous separation of At from lead as well as its complexation with insulin. The At-insulin complex might be a potential radiopharmaceutical in the treatment of hepatocellular carcinoma. The stability of At-insulin complex was checked by dialysis against deionized water and Ringer lactate (RL) solution. It has been found that the half-life of At-insulin complex is about {approx}12 h, when dialyzed against deionized water and is only 6 h, when dialyzed against RL solution having the same composition as blood serum. The 6 h half-life of this Insulin-At complex is perfect for killing cancer cells from external cell surfaces as the half-life of internalization of insulin molecule inside the cell is 7-12 h.
Complexation study on no-carrier-added astatine with insulin: A candidate radiopharmaceutical
International Nuclear Information System (INIS)
Lahiri, Susanta; Roy, Kamalika; Sen, Souvik
2008-01-01
No-carrier-added astatine radionuclides produced in the 7 Li-irradiated lead matrix were separated from bulk lead nitrate target by complexing At with insulin, followed by dialysis. The method offers simultaneous separation of At from lead as well as its complexation with insulin. The At-insulin complex might be a potential radiopharmaceutical in the treatment of hepatocellular carcinoma. The stability of At-insulin complex was checked by dialysis against deionized water and Ringer lactate (RL) solution. It has been found that the half-life of At-insulin complex is about ∼12 h, when dialyzed against deionized water and is only 6 h, when dialyzed against RL solution having the same composition as blood serum. The 6 h half-life of this Insulin-At complex is perfect for killing cancer cells from external cell surfaces as the half-life of internalization of insulin molecule inside the cell is 7-12 h
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Construction. 219.17 Section 219.17 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION, DEPARTMENT OF TRANSPORTATION CONTROL OF ALCOHOL AND DRUG USE General § 219.17 Construction. Nothing in this part— (a) Restricts...
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Employment. 219.140 Section 219.140 Foreign... DEVELOPMENT § 219.140 Employment. No qualified handicapped person shall, on the basis of handicap, be subjected to discrimination in employment under any program or activity conducted by the agency. The...
2010-07-01
... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Principles. 219.2 Section 219... Forest System Land and Resource Management Planning Purpose and Principles § 219.2 Principles. The planning regulations in this subpart are based on the following principles: (a) The first priority for...
2010-01-01
... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Settlement. 280.219 Section 280.219... Enforcement § 280.219 Settlement. (a) Cases may be settled before service of a charging letter. In cases in which settlement is reached before service of a charging letter, a proposed charging letter will be...
49 CFR 219.13 - Preemptive effect.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Preemptive effect. 219.13 Section 219.13 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION, DEPARTMENT OF TRANSPORTATION CONTROL OF ALCOHOL AND DRUG USE General § 219.13 Preemptive effect. (a) Under...
45 CFR 150.219 - Final determination.
2010-10-01
... 45 Public Welfare 1 2010-10-01 2010-10-01 false Final determination. 150.219 Section 150.219... Are Failing To Substantially Enforce HIPAA Requirements § 150.219 Final determination. If, after... the State a written notice of its final determination. The notice includes the following: (a...
49 CFR 21.9 - Compliance information.
2010-10-01
... 49 Transportation 1 2010-10-01 2010-10-01 false Compliance information. 21.9 Section 21.9 Transportation Office of the Secretary of Transportation NONDISCRIMINATION IN FEDERALLY-ASSISTED PROGRAMS OF THE DEPARTMENT OF TRANSPORTATION-EFFECTUATION OF TITLE VI OF THE CIVIL RIGHTS ACT OF 1964 § 21.9 Compliance information. (a) Cooperation and...
48 CFR 653.219 - Small business programs.
2010-10-01
... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Small business programs. 653.219 Section 653.219 Federal Acquisition Regulations System DEPARTMENT OF STATE CLAUSES AND FORMS FORMS Prescription of Forms 653.219 Small business programs. ...
Energy Technology Data Exchange (ETDEWEB)
Wilbur, D. Scott [Univ. of Washington, Seattle, WA (United States)
2011-12-14
The overall objective of this research effort was to develop methods for labeling biomolecules with higher oxidation state species of At-211. This was to be done in an effort to develop reagents that had higher in vivo stability than the present carbon-bonded At-211-labeled compounds. We were unsuccessful in that effort, as none of the approaches studied provided reagents that were stable to in vivo deastatination. However, we gained a lot of information about At-211 in higher oxidation states. The studies proved to be very difficult as small changes in pH and other conditions appeared to change the nature of the species that obtained (by HPLC retention time analyses), with many of the species being unidentifiable. The fact that there are no stable isotopes of astatine, and the chemistry of the nearest halogen iodine is quite different, made it very difficult to interpret results of some experiments. With that said, we believe that a lot of valuable information was obtained from the studies. The research effort evaluated: (1) methods for chemical oxidation of At-211, (2) approaches to chelation of oxidized At-211, and (3) approaches to oxidation of astatophenyl compounds. A major hurdle that had to be surmounted to conduct the research was the development of HPLC conditions to separate and identify the various oxidized species formed. Attempts to develop conditions for separation of iodine and astatine species by normal and reversed-phase TLC and ITLC were not successful. However, we were successful in developing conditions (from a large number of attempts) to separate oxidized forms of iodine ([I-125]iodide, [I-125]iodate and [I-125]periodate) and astatine ([At-211]astatide, [At-211]astatate, [At-211]perastatate, and several unidentified At-211 species). Information on the basic oxidation and characterization of At-211 species is provided under Objective 1. Conditions were developed to obtain new At-211 labeling method where At-211 is chelated with the DOTA and
2010-04-01
... Annuity), 234 (Lump-Sum Payments), and 222 (Family Relationships), certain requirements must be met before... used as evidence. Part 222 defines and explains family relationships for which evidence requirements... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Introduction. 219.1 Section 219.1 Employees...
22 CFR 219.160 - Communications.
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Communications. 219.160 Section 219.160 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS OF HANDICAP IN... communication with applicants, participants, personnel of other Federal entities, and members of the public. (1...
48 CFR 1353.219 - Small business programs.
2010-10-01
... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Small business programs. 1353.219 Section 1353.219 Federal Acquisition Regulations System DEPARTMENT OF COMMERCE CLAUSES AND FORMS FORMS Prescription of Forms 1353.219 Small business programs. Use Form CD-570, Small Business Set...
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Definitions. 219.2 Section 219.2 Employees... some other person. Benefit means any employee annuity, spouse annuity, survivor annuity, or lump-sum... proves to the satisfaction of the Board that an individual meets a requirement for eligibility for...
49 CFR 1542.219 - Supplementing law enforcement personnel.
2010-10-01
... 49 Transportation 9 2010-10-01 2010-10-01 false Supplementing law enforcement personnel. 1542.219 Section 1542.219 Transportation Other Regulations Relating to Transportation (Continued) TRANSPORTATION SECURITY ADMINISTRATION, DEPARTMENT OF HOMELAND SECURITY CIVIL AVIATION SECURITY AIRPORT SECURITY Operations § 1542.219 Supplementing law...
36 CFR 219.17 - Interaction with private landowners.
2010-07-01
... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Interaction with private landowners. 219.17 Section 219.17 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF... Sustainability § 219.17 Interaction with private landowners. The responsible official must seek to collaborate...
International Nuclear Information System (INIS)
Shyful Azizi Abdul Rahman; Abdul Rahim Harun; Rusli Ibrahim; Khairuddin Abdul Rahim
2014-01-01
Developing a good crop production management package; drought resistance variety, effective water and nutrient management in rice production practices is crucial for global climate change adaptation. A research project under IAEA RAS5065 (Supporting Climate-Proofing Rice Production Systems (CRiPS) Based on Nuclear Applications) was conducted from 2012 to 2013, in collaboration with MARDI. Two advanced mutant lines, MR219-4 and MR219-9 were used in this research project to evaluate growth, yield potential and fertilizer uptake under different water input condition (flooded and aerobic). The advanced mutant line MR219-9 showed comparable growth, yield and nitrogen uptake under both flooded and aerobic conditions. The yield and yield components are not significantly different from the parent variety (MR219) but total N uptake was lower than MR219 regardless of water regime. The field trial showed that MR219-9 has a better total N content which is comparable to the aerobic rice variety (MRIA 1) and this indicates that this advance mutant line MR219-9 is a potential aerobic rice variety. (author)
37 CFR 1.219 - Early publication.
2010-07-01
... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Early publication. 1.219... COMMERCE GENERAL RULES OF PRACTICE IN PATENT CASES National Processing Provisions Publication of Applications § 1.219 Early publication. Applications that will be published under § 1.211 may be published...
20 CFR 219.23 - Evidence to prove death.
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Evidence to prove death. 219.23 Section 219... EVIDENCE REQUIRED FOR PAYMENT Evidence of Age and Death § 219.23 Evidence to prove death. (a) Preferred evidence of death. The best evidence of a person's death is— (1) A certified copy of or extract from the...
36 CFR 219.19 - Ecological, social, and economic sustainability.
2010-07-01
... economic sustainability. 219.19 Section 219.19 Parks, Forests, and Public Property FOREST SERVICE..., Social, and Economic Sustainability § 219.19 Ecological, social, and economic sustainability. Sustainability, composed of interdependent ecological, social, and economic elements, embodies the Multiple-Use...
48 CFR 52.219-22 - Small Disadvantaged Business Status.
2010-10-01
.... Status as a small business and status as a small disadvantaged business for general statistical purposes... Business Status. 52.219-22 Section 52.219-22 Federal Acquisition Regulations System FEDERAL ACQUISITION... Clauses 52.219-22 Small Disadvantaged Business Status. As prescribed in 19.308(b), insert the following...
30 CFR 219.102 - Method of payment.
2010-07-01
... writing to the Minerals Management Service, Minerals Revenue Management, P.O. Box 5760, Denver, Colorado... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Method of payment. 219.102 Section 219.102 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR MINERALS REVENUE MANAGEMENT...
Lien, Huang-Wei; Yang, Chung-Hsiang; Cheng, Chia-Hsiung; Liao, Yung-Feng; Han, Yu-San; Huang, Chang-Jen
2013-12-13
Zebrafish synuclein-γ2 (sncgb) has been reported to be expressed specifically in the notochord. However, the mechanism by which the sncgb gene promoter is regulated has not been described. In this paper, we demonstrate that Zinc finger protein 219-like (ZNF219L) and sox9a are involved in the regulation of sncgb gene expression. Furthermore, we observed that over-expression of both ZNF219L and Sox9a resulted in increased sncgb expression. In addition, ZNF219L is physically associated with Sox9a, and simultaneous morpholino knockdown of znf219L and sox9a caused a synergistic decrease of sncgb expression in the notochord. Taken together, our results reveal that coordination of ZNF219L with Sox9a is involved in the regulation of notochord-specific expression of sncgb. Copyright © 2013 The Authors. Published by Elsevier Inc. All rights reserved.
40 CFR 86.219-94 - CVS calibration.
2010-07-01
... 40 Protection of Environment 18 2010-07-01 2010-07-01 false CVS calibration. 86.219-94 Section 86.219-94 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED... Later Model Year Gasoline-Fueled New Light-Duty Vehicles, New Light-Duty Trucks and New Medium-Duty...
49 CFR 173.219 - Life-saving appliances.
2010-10-01
... 49 Transportation 2 2010-10-01 2010-10-01 false Life-saving appliances. 173.219 Section 173.219... Life-saving appliances. (a) A life-saving appliance, self-inflating or non-self-inflating, containing small quantities of hazardous materials that are required as part of the life-saving appliance must...
7 CFR 58.219 - High pressure pumps and lines.
2010-01-01
... 7 Agriculture 3 2010-01-01 2010-01-01 false High pressure pumps and lines. 58.219 Section 58.219....219 High pressure pumps and lines. High pressure lines may be cleaned-in-place and shall be of such construction that dead ends, valves and the high pressure pumps can be disassembled for hand cleaning. The high...
Astatine-211 Radiochemistry: The Development Of Methodologies For High Activity Level Radiosynthesis
International Nuclear Information System (INIS)
Zalutsky, Michael R.
2012-01-01
Targeted radionuclide therapy is emerging as a viable approach for cancer treatment because of its potential for delivering curative doses of radiation to malignant cell populations while sparing normal tissues. Alpha particles such as those emitted by 211At are particularly attractive for this purpose because of their short path length in tissue and high energy, making them highly effective in killing cancer cells. The current impact of targeted radiotherapy in the clinical domain remains limited despite the fact that in many cases, potentially useful molecular targets and labeled compounds have already been identified. Unfortunately, putting these concepts into practice has been impeded by limitations in radiochemistry methodologies. A critical problem is that the synthesis of therapeutic radiopharmaceuticals provides additional challenges in comparison to diagnostic reagents because of the need to perform radio-synthesis at high levels of radioactivity. This is particularly important for α-particle emitters such as 211At because they deposit large amounts of energy in a highly focal manner. The overall objective of this project is to develop convenient and reproducible radiochemical methodologies for the radiohalogenation of molecules with the α-particle emitter 211At at the radioactivity levels needed for clinical studies. Our goal is to address two problems in astatine radiochemistry: First, a well known characteristic of 211At chemistry is that yields for electrophilic astatination reactions decline as the time interval after radionuclide isolation from the cyclotron target increases. This is a critical problem that must be addressed if cyclotrons are to be able to efficiently supply 211At to remote users. And second, when the preparation of high levels of 211At-labeled compounds is attempted, the radiochemical yields can be considerably lower than those encountered at tracer dose. For these reasons, clinical evaluation of promising 211At-labeled targeted
ASTATINE-211 RADIOCHEMISTRY: THE DEVELOPMENT OF METHODOLOGIES FOR HIGH ACTIVITY LEVEL RADIOSYNTHESIS
Energy Technology Data Exchange (ETDEWEB)
MICHAEL R. ZALUTSKY
2012-08-08
Targeted radionuclide therapy is emerging as a viable approach for cancer treatment because of its potential for delivering curative doses of radiation to malignant cell populations while sparing normal tissues. Alpha particles such as those emitted by 211At are particularly attractive for this purpose because of their short path length in tissue and high energy, making them highly effective in killing cancer cells. The current impact of targeted radiotherapy in the clinical domain remains limited despite the fact that in many cases, potentially useful molecular targets and labeled compounds have already been identified. Unfortunately, putting these concepts into practice has been impeded by limitations in radiochemistry methodologies. A critical problem is that the synthesis of therapeutic radiopharmaceuticals provides additional challenges in comparison to diagnostic reagents because of the need to perform radio-synthesis at high levels of radioactivity. This is particularly important for {alpha}-particle emitters such as 211At because they deposit large amounts of energy in a highly focal manner. The overall objective of this project is to develop convenient and reproducible radiochemical methodologies for the radiohalogenation of molecules with the {alpha}-particle emitter 211At at the radioactivity levels needed for clinical studies. Our goal is to address two problems in astatine radiochemistry: First, a well known characteristic of 211At chemistry is that yields for electrophilic astatination reactions decline as the time interval after radionuclide isolation from the cyclotron target increases. This is a critical problem that must be addressed if cyclotrons are to be able to efficiently supply 211At to remote users. And second, when the preparation of high levels of 211At-labeled compounds is attempted, the radiochemical yields can be considerably lower than those encountered at tracer dose. For these reasons, clinical evaluation of promising 211At
36 CFR 219.12 - Collaboration and cooperatively developed landscape goals.
2010-07-01
... cooperatively developed landscape goals. 219.12 Section 219.12 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE PLANNING National Forest System Land and Resource Management Planning Collaborative Planning for Sustainability § 219.12 Collaboration and cooperatively developed landscape goals. (a...
48 CFR 1352.219-71 - Notification to delay performance (Deviation).
2010-10-01
... performance (Deviation). 1352.219-71 Section 1352.219-71 Federal Acquisition Regulations System DEPARTMENT OF....219-71 Notification to delay performance (Deviation). As prescribed in 48 CFR 1319.811-3(b), insert the following clause: Notification To Delay Performance (Deviation) (APR 2010) The contractor shall...
12 CFR 219.1 - Authority, purpose and scope.
2010-01-01
... 12 Banks and Banking 2 2010-01-01 2010-01-01 false Authority, purpose and scope. 219.1 Section 219.1 Banks and Banking FEDERAL RESERVE SYSTEM BOARD OF GOVERNORS OF THE FEDERAL RESERVE SYSTEM REIMBURSEMENT FOR PROVIDING FINANCIAL RECORDS; RECORDKEEPING REQUIREMENTS FOR CERTAIN FINANCIAL RECORDS...
International Nuclear Information System (INIS)
Abdul Rahim Harun; Zarith Shafika Kamarudin; Abdullah, M.Z.; Anna, L.P.K.; Sobri Hussain; Rusli Ibrahim; Khairuddin abdul Rahim
2012-01-01
Two advance rice mutant lines, MR219-4 and MR219-9 derived from mutagenesis of Oryza sativa cv. MR219 with gamma radiation at 300 Gy were evaluated in simulated drought condition in the greenhouse at Malaysian Nuclear Agency. The mutants were evaluated simultaneously with ARN1, a drought resistant variety and MR211 a susceptible cultivar as a check. Randomized complete block design with three replicates was used in the experiment. The evaluation and selection were done based on leaf rolling and leaf drying as well as other agronomic traits, such as, number of tillers per plant, plant height, flag leaf area, grain weight per plant, grain yield per plant, 100-grain weight, harvest index, panicle length and plant biomass. The mutants MR219-4 showed moderate tolerance and MR219-9 showed tolerance to drought respectively as compare to the check variety (ARN1, MR211) and control MR219. Leaf rolling, leaf drying, days to flowering and days to maturity are valuable secondary traits that may provide additional information for selection because of associating with the plant survival under water stress. Further research on expression of drought-tolerant lines under different drought conditions is essential in order to identify particular traits that are associated with drought tolerance and high yield potential. Similarly the importance of secondary traits, relative to other putative traits for drought tolerance, needs to be tested in various environments. (author)
Radiological risk of actinon (219Rn)
International Nuclear Information System (INIS)
Crawford, D.J.
1981-12-01
The research reported was designed to provide information on the following subjects: (1) development of the functional relations between exposure to the 219 Rn decay chain and pertinent health effects; (2) specification of the circumstances under which a significant concentration of the decay chain may occur; (3) recommendation of an exposure standard which will provide protection of the public from significant elevation of health effects; and (4) an assessment of the impact of 219 Rn on determinations of the concentration of the 222 Rn decay chain and/or its precursors
14 CFR 21.9 - Replacement and modification articles.
2010-01-01
... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Replacement and modification articles. 21.9... CERTIFICATION PROCEDURES FOR PRODUCTS AND PARTS General § 21.9 Replacement and modification articles. (a) If a person knows, or should know, that a replacement or modification article is reasonably likely to be...
20 CFR 219.43 - Evidence of child's dependency.
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Evidence of child's dependency. 219.43... EVIDENCE REQUIRED FOR PAYMENT Evidence of Relationship § 219.43 Evidence of child's dependency. (a) When the dependency requirement must be met. Usually the dependency requirement must be met at one of the...
20 CFR 219.24 - Evidence of presumed death.
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Evidence of presumed death. 219.24 Section... EVIDENCE REQUIRED FOR PAYMENT Evidence of Age and Death § 219.24 Evidence of presumed death. When a person cannot be proven dead but evidence of death is needed, the Board may presume he or she died at a certain...
MicroRNA-219 modulates NMDA receptor-mediated neurobehavioral dysfunction
DEFF Research Database (Denmark)
Kocerha, Jannet; Faghihi, Mohammad Ali; Lopez-Toledano, Miguel A
2009-01-01
significantly modulated behavioral responses associated with disrupted NMDA receptor transmission. Furthermore, pretreatment with the antipsychotic drugs haloperidol and clozapine prevented dizocilpine-induced effects on miR-219. Taken together, these data support an integral role for miR-219 in the expression...
Project management plan for Project W-178, 219-S secondary containment
International Nuclear Information System (INIS)
Buckles, D.I.
1995-01-01
This Project Management Plan (PMP) establishes the organizational responsibilities, control systems, and procedures for managing the execution of project activities for Project W-178, the 219-S Secondary Containment Upgrade. The scope of this project will provide the 219-S Facility with secondary containment for all tanks and piping systems. Tank 103 will be replaced with a new tank which will be designated as Tank 104. Corrosion protection shall be installed as required. The cells shall be cleaned and the surface repaired as required. The 219-S Waste Handling Facility (219-S Facility), located in the 200 West Area, was constructed in 1951 to support the 222-S Laboratory Facility. The 219-S Facility has three tanks, TK-101, TK-102, and TK-103, which receive and neutralize low level radioactive wastes from the 222-S Laboratory. For purposes of the laboratory, the different low level waste streams have been designated as high activity and intermediate activity. The 219-S Facility accumulates and treats the liquid waste prior to transferring it to SY Tank Farm in the 200-W Area. Transfers are normally made by pipeline from the 219-S Facility to the 241-SY Tank Farm. Presently transfers are being made by tanker truck to the 200-E Area Tank Farms due to the diversion box catch tank which has been removed from service
48 CFR 552.219-72 - Preparation, Submission, and Negotiation of Subcontracting Plans.
2010-10-01
..., and Negotiation of Subcontracting Plans. 552.219-72 Section 552.219-72 Federal Acquisition Regulations... Text of Provisions and Clauses 552.219-72 Preparation, Submission, and Negotiation of Subcontracting... Negotiation of Subcontracting Plans (JUN 2005) (a) An offeror, other than a small business concern, submitting...
2010-10-01
... TRANSPORTATION CONTROL OF ALCOHOL AND DRUG USE Post-Accident Toxicological Testing § 219.207 Fatality. (a) In the..., United States Code (but not the agent of the Secretary for purposes of the Federal Tort Claims Act...
48 CFR 1852.219-73 - Small business subcontracting plan.
2010-10-01
... Provisions and Clauses 1852.219-73 Small business subcontracting plan. As prescribed in 1819.708-70(a), insert the following provision: Small Business Subcontracting Plan (MAY 1999) (a) This provision is not... contain FAR clause 52.219-9, “Small Business Subcontracting Plan.” The apparent low bidder must submit the...
36 CFR 219.15 - Interaction with American Indian tribes and Alaska Natives.
2010-07-01
... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Interaction with American Indian tribes and Alaska Natives. 219.15 Section 219.15 Parks, Forests, and Public Property FOREST... Collaborative Planning for Sustainability § 219.15 Interaction with American Indian tribes and Alaska Natives...
Radiological risk of actinon (/sup 219/Rn)
Energy Technology Data Exchange (ETDEWEB)
Crawford, D.J.
1981-12-01
The research reported was designed to provide information on the following subjects: (1) development of the functional relations between exposure to the /sup 219/Rn decay chain and pertinent health effects; (2) specification of the circumstances under which a significant concentration of the decay chain may occur; (3) recommendation of an exposure standard which will provide protection of the public from significant elevation of health effects; and (4) an assessment of the impact of /sup 219/Rn on determinations of the concentration of the /sup 222/Rn decay chain and/or its precursors.
Lifescience Database Archive (English)
Full Text Available Japanese medaka Oryzias latipes Oryzias_latipes_L.png 219.png Taxonomy icon (c) Database Center for Life Sci...ence licensed under CC Attribution2.1 Japan アイコン:メダカ HNI-Ⅱ系統バージョン bando 2010/02/15 15:31:07 2010/02/16 09:53:27 ...
43 CFR 2.19 - When will bureaus waive fees?
2010-10-01
... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false When will bureaus waive fees? 2.19 Section... OF INFORMATION ACT Requests for Records under the FOIA § 2.19 When will bureaus waive fees? (a) Fees... section and appendix D to this part. The burden is on you to justify entitlement to a fee waiver. Requests...
2010-07-01
... System Land and Resource Management Planning Purpose and Principles § 219.1 Purpose. (a) Land and... management of these lands. (3) Sustainability, composed of interdependent ecological, social, and economic elements, embodies the principles of multiple-use and sustained-yield without impairment to the...
48 CFR 2452.219-70 - Small business subcontracting plan compliance.
2010-10-01
... of Provisions and Clauses 2452.219-70 Small business subcontracting plan compliance. As prescribed in 2419.708(d), insert the following provision: Small Business Subcontracting Plan Compliance (FEB 2006... the clause at FAR 52.219-9, Small Business Subcontracting Plan. (c) The government will consider...
25 CFR 166.219 - How do I acquire a permit through negotiation?
2010-04-01
... 25 Indians 1 2010-04-01 2010-04-01 false How do I acquire a permit through negotiation? 166.219 Section 166.219 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GRAZING PERMITS Permit Requirements Obtaining A Permit § 166.219 How do I acquire a permit through negotiation? (a) Permits may be negotiated and granted by th...
2010-10-01
... (Acquisition, Technology, and Logistics) its authority under paragraph 8(a)(1)(A) of the Small Business Act (15... DEFENSE SOCIOECONOMIC PROGRAMS SMALL BUSINESS PROGRAMS Contracting With the Small Business Administration (The 8(a) Program) 219.800 General. (a) By Partnership Agreement (PA) between the Small Business...
Lien, Huang-Wei; Yang, Chung-Hsiang; Cheng, Chia-Hsiung; Hung, Chin-Chun; Liao, Wei-Hao; Hwang, Pung-Pung; Han, Yu-San; Huang, Chang-Jen
2013-01-01
The notochord is required for body plan patterning in vertebrates, and defects in notochord development during embryogenesis can lead to diseases affecting the adult. It is therefore important to elucidate the gene regulatory mechanism underlying notochord formation. In this study, we cloned the zebrafish zinc finger 219-like (ZNF219L) based on mammalian ZNF219, which contains nine C2H2-type zinc finger domains. Through whole-mount in situ hybridization, we found that znf219L mRNA is mainly expressed in the zebrafish midbrain-hindbrain boundary, hindbrain, and notochord during development. The znf219L morpholino knockdown caused partial abnormal notochord phenotype and reduced expression of endogenous col2a1a in the notochord specifically. In addition, ZNF219L could recognize binding sites with GGGGG motifs and trigger augmented activity of the col2a1a promoter in a luciferase assay. Furthermore, in vitro binding experiments revealed that ZNF219L recognizes the GGGGG motifs in the promoter region of the zebrafish col2a1a gene through its sixth and ninth zinc finger domains. Taken together, our results reveal that ZNF219L is involved in regulating the expression of col2a1a in zebrafish notochord specifically.
49 CFR 219.701 - Standards for drug and alcohol testing.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Standards for drug and alcohol testing. 219.701... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION CONTROL OF ALCOHOL AND DRUG USE Drug and Alcohol Testing Procedures § 219.701 Standards for drug and alcohol testing. (a) Drug testing required or authorized by subparts B...
20 CFR 219.30 - When evidence of marriage is required.
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false When evidence of marriage is required. 219.30... EVIDENCE REQUIRED FOR PAYMENT Evidence of Relationship § 219.30 When evidence of marriage is required. (a) When an application is filed for benefits. Documentary evidence of marriage is required when an...
20 CFR 219.33 - Evidence of a deemed valid marriage.
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Evidence of a deemed valid marriage. 219.33... EVIDENCE REQUIRED FOR PAYMENT Evidence of Relationship § 219.33 Evidence of a deemed valid marriage. (a) Preferred evidence. Preferred evidence of a deemed valid marriage is— (1) Evidence of a ceremonial marriage...
20 CFR 219.32 - Evidence of a common-law marriage.
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Evidence of a common-law marriage. 219.32... EVIDENCE REQUIRED FOR PAYMENT Evidence of Relationship § 219.32 Evidence of a common-law marriage. (a) Preferred evidence. Evidence of a common-law marriage must give the reasons why the informant believes that...
2010-07-01
... Forest System Land and Resource Management Planning Definitions § 219.36 Definitions. Definitions of the... vision for a specific area of land or type of land within the plan area. Statements of desired conditions... species of plants or animals which are not indigenous to an area but valued for their contribution to...
2010-10-01
... TRANSPORTATION CONTROL OF ALCOHOL AND DRUG USE General § 219.5 Definitions. As used in this part— Accident or... alcohol) that has known mind- or function-altering effects on a human subject, specifically including any... ownership or control of the railroad and not operated or staffed by a salaried officer or employee of the...
48 CFR 252.219-7004 - Small business subcontracting plan (test program).
2010-10-01
... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Small business... AND CONTRACT CLAUSES Text of Provisions And Clauses 252.219-7004 Small business subcontracting plan (test program). As prescribed in 219.708(b)(1)(B), use the following clause: Small Business...
40 CFR 80.219 - Designation and downstream requirements for GPA gasoline.
2010-07-01
... 40 Protection of Environment 16 2010-07-01 2010-07-01 false Designation and downstream requirements for GPA gasoline. 80.219 Section 80.219 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY... sold or dispensed for use in motor vehicles at a retail outlet or wholesale purchaser-consumer facility...
20 CFR 219.42 - When evidence of child's dependency is required.
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false When evidence of child's dependency is required. 219.42 Section 219.42 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE... child's dependency is required. Evidence of a child's dependency on the employee is required when— (a...
48 CFR 1552.219-71 - Procedures for Participation in the EPA Mentor-Protege Program.
2010-10-01
... Participation in the EPA Mentor-Protege Program. 1552.219-71 Section 1552.219-71 Federal Acquisition Regulations... Texts of Provisions and Clauses 1552.219-71 Procedures for Participation in the EPA Mentor-Protege... EPA Mentor-Protege Program (OCT 2000) (a) This provision sets forth the procedures for participation...
12 CFR 219.6 - Payment procedures.
2010-01-01
... obtain payment of costs incurred prior to the time the financial institution receives this notice. [Reg... PROVIDING FINANCIAL RECORDS; RECORDKEEPING REQUIREMENTS FOR CERTAIN FINANCIAL RECORDS (REGULATION S) Reimbursement to Financial Institutions for Providing Financial Records § 219.6 Payment procedures. (a) Notice...
36 CFR 219.20 - Ecological sustainability.
2010-07-01
... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Ecological sustainability... Sustainability § 219.20 Ecological sustainability. To achieve ecological sustainability, the responsible official... diversity and species diversity are components of ecological sustainability. The planning process must...
27 CFR 28.219 - Return of wine withdrawn for export with benefit of drawback.
2010-04-01
... Exportation of Wine With Benefit of Drawback § 28.219 Return of wine withdrawn for export with benefit of... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Return of wine withdrawn for export with benefit of drawback. 28.219 Section 28.219 Alcohol, Tobacco Products and Firearms...
48 CFR 219.702 - Statutory requirements.
2010-10-01
..., DEPARTMENT OF DEFENSE SOCIOECONOMIC PROGRAMS SMALL BUSINESS PROGRAMS The Small Business Subcontracting Program 219.702 Statutory requirements. (1) Section 834 of Public Law 101-189, as amended (15 U.S.C. 637... on a corporate, division, or plant-wide basis will reduce administrative burdens while enhancing...
Morphological differentiation of Streptomyces viridochromogenes E-219 on solid culture
International Nuclear Information System (INIS)
Liang Xinle; Zhu Jing; Jin Yingyan
2012-01-01
The Streptomyces viridochromogenes E-219 was derived from Streptomyces viridochromogenes CGMCC4.1119 treated with 60 Co γ-rays irradiation and protoplast fusion. With the help of fluorescent probes, fluorescence microscope and electron microscopy, the morphology and development of E-219 on solid surface culture were investigated in this study. The effect of agarslant culture time on the production of Avilamycin was also studied to provide theoretical basis for industrial fermentation of selecting the appropriate seed to culture on the agarslant culture medium. The results implied that the development of colonies of Streptomyces viridochromogenes accompanied the intermittent hyhae apoptosis, and the production of spores was from the active mycelium. The colonial morphology of strain E-219 was significantly different from the original strain CGMCC4h1119. There were variegated hyphae formation in the stage of spore germination and initial hyphae development (10 h) with the live and dead segments alternated in a highly regular fashion within the same hypha. After the early single colony formation, the third phase was followed by profuse growth of the live segments derived from the variegated hypha, then the second apoptosis of the mycelia (48 h) was occurred with another quick growth, and sporulation was occurred at 96 h. Strain CGMCC4.1119 had spiral sporotrichial and round conidiophores with spike, whereas strain E-219 had linear sporotrichial, smooth and dylindrical conidiophore. The results of shake flask experiments indicated that the spores of E-219 had that highest activity when cultured on agarslant culture medium and incubated for 106 h with the production of avilamycin up to 1200 mg/L. (authors)
48 CFR 752.219-8 - Utilization of small business concerns and small disadvantaged business concerns.
2010-10-01
... business concerns and small disadvantaged business concerns. 752.219-8 Section 752.219-8 Federal... AND CONTRACT CLAUSES Texts of Provisions and Clauses 752.219-8 Utilization of small business concerns and small disadvantaged business concerns. The Foreign Assistance Act calls for USAID to give small...
48 CFR 219.7104 - Developmental assistance costs eligible for reimbursement or credit.
2010-10-01
... costs eligible for reimbursement or credit. 219.7104 Section 219.7104 Federal Acquisition Regulations... reimbursement or credit. (a) Developmental assistance provided under an approved mentor-protege agreement is... eligible for reimbursement are set forth in appendix I. (b) Before incurring any costs under the Program...
48 CFR 252.219-7003 - Small business subcontracting plan (DoD contracts).
2010-10-01
... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Small business... AND CONTRACT CLAUSES Text of Provisions And Clauses 252.219-7003 Small business subcontracting plan (DoD contracts). As prescribed in 219.708(b)(1)(A), use the following clause: Small Business...
36 CFR 219.18 - Role of advisory committees.
2010-07-01
... PLANNING National Forest System Land and Resource Management Planning Collaborative Planning for... variety of public purposes, particularly those groups organized to develop landscape goals (§ 219.12(b...
48 CFR 1052.219-73 - Department of the Treasury Mentor-Protégé Program.
2010-10-01
... Mentor-Protégé Program. 1052.219-73 Section 1052.219-73 Federal Acquisition Regulations System... and Clauses 1052.219-73 Department of the Treasury Mentor-Protégé Program. As described in DTAR 1019.202-70, insert the following provision: Department of the Treasury Mentor-Protégé Program (JAN 2000...
49 CFR 219.800 - Annual reports.
2010-10-01
..., DEPARTMENT OF TRANSPORTATION CONTROL OF ALCOHOL AND DRUG USE Annual Report § 219.800 Annual reports. (a) Each... also use the electronic version of the MIS form provided by the DOT. The Administrator may designate... submission to FRA. For information on where to submit MIS forms and for the electronic version of the form...
20 CFR 219.50 - When evidence of “living with” is required.
2010-04-01
... with” is required. Evidence of “living with” (see part 222 of this chapter on Family Relationships) is... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false When evidence of âliving withâ is required. 219.50 Section 219.50 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD...
12 CFR 219.5 - Conditions for payment.
2010-01-01
... financial records prior to the time the financial institution is notified of such event. (c) Itemized bill... FOR PROVIDING FINANCIAL RECORDS; RECORDKEEPING REQUIREMENTS FOR CERTAIN FINANCIAL RECORDS (REGULATION S) Reimbursement to Financial Institutions for Providing Financial Records § 219.5 Conditions for...
Extraction and purification of {sup 227}Ac and development of solid {sup 219}Rn source
Energy Technology Data Exchange (ETDEWEB)
Tang, Quan; Qiu, Shoukang; Xiao, Detao; Zhou, Yaohui; An, Xiaogang [University of South China, Hengyang (China). Radon Key Laboratory of Hunan Province/School of Nuclear Science and Technology
2014-04-01
The method of {sup 227}Ac extraction and purification from high-grade uranium ore and the test results of solid {sup 219}Rn source made from {sup 227}Ac are reported in this paper. With five years of follow-up monitoring, radiochemical purity of {sup 227}Ac and the emanation power of solid {sup 219}Rn source has been checked by emanation method and γ-spectrometry, the results showed that {sup 228}Th, {sup 231}Pa and {sup 226}Ra have been effectively removed and the emanation power of {sup 219}Rn source is about 80%. The long-term test results also showed that the {sup 219}Rn emanation rate remains stable in a wide air humidity range (40% ∝ 90%). Though the {sup 219}Rn source has not been accurately calibrated yet, it has been applied in the research for delay coincidence measurement of {sup 223}Ra. (orig.)
9 CFR 93.219 - Declaration for poultry.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Declaration for poultry. 93.219... AGRICULTURE EXPORTATION AND IMPORTATION OF ANIMALS (INCLUDING POULTRY) AND ANIMAL PRODUCTS IMPORTATION OF CERTAIN ANIMALS, BIRDS, FISH, AND POULTRY, AND CERTAIN ANIMAL, BIRD, AND POULTRY PRODUCTS; REQUIREMENTS...
21 CFR 2.19 - Methods of analysis.
2010-04-01
... Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL GENERAL ADMINISTRATIVE RULINGS AND DECISIONS General Provisions § 2.19 Methods of analysis. Where the method of analysis... issues of the “Journal of the Association of Official Analytical Chemists”), which are incorporated by...
Configurations and level structure of 219Rn
International Nuclear Information System (INIS)
Sheline, R.K.; Liang, C.F.; Paris, P.
1998-01-01
The level structure of 219 Rn has been studied using the alpha decay of 223 Ra and coincident gamma rays. While only modest changes are required in the level structure, and only above 342.8 keV, severe changes are required throughout the level scheme in the spin assigments. These changes allow the assignment of two sets of anomalous bands with K=5/2 ± and K=3/2 ± . The K=5/2 ± bands have configurations intermediate between the reflection asymmetric configuration and the g 9/2 shell model configuration, while the K=3/2 ± bands have configurations intermediate between the mixed reflection asymmetric configuration and the i 11/2 shell model configuration. Comparison of the systematics of 219 Rn with neighboring isotones, isobars, and isotopes shows clearly the collapse of the quadrupole-octupole-type configurations into the less degenerate shell model configurations. copyright 1998 The American Physical Society
48 CFR 53.219 - Small Business Programs.
2010-10-01
... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Small Business Programs... (CONTINUED) CLAUSES AND FORMS FORMS Prescription of Forms 53.219 Small Business Programs. (a) The following form may be used in reporting small disadvantaged business contracting data: OF 312 (10/00), Small...
12 CFR 219.23 - Recordkeeping and reporting requirements.
2010-01-01
... Funds § 219.23 Recordkeeping and reporting requirements. (a) Domestic and international funds transfers... recordkeeping and reporting requirements for domestic and international funds transfers by insured depository... usefulness in criminal, tax, or regulatory investigations or proceedings. These regulations are codified at...
Directory of Open Access Journals (Sweden)
Jing Yang
2018-01-01
Full Text Available MicroRNAs play significant roles in the development of cancer and may serve as promising therapeutic targets. In our previous work, miR-219-5p was identified as one of the important metastasis-related microRNAs in HCC. Here we demonstrated that miR-219-5p expression was elevated in HCC tissues and was associated with vascular invasion and dismal prognosis. In multivariate analysis, miR-219-5p was identified as an independent prognostic indicator for HCC patients. Functional mechanism analyses showed that miR-219-5p promoted HCC cell proliferation and invasion in in vitro, as well as in vivo, tumor growth and metastasis in nude mice models bearing human HCC tumors. In addition, cadherin 1 (CDH1 was revealed to be a downstream target of miR-219-5p in HCC cells. In conclusion, miR-219-5p promotes tumor growth and metastasis of HCC by regulating CDH1 and can serve as a prognostic marker for HCC patients.
25 CFR 2.19 - Action by Area Directors and Education Programs officials on appeal.
2010-04-01
... Programs officials on appeal. (a) Area Directors, Area Education Programs Administrators, Agency... 25 Indians 1 2010-04-01 2010-04-01 false Action by Area Directors and Education Programs officials on appeal. 2.19 Section 2.19 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR PROCEDURES...
Murai, Kiyohito; Sun, Guoqiang; Ye, Peng; Tian, E; Yang, Su; Cui, Qi; Sun, Guihua; Trinh, Daniel; Sun, Olivia; Hong, Teresa; Wen, Zhexing; Kalkum, Markus; Riggs, Arthur D; Song, Hongjun; Ming, Guo-li; Shi, Yanhong
2016-03-11
Dysregulated expression of miR-219, a brain-specific microRNA, has been observed in neurodevelopmental disorders, such as schizophrenia (SCZ). However, its role in normal mammalian neural stem cells (NSCs) and in SCZ pathogenesis remains unknown. We show here that the nuclear receptor TLX, an essential regulator of NSC proliferation and self-renewal, inhibits miR-219 processing. miR-219 suppresses mouse NSC proliferation downstream of TLX. Moreover, we demonstrate upregulation of miR-219 and downregulation of TLX expression in NSCs derived from SCZ patient iPSCs and DISC1-mutant isogenic iPSCs. SCZ NSCs exhibit reduced cell proliferation. Overexpression of TLX or inhibition of miR-219 action rescues the proliferative defect in SCZ NSCs. Therefore, this study uncovers an important role for TLX and miR-219 in both normal neurodevelopment and in SCZ patient iPSC-derived NSCs. Moreover, this study reveals an unexpected role for TLX in regulating microRNA processing, independent of its well-characterized role in transcriptional regulation.
48 CFR 52.219-2 - Equal Low Bids.
2010-10-01
.... If the bidder is awarded a contract as a result of receiving priority consideration under this... AND FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 52.219-2 Equal...) amount to more than 50 percent of the contract price. (c) Failure to identify the labor surplus areas as...
Code Assessment of SPACE 2.19 using LSTF Steam Generator Tube Rupture Test
Energy Technology Data Exchange (ETDEWEB)
Kim, Minhee; Kim, Seyun [KHNP CRI, Daejeon (Korea, Republic of)
2016-10-15
The SPACE is a best estimated two-phase three-field thermal-hydraulic analysis code used to analyze the safety and performance of pressurized water reactors. As a result of the development, the 2.19 version of the code was released through the successive various verification and validation works. The present work is on the line of expanding the work by Kim et al. In this study, results produced by the SPACE 2.19 code were compared with the experimental data from JAERI's LSTF Test Run LSTF SB-SG-06 experiment simulating a Steam Generator Tube Rupture (SGTR) transient. In order to identify the predictability of SPACE 2.19, the LSTF steam generator tube rupture test was simulated. To evaluate the computed results, LSTF SB-SG-06 test data simulating the SGTR and the RELAP5/ MOD3.1 are used. The calculation results indicate that the SPACE 2.19 code predicted well the sequence of events and the major phenomena during the transient, such as the asymmetric loop behavior, reactor coolant system cooldown and heat transfer by natural circulation, the primary and secondary system depressurization by the pressurizer auxiliary spray and the steam dump using the intact loop steam generator relief valve.
48 CFR 852.219-72 - Evaluation factor for participation in the VA mentor-protégé program.
2010-10-01
... participation in the VA mentor-protégé program. 852.219-72 Section 852.219-72 Federal Acquisition Regulations... Texts of Provisions and Clauses 852.219-72 Evaluation factor for participation in the VA mentor-protégé... the VA Mentor-Protégé Program (DEC2009) This solicitation contains an evaluation factor or sub-factor...
33 CFR 135.219 - Notification of changes affecting certification.
2010-07-01
... SECURITY (CONTINUED) MARINE POLLUTION FINANCIAL RESPONSIBILITY AND COMPENSATION OFFSHORE OIL POLLUTION COMPENSATION FUND Financial Responsibility for Offshore Facilities § 135.219 Notification of changes affecting... Fund Administrator in writing when any changes occur which prevent the owner, operator, or guarantor...
2010-04-01
... 25 Indians 1 2010-04-01 2010-04-01 false What happens if a residential program does not maintain residency levels required by this subpart? 39.219 Section 39.219 Indians BUREAU OF INDIAN AFFAIRS..., Student Counts, and Verifications Residential Programs § 39.219 What happens if a residential program does...
20 CFR 725.219 - Duration of entitlement; child.
2010-04-01
... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Duration of entitlement; child. 725.219... of entitlement; child. (a) An individual is entitled to benefits as a child for each month beginning... month in which any one of the following events first occurs: (1) The child dies; (2) The child marries...
Directory of Open Access Journals (Sweden)
Huizi Lei
Full Text Available BACKGROUND AIMS: Gastric cancer is the most frequent gastrointestinal tumor in adults and is the most lethal form of human cancer. Despite of the improvements in treatments, the underlying mechanism of gastric carcinogenesis is not well known. To define novel modulators that regulate susceptibility to tumorgenesis, we focused on miR-219-2-3p. METHODS: Quantitative RT-PCR was employed to investigate the level of miR-219-2-3p in gastric cancer (GC tissues (n = 113 and their matched adjacent normal tissues (n = 113. In vitro cell proliferation, apoptosis assays, cell migration, and invasion assays were performed to elucidate biological effects of miR-219-2-3p. Since silencing of miRNA by promoter CpG island methylation may be an important mechanism in tumorgenesis, GC cells were treated with 5-aza-2'-deoxycytidine and trichostatin A, and expression changes of miR-219-2-3p were subsequently examined by quantitative RT-PCR. Finally, the methylation status of CpG island upstream of miR-219-2-3p was analyzed by methylation-specific PCR in GC tissues (n = 22. RESULTS: miR-219-2-3p was down-regulated in GC and cell lines. In addition, the experiments documented the lower expression of miR-219-2-3p in GC specimens with higher grade and later stage tumors. Meanwhile, miR-219-2-3p exerted antiproliferative, proapoptotic, and antimetastatic roles and reduced levels of p-ERK1/2 in GC cells. Furthermore, 5-aza-2'-deoxycytidine and trichostatin A increased the expression (~2 fold of miR-219-2-3p in GC cells. By methylation-specific PCR, DNA methylation in the upstream region of miR-219-2-3p was detected in both adjacent normal tissues and cancer tissues. As expected, the methylation level was considerably higher in the miR-219-2-3p down-regulated group than up-regulated group. CONCLUSIONS: miR-219-2-3p is potentially involved in gastric cancer progression and metastasis by regulating ERK1/2-related signal pathways, which may provide a novel therapeutic strategy
Directory of Open Access Journals (Sweden)
Mariana Schroeder
2018-03-01
Full Text Available Consumption of a low calorie diet is the most common approach to lose weight. While generally effective at first, it is frequently followed by a relapse where the pre-diet weight is regained, and often exceeded. This pattern of repeated weight loss/regain is referred to as weight cycling and the resulting metabolic response varies greatly between individuals. Objective: We attempted to address the issue of individual differences in the response to weight cycling in male mice. Methods: We first exposed adult wild type mice to repeated cycles of high/low fat food. Next, using a lentiviral approach, we knocked-down or over-expressed miR-219 in the ventromedial hypothalamus (VMH of an additional mouse cohort and performed a full metabolic assessment. Results: Exposure of wild type males to weight cycling resulted in the division of the cohort into subsets of resistant versus metabolic-syndrome-prone (MS animals, which differed in their metabolic profile and hypothalamic miR-219 levels. Lentiviral knock-down of miR-219 in the VMH led to exacerbation of metabolic syndrome. In contrast, over-expression of miR-219 resulted in moderation of the metabolic syndrome phenotype. Conclusions: Our results suggest a role for miR-219 in the mediation of the metabolic phenotype resulting from repeated weight cycling. Keywords: Weight cycling, Metabolic syndrome, miRNAs, Ventromedial hypothalamus, High fat diet, Diabetes
2010-10-01
... Representation for the Small Business Competitiveness Demonstration Program. 52.219-19 Section 52.219-19 Federal... Representation for the Small Business Competitiveness Demonstration Program. As prescribed in 19.1008(a), insert the following provision: Small Business Concern Representation for the Small Business Competitiveness...
36 CFR 219.4 - Identification and consideration of issues.
2010-07-01
... capabilities and available resources, including current and likely Forest Service budgets; (iv) The scientific... restore ecological conditions that are similar to the biological and physical range of expected variability (§ 219.20(b)(1)); and (vii) Opportunities to contribute to knowledge about and preservation of...
20 CFR 219.35 - Evidence that a marriage has ended.
2010-04-01
... divorce or annulment; or (2) Evidence of the death (See § 219.23) of a party to the marriage. (b) Other..., the claimant must explain the reason therefor and submit other convincing evidence that the marriage...
Conceptual design report, 219-S secondary containment upgrade, Project W-178
International Nuclear Information System (INIS)
Beyer, J.J.
1993-05-01
The 219-S Facility is located in the 200-West Area on the Hanford Site and was constructed in 1951. The facility receives and treats liquid, low-level mixed waste from the 222-S Laboratory prior to transfer of that waste to the SY Tank Farm. The 219-S Facility consists of Cell A containing Tanks 101 and 102 and Cell B containing Tank 103 and a spare space. Project W-178 will modify the 219-S Facility to bring it into compliance with the tank system standards in WAC 173-303-640. The secondary containment upgrade will consist of a stainless steel cell liner in both Cell A and the spare space in Cell B. Additionally, Cell B will be modified by taking Tank 103 out of service and installing a new tank: Tank 104. The construction work will be accomplished in phases to minimize service interruption to the 222-S Laboratory. The proposed design and construction method is the most cost effective of four alternatives evaluated during a value engineering session. Project W-178 is a fiscal year 1995 Line Item. Total estimated construction costs of the project are $2,600,000; other project costs are $710,000. The total project cost is $3,300,000
26 CFR 1.219-2 - Definition of active participant.
2010-04-01
... individuals whose compensation exceeds a certain amount accrue benefits under the plan. An individual whose... participant. However, any benefit that may vary with future compensation of an individual provides additional... 26 Internal Revenue 3 2010-04-01 2010-04-01 false Definition of active participant. 1.219-2...
48 CFR 952.219-70 - DOE Mentor-Protege program.
2010-10-01
... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false DOE Mentor-Protege program... FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 952.219-70 DOE Mentor.... DOE Mentor-Protege Program (MAY 2000) The Department of Energy has established a Mentor-Protege...
48 CFR 52.219-9 - Small business subcontracting plan.
2010-10-01
... Clauses 52.219-9 Small business subcontracting plan. As prescribed in 19.708(b), insert the following clause: Small Business Subcontracting Plan (OCT 2010) (a) This clause does not apply to small business... business, and women-owned small business concerns. If the offeror is submitting an individual contract plan...
48 CFR 1852.219-79 - Mentor requirements and evaluation.
2010-10-01
... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Mentor requirements and... and Clauses 1852.219-79 Mentor requirements and evaluation. As prescribed in 1819.7215, insert the following clause: Mentor Requirements and Evaluation (MAY 2009) (a) The purpose of the NASA Mentor-Protégé...
2010-07-01
... many times I may receive reimbursement for tour renewal travel? 302-3.219 Section 302-3.219 Public Contracts and Property Management Federal Travel Regulation System RELOCATION ALLOWANCES RELOCATION....219 Is there a limit on how many times I may receive reimbursement for tour renewal travel? (a) If you...
2010-07-01
... clothing, magazines and periodicals, and items which may be personally used by the veteran. 21.219 Section....219 Supplies consisting of clothing, magazines and periodicals, and items which may be personally used... will be supplied. (b) Furnishing magazines and periodicals. Appropriate past issues of magazines...
48 CFR 52.219-1 - Small Business Program Representations.
2010-10-01
... section 8(a), 8(d), 9, or 15 of the Small Business Act or any other provision of Federal law that... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Small Business Program....219-1 Small Business Program Representations. As prescribed in 19.308(a)(1), insert the following...
48 CFR 552.219-76 - Mentor Requirements and Evaluation.
2010-10-01
... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Mentor Requirements and....219-76 Mentor Requirements and Evaluation. As prescribed in 519.7017(b), insert the following clause: Mentor Requirements and Evaluation (SEP 2009) (a) The purpose of the GSA Mentor-Protégé Program is for a...
48 CFR 752.219-71 - Mentor requirements and evaluation.
2010-10-01
... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Mentor requirements and....219-71 Mentor requirements and evaluation. As prescribed in AIDAR 719.273-11(b), insert the following clause: Mentor Requirements and Evaluation (July 13, 2007) (a) Mentor and Protégé firms shall submit an...
5 CFR 591.219 - How does OPM compute shelter price indexes?
2010-01-01
... REGULATIONS ALLOWANCES AND DIFFERENTIALS Cost-of-Living Allowance and Post Differential-Nonforeign Areas Cost-Of-Living Allowances § 591.219 How does OPM compute shelter price indexes? (a) In addition to rental...
Code Assessment of SPACE 2.19 using LSTF 10% Main Steam-Line-Break Test
Energy Technology Data Exchange (ETDEWEB)
Kim, Minhee; Kim, Seyun [KHNP CRI, Daejeon (Korea, Republic of)
2016-10-15
The Safety and Performance Analysis Code for Nuclear Power Plants (SPACE) has been developed in recent years by the Korea Hydro and Nuclear Power Co. through collaborative works with other Korean nuclear industries and research institutes. As a result of the development, the 2.19 version of the code was released through the successive various verification and validation works. In this study, results produced by the SPACE 2.19 code were compared with the experimental data from JAERI's LSTF Test Run SBSL- 01 for a 10% main steam line break transient in a pressurized water reactor. The LSTF 10% main steam line break test were simulated using the SPACE 2.19 for code V and V work. The overall comparisons between the SPACE 2.19 code prediction and the LSTF Test Run SB-SL-01 experimental data are reasonably satisfactory. The comparisons were conducted in terms of the variations of mass flow rate, void fraction, pressure, collapsed liquid level, temperature, and system flow rate for the transient. In addition, the input model was modified for simulation accuracy of PZR pressure based on the calculated results. The correction of PORV setpoint affects to simulate the PORV open and close phenomena similarly with experiments. From the modification, the computed results show a reasonable agreement with experimental data in overall transient time.
36 CFR 219.11 - Monitoring and evaluation for adaptive management.
2010-07-01
... OF AGRICULTURE PLANNING National Forest System Land and Resource Management Planning The Framework for Planning § 219.11 Monitoring and evaluation for adaptive management. (a) Plan monitoring strategy... national, regional, and local supply and demand for products, services, and values. Special consideration...
International Nuclear Information System (INIS)
Maina, T.; Stolz, B.; Albert, R.; Bruns, C.; Koch, P.; Maecke, H.
1994-01-01
A new derivative of octreotide SDZ 219-387 [PnAO-(D)Phe 1 -octreotide] was synthesized, which binds specifically and with high affinity to somatostatin receptors in vitro (pK i =9.79±0.16). This new somatostatin analogue chelates technetium-99m under mild labelling conditions in good yields. The resulting [ 99m Tc]SDZ 219-387 was stable up to 6 h after labelling and could be isolated in a pure radiochemical and chemical form by high-perfomance liquid chromatographic purification. The intravenous administration of purified [ 99m Tc]SDZ 219-387 revealed that the radioligand was rapidly cleared from circulation, and tumour uptake of 0.38% ID/g was observed at 1.5 h post injection. [ 99m Tc]SDZ 219-387 specifically interacted with somatostatin binding sites on the tumour. However, the radioligand is highly lipophilic and excreted mainly through the hepatobiliary system. As a consequence, [ 99m Tc]SDZ 219-387 exhibits increased background activity and therefore is not appropriate for the in vivo visualization of somatostatin receptor-positive tumours and/or their metastases in the abdomen. (orig.)
Miah, Gous; Rafii, Mohd Y; Ismail, Mohd R; Puteh, Adam B; Rahim, Harun A; Latif, Mohammad A
2017-07-01
The rice cultivar MR219 is famous for its better yield and long and fine grain quality; however, it is susceptible to blast disease. The main objective of this study was to introgress blast resistance genes into MR219 through marker-assisted selection (MAS). The rice cultivar MR219 was used as the recurrent parent, and Pongsu Seribu 1 was used as the donor. Marker-assisted foreground selection was performed using RM6836 and RM8225 to identify plants possessing blast resistance genes. Seventy microsatellite markers were used to estimate recurrent parent genome (RPG) recovery. Our analysis led to the development of 13 improved blast resistant lines with Piz, Pi2 and Pi9 broad-spectrum blast resistance genes and an MR219 genetic background. The RPG recovery of the selected improved lines was up to 97.70% with an average value of 95.98%. Selected improved lines showed a resistance response against the most virulent blast pathogen pathotype, P7.2. The selected improved lines did not express any negative effect on agronomic traits in comparison with MR219. The research findings of this study will be a conducive approach for the application of different molecular techniques that may result in accelerating the development of new disease-resistant rice varieties, which in turn will match rising demand and food security worldwide. © 2016 Society of Chemical Industry. © 2016 Society of Chemical Industry.
36 CFR 223.219 - Sustainable harvest of special forest products.
2010-07-01
... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Sustainable harvest of....219 Sustainable harvest of special forest products. (a) Sustainable harvest levels. Prior to offering... product's sustainable harvest level. A special forest product's sustainable harvest level is the total...
The corrosion Characteristics and Behaviors of the Ti-2.19Al-2.35Zr alloy
International Nuclear Information System (INIS)
Kim, Tae Hoon; Kang, Chang Sun; Baek, Jong Hyuk; Kim, Hyun Gil; Choi, Byoung Kwon; Jeong, Yong Hwan
2007-01-01
Ti-2.19Al-2.35Zr alloy is being considered as a steam generator tube material for the advanced pressurized water reactor (PWR) which is being developed by KAERI for the purpose of seawater desalination as well as a small scale electricity production. The main operational environment of SMART differs somewhat from that of a commercial PWR. That is, a heat-exchange tube is always exposed to a high temperature/pressure condition and an ammonia water chemistry is designed as a pH controlling agent without an addition of boric acid. The excellent mechanical and corrosion resistance properties are required for the steam generator tube material in SMART. Thus Ti-2.19Al-2.35Zr alloy was studied to investigate of the corrosion characteristics and behaviors of the Ti- 2.19Al-2.35Zr alloy in a simulated-SMART loop
Directory of Open Access Journals (Sweden)
Alessandra Mosca
2018-04-01
Full Text Available The risk for Alzheimer’s disease (AD is associated with the presence of the 4 allele of Apolipoprotein E (APOE gene and, recently, with a novel genetic variant of the RNF219 gene. This study aimed at evaluating interactions between APOE-4 and RNF219/G variants in the modulation of behavioral and cognitive features of two cohorts of patients suffering from mild cognitive impairment (MCI or AD. We enrolled a total of 173 female MCI or AD patients (83 MCI; 90 AD. Subjects were screened with a comprehensive set of neuropsychological evaluations and genotyped for the APOE and RNF219 polymorphic variants. Analysis of covariance was performed to assess the main and interaction effects of APOE and RNF219 genotypes on the cognitive and behavioral scores. The analysis revealed that the simultaneous presence of APOE-4 and RNF219/G variants results in significant effects on specific neuropsychiatric scores in MCI and AD patients. In MCI patients, RNF219 and APOE variants worked together to impact the levels of anxiety negatively. Similarly, in AD patients, the RNF219 variants were found to be associated with increased anxiety levels. Our data indicate a novel synergistic activity APOE and RNF219 in the modulation of behavioral traits of female MCI and AD patients.
International Nuclear Information System (INIS)
Gilbert, R.O.; Simpson, J.C.; Engel, D.W.; Kinnison, R.R.
1984-03-01
For NS201 the estimated average 239 240 Pu to 241 Am ratios for vegetation and soil are 7.3 and 11.5, respectively, where the 241 Am data were obtained using wet chemistry. The geometric mean 90 Sr to 137 Cs ratios for vegetation and soil at NS201 are estimated to be 1.1 and 1.9. These results suggest that the true (population) median 239 240 Pu to 241 Am and 90 Sr to 137 Cs ratios are smaller for vegetation than for soil at NS201. For NS219 and NS221 the estimated average 239 240 Pu to 241 Am ratios for surface soil at NS219 and NS221 are 2.8 and 0.78, respectively. There is an obvious statistical difference in the average 239 240 Pu to 241 Am ratios at these sites. The geometric mean 239 240 Pu to 241 Am ratios for vegetation samples at NS219 and NS221 are estimated to be 3.2 and 0.82, respectively. The data suggest there may be a difference in the 239 240 Pu to 241 Am ratios for soil and vegetation at NS219, but not at NS221. The geometric mean 90 Sr to 137 Cs ratio for surface soil at NS219 and NS221 combined is 0.93. The geometric mean 90 Sr to 137 Cs ratio for vegetation for the two sites (pooled data) is estimated to be 1.8. 43 references, 42 figures, 7 tables
International Nuclear Information System (INIS)
1995-01-01
The U.S. Department of Energy (DOE) is proposing to: (1) replace the 222-S Laboratory (222-S) radioactive liquid waste drain lines to the 219-S Waste Handling Facility (219-S); (2) upgrade 219-S by replacing or upgrading the waste storage tanks and providing secondary containment and seismic restraints to the concrete cells which house the tanks; and (3) replace the transfer lines from 219-S to the 241-SY Tank Farm. This environmental assessment (EA) has been prepared in compliance with the National Environmental Policy Act (NEPA) of 1969, as amended, the Council on Environmental Quality Regulations for Implementing the Procedural Provisions of NEPA (40 Code of Federal Regulations [CFR] 1500-1508), and the DOE Implementing Procedures for NEPA (10 CFR 1021). 222-S is used to perform analytical services on radioactive samples in support of the Tank Waste Remediation System and Hanford Site environmental restoration programs. Activities conducted at 222-S include decontamination of analytical processing and support equipment and disposal of nonarchived radioactive samples. These activities generate low-level liquid mixed waste. The liquid mixed waste is drained through pipelines in the 222-S service tunnels and underground concrete encasements, to two of three tanks in 219-S, where it is accumulated. 219-S is a treatment, storage, and/or disposal (TSD) unit, and is therefore required to meet Washington Administrative Code (WAC) 173-303, Dangerous Waste Regulations, and the associated requirements for secondary containment and leak detection. The service tunnels are periodically inspected by workers and decontaminated as necessary to maintain as low as reasonably achievable (ALARA) radiation levels. Although no contamination is reaching the environment from the service tunnels, the risk of worker exposure is present and could increase. 222-S is expected to remain in use for at least the next 30 years to serve the Hanford Site environmental cleanup mission
18 CFR 367.2190 - Account 219, Accumulated other comprehensive income.
2010-04-01
... COMPANY ACT OF 2005, FEDERAL POWER ACT AND NATURAL GAS ACT UNIFORM SYSTEM OF ACCOUNTS FOR CENTRALIZED SERVICE COMPANIES SUBJECT TO THE PROVISIONS OF THE PUBLIC UTILITY HOLDING COMPANY ACT OF 2005, FEDERAL POWER ACT AND NATURAL GAS ACT Balance Sheet Chart of Accounts Proprietary Capital § 367.2190 Account 219...
48 CFR 52.219-8 - Utilization of small business concerns.
2010-10-01
... management and daily business operations of which are controlled by one or more veterans. Women-owned small... Clauses 52.219-8 Utilization of small business concerns. As prescribed in 19.708(a), insert the following clause: Utilization of Small Business Concerns (MAY 2004) (a) It is the policy of the United States that...
50 CFR 216.219 - Renewal and modifications of Letters of Authorization.
2010-10-01
... OCEANIC AND ATMOSPHERIC ADMINISTRATION, DEPARTMENT OF COMMERCE MARINE MAMMALS REGULATIONS GOVERNING THE TAKING AND IMPORTING OF MARINE MAMMALS Taking of Marine Mammals Incidental to Explosive Severance.... Gulf of Mexico § 216.219 Renewal and modifications of Letters of Authorization. (a) A Letter of...
Negative Ion Source Development and Photodetachment Studies at ISOLDE
AUTHOR|(CDS)2254068; Hanstorp, Dag; Rothe, Sebastian
Astatine is one of the rarest elements on earth. The small amount of existing astatine is either created in decay chains of heavier elements or artificially. One of its longer lived isotopes, 211At, is of interest for targeted alpha therapy, a method of treating cancer by using the alpha decay of radioactive elements directly at the location of a tumor. However, its chemical properties are yet to be determined due to the short life time of astatine. A milestone towards the determination of the electronegativity of astatine was the measurement of its ionization potential (IP) at CERN-ISOLDE. However, its electron affinity (EA, the binding energy of the additional electron in a negative ion), is still to be measured. In order to determine the EA of radioisotopes by laser photodetachment spectroscopy, the Gothenburg ANion Detector for Affinity measurements by Laser Photodetachment (GANDALPH) has been built in recent years. As a proof-of-principle, the EA of the 128I negative ion, produced at the CERN-ISOLDE rad...
20 CFR 219.31 - Evidence of a valid ceremonial marriage.
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Evidence of a valid ceremonial marriage. 219... marriage. (a) Preferred evidence. Preferred evidence of a ceremonial marriage is— (1) A copy of the public record of the marriage, certified by the custodian of the record or by a Board employee; (2) A copy of a...
Long, Ju; Yan, Shanhuo; Lao, Kegan; Pang, Wanrong; Ye, Xuehe; Sun, Lei
2014-04-01
α-Thalassemia is a common single-gene genetic disease that can cause Hb Bart's hydrops fetalis and Hb H disease in tropical and subtropical regions. When examining conventional thalassemia genes, an only detected --(SEA) genotype sample needs further analysis. In doing so, we found a novel 21.9kb deletion (Qinzhou type deletion). The deletion position of the novel 21.9kb deletion is from 14373bp to 36299bp of the α-globin gene cluster (NG_000006.1); thus, there exists a 21927bp sequence deletion, into which a 29bp sequence is added. After sequence analysis, a group of Gap-PCR primers were synthesized to diagnose this novel thalassemia genotype. Through pedigree analysis, we deduced that the propositus obtained the novel alleles from her mother. The genotype of this propositus is --(SEA)/-α(21.9) and its phenotype conforms to the characteristics of Hb H disease, establishing that the combination between -α(21.9) genotype and α(0) genotype can lead to Hb H disease. By molecular analysis, we established that this case fits the characteristic of an α(+) thalassemia genotype. © 2013.
48 CFR 1852.219-74 - Use of rural area small businesses.
2010-10-01
... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Use of rural area small... and Clauses 1852.219-74 Use of rural area small businesses. As prescribed in 1819.7103, insert the following clause: Use of Rural Area Small Business (SEP 1990) (a) Definitions. Rural area means any county...
48 CFR 3052.219-72 - Evaluation of prime contractor participation in the DHS mentor-protégé program.
2010-10-01
... contractor participation in the DHS mentor-protégé program. 3052.219-72 Section 3052.219-72 Federal... Evaluation of prime contractor participation in the DHS mentor-protégé program. As prescribed in (HSAR) 48... the DHS Mentor-Protégé Program (JUN 2006) This solicitation contains a source selection factor or...
Development and therapeutic application of internally emitting radiopharmaceuticals
International Nuclear Information System (INIS)
Adelstein, S.J.; Bloomer, W.D.
1980-01-01
This project is concerned with developing the potential of alpha-emitting radionuclides as agents for radiotherapy. Among the available α-emitters, astatine-211 appears most promising for testing the efficacy of α-emitters for therapeutic applications because: (1) it has some chemical similarities to iodine, an element that can readily be incorporated into numerous proteins and peptides; (2) it has a half life that is long enough to permit chemical manipulation yet short enough to minimize destruction of healthy cells; and (3) α-emission is associated with 100% of its decays. If appropriate biological carriers can be labeled with an alpha emitter such as 211 At, they could be of great utility in several areas of therapeutic medicine where elimination of specific cell populations is desired. While previous attempts to astatinate proteins using standard iodination techniques have been unsuccessful, effective labeling of proteins with astatine by first synthesizing an aryl astatide and then coupling this compound to the protein via an acylation has been achieved. Undergoing current investigation are several different aryl astatide-followed-by-acylation approaches including an astatinated Bolton-Hunter type reagent using concanavalin A (ConA) and melanocyte stimulating hormone (MSH) as model compounds
Yan, Guangqi; Wang, Xue; Yang, Mingliang; Lu, Li; Zhou, Qing
2017-01-01
Oral squamous cell carcinoma (OSCC) is a prevalent oral disease with a high morbidity and mortality rate. Several long non-coding RNAs (lncRNAs) were identified as important regulators of carcinogenesis. However, the pathogenic implications of TUG1 in OSCC are still unclear. In the present study, the expression of TUG1 was increased in OSCC cells. Knockdown of TUG1 inhibited cell proliferation, migration, and invasion, and induced cell cycle arrest at G0/G1 phase, whereas overexpression of TUG1 exerted the opposite effect on OSCC cells. A reciprocal repressive interaction between TUG1 and miR-219 was found, and miR-219 inhibition abolished the tumor-suppressive effect of TUG1 knockdown on cell growth and motility. Furthermore, bioinformatics analysis and luciferase reporter assay showed that FMNL2 was a direct target of miR-219. Restoration of FMNL2 abrogated the miR-219-induced inhibition of cell proliferation, cell cycle progression, migration, and invasion. Besides, overexpression of TUG1 promoted tumor growth and metastasis in vivo . Clinically, the expression of TUG1 and FMNL2 were increased, but miR-219 was decreased in primary tumors compared to non-tumor tissues. Both the upregulated TUG1, and FMNL2 and the downregulated miR-219 was associated with advanced stage of OSCC and poor overall survival. Notably, multivariate analyses confirmed that FMNL2 was an independent risk factor for OSCC. In conclusion, our data revealed that TUG1 confers oncogenic function in OSCC and TUG1/miR-219/FMNL2 axis may be a novel therapeutic strategy in this disease.
48 CFR 653.219-71 - DOS form DS-4053, Department of State Mentor-Protégé Program Application.
2010-10-01
..., Department of State Mentor-Protégé Program Application. 653.219-71 Section 653.219-71 Federal Acquisition...-4053, Department of State Mentor-Protégé Program Application. As prescribed in 619.102-70(i), DS-4053 is prescribed for use in applying for an agreement under the Department of State Mentor-Protégé...
Tanweer, Fatah A.; Rafii, Mohd Y.; Sijam, Kamaruzaman; Rahim, Harun A.; Ahmed, Fahim; Ashkani, Sadegh; Latif, Mohammad A.
2015-01-01
Blast is the most common biotic stress leading to the reduction of rice yield in many rice-growing areas of the world, including Malaysia. Improvement of blast resistance of rice varieties cultivated in blast endemic areas is one of the most important objectives of rice breeding programs. In this study, the marker-assisted backcrossing strategy was applied to improve the blast resistance of the most popular Malaysian rice variety MR219 by introgressing blast resistance genes from the Pongsu Seribu 2 variety. Two blast resistance genes, Pi-b and Pi-kh, were pyramided into MR219. Foreground selection coupled with stringent phenotypic selection identified 15 plants homozygous for the Pi-b and Pi-kh genes, and background selection revealed more than 95% genome recovery of MR219 in advanced blast resistant lines. Phenotypic screening against blast disease indicated that advanced homozygous blast resistant lines were strongly resistant against pathotype P7.2 in the blast disease endemic areas. The morphological, yield, grain quality, and yield-contributing characteristics were significantly similar to those of MR219. The newly developed blast resistant improved lines will retain the high adoptability of MR219 by farmers. The present results will also play an important role in sustaining the rice production of Malaysia. PMID:26734013
48 CFR 852.219-9 - VA Small business subcontracting plan minimum requirements.
2010-10-01
... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false VA Small business... Provisions and Clauses 852.219-9 VA Small business subcontracting plan minimum requirements. As prescribed in subpart 819.709, insert the following clause: VA Small Business Subcontracting Plan Minimum Requirements...
I219V polymorphism in hMLH1 gene in patients affected with ulcerative colitis.
Vietri, Maria Teresa; Riegler, Gabriele; De Paola, Marialaura; Simeone, Serena; Boggia, Maria; Improta, Alessia; Parisi, Mariarita; Molinari, Anna Maria; Cioffi, Michele
2009-04-01
hMLH1 gene, lying on chromosome 3p21-23, is a key factor of the mismatch repair (MMR) complex, which amends DNA replication errors. MMR alterations are involved in the development of both hereditary and sporadic forms of colorectal carcinoma related to ulcerative colitis (UC). I219V Polymorphism is located on exon 8 of hMLH1 and provides an aminoacidic substitution of isoleucine to valine, on the protein codon 219. This may affect the speed and fidelity of protein synthesis because of a tRNA paucity or changes in the mRNA secondary structure. Most of the hereditary nonpolyposis colon cancer-associated missense mutations of hMLH1 cause structural changes of the amino- or carboxy-terminal regions, involving the domains that interact with ATP and hPMS2. In this study, we analyzed the hMLH1 I219V polymorphism frequency in colectomized patients with UC. Venous blood from 100 ulcerative patients and 97 apparently healthy subjects has been collected. Out of 100 patients affected with UC, 75 noncolectomized showed an alternating course of disease, while 25 did not respond to the common drugs, and underwent colectomy. Genotyping was performed by polymerase chain reaction and following enzymatic digestion by BccI. No significant differences were found between patients with UC and controls both for genotype and allele frequencies. However, our data show a significant association when colectomized and noncolectomized patients are compared. The frequencies of G homozygosity were 28% in colectomized and 10.7% in noncolectomized patients (p < 0.05, chi(2) = 4.4, Odds ratio = 3.3). The allele frequencies of allele A were 52% in colectomized and 68% in noncolectomized patients; while those of allele G were 48% and 32%, respectively. I219V polymorphism in hMLH1 could influence the clinical course of the disease and lead to resistance to therapy.
48 CFR 52.219-20 - Notice of Emerging Small Business Set-Aside.
2010-10-01
... Clauses 52.219-20 Notice of Emerging Small Business Set-Aside. As prescribed in 19.1008(b), insert the following provision: Notice of Emerging Small Business Set-Aside (JAN 1991) Offers or quotations under this acquisition are solicited from emerging small business concerns only. Offers that are not from an emerging...
48 CFR 52.219-7 - Notice of Partial Small Business Set-Aside.
2010-10-01
... Clauses 52.219-7 Notice of Partial Small Business Set-Aside. As prescribed in 19.508(d), insert the following clause: Notice of Partial Small Business Set-Aside (JUN 2003) (a) Definitions. Small business..., and qualified as a small business under the size standards in this solicitation. (b) General. (1) A...
48 CFR 52.219-6 - Notice of Total Small Business Set-Aside.
2010-10-01
... Clauses 52.219-6 Notice of Total Small Business Set-Aside. As prescribed in 19.508(c), insert the following clause: Notice of Total Small Business Set-Aside (JUN 2003) (a) Definition. Small business concern... qualified as a small business under the size standards in this solicitation. (b) General. (1) Offers are...
48 CFR 1852.219-77 - NASA Mentor-Protégé Program.
2010-10-01
... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true NASA Mentor-ProtégÃ... and Clauses 1852.219-77 NASA Mentor-Protégé Program. As prescribed in 1819.7215, insert the following clause: NASA Mentor-Protégé Program (MAY 2009) (a) Prime contractors are encouraged to participate in the...
48 CFR 752.219-70 - USAID Mentor-Protégé Program.
2010-10-01
... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false USAID Mentor-ProtégÃ....219-70 USAID Mentor-Protégé Program. As prescribed in 719.273-11(a), insert the following provision: USAID Mentor-Protégé Program (July 13, 2007) (a) Large and small business are encouraged to participate...
48 CFR 552.219-75 - GSA Mentor-Protégé Program.
2010-10-01
... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false GSA Mentor-ProtégÃ....219-75 GSA Mentor-Protégé Program. As prescribed in 519.7017(a), insert the following clause: GSA Mentor-ProtéGé Program (SEP 2009) (a) Prime contractors, including small businesses, are encouraged to...
48 CFR 852.219-71 - VA mentor-protégé program.
2010-10-01
... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false VA mentor-protégÃ....219-71 VA mentor-protégé program. As prescribed in 819.7115(a), insert the following clause: VA Mentor-Protégé Program (DEC 2009) (a) Large businesses are encouraged to participate in the VA Mentor-Protégé...
48 CFR 3052.219-71 - DHS mentor-protégé program.
2010-10-01
... 48 Federal Acquisition Regulations System 7 2010-10-01 2010-10-01 false DHS mentor-protégÃ... CONTRACT CLAUSES Text of Provisions and Clauses 3052.219-71 DHS mentor-protégé program. As prescribed in (HSAR) 48 CFR 3019.708-70(b), insert the following clause: DHS Mentor-Protégé Program (JUN 2006) (a...
48 CFR 352.219-71 - Mentor-protégé program reporting requirements.
2010-10-01
... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Mentor-protégé program... Clauses 352.219-71 Mentor-protégé program reporting requirements. As prescribed in 319.270-1(b), the Contracting Officer shall insert the following clause: Mentor-Protégé Program Reporting Requirements (January...
Radiobiological Effects of Alpha-Particles from Astatine-211: From DNA Damage to Cell Death
Energy Technology Data Exchange (ETDEWEB)
Claesson, Kristina
2011-05-15
In recent years, the use of high linear energy transfer (LET) radiation for radiotherapeutic applications has gained increased interest. Astatine-211 (211At) is an alpha-particle emitting radionuclide, promising for targeted radioimmunotherapy of isolated tumor cells and microscopic clusters. To improve development of safe radiotherapy using 211At it is important to increase our knowledge of the radiobiological effects in cells. During radiotherapy, both tumors and adjacent normal tissue will be irradiated and therefore, it is of importance to understand differences in the radio response between proliferating and resting cells. The aim of this thesis was to investigate effects in fibroblasts with different proliferation status after irradiation with alpha-particles from 211At or X-rays, from inflicted DNA damage, to cellular responses and biological consequences. Throughout this work, irradiation was performed with alpha-particles from 211A or X-rays. The induction and repair of double-strand breaks (DSBs) in human normal fibroblasts were investigated using pulsed-field gel electrophoresis and fragment analysis. The relative biological effectiveness (RBE) of 211At for DSB induction varied between 1.4 and 3.1. A small increase of DSBs was observed in cycling cells compared to stationary cells. The repair kinetics was slower after 211At and more residual damage was found after 24 h. Comparison between cells with different proliferation status showed that the repair was inefficient in cycling cells with more residual damage, regardless of radiation quality. Activation of cell cycle arrests was investigated using immunofluorescent labeling of the checkpoint kinase Chk2 and by measuring cell cycle distributions with flow cytometry analysis. After alpha-particle irradiation, the average number of Chk2-foci was larger and the cells had a more affected cell cycle progression for several weeks compared with X-irradiated cells, indicating a more powerful arrest after 211At
Occurrence of rhyolytic tuffs at deep sea drilling project site 219 on the Laccadive Ridge
Digital Repository Service at National Institute of Oceanography (India)
Siddiquie, H.N.; Sukheswala, R.N.
A study of thin sections from the lower and middle parts of Unit 5 (Paleocene) from Site 219 shows that these largely consist of acidic or rhyolitic tuffs. The overlying limestones in Unit 5 (Paleocene) and Unit 4 (Lower Eocene) also contain...
International Nuclear Information System (INIS)
Koziorowski, J.
1998-01-01
Radiohalogens are widely used in nuclear medicine, both as tool for diagnostic in vivo imaging, and in radionuclide therapy. This study deals with the use of radiohalogens; separation, precursor synthesis, labeling and biological behavior. The focus is on 211 At and 124 I, the former being a candidate for nuclide therapy and the latter potentially useful for diagnostic imaging and Auger-electron based radiotherapy. For astatine the separation, labeling and some biological behavior is described, and for iodine the latter two. Astatine was separated from an irradiated bismuth target by dry distillation. A novel cryotrap was developed for the isolation of astatine and subsequent synthesis of radiolabeled compounds. 5-[ 211 At]astato-2'-deoxyuridine (AUdR) and N-succinimidyl-4-[ 211 At]astatobenzoate (SAB) were synthesized in 95% respectively 90% radiochemical yields. The former is incorporated into DNA of proliferating cells and can therefore be used as an endoradiotherapeutic agent. The latter is a conjugate for the astatination of proteins. Human epidermal growth factor (hEGF) was tagged with astatine using three approaches: a) direct labeling of native hEGF, b) conjugation with SAB, and c) direct labeling of an hEGF - 7-(3-aminopropyl)-7,8-dicarba-nido-undecaborate(1-) conjugate. The overall labeling yields were 3.5% for direct labeling, 44% for SAB and 70% for the hEGF-nido-carborane conjugate. A new route to N-succinimidyl 3- and 4- [ 124 I]iodobenzoate, two reagents for radioiodination of proteins is described affording 90% radiochemical yield. Three radioiodinated analogs of PK11195, 1-(2-chlorophenyl)-N-methyl-N-(1-methylpropyl)isoquinoline-3-carboxyam ide, a peripheral-type benzodiazepine receptor antagonist, were synthesized. All three analogs were obtained in >90% radiochemical yield. Synthesis and application of 5-[ 124 I]iodo-2'-deoxyuridine (IUdR) is presented. The closo-dodecaborate anion was evaluated as prosthetic group for radioiodination of
48 CFR 652.219-72 - Department of State Mentor-Protégé Program.
2010-10-01
... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Department of State Mentor....219-72 Department of State Mentor-Protégé Program. As prescribed in 619.202-70(o)(1), insert the following provision: Department of State Mentor-Protégé Program (APR 2004) (a) Large and small businesses...
Evaluation of 3 Inch SN-219 Failure and S and SX Tank Farm Saltwell Piping
International Nuclear Information System (INIS)
ELSEN, J.J.
2000-01-01
Evaluation of direct buried piping currently in use or designated for future Saltwell pumping in S and SX Farms. Documented evaluation of failed S-103 saltwell pumping transfer line 3 inch SN-219. This evaluation is intended to reflect current status of Saltwell piping, when taken in context with referenced documents
29 CFR 779.219 - Unified operation may be achieved without common control or common ownership.
2010-07-01
... Act May Apply; Enterprise Coverage Unified Operation Or Common Control § 779.219 Unified operation may... through “unified operation.” It is clear from the definition that if the described activities are performed through unified operation they will be part of the enterprise whether they are performed by one...
International Nuclear Information System (INIS)
Khazrouni, S.
1985-06-01
Using α-particle and γ-ray spectroscopy, it has been possible to establish the high spin pattern in 215 Fr and propose a decay scheme up to I π = (47/2 + ) containing six isomeric states. These results are interpreted using the recent version of the deformed Woods-Saxon model and the Strutinsky normalisation technique. A similar study in 219 Ac has revealed the existence of two quasi-bands each formed of states of alternating parity and connected by strong E1 transitions. This data for 219 Ac fits better with the stable octupole deformation model, mainly because of the high-spin parity doublets observed for the first time, than with the α-cluster model [fr
75 FR 25844 - Class Deviation From FAR 52.219-7, Notice of Partial Small Business Set-Aside
2010-05-10
... Small Business Set-Aside AGENCY: Defense Logistics Agency, DoD. ACTION: Notice. SUMMARY: This is to...) regarding partial small business set-asides for Defense Logistics Agency (DLA), Defense Energy Support..., DESC is requesting a class deviation from FAR Clause 52.219-7, Notice of Partial Small Business Set...
International Nuclear Information System (INIS)
DIVINE, J.R.; PARSONS, G.L.
2008-01-01
A minor leak was detected in a drain line for Hood 2B located in the 222-S Laboratory. The line transfers radioactive waste, spent analytical standards, and chemicals used in various analytical procedures. Details are in the report provided by David Comstock, 2B NDE June 2008, work package LAB-WO-07-2012. Including the noted leak, the 222-S Laboratory has experienced two drain line leaks in approximately the last two years of operation. As a consequence, CH2M HILL Hanford Group, Inc. (CH2M HILL) requested the support of ChemMet, Ltd., PC (ChemMet) at the Hanford Site 222-S Laboratory. The corrosion expertise from ChemMet was required prior to preparation of a compatibility assessment for the 222-S Laboratory waste transfer system to assure the expected life of the piping system is extended as much as practicable. The system includes piping within the 222-S Laboratory and the 219-S Waste Storage and Transfer Facility and Operations Process. The ChemMet support was required for an assessment by 222-S staff to analyze what improvements to operational activities may be implemented to extend the tank/piping system life. This assessment will include a summary of the various material types, age, and locations throughout the facility. The assessment will also include a discussion of materials that are safe for drain line disposal on a regular basis, materials that are safe for disposal on a case-by-case basis including specific additional requirements such as flushing, neutralization to a specific pH, and materials prohibited from disposal. The assessment shall include adequate information for 222-S Laboratory personnel to make informed decisions in the future disposal of specific material types by discussing types of compatibility of system materials and potential wastes. The assessment is expected to contain some listing of acceptable waste materials but is not anticipated to be a complete or comprehensive list. Finally the assessment will encompass a brief discussion of
VizieR Online Data Catalog: K2-19b light curve (Armstrong+, 2015)
Armstrong, D. J.; Santerne, A.; Veras, D.; Barros, S. C. C.; Demangeon, O.; Lillo-Box, J.; McCormac, J.; Osborn, H. P.; Tsantaki, M.; Almenara, J.-M.; Barrado, D.; Boisse, I.; Bonomo, A. S.; Brown, D. J. A.; Bruno, G.; Rey Cerda, J.; Courcol, B.; Deleuil, M.; Diaz, R. F.; Doyle, A. P.; Hebrard, G.; Kirk, J.; Lam, K. W. F.; Pollacco, D. L.; Rajpurohit, A.; Spake, J.; Walker, S. R.
2015-08-01
The Near Infrared Transiting ExoplanetS (NITES) Telescope is a semi-robotic 0.4m (f/10) Meade LX200GPS Schmidt-Cassegrain telescope installed at the ORM, La Palma. One transit of K2-19b was observed on 2015 Feb 28. The telescope was defocused slightly to 3.3 FWHM and 814 images of 20s exposure time were obtained with 5s dead time between each. Observations were obtained without a filter. The table presents data taken with the NITES telescope shown in Figure 1 of the publication. (1 data file).
Polychlorinated biphenyls (PCB) analysis report for solid sample from 219S tank 104
International Nuclear Information System (INIS)
Ross, G.A.
1998-01-01
A sample of solids was obtained from tank 104 of 219S via a peristaltic pump equipped with a stainless steel tube and Norprenel tubing (Phthalate free). The sample obtained in a glass jar with Teflon 2 lid, was analyzed for PCBs as Aroclor mixtures. A soxhlet extraction procedure was used to extract the Aroclors from the sample. Analysis was performed using dual column confirmation gas chromatography/electron capture detection (GC/ECD). The extraction method closely follows SW-846 method 3540C and the analysis follows SW-846 method
Polychlorinated biphenyls (PCB) analysis report for solid sample from 219S tank 101
International Nuclear Information System (INIS)
Diaz, L.A.
1998-01-01
One waste sample that was obtained with solids from tank 101 of 219S via a peristaltic pump equipped with a stainless steel tube and Norprene tubing (Phthalate free) was obtained in a glass jar with teflon lid was analyzed (with duplicate, matrix spike, and matrix spike duplicate) for PCBs as Aroclor mixtures by the Inorganic/Organic Chemistry Group. A soxhlet extraction procedure was used for extraction of the Aroclors from the sample. Analysis was performed using dual column confirmation gas chromatography/electron capture detection (GC/ECD). Results are presented
ECNJEFI. A JEFI based 219-group neutron cross-section library: User's manual
International Nuclear Information System (INIS)
Stad, R.C.L. van der; Gruppelaar, H.
1992-07-01
This manual describes the contents of the ECNJEF1 library. The ECNJEF1 library is a JEF1.1 based 219-group AMPX-Master library for reactor calculations with the AMPX/SCALE-system, e.g. the PASC-3 system as implemented at the Netherlands Energy Research Foundation in Petten, Netherlands. The group cross-section data were generated with NJOY and NPTXS/XLACS-2 from the AMPX system. The data on the ECNJEF1 library allows resolved-resonance treatment by NITAWL and/or unresolved resonance self-shielding by BONAMI. These codes are based upon the Nordheim and Bondarenko methods, respectively. (author). 10 refs., 7 tabs
Astatine-211 labeling. A study towards automatic production of astatinated antibodies
International Nuclear Information System (INIS)
Emma Aneheim; Per Albertsson; Sture Lindegren; Holger Jensen
2015-01-01
Targeted alpha therapy is especially interesting for therapy of microscopic cancer tumors due to short path length and high linear energy transfer of the alpha particles. One of the most promising nuclides for targeted alpha therapy is 211 At. To facilitate larger clinical studies using 211 At, the current manual synthesis of radiolabeled antibodies would benefit from being transferred into an automated method. In this work, successful modifications of the manual synthesis have been performed in order to adapt it to automation. The automatic synthesis has also been tested using the modified synthesis method. (author)
Pang, Wanrong; Long, Ju; Weng, Xunjin; Fan, Qiongying; Sun, Lei; Pan, Zhijian; Fan, Zuqian
2018-01-01
Different types of deletional α-thalassemia (α-thal) have been reported by researchers in China. This study describes one family carrying -α 21.9 (NG_000006.1: g.14373_36299delinsGGGAAGGGTGGGTGGGAATAACAGCTTTT), -α 2.4 (NG_000006.1: g.36860_39251del) and - - THAI (Thailand) (NG_000006.1: g.10664_44164del) alleles in Guangxi Zhuang Autonomous Region, People's Republic of China (PRC), and reports the frequencies of these types in the population of this region. The proband was a 4-year-old girl, who screened positive for thalassemia, although the thalassemia genotype results were normal when screened using the routine kits. Samples of the proband's parents were also collected to perform further analyses. Two real-time gap-polymerase chain reaction (gap-PCR) systems were designed for separate detection of - - THAI and screening for -α 21.9 and -α 2.4 . The genotype of the proband was -α 21.9 /-α 2.4 , and the two variants were inherited from her parents. In the frequency study, five - - THAI , four -α 21.9 and 11 -α 2.4 positive individuals were detected in the 3410 random samples. Thus, allele frequencies of -α 21.9 , - - THAI and -α 2.4 in the population of southern Guangxi were determined as 0.059, 0.073 and 0.161%, respectively. This is the first report of an individual carrying the -α 21.9 /-α 2.4 genotype, and the first report of the detection of -α 21.9 , -α 2.4 and - - THAI in a single family. The total frequency for these alleles was 0.293% in southern Guangxi, suggesting that the thalassemia clinical center in this region should utilize a screening kit that allows detection of these types of deletions for a more comprehensive evaluation of thalassemia risk.
$\\beta$-delayed fission, laser spectroscopy and shape-coexistence studies with radioactive At beams
We propose to study the $\\beta$-delayed fission, laser spectroscopy and radioactive decay of the newly available pure beams of neutron-deficient and neutron-rich astatine (Z=85) isotopes. The fission probability and the fission fragment distribution of the even-even isotopes $^{194,196}$Po following the $\\beta$-decay of the isotopes $^{194,196}$At will be studied with the Windmill setup. In-source laser spectroscopy will be performed on the entire astatine isotopic chain, using a combination of the Windmill setup, ISOLTRAP MR-ToF and ISOLDE Faraday. Radioactive decay data will be acquired at the Windmill setup throughout those studies and contribute to the global understanding of the phenomenon of shape coexistence in the neutron-deficient lead region.
Project specific quality assurance plan for Project W-178, 219-S secondary containment
International Nuclear Information System (INIS)
Buckles, D.I.
1994-01-01
The scope of this Quality Assurance Program Plan (QAPP) is to provide a system of Quality Assurance reviews and verifications on the design, procurement and construction of the 219-S Secondary Containment Upgrade. The reviews and verifications will be on activities associated with design, procurement, and construction of the Secondary Containment Upgrade which includes, but is not limited to demolition, removal, new tank installation, tank 103 isolation, tank cell refurbishment, electrical, instrumentation, piping/tubing including supports, pump and valves, and special coatings. The full project scope is defined in the project Functional Design Criteria (FDC), SD-W178-FDC-001, and all activities must be in compliance with this FDC and related design documentation
International Nuclear Information System (INIS)
Shahidan Yob; Nor Ishadi Ismail; Kamarudin Buyong
2015-01-01
Control of the fuel-efficient plant operations are key to gamma irradiation service in MINTec-Sinagama. Without an efficient operation, irradiation services will be disrupted and lead to customer product failed to be completed in a set time. Additionally, downtime each time operation is also important to monitor to ensure that the fuel-efficient plant exceeded 85% in each month. In this paper MINTec plant operations data collection-Sinagama made during the year 2011-2015. Analysis carried out against downtime, the extent of damage and the action according to the classification of plant problems. This data collection is important for pattern characterization solution that can be made to the irradiator IR219, JS10000 in MINTec-Sinagama. (author)
H.P. Endtz (Hubert); J.W. Mouton (Johan); J.G. den Hollander (Jan); N.P.W.C.J. van den Braak (Nicole); H.A. Verbrugh (Henri)
1997-01-01
textabstractThe in vitro activity of trovafloxacin (CP-99,219), a new fluoroquinolone, was compared with the in vitro activities of other commonly used quinolones and other antimicrobial agents against 445 gram-positive microorganisms isolated between 1986 and 1995 from
An Expert System for Managing Storage Space Constraints Aboard United States Naval Vessels
1991-12-01
d. solvents, thinners, primers, cmpounds, varnishes , and lacquers i e. alcohol, acetone, ether, and naphtha; f. greases * nd pastes Except for...suffocation. Malocarbon liquids are compounds of carbon containing any of the halogen elements ( fluorine , chlorine, bromine, iodine, or astatine. (Examples are
Charge radii and electromagnetic moments of At-211195
Cubiss, J. G.; Barzakh, A. E.; Seliverstov, M. D.; Andreyev, A. N.; Andel, B.; Antalic, S.; Ascher, P.; Atanasov, D.; Beck, D.; Bieroń, J.; Blaum, K.; Borgmann, Ch.; Breitenfeldt, M.; Capponi, L.; Cocolios, T. E.; Day Goodacre, T.; Derkx, X.; De Witte, H.; Elseviers, J.; Fedorov, D. V.; Fedosseev, V. N.; Fritzsche, S.; Gaffney, L. P.; George, S.; Ghys, L.; Heßberger, F. P.; Huyse, M.; Imai, N.; Kalaninová, Z.; Kisler, D.; Köster, U.; Kowalska, M.; Kreim, S.; Lane, J. F. W.; Liberati, V.; Lunney, D.; Lynch, K. M.; Manea, V.; Marsh, B. A.; Mitsuoka, S.; Molkanov, P. L.; Nagame, Y.; Neidherr, D.; Nishio, K.; Ota, S.; Pauwels, D.; Popescu, L.; Radulov, D.; Rapisarda, E.; Revill, J. P.; Rosenbusch, M.; Rossel, R. E.; Rothe, S.; Sandhu, K.; Schweikhard, L.; Sels, S.; Truesdale, V. L.; Van Beveren, C.; Van den Bergh, P.; Wakabayashi, Y.; Van Duppen, P.; Wendt, K. D. A.; Wienholtz, F.; Whitmore, B. W.; Wilson, G. L.; Wolf, R. N.; Zuber, K.
2018-05-01
Hyperfine-structure parameters and isotope shifts of At-211195 have been measured for the first time at CERN-ISOLDE, using the in-source resonance-ionization spectroscopy method. The hyperfine structures of isotopes were recorded using a triad of experimental techniques for monitoring the photo-ion current. The Multi-Reflection Time-of-Flight Mass Spectrometer, in connection with a high-resolution electron multiplier, was used as an ion-counting setup for isotopes that either were affected by strong isobaric contamination or possessed a long half-life; the ISOLDE Faraday cups were used for cases with high-intensity beams; and the Windmill decay station was used for short-lived, predominantly α -decaying nuclei. The electromagnetic moments and changes in the mean-square charge radii of the astatine nuclei have been extracted from the measured hyperfine-structure constants and isotope shifts. This was only made possible by dedicated state-of-the-art large-scale atomic computations of the electronic factors and the specific mass shift of atomic transitions in astatine that are needed for these extractions. By comparison with systematics, it was possible to assess the reliability of the results of these calculations and their ascribed uncertainties. A strong deviation in the ground-state mean-square charge radii of the lightest astatine isotopes, from the trend of the (spherical) lead isotopes, is interpreted as the result of an onset of deformation. This behavior bears a resemblance to the deviation observed in the isotonic polonium isotopes. Cases for shape coexistence have been identified in At,199197, for which a significant difference in the charge radii for ground (9 /2- ) and isomeric (1 /2+ ) states has been observed.
Directory of Open Access Journals (Sweden)
Spande Thomas F
2007-09-01
Full Text Available Abstract Background The 5,8-disubstituted indolizidines are the largest class of poison-frog alkaloids found in anuran skin, and are of considerable interest because of their inhibitory effects on the neuronal nicotinic acetylcholine receptors. Many synthetic strategies for the construction of this nucleus have been reported: however, a flexible route has not been reported to date. Results Synthesis of lactam chiral building blocks for the flexible synthesis of the title alkaloids has been achieved using a Michael-type conjugate addition reaction to a chiral cyclic enamine ester as the key step in constructing the trisubstituted piperidine ring system. To demonstrate the usefulness of these chiral building blocks, syntheses of (--203A, (--205A from 1, and (--219F from 2 have been achieved. Conclusion The total synthesis of (--203A, (--205A, and (--219F was achieved, and the absolute stereochemistry of natural 203A was determined to be 5S, 8R, 9S. In addition, the relative stereochemistry of natural 219F was determined.
Workshop on selected aspects of radiochemistry
International Nuclear Information System (INIS)
1991-11-01
The aspects chosen for the workshop are: isotope preparation, separation methods; radiochemical methods and analyses; environmental protection and radiochemistry; the chemistry of the fifth halogen, astatine. From the 28 contributions presented at the workshop, 24 are of relevance in the INIS and EDB scope and are separately retrievable from the database. (BBR) [de
Energy Technology Data Exchange (ETDEWEB)
Jaszczak, R.J.
1995-12-01
Research is described in the following areas: development and evaluation quantitatively of reconstruction algorithms with improved compensations for attenuation, scatter, and geometric collimator response; evaluation of single photon emission computed tomography (SPECT) quantification of iodine 123 and astatine 211; and the development and evaluation of SPECT pinhole imaging for low and medium energy photons.
International Nuclear Information System (INIS)
Jaszczak, R.J.
1995-12-01
Research is described in the following areas: development and evaluation quantitatively of reconstruction algorithms with improved compensations for attenuation, scatter, and geometric collimator response; evaluation of single photon emission computed tomography (SPECT) quantification of iodine 123 and astatine 211; and the development and evaluation of SPECT pinhole imaging for low and medium energy photons
International Nuclear Information System (INIS)
Panini, G.C.; Siciliano, F.; Lioi, A.
1987-01-01
The main characteristics of a P 3 coupled 219-group neutron 36-group gamma-ray library in the AMPX-II Master Interface Format obtained processing ENDF/B-IV data by means of various AMPX-II System modules are presented in this note both for the more reprocessing aspects and features of the generated component files-neutrons, photon and secondary gamma-ray production cross sections. As far as the neutron data are concerned there is the avaibility of 186 data sets regarding most significant fission products. Results of the additional validation of the neutron data pertaining to eighteen benchmark experiments are also given. Some calculational tests on both neutron and coupled data emphasize the important role of the secondary gamma-ray data in nuclear criticality safety calculations
Bekkenk, MW; Geelen, FAMJ; Vader, PCV; Heule, F; Geerts, ML; van Vloten, WA; Meijer, CJLM; Willemze, R
2000-01-01
To evaluate our diagnostic and therapeutic guidelines, clinical and long-term follow-up data of 219 patients with primary or secondary cutaneous CD30(+) lympho proliferative disorders were evaluated. The study group included 118 patients with lymphomatoid papulosis (LyP; group 1), 79 patients with
Bekkenk, M. W.; Geelen, F. A.; van Voorst Vader, P. C.; Heule, F.; Geerts, M. L.; van Vloten, W. A.; Meijer, C. J.; Willemze, R.
2000-01-01
To evaluate our diagnostic and therapeutic guidelines, clinical and long-term follow-up data of 219 patients with primary or secondary cutaneous CD30(+) lymphoproliferative disorders were evaluated. The study group included 118 patients with lymphomatoid papulosis (LyP; group 1), 79 patients with
The Installation Restoration Program Toxicology Guide. Volume 2
1987-05-01
Periodic Table: fluorine , chlorine, bromine, iodine, and astatine. Fluorine is the most active of all chemical elements. 5/87 LIST OF ABBREVIATIONS...fire- retardant varnishes and as an aminizing agent for cotton fabric (901). 37.2 ENVIRONMENTAL FATE A1D EXPOSURE PATHWAYS 37.2.1 Transport in Soil...subject to packaging and labeling regulations. Directive on Paints, Varnishes . Printing Inks. Adhesives and Similar Product; (1334) Pentachlorophenol
International Nuclear Information System (INIS)
Asma Ilyani Kadar; Sobri Hussein; Abdul Rahim Harun; Fazliana Mohd Saaya
2014-01-01
Mutation technique is a conventional breeding technique and it is very effective in improving of main crop characteristics such as yield traits, resistance to diseases and pests and nutritional qualities. In this study, MR219 seeds were treated with Carbon ion radiation (60 Gy) by AVF-Cyclotron at the Japan Atomic Energy Research Institute (JAERI), Takasaki, Japan and were planted at the Malaysian Nuclear Agency up to third mutant generation (M3). Thirty one M3 mutant lines (ML1 to ML31) were evaluated on morphological, yield and yield components, and were compared to the parental variety, MR219. Analysis of variance revealed that there was a significant difference among mutant lines in culm height, days to flowering, number of tillers, number of panicles, 1000 grain weight, total grain weight, total of dry matter, alkaline spreading value, gel consistency, amylose content, ash, crude protein, fat, dietary fibre, carbohydrate and energy. Mutant line ML21 had the best performance in majority of yield components and vegetative traits as compared to others mutant lines and parental variety. For nutritional composition, mutant lines namely ML31, ML21, ML10, ML19 were improved in crude protein content, dietary fibre and carbohydrate content. The estimation of glycemic index revealed that two mutant lines namely ML3 and ML30 can be consumed by diabetics. (author)
Incidence and predictors of difficult laryngoscopy in 11,219 pediatric anesthesia procedures.
Heinrich, Sebastian; Birkholz, Torsten; Ihmsen, Harald; Irouschek, Andrea; Ackermann, Andreas; Schmidt, Joachim
2012-08-01
Difficult laryngoscopy in pediatric patients undergoing anesthesia. This retrospective analysis was conducted to investigate incidence and predictors of difficult laryngoscopy in a large cohort of pediatric patients receiving general anesthesia with endotracheal intubation. Young age and craniofacial dysmorphy are predictors for the difficult pediatric airway and difficult laryngoscopy. For difficult laryngoscopy, other general predictors are not yet described. Retrospectively, from a 5-year period, data from 11.219 general anesthesia procedures in pediatric patients with endotracheal intubation using age-adapted Macintosh blades in a single center (university hospital) were analyzed statistically. The overall incidence of difficult laryngoscopy [Cormack and Lehane (CML) grade III and IV] was 1.35%. In patients younger than 1 year, the incidence of CML III or IV was significantly higher than in the older patients (4.7% vs 0.7%). ASA Physical Status III and IV, a higher Mallampati Score (III and IV) and a low BMI were all associated (P pediatric anesthesia is lower than in adults. Our results show that the risk of difficult laryngoscopy is much higher in patients below 1 year of age, in underweight patients and in ASA III and IV patients. The underlying disease might also contribute to the risk. If the Mallampati score could be obtained, prediction of difficult laryngoscopy seems to be reliable. Our data support the existing recommendations for a specialized anesthesiological team to provide safe anesthesia for infants and neonates. © 2012 Blackwell Publishing Ltd.
Directory of Open Access Journals (Sweden)
Jun Li
2014-01-01
Full Text Available Background. Several common single-nucleotide polymorphisms (SNPs at apolipoprotein E (ApoE have been linked with late onset sporadic Alzheimer’s disease and declining normative cognitive ability in elder people, but we are unclear about their relationship with cognition in children. Results. We studied -491A/T, -427T/C, and -219G/T promoter polymorphisms and ε2/ε3/ε4 at ApoE among children with mental retardation (MR, n=130, borderline MR (n=124, and controls (n=334 from an iodine deficiency area in China. The allelic and genotypic distribution of individual locus did not significantly differ among three groups with Mantel-Haenszel χ2 test (P>0.05. However, frequencies of haplotype of -491A/-427T/-219T/ε4 were distributed as MR > borderline MR > controls (P uncorrected = 0.004, indicating that the presence of this haplotype may increase the risk of disease. Conclusions. In this large population-based study in children, we did not find any significant association between single locus of the four common ApoE polymorphisms (-491A/T, -427T/C, -219T/G, and ε2/3/4 and MR or borderline MR. However, we found that the presence of ATTε4 haplotype was associated with an increased risk of MR and borderline MR. Our present work may help enlarge our knowledge of the cognitive role of ApoE across the lifespan and the mechanisms of human cognition.
Energy Technology Data Exchange (ETDEWEB)
Narita, Norio; Hori, Yasunori; Kusakabe, Nobuhiko; Takeda, Yoichi; Tamura, Motohide [Astrobiology Center, 2-21-1 Osawa, Mitaka, Tokyo, 181-8588 (Japan); Hirano, Teruyuki [Department of Earth and Planetary Sciences, Tokyo Institute of Technology, 2-12-1 Ookayama, Meguro-ku, Tokyo 152-8551 (Japan); Fukui, Akihiko; Yanagisawa, Kenshi [Okayama Astrophysical Observatory, National Astronomical Observatory of Japan, Asakuchi, Okayama 719-0232 (Japan); Sanchis-Ojeda, Roberto [Department of Astronomy, University of California, Berkeley, CA 94720 (United States); Winn, Joshua N. [Department of Physics, and Kavli Institute for Astrophysics and Space Research, Massachusetts Institute of Technology, Cambridge, MA 02139 (United States); Ryu, Tsuguru; Onitsuka, Masahiro [National Astronomical Observatory of Japan, 2-21-1 Osawa, Mitaka, Tokyo, 181-8588 (Japan); Kudo, Tomoyuki [Subaru Telescope, 650 North A’ohoku Place, Hilo, HI 96720 (United States); Delrez, Laetitia; Gillon, Michael; Jehin, Emmanuel [Institut d’Astrophysique et de Géophysique, Université de Liège, Allée du 6 Août 17, Bat. B5C, B-4000 Liège (Belgium); McCormac, James [Department of Physics, University of Warwick, Gibbet Hill Road, Coventry CV4 7AL (United Kingdom); Holman, Matthew [Smithsonian Astrophysical Observatory, 60 Garden Street, Cambridge, MA 02138 (United States); Izumiura, Hideyuki, E-mail: norio.narita@nao.ac.jp [SOKENDAI (The Graduate University for Advanced Studies), 2-21-1 Osawa, Mitaka, Tokyo, 181-8588 (Japan)
2015-12-10
K2-19 (EPIC201505350) is an interesting planetary system in which two transiting planets with radii ∼7 R{sub ⊕} (inner planet b) and ∼4 R{sub ⊕} (outer planet c) have orbits that are nearly in a 3:2 mean-motion resonance. Here, we present results of ground-based follow-up observations for the K2-19 planetary system. We have performed high-dispersion spectroscopy and high-contrast adaptive-optics imaging of the host star with the HDS and HiCIAO on the Subaru 8.2 m telescope. We find that the host star is a relatively old (≥8 Gyr) late G-type star (T{sub eff} ∼ 5350 K, M{sub s} ∼ 0.9 M{sub ⊙}, and R{sub s} ∼ 0.9 R{sub ⊙}). We do not find any contaminating faint objects near the host star that could be responsible for (or dilute) the transit signals. We have also conducted transit follow-up photometry for the inner planet with KeplerCam on the FLWO 1.2 m telescope, TRAPPISTCAM on the TRAPPIST 0.6 m telescope, and MuSCAT on the OAO 1.88 m telescope. We confirm the presence of transit timing variations (TTVs), as previously reported by Armstrong and coworkers. We model the observed TTVs of the inner planet using the synodic chopping formulae given by Deck and Agol. We find two statistically indistinguishable solutions for which the period ratios (P{sub c}/P{sub b}) are located slightly above and below the exact 3:2 commensurability. Despite the degeneracy, we derive the orbital period of the inner planet P{sub b} ∼ 7.921 days and the mass of the outer planet M{sub c} ∼ 20 M{sub ⊕}. Additional transit photometry (especially for the outer planet) as well as precise radial-velocity measurements would be helpful to break the degeneracy and to determine the mass of the inner planet.
Folding model analysis of 58Ni + 64Ni elastic and inelastic scattering at Elab=203.8 and 219.2 MeV
International Nuclear Information System (INIS)
Ruiz, J.A.; Ferrero, J.L.; Bilwes, B.; Bilwes, R.
1992-01-01
Angular distributions of elastic scattering of 58 Ni by 64 Ni and inelastic scattering leading to the first 2 + state in 58 Ni or in 64 Ni were measured at E lab =203.8 and 219.2 MeV. The data were analyzed in the frame of the folding model. A renormalization N of the folding potential consistently lower than unity (N∼0.65) is needed to reproduce the elastic scattering data. Coupled-channel calculations including the main inelastic channels explain partly this discrepancy. They reproduce the elastic and inelastic scattering data with a renormalization of N∼0.8 at both energies. Interference between Coulomb and nuclear excitation is shown to play an important role in the repulsive character of the polarization potential. (author) 38 refs.; 6 figs.; 1 tab
Breton, Jacques; Lavergne, Jérôme; Wakeham, Marion C; Nabedryk, Eliane; Jones, Michael R
2007-06-05
In native reaction centers (RCs) from photosynthetic purple bacteria the primary quinone (QA) and the secondary quinone (QB) are interconnected via a specific His-Fe-His bridge. In Rhodobacter sphaeroides RCs the C4=O carbonyl of QA forms a very strong hydrogen bond with the protonated Npi of His M219, and the Ntau of this residue is in turn coordinated to the non-heme iron atom. The second carbonyl of QA is engaged in a much weaker hydrogen bond with the backbone N-H of Ala M260. In previous work, a Trp side chain was introduced by site-directed mutagenesis at the M260 position in the RC of Rb. sphaeroides, resulting in a complex that is completely devoid of QA and therefore nonfunctional. A photochemically competent derivative of the AM260W mutant was isolated that contains a Cys side chain at the M260 position (denoted AM260(W-->C)). In the present work, the interactions between the carbonyl groups of QA and the protein in the AM260(W-->C) suppressor mutant have been characterized by light-induced FTIR difference spectroscopy of the photoreduction of QA. The QA-/QA difference spectrum demonstrates that the strong interaction between the C4=O carbonyl of QA and His M219 is lost in the mutant, and the coupled CO and CC modes of the QA- semiquinone are also strongly perturbed. In parallel, a band assigned to the perturbation of the C5-Ntau mode of His M219 upon QA- formation in the native RC is lacking in the spectrum of the mutant. Furthermore, a positive band between 2900 and 2400 cm-1 that is related to protons fluctuating within a network of highly polarizable hydrogen bonds in the native RC is reduced in amplitude in the mutant. On the other hand, the QB-/QB FTIR difference spectrum is essentially the same as for the native RC. The kinetics of electron transfer from QA- to QB were measured by the flash-induced absorption changes at 780 nm. Compared to native RCs the absorption transients are slowed by a factor of about 2 for both the slow phase (in the
A simple method for labelling proteins with 211At via diazotized aromatic diamine
International Nuclear Information System (INIS)
Wunderlich, G.; Franke, W.-G.; Fischer, S.; Dreyer, R.
1987-01-01
A simple and rapid method for labelling proteins with 211 At by means of a 1,4-diaminobenzene link is described. This link is transformed into the diazonium salt and subsequently reactions of both 211 At and proteins with the diazonium salt take place simultaneously. For possibly high yields of astatized protein an appropriate temperature of 273 K was found. The results demonstrate the difference between the reaction mechanisms of iodine and astatine with proteins. (author)
International Nuclear Information System (INIS)
Longo, R C; MartInez, E; Dieguez, O; Vega, A; Gallego, L J
2007-01-01
Using the modified embedded atom model in conjunction with a self-consistent tight-binding method, we investigated the lowest-energy structures of Fe monolayers and isolated Fe n clusters (n = 2-19) supported on the Ni(111) surface. In keeping with experimental findings, our calculations predict that the atoms of the monolayer occupy face-centred cubic (fcc) rather than hexagonal close-packed (hcp) sites. Likewise in agreement with experiment we found that Fe layers stack with a pseudomorphic fcc structure up to two monolayers, beyond which they stack as bcc(110). The structures of supported Fe clusters are predicted to be two-dimensional islands maximizing the number of nearest-neighbour bonds among the adsorbed Fe atoms, and their average magnetic moments per atom decrease towards that of the supported Fe monolayer almost monotonically as n increases. Finally, a pair of Fe 3 clusters on Ni(111) were found to exhibit virtually no interaction with each other even when separated by only one atomic row, i.e. so long as they do not coalesce they retain their individual magnetic properties
Contribution of weight status to asthma prevalence racial disparities, 2-19 year olds, 1988-2014.
Akinbami, Lara J; Rossen, Lauren M; Fakhouri, Tala H I; Simon, Alan E; Kit, Brian K
2017-08-01
Racial disparities in childhood asthma prevalence increased after the 1990s. Obesity, which also varies by race/ethnicity, is an asthma risk factor but its contribution to asthma prevalence disparities is unknown. We analyzed nationally representative National Health Examination and Nutrition Survey data for 2-19 year olds with logistic regression and decomposition analyses to assess the contributions of weight status to racial disparities in asthma prevalence, controlling for sex, age, and income status. From 1988-1994 to 2011-2014, asthma prevalence increased more among non-Hispanic black (NHB) (8.4% to 18.0%) than non-Hispanic white (NHW) youth (7.2% to 10.3%). Logistic regression showed that obesity was an asthma risk factor for all groups but that a three-way "weight status-race/ethnicity-time" interaction was not significant. That is, weight status did not modify the race/ethnicity association with asthma over time. In decomposition analyses, weight status had a small contribution to NHB/NHW asthma prevalence disparities but most of the disparity remained unexplained by weight status or other asthma risk factors (sex, age and income status). NHB youth had a greater asthma prevalence increase from 1988-1994 to 2011-2014 than NHW youth. Most of the racial disparity in asthma prevalence remained unexplained after considering weight status and other characteristics. Published by Elsevier Inc.
Wilbur, D. Scott; Chyan, Ming-Kuan; Hamlin, Donald K.; Nguyen, Holly; Vessella, Robert L.
2011-01-01
Evaluation of monoclonal antibody (MAb) fragments (e.g. Fab′, Fab or engineered fragments) as cancer-targeting reagents for therapy with the α-particle emitting radionuclide astatine-211 (211At) has been hampered by low in vivo stability of the label and a propensity of these proteins localize to kidneys. Fortunately, our group has shown that the low stability of the 211At label, generally a meta- or para-[211At]astatobenzoyl conjugate, on MAb Fab′ fragments can be dramatically improved by use of closo-decaborate(2-) conjugates. However, the higher stability of radiolabeled MAb Fab′ conjugates appears to result in retention of the radioactivity in kidneys. This investigation was conducted to evaluate whether the retention of radioactivity in kidney might be decreased by the use of acid-cleavable hydrazone between the Fab′ and the radiolabeled closo-decaborate(2-) moiety. Five conjugation reagents containing sulfhydryl-reactive maleimide groups, a hydrazone functionality and a closo-decaborate(2-) moiety were prepared. In four of the five conjugation reagents, a discrete polyethylene glycol (PEG) linker was used, and one substituent adjacent to the hydrazone was varied (phenyl, benzoate, anisole or methyl) to provide varying acid-sensitivity. In the initial studies, the five maleimido-closo-decaborate(2-) conjugation reagents were radioiodinated (125I or 131I), then conjugated with an anti-PSMA Fab′ (107-1A4 Fab′). Biodistributions of the five radioiodinated Fab′ conjugates were obtained in nude mice at 1, 4 and 24 h post injection (pi). In contrast to closo-decaborate(2-) conjugated to 107-1A4 Fab′ through a non-cleavable linker, two conjugates containing either a benzoate or a methyl substituent on the hydrazone functionality displayed clearance rates from kidney, liver and spleen that were similar to those obtained with directly radioiodinated Fab′ (i.e. no conjugate). The maleimido-closo-decaborate(2-) conjugation reagent containing a benzoate
Directory of Open Access Journals (Sweden)
Marie Hélène C. Torres
2014-12-01
Full Text Available Ensaios de Teoria e Prática de Tradução. A tradução na sala de aula. Maria Alice Araújo Ferreira, Germana Henriques Pereira de Souza e Sabine Gorovitz (Org., Brasília: Editora da UnB, 2014. 219 p.
Fabbian, Fabio; Gallerani, Massimo; Pala, Marco; De Giorgi, Alfredo; Salmi, Raffaella; Dentali, Francesco; Ageno, Walter; Manfredini, Roberto
2014-11-01
Using a regional Italian database, we evaluated the relationship between renal dysfunction and in-hospital mortality (IHM) in patients with acute stroke (ischemic/hemorrhagic). Patients were classified on the basis of renal damage: without renal dysfunction, with chronic kidney disease (CKD), and with end-stage renal disease (ESRD). Of a total of 186,219 patients with a first episode of stroke, 1626 (0.9%) had CKD and 819 (0.4%) had ESRD. Stroke-related IHM (total cases) was independently associated with CKD, ESRD, atrial fibrillation (AF), age, and Charlson comorbidity index (CCI). In patients with ischemic stroke (n=154,026), IHM remained independently associated with CKD, ESRD, AF, and CCI. In patients with hemorrhagic stroke (n=32,189), variables that were independently associated with IHM were CKD, ESRD, and AF. Renal dysfunction is associated with IHM related to stroke, both ischemic and hemorrhagic, with even higher odds ratios than those of other established risk factors, such as age, comorbidities, and AF. © The Author(s) 2013.
Jacobson, Denise L.; Williams, Paige; Tassiopoulos, Katherine; Melvin, Ann; Hazra, Rohan; Farley, John
2011-01-01
Background Hypercholesterolemia is common in perinatally HIV-infected (HIV+) children, but little is known about the clinical course and management in this population. Methods We studied HIV+ children in a multisite prospective cohort study (PACTG 219C) and considered follow-up for two years after development of hypercholesterolemia. We estimated the time to and factors associated with resolution of hypercholesterolemia and described changes in ARV regimen and use of lipid-lowering medications. We defined incident hypercholesterolemia as entry total cholesterol (cholesterol) hypercholesterolemia as two consecutive cholesterol hypercholesterolemia. Results Among 240 incident hypercholesterolemia cases, 81 (34%) had resolution to normal cholesterol within two years of follow-up (median follow-up = 1.9 years). The median age of cases was 10.3 years with 54% Non-Hispanic black and 53% male. Resolution to normal cholesterol was more likely in children who changed ARV regimen (adjusted Hazard Ratio (aHR) = 2.37, 95%CI 1.45, 3.88) and who were ≥ 13 years old (aHR=2.39, 95%CI 1.33, 4.27). Types of regimen changes varied greatly and 15 children began statins. Conclusions The majority of children who develop hypercholesterolemia maintain elevated levels over time, potentially placing them at risk for premature cardiovascular morbidity. PMID:21602698
Tank 103, 219-S Facility at 222-S Laboratory, analytical results for the final report
International Nuclear Information System (INIS)
Fuller, R.K.
1998-01-01
This is the final report for the polychlorinated biphenyls analysis of Tank-103 (TK-103) in the 219-S Facility at 222-S Laboratory. Twenty 1-liter bottles (Sample numbers S98SO00074 through S98SO00093) were received from TK-103 during two sampling events, on May 5 and May 7, 1998. The samples were centrifuged to separate the solids and liquids. The centrifuged sludge was analyzed for PCBs as Aroclor mixtures. The results are discussed on page 6. The sample breakdown diagram (Page 114) provides a cross-reference of sample identification of the bulk samples to the laboratory identification number for the solids. The request for sample analysis (RSA) form is provided as Page 117. The raw data is presented on Page 43. Sample Description, Handling, and Preparation Twenty samples were received in the laboratory in 1-Liter bottles. The first 8 samples were received on May 5, 1998. There were insufficient solids to perform the requested PCB analysis and 12 additional samples were collected and received on May 7, 1998. Breakdown and sub sampling was performed on May 8, 1998. Sample number S98SO00084 was lost due to a broken bottle. Nineteen samples were centrifuged and the solids were collected in 8 centrifuge cones. After the last sample was processed, the solids were consolidated into 2 centrifuge cones. The first cone contained 9.7 grams of solid and 13.0 grams was collected in the second cone. The wet sludge from the first centrifuge cone was submitted to the laboratory for PCB analysis (sample number S98SO00102). The other sample portion (S98SO00103) was retained for possible additional analyses
Astatine-211 labelled proteins and their stability in vivo
International Nuclear Information System (INIS)
Yi Changhou; Jin Jannan; Zhang Shuyuan; Wang Ketai; Zhang Dayuan; Zhou Maolun
1989-01-01
211 At or 131 I labelled proteins, e.g. 211 At-IgG or 211 At-BSA (bovine serum albumin) were prepared by 211 At reaction with the diazo-compound of para-aminobenzoic acid, which is then conjugated with IgG or BSA via an acylation reaction. The 211 At-carbon bond was found metabolically stable under in vivo conditions. For the labelling of proteins with 211 At or 131 I, other methods of direct oxidation are also described. The results show that for the labelling of proteins with 211 At, high rate of incorporation can be obtained with hydrogen peroxide as oxidant, but the labelling of proteins with 131 I is more favourable with the strong oxidant Chloramine-T. (author) 12 refs.; 6 figs
Directory of Open Access Journals (Sweden)
Marie Hélène C. Torres
2014-12-01
Full Text Available http://dx.doi.org/10.5007/2175-7968.2014v2n34p294 Ensaios de Teoria e Prática de Tradução. A tradução na sala de aula. Maria Alice Araújo Ferreira, Germana Henriques Pereira de Souza e Sabine Gorovitz (Org., Brasília: Editora da UnB, 2014. 219 p.
Torres, Marie Hélène C.
2014-01-01
http://dx.doi.org/10.5007/2175-7968.2014v2n34p294 Ensaios de Teoria e Prática de Tradução. A tradução na sala de aula. Maria Alice Araújo Ferreira, Germana Henriques Pereira de Souza e Sabine Gorovitz (Org.), Brasília: Editora da UnB, 2014. 219 p.
Directory of Open Access Journals (Sweden)
Daryush Talei
2013-01-01
Full Text Available Germination is a key process in plants' phenological cycles. Accelerating this process could lead to improvment of the seedling growth as well as the cultivation efficiency. To achieve this, the effect of microwave frequency on the germination of rice seeds was examined. The physiological feedbacks of the MR 219 rice variety in terms of seed germination rate (GR, germination percentage (GP, and mean germination time (MGT were analyzed by exposing its seeds to 2450 MHz of microwave frequency for one, four, seven, and ten hours. It was revealed that exposing the seeds to the microwave frequency for 10 hours resulted in the highest GP. This treatment led to 100% of germination after three days with a mean germination time of 2.1 days. Although the other exposure times of microwave frequency caused the moderate effects on germination with a GPa3 ranged from 93% to 98%, they failed to reduce the MGTa3. The results showed that ten-hour exposure times of microwave frequency for six days significantly facilitated and improved the germination indices (primary shoot and root length. Therefore, the technique is expected to benefit the improvement of rice seed germination considering its simplicity and efficacy in increasing the germination percentage and rate as well as the primary shoot and root length without causing any environmental toxicity.
Energy Technology Data Exchange (ETDEWEB)
Hlodak, M [Univerzita Komenskeho v Bratislave, Prirodovedecka fakulta, Ustav laboratorneho vyskumu geomaterialov, 84215 Bratislava (Slovakia)
2012-04-25
Soil contamination by different PTSD may have different geogenic and anthropogenic origin and occurs in all countries of the world. The aim of this paper is to evaluate the soils contamination of a lower plain of the Hron River. This paper used the results of the thesis Soil contamination of the Hron River floodplain by trace elements (As, Cd, Cu, Hg, Pb, Zn) [1]. Soil contamination was evaluated by: Act. 219/2008 Coll. on the protection and use of agricultural land, by anthropogenic factor (AF), geo-accumulation index (IgeoE) and Tomlinson index - the index of the pollution load (PLI). (author)
Yu, Yu; Qian, Lei; Cui, Jiuwei
2017-09-01
Current evidence suggests that the neutrophil-to-lymphocyte ratio (NLR) may be a biomarker for poor prognosis in lung cancer, although this association remains controversial. Therefore, a meta-analysis was performed to evaluate the association between NLR and lung cancer outcome. A systematic literature search was performed through the PubMed, Embase and Cochrane Library databases (until July 30, 2016), to identify studies evaluating the association between NLR and overall survival (OS) and/or progression-free survival (PFS) among patients with lung cancer. Based on the results of this search, data from 18 studies involving 7,219 patients with lung cancer were evaluated. The pooled hazard ratio (HR) suggested that elevated pretreatment NLR predicted poor OS [HR=1.46, 95% confidence interval (CI): 1.30-1.64] and poor PFS (HR=1.42, 95% CI: 1.15-1.75) among patients with lung cancer. Subgroup analysis revealed that the prognostic value of NLR for predicting poor OS increased among patients who underwent surgery (HR=1.50, 95% CI: 1.21-1.84) or patients with early-stage disease (HR=1.64, 95% CI: 1.37-1.97). An NLR cut-off value of ≥4 significantly predicted poor OS (HR=1.56, 95% CI: 1.31-1.85) and PFS (HR=1.54, 95% CI: 1.13-1.82), particularly in the cases of small-cell lung cancer. Thus, the results of the present meta-analysis suggested that an elevated pretreatment NLR (e.g., ≥4) may be considered as a biomarker for poor prognosis in patients with lung cancer.
International Nuclear Information System (INIS)
1995-07-01
This report is a transcript of an interview of Dr. Patricia Wallace Durbin by representatives of the US DOE Office of Human Radiation Research. Dr. Durbin was selected for this interview because of her knowledge of the human plutonium injections and her recollections of key figures, especially Joseph Hamilton. After a brief biographical sketch Dr. Durbin discusses her loss of research funding from DOE, her recollections concerning research into strontium metabolism as part of Project Sunshine, her recollections relating to the rationale for studies of human metabolism of radionuclides, her remembrances of Dr. Hamilton's Astatine and Plutonium research, and her experiences in gathering archival records concerning these researches
Directory of Open Access Journals (Sweden)
D. A. Fink
2015-02-01
Full Text Available A Laser Ion Source and Trap (LIST for a thick-target, isotope-separation on-line facility has been implemented at CERN ISOLDE for the production of pure, laser-ionized, radioactive ion beams. It offers two modes of operation, either as an ion guide, which performs similarly to the standard ISOLDE resonance ionization laser ion source (RILIS, or as a more selective ion source, where surface-ionized ions from the hot ion-source cavity are repelled by an electrode, while laser ionization is done within a radio-frequency quadrupole ion guide. The first physics application of the LIST enables the suppression of francium contamination in ion beams of neutron-rich polonium isotopes at ISOLDE by more than 1000 with a reduction in laser-ionization efficiency of only 20. Resonance ionization spectroscopy is performed directly inside the LIST device, allowing the study of the hyperfine structure and isotope shift of ^{217}Po for the first time. Nuclear decay spectroscopy of ^{219}Po is performed for the first time, revealing its half-life, α-to-β-decay branching ratio, and α-particle energy. This experiment demonstrates the applicability of the LIST at radioactive ion-beam facilities for the production and study of pure beams of exotic isotopes.
Microdosimetry of astatine-211 and comparison with that of iodine-125
International Nuclear Information System (INIS)
Unak, T.
2001-01-01
211 At is an alpha and Auger emitter radionuclide and has been frequently used for labeling of different kind of chemical agents. 125 I is also known as an effective Auger emitter. The radionuclides which emit short range and high LET radiations such as alpha particles and Auger electrons have high radiotoxic effectiveness on the living systems. The microdosimetric data are suitable to clarify the real radiotoxic effectiveness and to get the detail of diagnostic and therapeutic application principles of these radionuclides. In this study, the energy and dose absorptions by cell nucleus from alpha particles and Auger electrons emitted by 211 At have been calculated using a Monte Carlo calculation program (code: UNMOC). For these calculations two different model corresponding to the cell nucleus have been used and the data obtained were compared with the data earlier obtained for 125 I. As a result, the radiotoxicity of 211 At is in the competition with 125 I. In the case of a specific agent labelled with 211 At or 125 I is incorporated into the cell or cell nucleus, but non-bound to DNA or not found very close to it, 211 At should considerably be much more radiotoxic than 125 I, but in the case of the labelled agent is bound to DNA or take a place very close to it, the radiotoxicity of 125 I should considerably be higher than 211 At. (author)
Teze, David; Sergentu, Dumitru-Claudiu; Kalichuk, Valentina; Barbet, Jacques; Deniaud, David; Galland, Nicolas; Maurice, Rémi; Montavon, Gilles
2017-05-31
211 At is a most promising radionuclide for targeted alpha therapy. However, its limited availability and poorly known basic chemistry hamper its use. Based on the analogy with iodine, labelling is performed via astatobenzoate conjugates, but in vivo deastatination occurs, particularly when the conjugates are internalized in cells. Actually, the chemical or biological mechanism responsible for deastatination is unknown. In this work, we show that the C-At "organometalloid" bond can be cleaved by oxidative dehalogenation induced by oxidants such as permanganates, peroxides or hydroxyl radicals. Quantum mechanical calculations demonstrate that astatobenzoates are more sensitive to oxidation than iodobenzoates, and the oxidative deastatination rate is estimated to be about 6 × 10 6 faster at 37 °C than the oxidative deiodination one. Therefore, we attribute the "internal" deastatination mechanism to oxidative dehalogenation in biological compartments, in particular lysosomes.
Directory of Open Access Journals (Sweden)
Fiona Hey
Full Text Available The WNT signalling pathway controls many developmental processes and plays a key role in maintenance of intestine renewal and homeostasis. Glycogen Synthase Kinase 3 (GSK3 is an important component of the WNT pathway and is involved in regulating β-catenin stability and expression of WNT target genes. The mechanisms underpinning GSK3 regulation in this context are not completely understood, with some evidence suggesting this occurs through inhibitory N-terminal serine phosphorylation in a similar way to GSK3 inactivation in insulin signaling. To investigate this in a physiologically relevant context, we have analysed the intestinal phenotype of GSK3 knockin mice in which N-terminal serines 21/9 of GSK3α/β have been mutated to non-phosphorylatable alanine residues. We show that these knockin mutations have very little effect on overall intestinal integrity, cell lineage commitment, β-catenin localization or WNT target gene expression although a small increase in apoptosis at villi tips is observed. Our results provide in vivo evidence that GSK3 is regulated through mechanisms independent of N-terminal serine phosphorylation in order for β-catenin to be stabilised.
78 FR 48152 - Advisory Committee on Student Financial Assistance; Meeting
2013-08-07
..., 80 F Street NW., Suite 413, Washington DC 20202-7582, (202) 219- 2099. SUPPLEMENTARY INFORMATION: The... at (202) 219-3032. You may also contact the Advisory Committee staff directly at (202) 219-2099. The..., August 21, 2013 by contacting Ms. Tracy Jones at (202) 219-2099 or via email at [email protected
75 FR 29739 - Advisory Committee on Student Financial Assistance: Hearing
2010-05-27
..., Capitol Place, 80 F Street, NW., Suite 413, Washington, DC 20202-7582, (202) 219-2099. Individuals who use... (202) 219-2099 or via e-mail at [email protected] . We will attempt to meet requests after this... at (202) 219-3032. You may also contact the Advisory Committee staff directly at (202) 219-2099. The...
Rehm, Colin D; Drewnowski, Adam; Monsivais, Pablo
2015-01-01
Dietary guidance emphasizes plain low-fat and skim milk over whole, reduced-fat, and flavored milk (milk eligible for replacement [MER]). The objective of this study was to evaluate the population-level impact of such a change on energy, macronutrient and nutrient intakes, and diet cost. Cross-sectional modeling study. Data from the 2001-2002 and 2003-2004 National Health and Nutrition Examination Survey. A total of 8,112 children aged 2-19 years. Energy, macronutrient, and micronutrient intake before and after replacement of MER with low-fat or skim milk. Survey-weighted linear regression models. Milk eligible for replacement accounted for 46% of dairy servings. Among MER consumers, replacement with skim or low-fat milk would lead to a projected reduction in energy of 113 (95% confidence interval [CI], 107-119) and 77 (95% CI, 73-82) kcal/d and percent energy from saturated fat by an absolute value of 2.5% of total energy (95% CI, 2.4-2.6) and 1.4% (95% CI, 1.3-1.5), respectively. Replacement of MER does not change diet costs or calcium and potassium intake. Substitution of MER has the potential to reduce energy and total and saturated fat intake with no impact on diet costs or micronutrient density. The feasibility of such replacement has not been examined and there may be negative consequences if replacement is done with non-nutrient-rich beverages. Copyright © 2015. Published by Elsevier Inc.
Use of interhalogen exchange for preparation of astatine-benzene and iodo-benzene
International Nuclear Information System (INIS)
Kolachkovski, A.; Khalkin, V.A.
1976-01-01
Experimental testing of interhalogen exchange between the solid and liquid phases has been carried out at 155 deg C with particular reference to a NaOH-Na 131 I-BrPh system. Iodine transition rate is dependent on the process duration and alkali amount. The relative amounts of 131 IPh resultant from the reaction of interhalogen exchange is evaluated by paper chromatography. The results obtained may be considered as those which provide experimental support for the assumed efficiency of the production of 131 IPh based on the reaction of interhalogen exchange to yield 70-80% 131 IPh
International Nuclear Information System (INIS)
Korotkin, Yu.S.; Ter-Akop'yan, G.M.; Popeko, A.G.; Drobina, T.P.; Zhuravleva, E.L.
1982-01-01
The results of experiments on further concentration of a new natural spontaneously fissionable nuclide, the concentrates of which form the Cheleken geothermal brines have been obtained, are presented. The conclusions are drown about the chemical nature of a new spontaneously fissionable nuclide. It is a chalcophile element which copreipitates with sulphides of copper, lead, arsenic and mercury from weakly acid solutions. The behaviour of the new nuclide in sulphide systems in many respects is similar to the behaviour of polonium, astatine and probably of bismuth. The most probable stable valence of the new nuclide varies from +1 up to +3. The data available on the chemical behaviour of the new nuclide as well as the analysis over contamination by spontaneously fissionable isotopes permit to state that the new natural spontaneously fissionable nuclide does not relate to the known isotopes
Is Electronegativity a Useful Descriptor for the 'Pseudo-Alkali-Metal' NH4?
International Nuclear Information System (INIS)
Whiteside, Alexander; Xantheas, Sotiris S.; Gutowski, Maciej S.
2011-01-01
Molecular ions in the form of 'pseudo-atoms' are common structural motifs in chemistry, with properties that are transferrable between different compounds. We have determined the electronegativity of the 'pseudo-alkali metal' ammonium (NH4) and evaluated its reliability as a descriptor in comparison to the electronegativities of the alkali metals. The computed properties of its binary complexes with astatine and of selected borohydrides confirm the similarity of NH4 to the alkali metal atoms, although the electronegativity of NH4 is relatively large in comparison to its cationic radius. We paid particular attention to the molecular properties of ammonium (angular anisotropy, geometric relaxation, and reactivity), which can cause deviations from the behaviour expected of a conceptual 'true alkali metal' with this electronegativity. These deviations allow for the discrimination of effects associated with the polyatomic nature of NH4.
48 CFR 1819.7302 - NASA contract clauses.
2010-10-01
... to Public Law 97-219 (the Small Business Innovation Development Act of 1982). (b) Contracting... pursuant to Public Law 97-219 (the Small Business Innovation Development Act of 1982). (c) Contracting... Law 97-219 (the Small Business Innovation Development Act of 1982). (d) Contracting officers shall...
75 FR 55314 - Advisory Committee on Student Financial Assistance: Meeting
2010-09-10
... later than Monday, September 20, 2010 by contacting Ms. Tracy Jones at (202) 219- 2099 or via e-mail at..., 80 F Street, NW., Suite 413, Washington, DC 20202-7582, (202) 219-2099. SUPPLEMENTARY INFORMATION.... You may also contact the Advisory Committee staff directly at (202) 219-2099. The registration...
76 FR 7551 - Advisory Committee on Student Financial Assistance: Hearing
2011-02-10
...-7582, (202) 219-2099. Individuals who use a telecommunications device for the deaf (TDD) may call the.... Tracy Jones at (202) 219-2099 or via email at [email protected] . We will attempt to meet...-3032. You may also contact the Advisory Committee staff directly at (202) 219-2099. The registration...
77 FR 42490 - Advisory Committee on Student Financial Assistance: Meeting
2012-07-19
..., 80 F Street NW., Suite 413, Washington, DC 20202-7582, (202) 219-2099. SUPPLEMENTARY INFORMATION: The...-3032. You may also contact the Advisory Committee staff directly at (202) 219-2099. The registration..., 2012 by contacting Ms. Tracy Jones at (202) 219-2099 or via email at [email protected] . We...
76 FR 52943 - Advisory Committee on Student Financial Assistance: Meeting
2011-08-24
... later than Monday, September 5, 2011 by contacting Ms. Tracy Jones at (202) 219- 2099 or via e-mail at..., Washington DC 20202-7582, (202) 219-2099. Individuals who use a telecommunications device for the deaf (TTY...-3032. You may also contact the Advisory Committee staff directly at (202) 219-2099. The registration...
DEFF Research Database (Denmark)
Back, T.; Haraldsson, B.; Hultborn, R
2009-01-01
of the glomerular filtration rate (GFR). The renal toxicity was evaluated at levels close to the dose limit for the bone marrow and well within the range for therapeutic efficacy on tumors. Astatinated MX35-F(ab')(2) monoclonal antibodies were administered intravenously to nude mice. Both non-tumor-bearing animals...... manifested late. Examination of the kidney sections showed histologic changes that were overall subdued. Following alpha-RIT with (211)At-MX35-F(ab')(2) at levels close to the dose limit of severe myelotoxicity, the effects found on renal function were relatively small, with only minor to moderate reductions...... in GFR. These results suggest that a mean absorbed dose to the kidneys of approximately 10 Gy is acceptable, and that the kidneys would not be the primary dose-limiting organ in systemic alpha-RIT when using (211)At-MX35-F(ab')(2) Udgivelsesdato: 2009/12...
Boiling points of the superheavy elements 117 and 118
International Nuclear Information System (INIS)
Takahashi, N.
2001-01-01
It has been shown that the relativistic effect on the electrons reveal in the heavy element region. What kind of changes will appear in the heavy elements because of the relativistic effects? Can we observe the changes? We observed that the boiling points of astatine and radon are lower than that extrapolated values from lighter elements in the same groups. Systematic behavior of the elements on the boiling point was examined and a new method for the estimation of the boiling points of the superheavy elements in the halogen and rare gases has been found. The estimated values of the elements 117 and 118 are 618 and 247 K, respectively which are considerably lower than those obtained until now. If these values are correct the production of the superheavy elements with heavy ions reaction may be affected. Further, the chemical properties may be fairly different from the lighter elements. (author)
DEFF Research Database (Denmark)
Lyckesvärd, Madeleine Nordén; Delle, Ulla; Kahu, Helena
2014-01-01
Childhood exposure to ionizing radiation increases the risk of developing thyroid cancer later in life and this is suggested to be due to higher proliferation of the young thyroid. The interest of using high-LET alpha particles from Astatine-211 ((211)At), concentrated in the thyroid by the same...... mechanism as (131)I [1], in cancer treatment has increased during recent years because of its high efficiency in inducing biological damage and beneficial dose distribution when compared to low-LET radiation. Most knowledge of the DNA damage response in thyroid is from studies using low-LET irradiation...... and much less is known of high-LET irradiation. In this paper we investigated the DNA damage response and biological consequences to photons from Cobolt-60 ((60)Co) and alpha particles from (211)At in normal primary thyrocytes of different cell cycle status. For both radiation qualities the intensity...
76 FR 44317 - Advisory Committee on Student Financial Assistance: Meeting
2011-07-25
... later than Monday, August 1, 2011 by contacting Ms. Tracy Jones at (202) 219-2099 or via e-mail at tracy..., 80 F Street, NW., Suite 413, Washington DC 20202-7582, (202) 219-2099. Individuals who use a...-3032. You may also contact the Advisory Committee staff directly at (202) 219-2099. The registration...
Final Report for grant entitled "Production of Astatine-211 for U.S. Investigators"
Energy Technology Data Exchange (ETDEWEB)
Wilbur, Daniel Scott
2012-12-12
Alpha-particle emitting radionuclides hold great promise in the therapy of cancer, but few alpha-emitters are available to investigators to evaluate. Of the alpha-emitters that have properties amenable for use in humans, 211At is of particular interest as it does not have alpha-emitting daughter radionuclides. Thus, there is a high interest in having a source of 211At for sale to investigators in the US. Production of 211At is accomplished on a cyclotron using an alpha-particle beam irradiation of bismuth metal. Unfortunately, there are few cyclotrons available that can produce an alpha particle beam for that production. The University of Washington has a cyclotron, one of three in the U.S., that is currently producing 211At. In the proposed studies, the things necessary for production and shipment of 211At to other investigators will be put into place at UW. Of major importance is the efficient production and isolation of 211At in a form that can be readily used by other investigators. In the studies, production of 211At on the UW cyclotron will be optimized by determining the best beam energy and the highest beam current to maximize 211At production. As it would be very difficult for most investigators to isolate the 211At from the irradiated target, the 211At-isolation process will be optimized and automated to more safely and efficiently obtain the 211At for shipment. Additional tasks to make the 211At available for distribution include obtaining appropriate shipping vials and containers, putting into place the requisite standard operating procedures for Radiation Safety compliance at the levels of 211At activity to be produced / shipped, and working with the Department of Energy, Isotope Development and Production for Research and Applications Program, to take orders, make shipments and be reimbursed for costs of production and shipment.
The potential of 211Astatine for NIS-mediated radionuclide therapy in prostate cancer
International Nuclear Information System (INIS)
Willhauck, Michael J.; Sharif Samani, Bibi-Rana; Goeke, Burkhard; Wolf, Ingo; Senekowitsch-Schmidtke, Reingard; Stark, Hans-Juergen; Meyer, Geerd J.; Knapp, Wolfram H.; Morris, John C.; Spitzweg, Christine
2008-01-01
We reported recently the induction of selective iodide uptake in prostate cancer cells (LNCaP) by prostate-specific antigen (PSA) promoter-directed sodium iodide symporter (NIS) expression that allowed a significant therapeutic effect of 131 I. In the current study, we studied the potential of the high-energy alpha-emitter 211 At, also transported by NIS, as an alternative radionuclide after NIS gene transfer in tumors with limited therapeutic efficacy of 131 I due to rapid iodide efflux. We investigated uptake and therapeutic efficacy of 211 At in LNCaP cells stably expressing NIS under the control of the PSA promoter (NP-1) in vitro and in vivo. NP-1 cells concentrated 211 At in a perchlorate-sensitive manner, which allowed a dramatic therapeutic effect in vitro. After intrapertoneal injection of 211 At (1 MBq), NP-1 tumors accumulated approximately 16% ID/g 211 At (effective half-life 4.6 h), which resulted in a tumor-absorbed dose of 1,580 ± 345 mGy/MBq and a significant tumor volume reduction of up to 82 ± 19%, while control tumors continued their growth exponentially. A significant therapeutic effect of 211 At has been demonstrated in prostate cancer after PSA promoter-directed NIS gene transfer in vitro and in vivo suggesting a potential role for 211 At as an attractive alternative radioisotope for NIS-targeted radionuclide therapy, in particular in smaller tumors with limited radionuclide retention time. (orig.)
International Nuclear Information System (INIS)
Foulon, Catherine F.; Alston, Kevin L.; Zalutsky, Michael R.
1998-01-01
We report herein the preparation and biological evaluation of two radioastatinated biotin conjugates, (3-[ 211 At]astatobenzoyl)norbiotinamide and ((5-[ 211 At]astato-3-pyridinyl)carbonyl)norbiotinamide. Both conjugates were stable in the presence of human serum and cerebrospinal fluid as well as murine serum, indicating a resistance to degradation to biotinidase. The normal tissue clearance of (3-[ 211 At]astatobenzoyl)norbiotinamide and ((5-[ 211 At]astato-3-pyridinyl)carbonyl)norbiotinamide was rapid, as observed previously with their iodo analogues. Also reported are the first syntheses of N-succinimidyl 5-[ 211 At]astato-3-pyridinecarboxylate and 3-[ 211 At]astatoaniline, two reagents of potential utility for labeling proteins and peptides with 211 At
New developments of the in-source spectroscopy method at RILIS/ISOLDE
Marsh, B A; Imai, N; Seliverstov, M D; Rothe, S; Sels, S; Capponi, L; Rossel, R E; Franchoo, S; Wendt, K; Focker, G J; Kalaninova, Z; Sjoedin, A M; Popescu, L; Nicol, T; Huyse, M; Radulov, D; Atanasov, D; Kesteloot, N; Borgmann, Ch; Cocolios, T E; Lecesne, N; Ghys, L; Pauwels, D; Rapisarda, E; Kreim, S; Liberati, V; Wolf, R N; Andel, B; Schweikhard, L; Lane, J; Derkx, X; Kudryavtsev, Yu; Zemlyanoy, S G; Fedosseev, V N; Lynch, K M; Rosenbusch, M; Van Duppen, P; Lunney, D; Manea, V; Barzakh, A E; Andreyev, A N; Truesdale, V; Flanagan, K T; Molkanov, P L; Koester, U; Van Beveren, C; Wienholtz, F; Goodacre, T Day; Antalic, S; Bastin, B; De Witte, H; Fink, D A; Fedorov, D V
2013-01-01
At the CERN ISOLDE facility, long isotope chains of many elements are produced by proton-induced reactions in target materials such as uranium carbide. The Resonance Ionization Laser Ion Source (RILIS) is an efficient and selective means of ionizing the reaction products to produce an ion beam of a chosen isotope. Coupling the RILIS with modern ion detection techniques enables highly sensitive studies of nuclear properties (spins, electromagnetic moments and charge radii) along an isotope chain, provided that the isotope shifts and hyperfine structure splitting of the atomic transitions can be resolved. At ISOLDE the campaign to measure the systematics of isotopes in the lead region (Pb, Bi, Tl and Po) has been extended to include the gold and astatine isotope chains. Several developments were specifically required for the feasibility of the most recent measurements: new ionization schemes (Po, At); a remote controlled narrow line-width mode of operation for the RILIS Ti:sapphire laser (At, Au, Po); isobar fr...
Studies of Stable Octupole Deformations in the Radium Region
2002-01-01
The purpose of the present project is to locate and identify states in the atomic nuclei possessing stable pearshaped octupole deformation. Such states, formally related to the structures known in molecular physics, manifest themselves as families of parity doublets in odd nuclei.\\\\ \\\\ The best possibilities for observing stable octupole deformations are offered in the Ra-region. Both theoretical calculations and experimental indications support such expectations. Such indications are the non-observation of two-phonon octupole vibrational states in the ISOLDE studies of the even-even radium nuclei, and the reversed sign of the decoupling factor of the ground state band in |2|2|5Ra observed in the single-neutron transfer reactions. In order to establish the predicted strong E1 and E3-transitions between the parity doublets in odd nuclei with stable octupole deformations it is proposed to study conversion electrons in odd-mass francium radium and radon isotopes following the @b-decay of francium and astatine. \\...
International Nuclear Information System (INIS)
Hofer, K.G.
1980-06-01
Internal radiotherapy should be performed with short-lived radionuclides which emit high LET radiation and short ranged radiation, and accumulated within cancers. Based on these considerations, several radionuclides (tritium, copper-64, gallium-67, iodine-123, iodine 125, iodine-131 and astatine-211) were chosen and their toxicity was assessed using cell division in mammalian cultured cells as a criterion. It was apparent that the toxic effects obtained with 125 I greatly exceeded those observed in cells treated with any other radionuclides. The possible hypotheses to explain the excessive radiosensitivity of 125 I were discussed in relation to microdosimetry calculation. It was also found that the division delay induced by radionuclide decay is primarily due to damage to the cell nucleus but not to the plasma membrane. The key problem remains the development of agents which can serve as carriers for radionuclide accumulation within tumors. Although several promising approaches (Synkavit, tamoxifen, iododeoxyuridine, antibodies, liposomes) were investigated, only 125 I-labelled Synkavit would be desirable for clinical application
Nitrogen Dynamic Study on Rice Mutant Lines Using 15N Isotope Techniques
International Nuclear Information System (INIS)
Ahmad Nazrul Abd Wahid; Shyful Azizi Abdul Rahman; Abdul Rahim Harun
2015-01-01
Malaysian Nuclear Agency in collaboration with UPM and MARDI has produced two types of rice mutant lines of MR219, viz. MR219-4 and MR219-9 developed under rice radiation mutagenenesis programme for adaptability to aerobic conditions. Aerobic cultivating is rice cultivation system on well drained soil and using minimal water input. At Malaysian Nuclear Agency, a nitrogen fertilization study in aerobic condition for the rice mutant lines was carried out in the shade house and field. The study is intended to examine and assess the dynamics of nitrogen by rice mutant lines through the different soil water management and nitrogen levels. Direct 15 N isotopic tracer method was used in this study, whereby the 15 N labeled urea fertilizer was utilized as a tracer for nitrogen nutrient uptake by the test crops. This paper is intended to highlight the progress that has been made in the study of the nitrogen dynamics on MR219-4 and MR219-9 rice mutant lines. (author)
2010-01-01
... institution means any office of a bank, savings bank, card issuer as defined in section 103 of the Consumers Credit Protection Act (15 U.S.C. 1602(n)), industrial loan company, trust company, savings association, building and loan, or homestead association (including cooperative banks), credit union, or consumer...
2010-04-01
..., emotional or mental illness, and specific learning disabilities. The term “physical or mental impairment... person means any person who has a physical or mental impairment that substantially limits one or more.... As used in this definition, the phrase: (1) Physical or mental impairment includes— (i) Any...
2010-10-01
..., DEPARTMENT OF TRANSPORTATION HAZARDOUS MATERIALS AND OIL TRANSPORTATION HAZARDOUS MATERIALS PROGRAM... with the disposition of previous applications for waiver of preemption determinations. [Amdt. 107-3, 41...
2010-01-01
... financial records or information related to: (a) Security interests, bankruptcy claims, debt collection. Any... loan insurance program. (c) Nonidentifiable information. Financial records that are not identified with.... (f) Federally required reports. Financial records required to be reported in accordance with any...
Probabilistic risk assessment: Number 219
International Nuclear Information System (INIS)
Bari, R.A.
1985-01-01
This report describes a methodology for analyzing the safety of nuclear power plants. A historical overview of plants in the US is provided, and past, present, and future nuclear safety and risk assessment are discussed. A primer on nuclear power plants is provided with a discussion of pressurized water reactors (PWR) and boiling water reactors (BWR) and their operation and containment. Probabilistic Risk Assessment (PRA), utilizing both event-tree and fault-tree analysis, is discussed as a tool in reactor safety, decision making, and communications. (FI)
2010-07-01
... planning framework. Land and resource management planning is a flexible process for fitting solutions to... responsible for national planning. National planning includes the Forest Service national strategic plan... Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE PLANNING National Forest...
48 CFR 219.1005 - Applicability.
2010-10-01
... objects, which otherwise meet criteria in FAR subpart 19.10. (b) The targeted industry categories for DoD are: North American Industry Classification System (NAICS) Description NAICS Code (1) Pharmaceutical... Navigation System and Instrument Manufacturing 334511 (10) (i) Cellular and Other Wireless Telecommunications...
Directory of Open Access Journals (Sweden)
Lin Zhang
Full Text Available A novel gene (designated as cen219 encoding endoglucanase was isolated from a Bursaphelenchus xylophilus metagenomic library by functional screening. Sequence analysis revealed that cen219 encoded a protein of 367 amino acids. SDS-PAGE analysis of purified endoglucanase suggested that Cen219 was a monomeric enzyme with a molecular mass of 40 kDa. The optimum temperature and pH for endoglucanase activity of Cen219 was separately 50 °C and 6.0. It was stable from 30 to 50 °C, and from pH 4.0 to 7.0. The activity was significantly enhanced by Mn(2+ and dramatically reduced by detergent SDS and metals Fe(3+, Cu(2+ or Hg(2+. The enzyme hydrolyzed a wide range of β-1, 3-, and β-1, 4-linked polysaccharides, with varying activities. Activities towards microcrystalline cellulose and filter paper were relatively high, while the highest activity was towards oat gum. The Km and Vmax of Cen219 towards CMC was 17.37 mg/ml and 333.33 U/mg, respectively. The findings have an insight into understanding the molecular basis of host-parasite interactions in B. xylophilus species. The properties also make Cen219 an interesting enzyme for biotechnological application.
Production of Astatine-211 at the Duke University Medical Center for its regional distribution
Energy Technology Data Exchange (ETDEWEB)
Zalutsky, Michael [Duke University Medical Center, Durham, NC (United States)
2016-01-01
Systemic targeted radiation therapy and radioimmunotherapy continue to be important tools in the treatment of certain cancers. Because of their high energy and short path length, alpha particle emitters such as 211At are more effective than either external beam x- ray or in vivo beta radiation in delivering potentially curative doses of radiation. The limited clinical trials that have been conducted to date have yielded encouraging responses in some patients, e.g., malignant brain tumors. In order to escalate the additional necessary research and development in radiochemistry, radiobiology and efficacy evaluation of alpha particle radiotherapeutics, it is universally agreed that access to an affordable, reliable supply of 211At is warranted. In conjunction with the Department of Energy's intent to enhance stable and radioactive isotope availability for research applications, it is the primary objective of this project to improve 211At production and purification capabilities at Duke so that this radionuclide can be supplied to researchers at other institutions throughout the US.The most widely used 211At production method involves the α,2n reaction on Bismuth using a cyclotron with beams ≤ 28 MeV. Yields can be enhanced with use of an internal target that allows for a higher alpha fluence plus efficient heat dissipation in the target. Both of these items are in place at Duke; however, in order to support production for multi-institutional use, irradiation campaigns in excess of 50 µAp and four hours duration will be needed. Further, post-irradiation processing equipment is lacking that will enable the distribution process. Financial support is sought for i) a shielded, ventilated processing/containment hood; ii) development of a post-irradiation target retrieval system; iii) fabrication of a 211At distillation and recovery module and iv) a performance review and, where needed, an enhancement of seven major subsystems that comprise the CS-30 Cyclotron. With these modifications in place, routine production of ≥200 mCi of At-211 should be readily achievable, given our methodological development of At-211 target preparation, internal target irradiation and dry distillation to recover the radionuclide.
Mazzilli, Rossella; Cimadomo, Danilo; Vaiarelli, Alberto; Capalbo, Antonio; Dovere, Lisa; Alviggi, Erminia; Dusi, Ludovica; Foresta, Carlo; Lombardo, Francesco; Lenzi, Andrea; Tournaye, Herman; Alviggi, Carlo; Rienzi, Laura; Ubaldi, Filippo Maria
2017-12-01
To evaluate the impact of the male factor on the outcomes of intracytoplasmic sperm injection (ICSI) cycles combined with preimplantation genetic testing for aneuploidies (PGT-A). Observational longitudinal cohort study. Private in vitro fertilization (IVF) center. A total of 1,219 oocyte retrievals divided into five study groups according to sperm parameters: normozoospermia (N), moderate male factor (MMF), severe oligoasthenoteratozoospermia (OAT-S), obstructive azoospermia (OA), and nonobstructive azoospermia (NOA). ICSI with ejaculated/surgically retrieved sperm, blastocyst culture, trophectoderm-based quantitative polymerase chain reaction PGT-A, and frozen-warmed euploid embryo transfer (ET). The primary outcome measures were fertilization, blastocyst development, and euploidy rates; the secondary outcome measures were live birth and miscarriage rates. Perinatal and obstetrical outcomes were monitored as well. A total of 9,042 metaphase II oocytes were inseminated. The fertilization rate was significantly reduced in MMF, OAT-S, OA, and NOA compared with N (74.8%, 68.7%, 67.3%, and 53.1% vs. 77.2%). The blastocyst rate per fertilized oocyte was significantly reduced in MMF and NOA compared with N (48.6% and 40.6% vs. 49.3%). The timing of blastocyst development also was affected in OA and NOA. Logistic regression analysis adjusted for confounders highlighted NOA as a negative predictor of obtaining an euploid blastocyst per OPU (odds ratio 0.5). When the analysis was performed per obtained blastocyst, however, no correlation between male factor and euploidy rate was observed. Embryo transfers also resulted in similar live birth and miscarriage rates. No impact of sperm factor on obstetrical/perinatal outcomes was observed. Severe male factor impairs early embryonic competence in terms of fertilization rate and developmental potential. However, the euploidy rate and implantation potential of the obtained blastocysts are independent from sperm quality
48 CFR 1319.811-3 - Contract clauses.
2010-10-01
... shall insert the clause 1352.219-71, Notification to Delay Performance (Deviation), in solicitations and...) Direct Award (Deviation), in direct contracts and purchase orders processed under the Partnership... 1352.219-72, Notification of Competition Limited to Eligible 8(a) Concerns, Alternate III (Deviation...
Directory of Open Access Journals (Sweden)
Olmar Baller Weber
2003-12-01
Full Text Available O objetivo deste trabalho foi selecionar e avaliar bactérias diazotróficas isoladas de abacaxizeiro (Ananas comosus (L. Merril no desenvolvimento de cultivares micropropagadas da mesma espécie em casa de vegetação. Plantas da cultivar Perolera foram submetidas à inoculação com Asaia bogorensis (AB219 e cultivadas em tubetes, durante 145 dias, com as misturas: casca de arroz carbonizada, folha de carnaubeira triturada e vermicomposto; casca de arroz carbonizada, pó da casca do coco maduro e vermicomposto; casca de arroz carbonizada, vermiculita e vermicomposto. Plantas da cultivar Primavera receberam inóculos com o AB219 e bactérias relacionadas a Burkholderia cepacia (AB202 e AB213, enquanto plantas das cultivares Pérola e Smooth Cayenne receberam AB219 e AB213, sendo cultivadas, por 140 dias, em tubetes com a mistura de vermicomposto e vermiculita. A colonização dos abacaxizeiros pelas bactérias diazotróficas foi confirmada. As plantas da cultivar Perolera cresceram melhor em casca de arroz carbonizada, vermiculita e vermicomposto e responderam positivamente ao AB219. Já as plantas da cultivar Primavera não apresentaram resposta significativa à inoculação com AB219, AB202 e AB213. Houve incremento de 23,1% a 38,5% na matéria seca de raízes das plantas da cultivar Pérola na presença de AB213 e AB219, respectivamente. A presença de AB213 incrementou em 15,2% a matéria seca da parte aérea das plantas da cultivar Smooth Cayenne. Os resultados revelam a eficiência de bactérias diazotróficas na promoção do crescimento de abacaxizeiros.The objective of this work was to select and to evaluate isolates of diazotrophic bacteria associated to pineapple (Ananas comosus (L. Merril plants in the development of micropropagated plantlets of cultivars pineapple in greenhouse. Plantlets from the Perolera cultivar have been submitted to inoculation with Asaia bogorensis (AB219 and were cultivated during 145 days on the following
Nuclear and chemical data for life sciences
International Nuclear Information System (INIS)
Moumita Maiti; Indian Institute of Technology Roorkee, Roorkee, Uttarakhand
2013-01-01
Use of reactor produced radionuclides is popular in life sciences. However, cyclotron production of proton rich radionuclides are being more focused in recent times. These radionuclides have already gained attention in various fields, including life sciences, provided they are obtained in pure form. This article is a representative brief of our contributions in generating nuclear data for the production of proton rich radionuclides of terbium, astatine, technetium, ruthenium, cadmium, niobium, zirconium, rhenium, etc., which may have application in clinical, biological, agriculture studies or in basic research. The chemical data required to separate the product isotopes from the corresponding target matrix have been presented along with a few propositions of radiopharmaceuticals. It also emphasizes on the development of simple empirical technique, based on the nuclear reaction model analysis, to generate reliable nuclear data for the estimation of yield and angular distribution of emitted neutrons and light charged particles from light as well as heavy ion induced reactions on thick stopping targets. These data bear utmost important in radiation dosimetry. (author)
Study of Neutron-Deficient $^{202-205}$Fr Isotopes with Collinear Resonance Ionization Spectroscopy
De Schepper, Stijn; Cocolios, Thomas; Budincevic, Ivan
The scope of this master’s thesis is the study of neutron-deficient $^{202−205}$Fr isotopes. These isotopes are inside the neutron-deficient lead region, a region that has shown evidence of shape coexistence. For this thesis, this discussion is limited to the phenomenon where a low lying excited state has a different shape than the ground state. Shape coexistence is caused by intruder states. These are single-particle Shell Model states that are perturbed in energy due to the interaction with a deformed core. In the neutron-deficient lead region the main proton intruder orbit is the 3s$_{1/2}$orbit. When going towards more neutron-deficient isotopes, deformation increases. The $\\pi3s_{1/2}$orbit will rise in energy and will eventually become the ground state in odd- A bismuth (Z=83) isotopes. It is also observed in odd-A astatine (Z=85) isotopes, already in less neutron-deficient nuclei. The same phenomenon is expected to be present francium (Z=87) isotopes already at $^{199}$Fr. Although it is currently ...
Development of Reagents for Application of At-211 to Targeted Radionuclide Therapy of Cancer
International Nuclear Information System (INIS)
Wilbur, D. Scott
2011-01-01
This grant covered only a period of 4 months as the major portion of the award was returned to DOE due to an award of funding from NIH that covered the same research objectives. A letter regarding the termination of the research is attached as the last page of the Final Report. The research conducted was limited due to the short period of this grant, but the results obtained in that period are outlined in the Final Report. The studies addressed in the research effort were directed at a problem that is of critical importance to the in vivo application of the alpha-particle emitting radionuclide At-211. That problem, low in vivo stability of many astatinated molecules, severely limits the use of At-211 in therapeutic applications. The advances sought in the studies were expected to expand the types of biomolecules that can be used as carriers of At-211, and provide improved in vivo targeting of the radiation dose compared with the dose delivered to normal tissue.
Moll, Lorna; Ben-Gedalya, Tziona; Reuveni, Hadas; Cohen, Ehud
2016-04-01
The discovery that the alteration of aging by reducing the activity of the insulin/IGF-1 signaling (IIS) cascade protects nematodes and mice from neurodegeneration-linked, toxic protein aggregation (proteotoxicity) raises the prospect that IIS inhibitors bear therapeutic potential to counter neurodegenerative diseases. Recently, we reported that NT219, a highly efficient IGF-1 signaling inhibitor, protects model worms from the aggregation of amyloid β peptide and polyglutamine peptides that are linked to the manifestation of Alzheimer's and Huntington's diseases, respectively. Here, we employed cultured cell systems to investigate whether NT219 promotes protein homeostasis (proteostasis) in mammalian cells and to explore its underlying mechanisms. We found that NT219 enhances the aggregation of misfolded prion protein and promotes its deposition in quality control compartments known as "aggresomes." NT219 also elevates the levels of certain molecular chaperones but, surprisingly, reduces proteasome activity and impairs autophagy. Our findings show that IGF-1 signaling inhibitors in general and NT219 in particular can promote proteostasis in mammalian cells by hyperaggregating hazardous proteins, thereby bearing the potential to postpone the onset and slow the progression of neurodegenerative illnesses in the elderly.-Moll, L., Ben-Gedalya, T., Reuveni, H., Cohen, E. The inhibition of IGF-1 signaling promotes proteostasis by enhancing protein aggregation and deposition. © FASEB.
Sci-Thur AM: YIS – 01: New technologies for astatine-211 targeted alpha therapy research
Energy Technology Data Exchange (ETDEWEB)
Crawford, Jason; Yang, Hua; Schaffer, Paul; Ruth, Thomas [University of Victoria, Victoria, BC (Canada); TRIUMF, Vancouver, BC (Canada)
2016-08-15
Purpose: The short-range, densely ionizing α-particles emitted by {sup 211}At (t{sub 1/2}=7.2h) are well suited for the treatment of diffuse microscopic disease, using cancer targeting biomolecules. {sup 211}At availability is limited by the rarity of α-cyclotrons required for standard production. Image-based dosimetry is also limited for {sup 211}At, which emits low intensity X-rays. Our goal was to leverage state-of-the-art infrastructure at TRIUMF to produce and evaluate two related isotopes, {sup 211}Rn (t{sub 1/2}=14.6h, 73% decay to {sup 211}At) as a generator for {sup 211}At, and {sup 209}At (t{sub 1/2}=5.4h, X-ray/gamma-ray emitter) as a novel 211At surrogate for preclinical imaging studies. Methods: Produced by spallation of uranium with 480 MeV protons, mass separated ion beams of short-lived francium isotopes were implanted into NaCl targets where {sup 211}Rn or {sup 209}At were produced by radioactive decay, in situ. {sup 211}Rn was transferred to dodecane from which {sup 211}At was efficiently extracted and evaluated for clinical applicability. High energy SPECT/CT was evaluated for measuring {sup 209}At activity distributions in mice and phantoms. Results: Our small scale {sup 211}Rn/{sup 211}At generator system provided high purity {sup 211}At samples. The methods are immediately scalable to the level of radioactivity required for in vivo experiments with {sup 211}At. {sup 209}At-based high energy SPECT imaging was determined suitable for pursuing image-based dosimetry in mouse tumour models. In the future, we will utilize quantitative {sup 209}At-SPECT for image-based dose calculations. Conclusion: These early studies provided a foundation for future endeavours with {sup 211}At-based α-therapy. Canada is now significantly closer to clinical targeted α-therapy of cancer.
International Nuclear Information System (INIS)
Meyer, G.J.; Roessler, K.; Stoecklin, G.
1979-01-01
Systematic studies of the astatodiazoniation reaction and a comparison with iododediazoniation under comparable conditions are reported. The yields for all astatohalobenzenes and -toluenes were nearly constant and unaffected by the nature of the diazonium compound, its isomeric form, and the number of isomers used at the same time. Only astatofluorobenzenes were obtained at higher yields. An electron-transfer mechanism is proposed for dediazoniation at these low halide concentration levels. At sufficient thermal excitation levels the electron transfer leads to the dissociation of nitrogen, while the phenyl and halogen radicals recombine. The isomer distribution found for some of the derivatives from dediazoniation may also be due to steric effects
International Nuclear Information System (INIS)
Ogawa, Kazuma; Mizuno, Yoshiaki; Washiyama, Kohshin; Shiba, Kazuhiro; Takahashi, Naruto; Kozaka, Takashi; Watanabe, Shigeki; Shinohara, Atsushi; Odani, Akira
2015-01-01
Introduction: Sigma receptors are overexpressed in a variety of human tumors, making them potential targets for radionuclide receptor therapy. We have previously synthesized and evaluated 131 I-labeled (+)-2-[4-(4-iodophenyl)piperidino]cyclohexanol [(+)-[ 131 I]pIV], which has a high affinity for sigma receptors. Therefore, (+)-[ 131 I]pIV significantly inhibited tumor cell proliferation in tumor-bearing mice. In the present study, we report the synthesis and the in vitro and in vivo characterization of (+)-[ 211 At]pAtV, an 211 At-labeled sigma receptor ligand, that has potential use in alpha-radionuclide receptor therapy. Methods: The radiolabeled sigma receptor ligand (+)-[ 211 At]pAtV was prepared using a standard halogenation reaction generating a 91% radiochemical yield with 98% purity after HPLC purification. The partition coefficient of (+)-[ 211 At]pAtV was measured. Cellular uptake experiments and in vivo biodistribution experiments were performed using a mixed solution of (+)-[ 211 At]pAtV and (+)-[ 125 I]pIV; the human prostate cancer cell line DU-145, which expresses high levels of the sigma receptors, and DU-145 tumor-bearing mice. Results: The lipophilicity of (+)-[ 211 At]pAtV was similar to that of (+)-[ 125 I]pIV. DU-145 cellular uptake and the biodistribution patterns in DU-145 tumor-bearing mice at 1 h post-injection were also similar between (+)-[ 211 At]pAtV and (+)-[ 125 I]pIV. Namely, (+)-[ 211 At]pAtV demonstrated high uptake and retention in tumor via binding to sigma receptors. Conclusion: These results indicate that (+)-[ 211 At]pAtV could function as an new agent for alpha-radionuclide receptor therapy.
Ogawa, Kazuma; Mizuno, Yoshiaki; Washiyama, Kohshin; Shiba, Kazuhiro; Takahashi, Naruto; Kozaka, Takashi; Watanabe, Shigeki; Shinohara, Atsushi; Odani, Akira
2015-11-01
Sigma receptors are overexpressed in a variety of human tumors, making them potential targets for radionuclide receptor therapy. We have previously synthesized and evaluated (131)I-labeled (+)-2-[4-(4-iodophenyl)piperidino]cyclohexanol [(+)-[(131)I]pIV], which has a high affinity for sigma receptors. Therefore, (+)-[(131)I]pIV significantly inhibited tumor cell proliferation in tumor-bearing mice. In the present study, we report the synthesis and the in vitro and in vivo characterization of (+)-[(211)At]pAtV, an (211)At-labeled sigma receptor ligand, that has potential use in alpha-radionuclide receptor therapy. The radiolabeled sigma receptor ligand (+)-[(211)At]pAtV was prepared using a standard halogenation reaction generating a 91% radiochemical yield with 98% purity after HPLC purification. The partition coefficient of (+)-[(211)At]pAtV was measured. Cellular uptake experiments and in vivo biodistribution experiments were performed using a mixed solution of (+)-[(211)At]pAtV and (+)-[(125)I]pIV; the human prostate cancer cell line DU-145, which expresses high levels of the sigma receptors, and DU-145 tumor-bearing mice. The lipophilicity of (+)-[(211)At]pAtV was similar to that of (+)-[(125)I]pIV. DU-145 cellular uptake and the biodistribution patterns in DU-145 tumor-bearing mice at 1h post-injection were also similar between (+)-[(211)At]pAtV and (+)-[(125)I]pIV. Namely, (+)-[(211)At]pAtV demonstrated high uptake and retention in tumor via binding to sigma receptors. These results indicate that (+)-[(211)At]pAtV could function as an new agent for alpha-radionuclide receptor therapy. Copyright © 2015 Elsevier Inc. All rights reserved.
28 CFR 2.19 - Information considered.
2010-07-01
... is imprisoned about the financial, social, psychological, and emotional harm done to, or loss... Commission with specific facts and reasoning relevant to the statutory criteria for parole (18 U.S.C. 4206..., to be most helpful, a recommendation should state its underlying factual basis and reasoning. However...
12 CFR 219.3 - Cost reimbursement.
2010-01-01
... that the financial institution use programming or other higher level technical services of a computer... (private sector) set out in the Employment Cost Trends section of the National Compensation Survey (http... PROVIDING FINANCIAL RECORDS; RECORDKEEPING REQUIREMENTS FOR CERTAIN FINANCIAL RECORDS (REGULATION S...
12 CFR 219.24 - Retention period.
2010-01-01
... PROVIDING FINANCIAL RECORDS; RECORDKEEPING REQUIREMENTS FOR CERTAIN FINANCIAL RECORDS (REGULATION S... period of time, taking into consideration the nature of the record and the amount of time that has...
Publications | Page 219 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
... (restricted access). Conventional energy generation is a fundamental cause for competing demands on natural resources of both water and energy sectors, and is a significant contributor to anthropogenic climate change. This research seeks to identify barriers to wide-scale penetration of renewable energy technologies.
Publications | Page 219 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Using Technology to Document Violations: Enabling Sex Worker Communities to Document Violence Against Them in India and Cambodia (open access). The project achieved the following; a significant shift in advocacy strategies from reactive to proactive strategies with a potential impact on the lives and wellbeing of ...
49 CFR 219.23 - Railroad policies.
2010-10-01
... approved forms for mandatory post-accident toxicological testing under subpart C of this part provides the... start of alcohol testing under the railroad's alcohol misuse prevention program and to each person... the work day the covered employee is required to be in compliance with this part is that period when...
Publications | Page 219 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Science-policy dialogues for water security : addressing vulnerability and adaptation to global change in the arid Americas (restricted access) ... Impact of maternal and child health private expenditure on poverty and inequity in Bangladesh : out-of-pocket payments by patients at Ministry of Health and Family Welfare ...
32 CFR 219.107 - IRB membership.
2010-07-01
... counsel in safeguarding the rights and welfare of human subjects. In addition to possessing the... subjects, such as children, prisoners, pregnant women, or handicapped or mentally disabled persons... IRB consists entirely of men or entirely of women, including the institution's consideration of...
77 FR 21161 - National Forest System Land Management Planning
2012-04-09
... 219 National Forest System Land Management Planning; Final Rule #0;#0;Federal Register / Vol. 77 , No... Forest Service 36 CFR Part 219 RIN 0596-AD02 National Forest System Land Management Planning AGENCY... Agriculture is adopting a new National Forest System land management planning rule (planning rule). The new...
1989-01-01
8217The Nature and Status of Ethnobotany," Chronica Botanica , Vol 6, pp 219-221. Jones, Volney H. 1957. "Botany," The Identification of Non- artifactual...Chronica Botanica , Vol. 6, pp. 219-221. CULTURAL Ethnobotany, general JONES, VOLNEY H., 1957, Botany. In Taylor, W., (editor), The Identification of Non
76 FR 76318 - Defense Federal Acquisition Regulation Supplement; Technical Amendments
2011-12-07
... Defense Business Transformation Agency Contracting Office. PART 204--ADMINISTRATIVE MATTERS 204.402...) * * * (iii) For special notices for small business events, follow the procedures at PGI 205.207(d)(ii). PART... Economy Act order. PART 219--SMALL BUSINESS PROGRAMS 0 22. Section 219.202-1 is added to read as follows...
Journal of Chemical Sciences | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Journals; Journal of Chemical Sciences; Volume 119; Issue 3. Issue front cover thumbnail. Volume 119, Issue 3. May 2007, pages 219-274. pp 219-230. Engineering macrocyclic figure-eight motif · V Haridas Harinder Singh Yogesh K Sharma Kashmiri Lal · More Details Abstract Fulltext PDF. The design and ...
African Journals Online (AJOL)
Items 201 - 219 of 219 ... Vol 5 (2014), Understanding the legal fundamentals of project finance contracts, Abstract PDF. Grace Chinyere Young. Vol 7 (2016), Unfair dismissal in Nigeria: Imperative for a departure from the common law, Abstract PDF. Emmanuel OC Obidimma, MI Anushiem, UMJ Ekeneme. Vol 6 (2015), United ...
2013-02-08
... activities (Section 219 of the Act), as well as the Women and Minority Business Enterprise requirements (Sec... activities (Section 219 of the Act), as well as the Women and Minority Business Enterprise requirements (Sec... below has been submitted to the Office of Management and Budget (OMB) for review, as required by the...
Why Innovations in Agriculture are Necessary?
Indian Academy of Sciences (India)
... of people living below poverty line (21.9%, 2011-12). Ensuring food security for increasing population and for millions of people living below poverty line (21.9%, 2011-12). Major source of livelihood (about 54.5% workers are engaged in agriculture). Major demand driver for the growth of other sectors of the economy.
Lifescience Database Archive (English)
Full Text Available za... 219 1e-55 tr|A6N1H0|A6N1H0_ORYSI Magnesium-protoporphyrin ix monomethyl es... 219 1e-55 tr|Q40093|Q40093_IPONI PNIL34...LAEFEPQLVY 429 Y M P++SGSVD AEFEPQLVY Sbjct: 134 AYLMPPIESGSVDFAEFEPQLVY 156 >tr|Q40093|Q40093_IPONI PNIL34
211 At-labeled agents for alpha-immunotherapy: On the in vivo stability of astatine-agent bonds
Ayed , Tahra ,; Pilmé , Julien; Tézé , David; Bassal , Fadel ,; Barbet , Jacques ,; Chérel , Michel; Champion , Julie ,; Maurice , Rémi; Montavon , Gilles ,; Galland , Nicolas ,
2016-01-01
International audience; The application of 211 At to targeted cancer therapy is currently hindered by the rapid deastatination that occurs in vivo. As the deastatination mechanism is unknown, we tackled this issue from the viewpoint of the intrinsic properties of At-involving chemical bonds. An apparent correlation has been evidenced between in vivo stability of 211 At-labeled compounds and the AtÀR (R ¼ C, B) bond enthalpies obtained from relativistic quantum mechanical calculations. Further...
International Nuclear Information System (INIS)
Wilbur, Daniel Scott
2016-01-01
This research is a collaborative effort between the research groups of the PIs, Dr. D. Scott Wilbur in the Department of Radiation Oncology at the University of Washington (UW) and Matthew O'Hara at the Pacific Northwest National Laboratory (PNNL). In this report only those studies conducted at UW and the budget information from UW will be reported. A separate progress and financial report will be provided by PNNL. This final report outlines the experiments (Tasks) conducted and results obtained at UW from July 1, 2013 thru June 30, 2016 (2-year project with 1 year no-cost extension). The report divides the information on the experiments and results obtained into the 5 specific objectives of the research efforts and the Tasks within those objectives. This format is used so that it is easy to see what has been accomplished in each area. A brief summary of the major findings from the studies is provided below. Summary of Major Findings from Research/Training Activities at UW: Anion and cation exchange columns did not provide adequate 211 At capture and/or extraction results under conditions studied to warrant further evaluation; PEG-Merrifield resins containing mPEG350, mPEG750, mPEG2000 and mPEG5000 were synthesized and evaluated; All of the mPEG resins with different sized mPEG moieties conjugated gave similar 211 At capture (>95%) from 8M HCl solutions and release with conc. NH 4 OH (~50-80%), but very low quantities were released when NaOH was used as an eluent; Capture and release of 211 At when loading [ 211 At]astatate appeared to be similar to that of [ 211 At]astatide on PEG columns, but further studies need to be conducted to confirm that; Capture of 211 At on PEG columns was lower (e.g. 80-90%) from solutions of 8M HNO 3 , but higher capture rates (e.g. 99%) can be obtained when 10M HNO 3 is mixed with an equal quantity of 8M HCl; Addition of reductants to the 211 At solutions did not appear to change the percent capture, but may have an effect on the % extracted; There was some indication that the PEG-Merrifield resins could be saturated (perhaps with Bi) resulting in lower capture percentages, but more studies need to be done to confirm that; A target dissolution chamber, designed and built at PNNL, works well with syringe pumps so it can be used in an automated system; Preliminary semi-automated 211 At isolation studies have been conducted with full-scale target dissolution and 211 At isolation using a PEG column on the Hamilton automated system gave low overall recoveries, but HNO 3 was used (rather than HCl) for loading the 211 At and flow rates were not optimized; Results obtained using PEG columns are high enough to warrant further development on a fully automated system; Results obtained also indicate that additional studies are warranted to evaluate other types of columns for 211 At separation from bismuth, which allow use of HNO 3 /HCl mixtures for loading and NaOH for eluting 211 At. Such a column could greatly simplify the overall isolation process and make it easier to automate.
International Nuclear Information System (INIS)
Foulon, Catherine F.; Schoultz, Bent W.; Zalutsky, Michael R.
1997-01-01
Biotinyl-3-[ 211 At]astatoanilide ([ 211 At]AtBA) was prepared in more than 80% yield by destannylation. In vitro, [ 211 At]AtBA exhibited a high affinity for streptavidin, and was stable after incubation in human serum, cerebrospinal fluid and distilled water, whereas it was rapidly degraded in mouse serum. HPLC analysis showed that the main degradation pathway in mouse serum was the cleavage of [ 211 At]astatoaniline. In mice, [ 211 At]AtBA and its 125 I-labeled analogue cleared rapidly from most tissues; however, there was some evidence for dehalogenation of both tracers
Functional design criteria radioactive liquid waste line replacement, Project W-087. Revision 3
International Nuclear Information System (INIS)
McVey, C.B.
1994-01-01
This document provides the functional design criteria for the 222-S Laboratory radioactive waste drain piping and transfer pipeline replacement. The project will replace the radioactive waste drain piping from the hot cells in 222-S to the 219-S Waste Handling Facility and provide a new waste transfer route from 219-S to the 244-S Catch Station in Tank Farms
DEFF Research Database (Denmark)
Larsen, Lesli H; Echwald, Søren Morgenthaler; Sørensen, Thorkild I A
2005-01-01
)) for mutations in MC4R. A total of 14 different mutations were identified of which two, Ala219Val and Leu325Phe, were novel variants. The variant receptor, Leu325Phe, was unable to bind [Nle4,d-Phe7]-alphaMSH, whereas the Ala219Val variant showed a significantly impaired melanotan II induction of cAMP, compared...
Establishment and biological characteristics of Piedmontese cattle ...
African Journals Online (AJOL)
use
2011-12-12
Dec 12, 2011 ... 2.30 ± 0.48. T. 12. 3.25 ± 0.17. T. 27. 2.19 ± 0.13. T. 13. 3.25 ± 0.29. T. 28. 2.19 ± 0.33. T. 14 .... technique has been used for many years and is still being used today, practice .... tissue culture and the nude mouse. Tissue Cell.
PENGARUH INFUS BUAH Foeniculum vulgare Mill PADA SIKLUS ESTRUS DAN BOBOT UTERUS TIKUS PUTIH
Directory of Open Access Journals (Sweden)
Sa'roni Sa'roni
2012-10-01
Full Text Available Buah Foeniculum vulgare Mill (adas secara tradisional untuk obat dan campuran jamu pengatur haid. Diduga buah Foeniculum vulgare Mill mempunyai pengaruh pada sistem reproduksi. Oleh karena itu, kami melakukan penelitian pengaruh infus buah Foeniculum vulgare Mill pada siklus estrus dan bobot uterus tikus putih.Infus diberikan secara oral sekali sehari selama 12 hari dengan dosis setara dengan 7,3 mg, 73 mg dan 219 mg/100 g bobot badan. Selama pemberian bahan, siklus estrus diperiksa setiap hari dan pada hari ke-13 diotopsi dan ditimbang bobot uterusnya.Hasil penelitian menunjukkan bahwa infus buah Foeniculum vulgare Mill setara dengan serbuk 7,3 mg, 73 mg dan 219 mg/100 g bobot badan dapat menghambat fase estrus (masa subur. Infus setara dengan serbuk 7 mg dan 219 mg/100 g bobot badan kelihatan dapat menghambat fase estrus yang sangat nyata dibandingkan dengan akuades. Infus buah Foeniculum vulgare Mill setara dengan serbuk 219 mg/100 g bobot badan dapat menurunkan bobot uterus, tetapi secara statistik tidak berbeda nyata dengan akuades. Kata kunci: Obat tradisional; Foeniculum vulgare Mill; Sistem Reproduksi
211At-labelling of polymer particles for radiotherapy: synthesis, purification and stability
International Nuclear Information System (INIS)
Larsen, R.H.; Hassfjell, S.P.; Hoff, P.; Alstad, J.; Bjoergum, J.
1993-01-01
Cyclotron-produced 211 At was distilled from a Bi metal target and coupled to N-succinimidyl-3-(trimethylstannyl)benzoate. The resulting N-succinimidyl-3-( 211 At)astatobenzoate was thereafter coupled to aminated monosized polymer particles with a diameter of 1.8 μm. The total time elapsed from the end of the cyclotron irradiation until the final product was prepared was about 2.5 hours. From 23 to 51% of the target activity at the end of bombardment was measured in the final conjugate. Solid-liquid extraction purification of the astatinated intermediate, using Sep-pak columns (Waters), gave more reproducible yields in the final conjugation step. The 211 At-labelled particles were incubated with fetal calf serum, human serum and human full blood at room temperature. The 211 At activity on the particles was measured before and after three times washing at 4, 24 and 48 hours. The stability was not significantly different from 100% for all media and for all time points. This indicates that 211 At-labelled particles can be stable under in vivo conditions, and may thereby be a promising agent for intracavitary radiotherapy on free-floating cancer cells or surface fixed cells. (Author)
78 FR 54152 - Airworthiness Directives; Rolls-Royce plc Turbofan Engines
2013-09-03
... Airworthiness Directives; Rolls-Royce plc Turbofan Engines AGENCY: Federal Aviation Administration (FAA), DOT...; -535C-37; -535E4-37; - 535E4-B-37, and -535E4-B-75 turbofan engines, and all RB211-524G2-19; - 524G3-19; -524H2-19; and -524H-36 turbofan engines. This AD requires a one-time inspection of the front combustion...
78 FR 20505 - Airworthiness Directives; Rolls-Royce plc Turbofan Engines
2013-04-05
... Turbofan Engines AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of proposed rulemaking...; - 535E4-37; -535E4-B-37, and -535E4-B-75 turbofan engines, and all RB211- 524G2-19; -524G3-19; -524H2-19; and -524H-36 turbofan engines. This proposed AD was prompted by the discovery of a cracked and...
Czech Academy of Sciences Publication Activity Database
Slezáčková, Alena; Blatný, Marek; Millová, Katarína; Jelínek, Martin
2011-01-01
Roč. 26, č. 2 (2011), s. 219-219 ISSN 0887-0446. [European Health Psychology Conference: Engaging with Other Health Professions: Challenges and Perspectives /25./. 20.09.2011-24.09.2011, Hersonissos, Kréta] R&D Projects: GA ČR GAP407/10/2410 Institutional research plan: CEZ:AV0Z70250504 Keywords : psychosomatic problems * middle adulthood * subjectively assessed health Subject RIV: AN - Psychology
49 CFR 219.9 - Responsibility for compliance.
2010-10-01
..., or has caused death or injury, a penalty not to exceed $100,000 per violation may be assessed; and... requirement is subject to a civil penalty of at least $650 and not more than $25,000 per violation, except that: Penalties may be assessed against individuals only for willful violations; where a grossly...
219-IJBCS-Article-Dr R N -Nwaoguikpe
African Journals Online (AJOL)
RHUMSIKI
The mechanism of action of the drug is based on its ability to ... ml of distilled water were mixed with each extract, then ... for 48 hours. The two–liquid phase layers were then separated ... gravitational force of 1500 x g for 15 minutes using the ...
24 CFR 200.219 - Content of certification.
2010-04-01
... URBAN DEVELOPMENT GENERAL INTRODUCTION TO FHA PROGRAMS Participation and Compliance Requirements... as a result of HUD audits, management reviews or other governmental investigations; (iv) There has... Federal Government or of a State Government from doing business with such Department or Agency; (vii) The...
219 ORIGINAL ARTICLE SEROPREVALENCE OF HEPATITIS C ...
African Journals Online (AJOL)
boaz
ABSTRACT. Background: Hepatitis C virus (HCV) infection is a major public health concern. The aim of this study was to ascertain the seroprevalence and risk factors of HCV antibodies among pregnant women in Anyigba, Kogi State North Central Nigeria. Materials and methods:Blood samples (5mls) were collected from ...
49 CFR 219.403 - Voluntary referral policy.
2010-10-01
... section, the railroad treats the referral and subsequent handling, including counseling and treatment, as confidential. (3) The railroad will, to the extent necessary for treatment and rehabilitation, grant the employee a leave of absence from the railroad for the period necessary to complete primary treatment and...
48 CFR 219.704 - Subcontracting plan requirements.
2010-10-01
... business firms specifically identified in the subcontracting plan. Notifications shall be in writing and... SYSTEM, DEPARTMENT OF DEFENSE SOCIOECONOMIC PROGRAMS SMALL BUSINESS PROGRAMS The Small Business... business concerns shall include subcontracts with historically black colleges and universities and minority...
49 CFR 219.213 - Unlawful refusals; consequences.
2010-10-01
... inconsistent with the employee's health, whether such refusal was made in good faith and based on medical..., as appropriate, also consider the following: (1) Whether the railroad made a good faith determination...
48 CFR 1052.219-71 - Subcontracting Plan.
2010-10-01
... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Subcontracting Plan. 1052... Subcontracting Plan. As prescribed in DTAR 1019.708-70(b), insert the following provision: Subcontracting Plan (MAR 2002) As part of its initial proposal, each large business offeror must submit a contracting plan...
Veterinary Laboratory Services Study - 1976.
1976-09-01
years. Many tests , such as ;uman pregnancy testing , Mycobacterium tuberculosis isolation and :iers have been converted to in—vitro procedures. Sheep...assignment in laboratories and worked in chemistry , mic robiology , or diagnostic areas can be directly uti l ized with little additional orientation. They...Chorionic Gonadotropin 475 730 17 1,222 UCG or Human Pregnancy 147 42 189 Tularemia 332 332 OX—19 211 211 Salmonella 219 219 Trichinella 17 17 Venipuncture
Několik poznámek k problematice ochrany duševního vlastnictví
Czech Academy of Sciences Publication Activity Database
Krejčí, Jindřich
2011-01-01
Roč. 5, č. 2 (2011), s. 217-219 ISSN 1802-8152 R&D Projects: GA MŠk LM2010006 Institutional research plan: CEZ:AV0Z70280505 Keywords : social science databases * intellectual property rights * open access Subject RIV: AO - Sociology, Demography http://dav.soc.cas.cz/uploads/9aded5ef84867217588bfc788d640e8a3b0e50d2_DaVp217-219%20Krejci.pdf
The Enemies List: The Foreign Terrorist Organization List and Its Role in Defining Terrorism
2014-03-01
seven days before the designation is published in the Federal Register, as section 219 of the Immigration and Nationality Act requires. Upon the...Organizations.” 38 Antiterrorism and Effective Death Penalty Act of 1996, 110 Stat. 1214 (amends § 219 of the Immigration and Nationality Act (Public Law...and the Israeli-occupied territories, Chile , Iran, and Cambodia. Table 1 reflects the list of communist FTOs designated prior to 9/11, and a
Energy Technology Data Exchange (ETDEWEB)
Wilbur, Daniel Scott [Univ. of Washington, Seattle, WA (United States)
2016-07-19
This research is a collaborative effort between the research groups of the PIs, Dr. D. Scott Wilbur in the Department of Radiation Oncology at the University of Washington (UW) and Matthew O’Hara at the Pacific Northwest National Laboratory (PNNL). In this report only those studies conducted at UW and the budget information from UW will be reported. A separate progress and financial report will be provided by PNNL. This final report outlines the experiments (Tasks) conducted and results obtained at UW from July 1, 2013 thru June 30, 2016 (2-year project with 1 year no-cost extension). The report divides the information on the experiments and results obtained into the 5 specific objectives of the research efforts and the Tasks within those objectives. This format is used so that it is easy to see what has been accomplished in each area. A brief summary of the major findings from the studies is provided below. Summary of Major Findings from Research/Training Activities at UW: Anion and cation exchange columns did not provide adequate 211At capture and/or extraction results under conditions studied to warrant further evaluation; PEG-Merrifield resins containing mPEG350, mPEG750, mPEG2000 and mPEG5000 were synthesized and evaluated; All of the mPEG resins with different sized mPEG moieties conjugated gave similar 211At capture (>95%) from 8M HCl solutions and release with conc. NH4OH (~50-80%), but very low quantities were released when NaOH was used as an eluent; Capture and release of 211At when loading [211At]astatate appeared to be similar to that of [211At]astatide on PEG columns, but further studies need to be conducted to confirm that; Capture of 211At on PEG columns was lower (e.g. 80-90%) from solutions of 8M HNO3, but higher capture rates (e.g. 99%) can be obtained when 10M HNO3 is mixed with an equal quantity of 8M HCl; Addition of reductants to the 211At solutions did not appear to change the percent capture, but may have an effect on the % extracted; There was some indication that the PEG-Merrifield resins could be saturated (perhaps with Bi) resulting in lower capture percentages, but more studies need to be done to confirm that; A target dissolution chamber, designed and built at PNNL, works well with syringe pumps so it can be used in an automated system; Preliminary semi-automated 211At isolation studies have been conducted with full-scale target dissolution and 211At isolation using a PEG column on the Hamilton automated system gave low overall recoveries, but HNO3 was used (rather than HCl) for loading the 211At and flow rates were not optimized; Results obtained using PEG columns are high enough to warrant further development on a fully automated system; Results obtained also indicate that additional studies are warranted to evaluate other types of columns for 211At separation from bismuth, which allow use of HNO3/HCl mixtures for loading and NaOH for eluting 211At. Such a column could greatly simplify the overall isolation process and make it easier to automate.
Bestvina, Christine M; Wroblewski, Kristen E; Daly, Bobby; Beach, Brittany; Chow, Selina; Hantel, Andrew; Malec, Monica; Huber, Michael T; Polite, Blase N
2018-03-13
Accurate understanding of the prognosis of an advanced cancer patient can lead to decreased aggressive care at the end of life and earlier hospice enrollment. Our goal was to determine the association between high-risk clinical events identified by a simple, rules-based algorithm and decreased overall survival, to target poor prognosis cancer patients who would urgently benefit from advanced care planning. A retrospective analysis was performed on outpatient oncology patients with an index visit from April 1, 2015, through June 30, 2015. We examined a three-month window for "high-risk events," defined as (1) change in chemotherapy, (2) emergency department (ED) visit, and (3) hospitalization. Patients were followed until January 31, 2017. A total of 219 patients receiving palliative chemotherapy at the University of Chicago Medicine with a prognosis of ≤12 months were included. The main outcome was overall survival, and each "high-risk event" was treated as a time-varying covariate in a Cox proportional hazards regression model to calculate a hazard ratio (HR) of death. A change in chemotherapy regimen, ED visit, hospitalization, and at least one high-risk event occurred in 54% (118/219), 10% (22/219), 26% (57/219), and 67% (146/219) of patients, respectively. The adjusted HR of death for patients with a high-risk event was 1.72 (95% confidence interval [CI] 1.19-2.46, p = 0.003), with hospitalization reaching significance (HR 2.74, 95% CI 1.84-4.09, p rules-based algorithm identified those with the greatest risk of death among a poor prognosis patient group. Implementation of this algorithm in the electronic health record can identify patients with increased urgency to address goals of care.
International Nuclear Information System (INIS)
King, Taj D.; Gandy, Johanna C.; Bijur, Gautam N.
2006-01-01
The ubiquitously expressed protein glycogen synthase kinase-3 (GSK3) is constitutively active, however its activity is markedly diminished following phosphorylation of Ser21 of GSK3α and Ser9 of GSK3β. Although several kinases are known to phosphorylate Ser21/9 of GSK3, for example Akt, relatively much less is known about the mechanisms that cause the dephosphorylation of GSK3 at Ser21/9. In the present study KCl-induced plasma membrane depolarization of SH-SY5Y cells, which increases intracellular calcium concentrations caused a transient decrease in the phosphorylation of Akt at Thr308 and Ser473, and GSK3 at Ser21/9. Overexpression of the selective protein phosphatase-1 inhibitor protein, inhibitor-2, increased basal GSK3 phosphorylation at Ser21/9 and significantly blocked the KCl-induced dephosphorylation of GSK3β, but not GSK3α. The phosphorylation of Akt was not affected by the overexpression of inhibitor-2. GSK3 activity is known to affect sarcoplasmic/endoplasmic reticulum calcium ATPase 2 (SERCA2) levels. Overexpression of inhibitor-2 or treatment of cells with the GSK3 inhibitors lithium and SB216763 increased the levels of SERCA2. These results indicate that the protein phosphatase-1/inhibitor-2 complex differentially regulates GSK3 dephosphorylation induced by KCl and that GSK3 activity regulates SERCA2 levels
Multi-Energy Processing for Novel Coating Technologies
2014-12-18
shape bounced back with increased inner flame lengths and reduced diameters. At 10.532 ^m, the length of the inner flame was the shortest, 3 mm, with a...brighter and shorter. At 10.22 ^m, the inner flame length was the shortest, 4 mm with 2 m expansion in diameter, indicating accelerated combustion...absorption rates less than 1/3 of that at 9 219 um the lame length shrank further and became brighter. With a laser irradiation at 9.219 ^m the flame
Alpha particle emitters in medicine
International Nuclear Information System (INIS)
Fisher, D.R.
1989-09-01
Radiation-induced cancer of bone, liver and lung has been a prominent harmful side-effect of medical applications of alpha emitters. In recent years, however, the potential use of antibodies labeled with alpha emitting radionuclides against cancer has seemed promising because alpha particles are highly effective in cell killing. High dose rates at high LET, effectiveness under hypoxic conditions, and minimal expectancy of repair are additional advantages of alpha emitters over antibodies labeled with beta emitting radionuclides for cancer therapy. Cyclotron-produced astatine-211 ( 211 At) and natural bismuth-212 ( 212 Bi) have been proposed and are under extensive study in the United States and Europe. Radium-223 ( 223 Ra) also has favorable properties as a potential alpha emitting label, including a short-lived daughter chain with four alpha emissions. The radiation dosimetry of internal alpha emitters is complex due to nonuniformly distributed sources, short particle tracks, and high relative specific ionization. The variations in dose at the cellular level may be extreme. Alpha-particle radiation dosimetry, therefore, must involve analysis of statistical energy deposition probabilities for cellular level targets. It must also account fully for nonuniform distributions of sources in tissues, source-target geometries, and particle-track physics. 18 refs., 4 figs
The in vivo fate of a 211At labelled monoclonal antibody with known specificity in a murine system
International Nuclear Information System (INIS)
Vaughan, A.T.M.; Bateman, W.J.; Fisher, D.R.
1982-01-01
A monoclonal antibody reactive against the human transferrin receptor has been labelled with the alpha and X ray emitting isotope Astatine 211. The labelling procedure does not affect the ability of the product to bind to the transferrin receptor on the human leukemic cell line HL60. Using a direct binding assay, 211 At labelled antibody can be specifically inhibited from binding to its target cells by excess unlabelled antibody. Furthermore, the binding inhibition demonstrated in this system correlates to enhanced clonogenic survival of these cells, indicating that very few atoms of 211 At/cell are required for cell death. Data obtained from labelled antibody injected into mice show that the labelled product in serum retains the ability to bind to HL60 cells in vitro, although tissue distributions of the injected activity implies that some of the radiolabel is lost from the protein. Despite this loss of label, preliminary experiments on the localization of labelled antibody to HL60 cells growing s/c in nude mice show that tumor tissue has a higher specific activity than all other tissues, other than blood, after 12 hours. This suggests that further work on the nature of label degradation in vivo is warranted in the context of potential therapeutic and diagnostic studies
Guo, Yuanyuan; Xun, Zhe; Coffman, Stephanie R; Chen, Feng
2017-01-01
The status of intestinal microbiota is a determinant of host health. However, the alteration of the gut microbiota caused by the innate immune response to virus infection is unclear. Caenorhabditis elegans and its natural virus Orsay provide an excellent model of host-virus interactions. We evaluated the intestinal microbial community complexity of the wild-type N2 and the innate immunity-deficient mutant rde-1 ( ne219 ) strains of C. elegans upon Orsay virus infection. The gut microbiota diversity was decreased in rde-1 ( ne219 ) mutant animals, and a large number of genes were associated with the difference between infected and uninfected rde-1 ( ne219 ) mutant animals. Therefore, this study provides the first evaluation of the alterations caused by Orsay virus on intestinal microbiota in wildtype and innate immunity-deficient animals using C. elegans as the model species. Our findings indicate that virus infection may alters the microbiome in animals with defective immune response.
Directory of Open Access Journals (Sweden)
Yuanyuan Guo
2017-05-01
Full Text Available The status of intestinal microbiota is a determinant of host health. However, the alteration of the gut microbiota caused by the innate immune response to virus infection is unclear. Caenorhabditis elegans and its natural virus Orsay provide an excellent model of host–virus interactions. We evaluated the intestinal microbial community complexity of the wild-type N2 and the innate immunity-deficient mutant rde-1 (ne219 strains of C. elegans upon Orsay virus infection. The gut microbiota diversity was decreased in rde-1 (ne219 mutant animals, and a large number of genes were associated with the difference between infected and uninfected rde-1 (ne219 mutant animals. Therefore, this study provides the first evaluation of the alterations caused by Orsay virus on intestinal microbiota in wildtype and innate immunity-deficient animals using C. elegans as the model species. Our findings indicate that virus infection may alters the microbiome in animals with defective immune response.
49 CFR 219.300 - Mandatory reasonable suspicion testing.
2010-10-01
... or body odors of the employee. (2) A railroad must require a covered employee to submit to a drug... body odors of the employee. Such observations may include indications of the chronic and withdrawal...
36 CFR 219.21 - Social and economic sustainability.
2010-07-01
... AGRICULTURE PLANNING National Forest System Land and Resource Management Planning Ecological, Social, and... national, regional, and local scales. Social analyses address human life-styles, cultures, attitudes... management on the well-being of communities and regions, and the net benefit of uses, values, products, or...
Lifescience Database Archive (English)
Full Text Available KXSRTLPFELIIALDXSLQAXGQLXLDD GESIQTYVDNKYSFIQFDVVSSPSSSAYKLQSTIXNNNYNGTASLIINSIQIYGSPSVQQ VIVNGSPINSFNAVSDSTLSVSNLQLALDESLKXFWIX...SLIINSIQIYGSPSVQQ VIVNGSPINSFNAVSDSTLSVSNLQLALDESLKXFWIXLK Frame B: knin*n*kknetfvfinyffcyciilxcwiiisiim*isr...fixvvvisfqlnqpphmlhqlmvfqlplkxlelyhln*llpwixhykqxvnyxwmm vnqfkpmliintlsfnsmlxphhlhlptnynqpxsitiimvpll*slilsk
29 CFR 1910.219 - Mechanical power-transmission apparatus.
2010-07-01
... dimensions specified in this paragraph shall apply to all guards, except horizontal overhead belts, rope... drives of twenty (20) inch centers or under shall be not less than one-fourth inch from the nearest... one-fourth (11/4) inches inside diameter, or larger. If made of metal shapes or bars, their section...
12 CFR 219.21 - Authority, purpose and scope.
2010-01-01
... amended by the Annunzio-Wylie Anti-Money Laundering Act of 1992 (Pub. L. 102-550, Title XV; 106 Stat. 3672... recordkeeping and reporting requirements will assist in the prosecution of money laundering activities and are...
1935 15' Quad #219 Aerial Photo Mosaic Index
Earth Data Analysis Center, University of New Mexico — Aerial Photo Reference Mosaics contain aerial photographs that are retrievable on a frame by frame basis. The inventory contains imagery from various sources that...
49 CFR 397.219 - Waiver determination and order.
2010-10-01
... rational basis; (3) Whether the highway routing designation of the State, political subdivision thereof, or... readily identifiable by the Administrator as one who may be affected by the order. A copy of each order is... with § 397.223, an order issued under this section constitutes the final agency decision regarding...
48 CFR 1552.219-70 - Mentor-Protege Program.
2010-10-01
... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Mentor-Protege Program... Mentor-Protege Program. As prescribed in 1519.203(a), insert the following clause: Mentor-Protege Program OCT 2000 (a) The Contractor has been approved to participate in the EPA Mentor-Protege program. The...
49 CFR 219.405 - Co-worker report policy.
2010-10-01
... dependence on alcohol or a drug or by another identifiable and treatable mental or physical disorder... and treatable mental or physical disorder— (1) The railroad must return the employee to service within... effects of alcohol and drugs on occupational or transportation safety. (f) Follow-up tests. A railroad may...
47 CFR 90.219 - Use of signal boosters.
2010-10-01
... to operate radio systems in the frequency bands above 150 MHz may employ signal boosters at fixed... fill in only weak signal areas and cannot extend the system's normal signal coverage area. (b) Class A... effective radiated power (ERP) of the unit to a maximum of 5 watts under all conditions. Class B broadband...
49 CFR 1544.219 - Carriage of accessible weapons.
2010-10-01
...) Flights for which screening is conducted. The provisions of § 1544.201(d), with respect to accessible weapons, do not apply to a law enforcement officer (LEO) aboard a flight for which screening is required..., county, or state law enforcement officer who is a direct employee of a government agency. (ii) Be sworn...
Lifescience Database Archive (English)
Full Text Available igf*n *iahvq*kigalsgpflvsrtgdvg*tkywdktsnih**ipqkvlvh*dsrtvamevgir *gvcnnspakwtsp...lihligf*n *iahvq*kigalsgpflvsrtgdvg*tkywdktsnih**ipqkvlvh*dsrtvamevgir *gvcnnspakwtspeng*r*qwmvdaqslkeviillt
Monolithic Hybrid and Passive Mode-Locked 40GHz Quantum Dot Laser Diodes
DEFF Research Database (Denmark)
Thompson, M. G.; Larsson, David; Rae, A. R.
2006-01-01
For the first time hybrid and passive mode-locking jitter performance is investigated in 40GHz quantum-dot mode-locked lasers. Record low passive mode-locking jitter of 219fs is presented, along with promising hybrid mode-locking results of 124fs.......For the first time hybrid and passive mode-locking jitter performance is investigated in 40GHz quantum-dot mode-locked lasers. Record low passive mode-locking jitter of 219fs is presented, along with promising hybrid mode-locking results of 124fs....
ONUS, Ahmet Naci
2014-01-01
Selected isozymes were investigated in plants of Capsicum baccatum L. ( Solanaceae) accessions SA219 (P.G.Smith), Hawkes 6489 (P.G.Smith), Capsicum cardenasii Heiser and Smith accession SA268 (P.G.Smith), Capsicum eximium A.T.Hunz accession Hawkes 3860 (J.G.Hawkes) and two interspecific F1 hybrids, C. baccatum SA219 x C. eximium Hawkes 3860 and C. baccatum Hawkes 6489 x C. cardenasii SA 268. The standard technique of horizontal gel electrophoresis was employed. The gel was cut into severa...
ORF Alignment: NC_002696 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available 219 ... Query: 38 ... RVLLFQPFTIPSASMEPNLYQGDYIIVSKFSYGWSKHSIPFSPPIIKGRIFDRAPKRGDI 97 ... RVLLFQPFTIPSAS...MEPNLYQGDYIIVSKFSYGWSKHSIPFSPPIIKGRIFDRAPKRGDI Sbjct: 1 ... RVLLFQPFTIPSASMEPNLYQGDYI
International Nuclear Information System (INIS)
Moore, Kevin L.; Schmidt, Rachel; Moiseenko, Vitali; Olsen, Lindsey A.; Tan, Jun; Xiao, Ying; Galvin, James; Pugh, Stephanie; Seider, Michael J.; Dicker, Adam P.; Bosch, Walter; Michalski, Jeff; Mutic, Sasa
2015-01-01
Purpose: The purpose of this study was to quantify the frequency and clinical severity of quality deficiencies in intensity modulated radiation therapy (IMRT) planning in the Radiation Therapy Oncology Group 0126 protocol. Methods and Materials: A total of 219 IMRT patients from the high-dose arm (79.2 Gy) of RTOG 0126 were analyzed. To quantify plan quality, we used established knowledge-based methods for patient-specific dose-volume histogram (DVH) prediction of organs at risk and a Lyman-Kutcher-Burman (LKB) model for grade ≥2 rectal complications to convert DVHs into normal tissue complication probabilities (NTCPs). The LKB model was validated by fitting dose-response parameters relative to observed toxicities. The 90th percentile (22 of 219) of plans with the lowest excess risk (difference between clinical and model-predicted NTCP) were used to create a model for the presumed best practices in the protocol (pDVH 0126,top10% ). Applying the resultant model to the entire sample enabled comparisons between DVHs that patients could have received to DVHs they actually received. Excess risk quantified the clinical impact of suboptimal planning. Accuracy of pDVH predictions was validated by replanning 30 of 219 patients (13.7%), including equal numbers of presumed “high-quality,” “low-quality,” and randomly sampled plans. NTCP-predicted toxicities were compared to adverse events on protocol. Results: Existing models showed that bladder-sparing variations were less prevalent than rectum quality variations and that increased rectal sparing was not correlated with target metrics (dose received by 98% and 2% of the PTV, respectively). Observed toxicities were consistent with current LKB parameters. Converting DVH and pDVH 0126,top10% to rectal NTCPs, we observed 94 of 219 patients (42.9%) with ≥5% excess risk, 20 of 219 patients (9.1%) with ≥10% excess risk, and 2 of 219 patients (0.9%) with ≥15% excess risk. Replanning demonstrated the predicted NTCP
Moore, Kevin L; Schmidt, Rachel; Moiseenko, Vitali; Olsen, Lindsey A; Tan, Jun; Xiao, Ying; Galvin, James; Pugh, Stephanie; Seider, Michael J; Dicker, Adam P; Bosch, Walter; Michalski, Jeff; Mutic, Sasa
2015-06-01
The purpose of this study was to quantify the frequency and clinical severity of quality deficiencies in intensity modulated radiation therapy (IMRT) planning in the Radiation Therapy Oncology Group 0126 protocol. A total of 219 IMRT patients from the high-dose arm (79.2 Gy) of RTOG 0126 were analyzed. To quantify plan quality, we used established knowledge-based methods for patient-specific dose-volume histogram (DVH) prediction of organs at risk and a Lyman-Kutcher-Burman (LKB) model for grade ≥2 rectal complications to convert DVHs into normal tissue complication probabilities (NTCPs). The LKB model was validated by fitting dose-response parameters relative to observed toxicities. The 90th percentile (22 of 219) of plans with the lowest excess risk (difference between clinical and model-predicted NTCP) were used to create a model for the presumed best practices in the protocol (pDVH0126,top10%). Applying the resultant model to the entire sample enabled comparisons between DVHs that patients could have received to DVHs they actually received. Excess risk quantified the clinical impact of suboptimal planning. Accuracy of pDVH predictions was validated by replanning 30 of 219 patients (13.7%), including equal numbers of presumed "high-quality," "low-quality," and randomly sampled plans. NTCP-predicted toxicities were compared to adverse events on protocol. Existing models showed that bladder-sparing variations were less prevalent than rectum quality variations and that increased rectal sparing was not correlated with target metrics (dose received by 98% and 2% of the PTV, respectively). Observed toxicities were consistent with current LKB parameters. Converting DVH and pDVH0126,top10% to rectal NTCPs, we observed 94 of 219 patients (42.9%) with ≥5% excess risk, 20 of 219 patients (9.1%) with ≥10% excess risk, and 2 of 219 patients (0.9%) with ≥15% excess risk. Replanning demonstrated the predicted NTCP reductions while maintaining the volume of the PTV
Directory of Open Access Journals (Sweden)
Polin Haghvirdizadeh
2015-01-01
Full Text Available Background. Type 2 diabetes mellitus (T2DM is a complex polygenic disorder characterized by impaired insulin resistance, insulin secretion, and dysregulation of lipid and protein metabolism with environmental and genetic factors. ATP-binding cassette transporter A1 (ABCA1 gene polymorphisms are reported as the one of the genetic risk factors for T2DM in various populations with conflicting results. This study was conducted based on PCR-HRM to determine the frequency of ABCA1 gene by rs2230806 (R219K, rs1800977 (C69T, and rs9282541 (R230C polymorphisms Malaysian subjects. Methods. A total of 164 T2DM and 165 controls were recruited and their genotypes for ABCA1 gene polymorphisms were determined based on the real time high resolution melting analysis. Results. There was a significant difference between the subjects in terms of age, BMI, FPG, HbA1c, HDL, LDL, and TG P<0.05. There was a significant association between HOM of R219K P=0.005, among Malaysian subjects; moreover, allele frequency revealed the significant difference in A allele of R219K P=0.003. But, there was no significant difference in genotypic and allelic frequencies of C69T and R230C polymorphism. Conclusion. R219K polymorphism of ABCA1 gene can be considered as a genetic risk factor for T2DM subjects among Malaysians.
ORF Alignment: NC_006582 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ] ... Length = 219 ... Query: 8 ... WNDVIGGEFQKTYYLELREFLKREYKEQTVYPHMNDLFNAFHYTPFEQVKVVILGQDPYH 67 ... WNDVI...GGEFQKTYYLELREFLKREYKEQTVYPHMNDLFNAFHYTPFEQVKVVILGQDPYH Sbjct: 1 ... WNDVI
ORF Alignment: NC_003155 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available 109 ... Query: 219 ATAESIRAFIRQNLHDPELSPPVIAAAHHISLSYLHRIFQQQAQGETVAAYIRSQRLEGA 27...8 ... ATAESIRAFIRQNLHDPELSPPVIAAAHHISLSYLHRIFQQQAQGETVAAYIRSQRLEGA Sbjct: 1 ... ATAESIRAFIRQNLHDPELSPPVIAAAHHISLSYLHRIFQQQAQGETVAAYIRSQRLEGA 60 ...
ORF Alignment: NC_004061 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... Length = 84 ... Query: 160 IKTNDLVTINYCIYENNKKLDKFNVEKFKFIVSQNNFIPELNNKLINHFTNDVI...FFKINF 219 ... IKTNDLVTINYCIYENNKKLDKFNVEKFKFIVSQNNFIPELNNKLINHFTNDVIFFKINF Sbjct: 1 ... IKTNDLVTINYCIYENNKKLDKFNVEKFKFIVSQNNFIPELNNKLINHFTNDVIFFKINF 60 ...
ORF Alignment: NC_004311 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... Length = 70 ... Query: 219 DKLKRALEAERSFTANSAHELRTPIAAALAQTQRLIAETQDKAARDRGEQIEAALHRLSR 278 ... DKLKRALEAERSFTANSAHEL...RTPIAAALAQTQRLIAETQDKAARDRGEQIEAALHRLSR Sbjct: 1 ... DKLKRALEAERSFTANSAHELRTPIAAALAQTQRLIAETQDKAARDRGEQIEAALHRLSR 60 ...
ORF Alignment: NC_004463 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... 110] ... Length = 44 ... Query: 219 HFVNRGDTLASIARKNHISAAELARANGLDPSAKLKLGTKL 259 ... HFVNRGDTLASIARKNHIS...AAELARANGLDPSAKLKLGTKL Sbjct: 1 ... HFVNRGDTLASIARKNHISAAELARANGLDPSAKLKLGTKL 41
Laser spectroscopy of francium isotopes at the borders of the region of reflection asymmetry
Budinčević, I; Bissell, M L; Cocolios, T E; de Groote, R P; De Schepper, S; Fedosseev, V N; Flanagan, K T; Franchoo, S; Garcia Ruiz, R F; Heylen, H; Lynch, K M; Marsh, B A; Neyens, G; Procter, T J; Rossel, R E; Rothe, S; Strashnov, I; Stroke, H H; Wendt, K D A
2014-01-01
The magnetic dipole moments and changes in mean-square charge radii of the neutron-rich $^{218m,219,229,231}\\text{Fr}$ isotopes were measured with the newly-installed Collinear Resonance Ionization Spectroscopy (CRIS) beam line at ISOLDE, CERN, probing the $7s~^{2}S_{1/2}$ to $8p~^{2}P_{3/2}$ atomic transition. The $\\delta\\langle r^{2}\\rangle^{A,221}$ values for $^{218m,219}\\text{Fr}$ and $^{229,231}\\text{Fr}$ follow the observed increasing slope of the charge radii beyond $N~=~126$. The charge radii odd-even staggering in this neutron-rich region is discussed, showing that $^{220}\\text{Fr}$ has a weakly inverted odd-even staggering while $^{228}\\text{Fr}$ has normal staggering. This suggests that both isotopes reside at the borders of a region of inverted staggering, which has been associated with reflection-asymmetric shapes. The $g(^{219}\\text{Fr}) = +0.69(1)$ value supports a $\\pi 1h_{9/2}$ shell model configuration for the ground state. The $g(^{229,231}\\text{Fr})$ values support the tentative $I^{\\pi}(^...
ORF Alignment: ch_oct10_gene_aa_db [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available 0000004359 [Cryptosporidium hominis] ... Length = 172 ... Query: 219 DIDECKEGSHSCSHICVNTRGSFVCECPKGYTLDK...NQQDCIDINECQENSGLGPCEFGCK 278 ... DIDECKEGSHSCSHICVNTRGSFVCECPKGYTLDKNQQDCIDINECQENSGLGPCEFGCK Sbjct: 1 ... DIDECKEGSHSCSHICVNTR
ORF Alignment: NC_004741 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ASSNQLSALPELPV Sbjct: 1 ... SETSLDLSCLGLRSLPRLPDNLDEINVSNNQLSMLPELPRALKELNASSNQLSALPELPV 60 ... Query: 180 RDDHIIRIFWLNQNRITAIPE...SILGLSSDSVVNLRENQLS 219 ... RDDHIIRIFWLNQNRITAIPESILGLSSDSVVNLRENQLS Sbjct: 121 RDDHIIRIFWLNQNRITAIPESILGLSSDSVVNLRENQLS 160
ORF Alignment: NC_004347 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available -1] ... Length = 219 ... Query: 21 ... AAEPLVIGAEDDWAPYCALDKQSGQPLGLAPELVKAVFATEKLEIAFRPLPFARCMHDAK 80 ... ... ... AAEPLVIGAEDDWAPYCALDKQSGQPLGLAPELVKAVFATEKLEIAFRPLPFARCMHDAK Sbjct: 1 ... AA...EPLVIGAEDDWAPYCALDKQSGQPLGLAPELVKAVFATEKLEIAFRPLPFARCMHDAK 60 ... Query: 141 YTYPTDFMDNTKITRFEAKSDAQILEMLVRGRVD
International Nuclear Information System (INIS)
Chatal, J. F.
2000-01-01
The antibodies can be satisfactorily labelled with technitium-99 m or indium-111 for tumor immunoscintigraphy. The immunoscintigraphy is not useful for the primary tumor diagnosis. It can be useful for the diagnosis of the some cancer extension and for recurrent tumor visualization. The immunoscintigraphy is widely competed with Positron Emission Tomography (PET) which gives accurate results. In the future the immunoscintigraphy, in pre-therapeutic stage, contribute to the estimation of the dose delivered to the tumor and to normal organs for adopting or not a radioimmunotherapy. The antibodies can also be labeled with Iodine-131 for an application in radioimmunotherapy (RIT). The RIT is efficient in the non-Hodgkin's lymphoma treatment because of their great radiosensitivity. Until now the results have been very modest in solid tumor treatment but methodological and biotechnological progresses have to improve the efficiency especially for the small tumors. In the future iodine-131 which requires the confinement (very expensive) of patients will be substituted by yttrium-90 beta emitter, more energetic than iodine-131 and can be injected in walking case. In the long term, the alpha emitter radionuclides (astatine-211 or bismuth-213) can be used for hematologic cancer treatment. In conclusion the future of radiolabeled monoclonal antibodies is essentially therapeutic. The radioimmunotherapy associated to the chemotherapy give promising perspectives for the radiosensitive cancer treatment and in general small solid tumor treatment (F.M.)
On the theory of time dilation in chemical kinetics
Baig, Mirza Wasif
2017-10-01
The rates of chemical reactions are not absolute but their magnitude depends upon the relative speeds of the moving observers. This has been proved by unifying basic theories of chemical kinetics, which are transition state theory, collision theory, RRKM and Marcus theory, with the special theory of relativity. Boltzmann constant and energy spacing between permitted quantum levels of molecules are quantum mechanically proved to be Lorentz variant. The relativistic statistical thermodynamics has been developed to explain quasi-equilibrium existing between reactants and activated complex. The newly formulated Lorentz transformation of the rate constant from Arrhenius equation, of the collision frequency and of the Eyring and Marcus equations renders the rate of reaction to be Lorentz variant. For a moving observer moving at fractions of the speed of light along the reaction coordinate, the transition state possess less kinetic energy to sweep translation over it. This results in the slower transformation of reactants into products and in a stretched time frame for the chemical reaction to complete. Lorentz transformation of the half-life equation explains time dilation of the half-life period of chemical reactions and proves special theory of relativity and presents theory in accord with each other. To demonstrate the effectiveness of the present theory, the enzymatic reaction of methylamine dehydrogenase and radioactive disintegration of Astatine into Bismuth are considered as numerical examples.
Silver impregnated nanoparticles of titanium dioxide as carriers for {sup 211}At
Energy Technology Data Exchange (ETDEWEB)
Cedrowska, Edyta; Lyczko, Monika; Piotrowska, Agata; Bilewicz, Aleksander [Institute of Nuclear Chemistry and Technology, Warsaw (Poland); Stolarz, Anna; Trcinska, Agnieszka [Warsaw Univ. (Poland). Heavy Ion Lab.; Szkliniarz, Katarzyna [Silesia Univ. Katowice (Poland). Inst. of Physics; Was, Bogdan [Polish Academy of Science, Cracow (Poland). Inst. of Nuclear Physics
2016-08-01
The {sup 211}At radioisotope exhibits very attractive nuclear properties for application in radionuclide therapy. Unfortunately use of {sup 211}At is limited, because astatine as the heaviest halogen forms weak bond with carbon atoms in the biomolecules which makes {sup 211}At bioconjugates unstable in physiological conditions. In our work we propose a new solution for binding of {sup 211}At which consists of using nanoparticles of titanium dioxide modified with silver atoms as carriers for {sup 211}At. Ag{sup +} cations have been absorbed on the nanometer-sized TiO{sub 2} particles (15 and 32 nm) through ion exchange process and were reduced in Tollens' reaction. The obtained TiO{sub 2}-Ag nanoparticles were labeled with {sup 211}At. It was found that labeling yields were almost quantitative under reducing conditions, while under oxidizing conditions they dropped to about 80%. The labeled nanoparticles exhibited very high stability in physiological salt, PBS buffer, solutions of peptides (0.001 M cysteine, 0.001 M glutathione) and in human blood serum. To make TiO{sub 2}/Ag nanoparticles well dispersed in water and biocompatible their surface was modified with a silane coupling agent containing poly(ethyleneglycol) molecules. The developed functionalization approach will allow us to attach biomolecules to the TiO{sub 2}/Ag surface.
Energy Technology Data Exchange (ETDEWEB)
Mume, Eskender [Organic Chemistry, Department of Chemistry, Uppsala University, S-751 24 Uppsala (Sweden); Orlova, Anna [Affibody AB, S-161 02 Bromma (Sweden); Malmstroem, Per-Uno [Division of Urology, Department of Surgical Sciences, Uppsala University, S-751 85 Uppsala (Sweden); Lundqvist, Hans [Unit of Biomedical Radiation Sciences, Rudbeck Laboratory, Uppsala University, S-751 85 Uppsala (Sweden); Sjoeberg, Stefan [Organic Chemistry, Department of Chemistry, Uppsala University, S-751 24 Uppsala (Sweden); Tolmachev, Vladimir [Unit of Biomedical Radiation Sciences, Rudbeck Laboratory, Uppsala University, S-751 85 Uppsala (Sweden)]. E-mail: vladimir.tolmachev@bms.uu.se
2005-08-01
Combining the specificity of radioimmunoscintigraphy and the high sensitivity of PET in an in vivo detection technique could improve the quality of nuclear diagnostics. Positron-emitting nuclide {sup 76}Br (T {sub 1/2}=16.2 h) might be a possible candidate for labeling monoclonal antibodies (mAbs) and their fragments, provided that the appropriate labeling chemistry has been established. For internalizing antibodies, such as the humanized anti-HER2 monoclonal antibody, trastuzumab, radiobromine label should be residualizing, i.e., ensuring that radiocatabolites are trapped intracellularly after the proteolytic degradation of antibody. This study evaluated the chemistry of indirect radiobromination of trastuzumab using N-succinimidyl 5-(tributylstannyl)-3-pyridinecarboxylate. Literature data indicated that the use of this method provided residualizing properties for iodine and astatine labels on some antibodies. An optimized 'one-pot' procedure produced an overall labeling efficiency of 45.5{+-}1.2% over 15 min. The bromine label was stable under physiological and denaturing conditions. The labeled trastuzumab retained its capacity to bind specifically to HER2-expressing SKOV-3 ovarian carcinoma cells in vitro (immunoreactivity more than 75%). However, in vitro cell test did not demonstrate that the radiobromination of trastuzumab using N-succinimidyl 5-bromo-3-pyridinecarboxylate improves cellular retention of radioactivity in comparison with the use of N-succinimidyl 4-bromobenzoate.
30 CFR 219.410 - What does this subpart contain?
2010-07-01
... GOMESA revenues are reserved for the following purposes: (1) Projects and activities for the purposes of... projects. (5) Planning assistance and administrative costs not-to-exceed 3 percent of the amounts received... Center, Building 85; MS-350B1; Denver, CO 80225-0165, or at (303) 231-3429. ...
34 CFR 685.219 - Public Service Loan Forgiveness Program.
2010-07-01
... duty for training or attendance at a service school. For civilians, “Military service” means service on... Revenue Code; (4) A Tribal college or university; or (5) A private organization that— (i) Provides the following public services: Emergency management, military service, public safety, law enforcement, public...
48 CFR 52.219-16 - Liquidated Damages-Subcontracting Plan.
2010-10-01
... following clause: Liquidated Damages—Subcontracting Plan (JAN 1999) (a) Failure to make a good faith effort... has failed to make such good faith effort, the Contracting Officer shall give the Contractor written notice specifying the failure and permitting the Contractor to demonstrate what good faith efforts have...
37 CFR 2.19 - Revocation or withdrawal of attorney.
2010-07-01
...., a corporate officer or general partner of a partnership). In the case of joint applicants or joint... a trademark case may withdraw upon application to and approval by the Director or, when applicable..., DEPARTMENT OF COMMERCE RULES OF PRACTICE IN TRADEMARK CASES Representation by Attorneys Or Other Authorized...
49 CFR 219.101 - Alcohol and drug use prohibited.
2010-10-01
...) Under the influence of or impaired by alcohol; (ii) Having .04 or more alcohol concentration in the breath or blood; or (iii) Under the influence of or impaired by any controlled substance. (3) No employee... distribution is through documented over the counter sales (Schedule V only). (c) Railroad rules. Nothing in...
49 CFR 219.203 - Responsibilities of railroads and employees.
2010-10-01
... duty tour. An employee who has been transported to receive medical care is not released from duty for... testing does not excuse such refusal by the employee timely to provide the required specimens. (c) Place...
32 CFR 219.116 - General requirements for informed consent.
2010-07-01
... statement that participation is voluntary, refusal to participate will involve no penalty or loss of...) Nothing in this policy is intended to limit the authority of a physician to provide emergency medical care...
48 CFR 652.219-73 - Mentor Requirements and Evaluation.
2010-10-01
... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Mentor Requirements and... Mentor Requirements and Evaluation. As prescribed in 619.202-70(o)(2), insert the following clause: Mentor Requirements and Evaluation (APR 2004) (a) Mentor and protégé firms shall submit an evaluation to...
48 CFR 1052.219-75 - Mentor Requirements and Evaluation.
2010-10-01
... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Mentor Requirements and... Mentor Requirements and Evaluation. As prescribed in DTAR 1019.202-70, insert the following clause: Mentor Requirements and Evaluation (JAN 2000) (a) Mentor and protégé firms shall submit an evaluation to...
All projects related to | Page 219 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Integrated Approach to Address Food and Nutrition Security in the ... Could integrated garden and nutrition programs at schools help address the problem? .... LABOUR POLICY, GENDER EQUALITY, ECONOMIC ANALYSIS, LABOUR ...
Haslach, Erica M; Huang, Huisuo; Dirain, Marvin; Debevec, Ginamarie; Geer, Phaedra; Santos, Radleigh G; Giulianotti, Marc A; Pinilla, Clemencia; Appel, Jon R; Doering, Skye R; Walters, Michael A; Houghten, Richard A; Haskell-Luevano, Carrie
2014-06-12
Human obesity has been linked to genetic factors and single nucleotide polymorphisms (SNPs). Melanocortin-4 receptor (MC4R) SNPs have been associated with up to 6% frequency in morbidly obese children and adults. A potential therapy for individuals possessing such genetic modifications is the identification of molecules that can restore proper receptor signaling and function. These compounds could serve as personalized medications improving quality of life issues as well as alleviating diseases symptoms associated with obesity including type 2 diabetes. Several hMC4 SNP receptors have been pharmacologically characterized in vitro to have a decreased, or a lack of response, to endogenous agonists such as α-, β-, and γ2-melanocyte stimulating hormones (MSH) and adrenocorticotropin hormone (ACTH). Herein we report the use of a mixture based positional scanning combinatorial tetrapeptide library to discover molecules with nM full agonist potency and efficacy to the L106P, I69T, I102S, A219V, C271Y, and C271R hMC4Rs. The most potent compounds at all these hMC4R SNPs include Ac-His-(pI)DPhe-Tic-(pNO2)DPhe-NH2, Ac-His-(pCl)DPhe-Tic-(pNO2)DPhe-NH2, Ac-His-(pCl)DPhe-Arg-(pI)Phe-NH2, and Ac-Arg-(pCl)DPhe-Tic-(pNO2)DPhe-NH2, revealing new ligand pharmacophore models for melanocortin receptor drug design strategies.
Bailey, B A; Bae, H; Strem, M D; Roberts, D P; Thomas, S E; Crozier, J; Samuels, G J; Choi, Ik-Young; Holmes, K A
2006-11-01
Endophytic isolates of Trichoderma species are being considered as biocontrol agents for diseases of Theobroma cacao (cacao). Gene expression was studied during the interaction between cacao seedlings and four endophytic Trichoderma isolates, T. ovalisporum-DIS 70a, T. hamatum-DIS 219b, T. harzianum-DIS 219f, and Trichoderma sp.-DIS 172ai. Isolates DIS 70a, DIS 219b, and DIS 219f were mycoparasitic on the pathogen Moniliophthora roreri, and DIS 172ai produced metabolites that inhibited growth of M. roreri in culture. ESTs (116) responsive to endophytic colonization of cacao were identified using differential display and their expression analyzed using macroarrays. Nineteen cacao ESTs and 17 Trichoderma ESTs were chosen for real-time quantitative PCR analysis. Seven cacao ESTs were induced during colonization by the Trichoderma isolates. These included putative genes for ornithine decarboxylase (P1), GST-like proteins (P4), zinc finger protein (P13), wound-induced protein (P26), EF-calcium-binding protein (P29), carbohydrate oxidase (P59), and an unknown protein (U4). Two plant ESTs, extensin-like protein (P12) and major intrinsic protein (P31), were repressed due to colonization. The plant gene expression profile was dependent on the Trichoderma isolate colonizing the cacao seedling. The fungal ESTs induced in colonized cacao seedlings also varied with the Trichoderma isolate used. The most highly induced fungal ESTs were putative glucosyl hydrolase family 2 (F3), glucosyl hydrolase family 7 (F7), serine protease (F11), and alcohol oxidase (F19). The pattern of altered gene expression suggests a complex system of genetic cross talk occurs between the cacao tree and Trichoderma isolates during the establishment of the endophytic association.
DIFFERENTIAL RESPONSE OF CLONES OF EUCALYPT TO GLYPHOSATE1
Directory of Open Access Journals (Sweden)
Leonardo Bianco de Carvalho
2015-02-01
Full Text Available Weed control is commonly performed by the inter-row mechanical weeding associated to intrarow glyphosate directed spraying, causing a risk for drift or accidental herbicide application, that can affect the crop of interest. The objective was to evaluate the response of clones C219, GG100, I144, and I224 of eucalypt (Eucalyptus grandis x E. urophylla to glyphosate doses of 0, 18, 36, 72, 180, 360, and 720 g of acid equivalent per hectare. The clones showed different growth patterns with regard to height, leaf number, stem dry weight, relative growth rate, net assimilation rate, and relative leaf growth rate. The clones I144 and GG100 were more susceptible to glyphosate, showing the doses required to reduce dry weight by 50% of 113.4 and 119.6 g acid equivalent per hectare, respectively. The clones C219 and I224 were less susceptible to glyphosate, showing the doses required to reduce dry weight by 50% of 237.5 and 313.5 g acid equivalent per hectare, respectively. Eucalyptus clones respond differently to glyphosate exposure, so that among I224, C219, GG100, and I144, the susceptibility to the herbicide is increasing.
Fifth international symposium on the natural radiation environment (NRE - V). Book of abstracts
International Nuclear Information System (INIS)
1991-01-01
Most of the 219 contributions Are on radon (to a much lesser extent: thoron) and its daughter products in dwellings and in the environment; on corresponding measuring instruments and - methods; on measurements done; and on radiation doses to professional workers and to the public. The section heading give a fairly good account of the subject matters treated. Measurement Techniques and Metrology (Nrs 1-33); Exposure to Natural Radiation in Non-Domestic Environments (34-56); Natural Radionuclides and Transfer Pathways (57-107); Radioactivity and Radiation in the Human Environment (108-183); Health Effects of Natural Radiation (184-205); Industrially Modified Levels of Radiation Exposure (206-219). (Quittner)
ORF Alignment: EHA1 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available Entamoeba histolytica HM-1:IMSS] ... Length = 219 ... Query: 344 EPAQADPENTYADGEGVEKCDAGKGPVKFTIHCVNKVGTSVPVTGAKFKVIIRSN...DGNEI 403 ... EPAQADPENTYADGEGVEKCDAGKGPVKFTIHCVNKVGTSVPVTGAKFKVIIRSNDGNEI Sbjct: 1 ... ... EPAQADPENTYADGEGVEKCDAGKGPVKFTIHCVNKVGTSVPVTGAKFKVIIRSNDGNEI 60 ... Query: 464 GVEG
ORF Alignment: EHA1 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available tamoeba histolytica HM-1:IMSS] ... Length = 219 ... Query: 344 EPAQADPENTYADGEGVEKCDAGKGPVKFTIHCVNKVGTAVPVTGAKFKVIIRSN...DGNEI 403 ... EPAQADPENTYADGEGVEKCDAGKGPVKFTIHCVNKVGTAVPVTGAKFKVIIRSNDGNEI Sbjct: 1 ... E...PAQADPENTYADGEGVEKCDAGKGPVKFTIHCVNKVGTAVPVTGAKFKVIIRSNDGNEI 60 ... Query: 464 GVEGGV
Widmann, Gerlig; Schullian, Peter; Gassner, Eva-Maria; Hoermann, Romed; Bale, Reto; Puelacher, Wolfgang
2015-03-01
OBJECTIVE. The purpose of this article is to evaluate 2D and 3D image quality of high-resolution ultralow-dose CT images of the craniofacial bone for navigated surgery using adaptive statistical iterative reconstruction (ASIR) and model-based iterative reconstruction (MBIR) in comparison with standard filtered backprojection (FBP). MATERIALS AND METHODS. A formalin-fixed human cadaver head was scanned using a clinical reference protocol at a CT dose index volume of 30.48 mGy and a series of five ultralow-dose protocols at 3.48, 2.19, 0.82, 0.44, and 0.22 mGy using FBP and ASIR at 50% (ASIR-50), ASIR at 100% (ASIR-100), and MBIR. Blinded 2D axial and 3D volume-rendered images were compared with each other by three readers using top-down scoring. Scores were analyzed per protocol or dose and reconstruction. All images were compared with the FBP reference at 30.48 mGy. A nonparametric Mann-Whitney U test was used. Statistical significance was set at p ASIR-100 at 3.48 mGy, ASIR-100 at 2.19 mGy, and MBIR at 0.82 mGy. MBIR at 2.19 and 3.48 mGy scored statistically significantly better than the FBP reference (p = 0.032 and 0.001, respectively). For 3D images, the FBP reference at 30.48 mGy did not statistically significantly differ from all reconstructions at 3.48 mGy; FBP and ASIR-100 at 2.19 mGy; FBP, ASIR-100, and MBIR at 0.82 mGy; MBIR at 0.44 mGy; and MBIR at 0.22 mGy. CONCLUSION. MBIR (2D and 3D) and ASIR-100 (2D) may significantly improve subjective image quality of ultralow-dose images and may allow more than 90% dose reductions.
Fracture risk by HIV infection status in perinatally HIV-exposed children.
Siberry, George K; Li, Hong; Jacobson, Denise
2012-03-01
The objective of this study was to examine the incidence of fractures in HIV-infected children and comparable HIV-exposed, uninfected (HEU) children in a multicenter, prospective cohort study (PACTG 219/219C) in the United States. The main outcome was first fracture during the risk period. Nine fractures occurred in 7 of 1326 HIV-infected and 2 of 649 HEU children, corresponding to incidence rates of 1.2 per 1000 person-years and 1.1 per 1000 person-years, respectively. The incidence rate ratio was 1.1 (95% CI 0.2, 5.5). There was no evidence of a substantially increased risk of fracture in HIV-infected compared to HEU children.
Kvartérní geologická stavba historického jádra města Brna: aplikace poznatků ze stavby kolektorů
Czech Academy of Sciences Publication Activity Database
Lisá, Lenka; Zapletalová, D.; Pecka, M.; Zůbek, A.; Mroczek, P.
2006-01-01
Roč. 91, - (2006), s. 219-226 ISSN 1211-8796 Institutional research plan: CEZ:AV0Z30130516 Keywords : collector channels * sedimentology * micromorphology * Quaternary Subject RIV: DB - Geology ; Mineralogy
Energy Technology Data Exchange (ETDEWEB)
Nestor, Marika, E-mail: marika.nestor@bms.uu.s [Unit of Otolaryngology and Head and Neck Surgery, Department of Surgical Sciences, Uppsala University, S-751 85 Uppsala (Sweden); Unit of Biomedical Radiation Sciences, Department of Oncology, Radiology and Clinical Immunology, Uppsala University, S-751 85 Uppsala (Sweden); Sundstroem, Magnus [Unit of Molecular Pathology, Department of Genetics and Pathology, Uppsala University (Sweden); Anniko, Matti [Unit of Otolaryngology and Head and Neck Surgery, Department of Surgical Sciences, Uppsala University, S-751 85 Uppsala (Sweden); Tolmachev, Vladimir [Unit of Biomedical Radiation Sciences, Department of Oncology, Radiology and Clinical Immunology, Uppsala University, S-751 85 Uppsala (Sweden)
2011-01-15
Aim: The monoclonal antibody cetuximab, targeting the epidermal growth factor receptor (EGFR), is a promising molecular targeting agent to be used in combination with radiation for anticancer therapy. In this study, effects of cetuximab in combination with alpha-emitting radioimmunotherapy (RIT) in a panel of cultured human squamous cell carcinomas (SCCs) were assessed. Methods: SCC cell lines were characterized and treated with cetuximab in combination with anti-CD44v6 RIT using the astatinated chimeric monoclonal antibody U36 ({sup 211}At-cMAb U36). Effects on {sup 211}At-cMAb U36 uptake, internalization and cell proliferation were then assessed in SCC cells. Results: Cetuximab in combination with {sup 211}At-cMAb U36 mediated increased growth inhibition compared to RIT or cetuximab alone in two cell lines. However, cetuximab also mediated radioprotective effects compared to RIT alone in two cell lines. The radioprotective effects occurred in the cell lines in which cetuximab clearly inhibited cell growth during radiation exposure. Cetuximab treatment also influenced {sup 211}At-cMAb-U36 uptake and internalization, suggesting interactions between CD44v6 and EGFR. Conclusions: Results from this study demonstrate the vast importance of further clarifying the mechanisms of cetuximab and radiation response, and the relationship between EGFR and suitable RIT targets. This is important not only in order to avoid potential radioprotective effects, but also in order to find and utilize potential synergistic effects from these combinations.
International Nuclear Information System (INIS)
Adelstein, S.J.; Zalutsky, M.; Bloomer, W.
1981-01-01
This project is concerned with developing the potential of alpha-emitting radionuclides as agents for radiotherapy. Alpha-emitters seem ideally suited for his application because their high linear energy transfer and short range permit the deposition of considerable energy in a very small volume of tissue. Unlike the beta particles of 131 I which have a range of about 1 to 2 mm in tissue, 5 to 7 MeV alpha particles would traverse only a few cell diameters. Among the available alpha-emitters, 211 At appears most promising for therapeutic applications because, (1) it has some chemical similarities to iodine, an element that can readily be incorporated into numerous proteins and peptides, (2) it has a half-life that is long enough to permit chemical manipulation yet short enough to minimize destruction of healthy cells due to degradation of the label over time, (3) it can be produced conveniently using a cyclotron, and (4) alpha emission is associated with 100% of its decays with no accompanying beta emission. In the past year the evaluation of an astatine-tellurium colloid as an agent for the destruction of malignant ascites has been completed. The therapeutic efficacy of 211 At-tellurium colloid has been compared with that of several beta-emitting radiocolloids. Studies on the application of monoclonal antibodies as carriers for selective delineation and destruction of malignant cell populations have also been initiated
Energy Technology Data Exchange (ETDEWEB)
Adelstein, S.J.; Zalutsky, M.; Bloomer, W.
1981-01-01
This project is concerned with developing the potential of alpha-emitting radionuclides as agents for radiotherapy. Alpha-emitters seem ideally suited for his application because their high linear energy transfer and short range permit the deposition of considerable energy in a very small volume of tissue. Unlike the beta particles of /sup 131/I which have a range of about 1 to 2 mm in tissue, 5 to 7 MeV alpha particles would traverse only a few cell diameters. Among the available alpha-emitters, /sup 211/At appears most promising for therapeutic applications because, (1) it has some chemical similarities to iodine, an element that can readily be incorporated into numerous proteins and peptides, (2) it has a half-life that is long enough to permit chemical manipulation yet short enough to minimize destruction of healthy cells due to degradation of the label over time, (3) it can be produced conveniently using a cyclotron, and (4) alpha emission is associated with 100% of its decays with no accompanying beta emission. In the past year the evaluation of an astatine-tellurium colloid as an agent for the destruction of malignant ascites has been completed. The therapeutic efficacy of /sup 211/At-tellurium colloid has been compared with that of several beta-emitting radiocolloids. Studies on the application of monoclonal antibodies as carriers for selective delineation and destruction of malignant cell populations have also been initiated.
International Nuclear Information System (INIS)
Nestor, Marika; Sundstroem, Magnus; Anniko, Matti; Tolmachev, Vladimir
2011-01-01
Aim: The monoclonal antibody cetuximab, targeting the epidermal growth factor receptor (EGFR), is a promising molecular targeting agent to be used in combination with radiation for anticancer therapy. In this study, effects of cetuximab in combination with alpha-emitting radioimmunotherapy (RIT) in a panel of cultured human squamous cell carcinomas (SCCs) were assessed. Methods: SCC cell lines were characterized and treated with cetuximab in combination with anti-CD44v6 RIT using the astatinated chimeric monoclonal antibody U36 ( 211 At-cMAb U36). Effects on 211 At-cMAb U36 uptake, internalization and cell proliferation were then assessed in SCC cells. Results: Cetuximab in combination with 211 At-cMAb U36 mediated increased growth inhibition compared to RIT or cetuximab alone in two cell lines. However, cetuximab also mediated radioprotective effects compared to RIT alone in two cell lines. The radioprotective effects occurred in the cell lines in which cetuximab clearly inhibited cell growth during radiation exposure. Cetuximab treatment also influenced 211 At-cMAb-U36 uptake and internalization, suggesting interactions between CD44v6 and EGFR. Conclusions: Results from this study demonstrate the vast importance of further clarifying the mechanisms of cetuximab and radiation response, and the relationship between EGFR and suitable RIT targets. This is important not only in order to avoid potential radioprotective effects, but also in order to find and utilize potential synergistic effects from these combinations.
Proceedings of transuranium elements
International Nuclear Information System (INIS)
Anon.
1992-01-01
The identification of the first synthetic elements was established by chemical evidence. Conclusive proof of the synthesis of the first artificial element, technetium, was published in 1937 by Perrier and Segre. An essential aspect of their achievement was the prediction of the chemical properties of element 43, which had been missing from the periodic table and which was expected to have properties similar to those of manganese and rhenium. The discovery of other artificial elements, astatine and francium, was facilitated in 1939-1940 by the prediction of their chemical properties. A little more than 50 years ago, in the spring of 1940, Edwin McMillan and Philip Abelson synthesized element 93, neptunium, and confirmed its uniqueness by chemical means. On August 30, 1940, Glenn Seaborg, Arthur Wahl, and the late Joseph Kennedy began their neutron irradiations of uranium nitrate hexahydrate. A few months later they synthesized element 94, later named plutonium, by observing the alpha particles emitted from uranium oxide targets that had been bombarded with deuterons. Shortly thereafter they proved that is was the second transuranium element by establishing its unique oxidation-reduction behavior. The symposium honored the scientists and engineers whose vision and dedication led to the discovery of the transuranium elements and to the understanding of the influence of 5f electrons on their electronic structure and bonding. This volume represents a record of papers presented at the symposium
Setkání bulharistů - Třetí mezinárodní kongres bulharistiky
Czech Academy of Sciences Publication Activity Database
Havlíková, Lubomíra
2014-01-01
Roč. 100, č. 1 (2014), s. 219-221 ISSN 0037-6922 Institutional support: RVO:68378017 Keywords : Bulgarian studies * International Congresses * history * philology * Cyrillo-Methodian studies Subject RIV: AB - History
Zwischenberichterstattung nach Börsenrecht, DRS, IAS und US-GAAP
Alvarez von Zerboni di Sposetti, Manuel
2003-01-01
Zwischenberichterstattung nach Börsenrecht, DRS, IAS und US-GAAP / von Manuel Alvarez und Stefan Wotschofsky. - 2., neubearb. und erw. Aufl. - Berlin : Erich Schmidt, 2003. - XX, 219 S. [1. Aufl. 2000
48 CFR 52.219-12 - Special 8(a) Subcontract Conditions.
2010-10-01
... all of the requirements of Contract No. __ [insert number of contract] for the consideration stated... (CONTINUED) CLAUSES AND FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 52... into Contract No. __ [insert number of contract] with the __ [insert name of contracting agency] to...
People and things. CERN Courier, November 1981, v. 21(9)
International Nuclear Information System (INIS)
Anon.
1981-01-01
The article reports on achievements of various people, staff changes and position opportunities within the CERN organization and contains news updates on upcoming or past events. At the end of August a circulating electron beam was achieved for the first time in the VUV (vacuum ultraviolet) ring of the US National Synchrotron Light Source at Brookhaven. Commissioning of the X-ray ring of the NSLS is imminent. From 11-14 January, an International Colloquium on Baryon Nonconservation (ICOBAN) will be held at the Tata Institute of Fundamental Research, Bombay.From 17-23 February an International Conference on Instrumentation for Colliding Beam Physics will be held at the Stanford Linear Accelerator Center. A Europhysics Conference on 'Computing in Accelerator Design and Operation' will be held in Warsaw from 21-24 September 1982. A team at Los Alamos, led by Charles Brau, has demonstrated the principle of a high efficiency free electron laser. Work has started on a prototype magnet to confirm the design of a 2 GeV electron microtron under study at Argonne for use in nuclear and particle physics research. On 2 October a new ion source and injector system, known as ABEL, was inaugurated at Berkeley. The X-ray synchrotron radiation produced by electron storage rings could provide improved diagnosis in conditions such as coronary artery disease. Fermilab is proposing to set up an on-site Latin America Center for Fundamental Physics and Technology to assist scientists and engineers from developing countries
48 CFR 552.219-74 - Section 8(a) Direct Award.
2010-10-01
... contracting activity shall give advance notice to SBA before it issues a final notice terminating performance... prior to processing any advance payments or novation agreements. The contracting activity may assign contract administration functions to a contract administration office. (c) The Contractor agrees: (1) To...
75 FR 219 - Availability of Funds and Collection of Checks
2010-01-05
...;Prices of new books are listed in the first FEDERAL REGISTER issue of each #0;week. #0; #0; #0; #0;#0.... FOR FURTHER INFORMATION CONTACT: Jeffrey S. H. Yeganeh, Financial Services Manager (202/728-5801), or...
Fission in Empire-II version 2.19 beta1, Lodi
International Nuclear Information System (INIS)
Sin, M.
2003-01-01
This is a description of the fission model implemented presently in EMPIRE-II. This package offers two ways to calculate the fission probability selected by parameters in the optional input. Fission barriers, fission transmission coefficients, fission cross sections and fission files are calculated
Evaluation report on SCTF Core-II test S2-19
International Nuclear Information System (INIS)
Ohnuki, Akira; Iwamura, Takamichi; Iguchi, Tadashi; Abe, Yutaka; Murao, Yoshio; Adachi, Hiromichi.
1991-03-01
Experimental studies using Slab Core Test Facility (SCTF) have revealed that the heat transfer enhancement in higher power bundles is mainly governed by the radial power ratio in core during the reflood in PWR-LOCA. As a physical mechanism for the heat transfer enhancement, it can be considered from the experimental evidence that the increase of upward steam flow rate in a higher power bundle which is caused by the higher steam production rate in the bundle gives the higher upward liquid flow rate in the bundle and the increase of the liquid flow rate gives the heat transfer enhancement. In order to develop a mechanistic model for the heat transfer enhancement based on this idea, the following relations should be identified quantitatively: (1) Relation between the steam production rate and the upward liquid flow rate, (2) Cross flow rate above the quench front and (3) Relation between the degree of heat transfer enhancement due to radial power ratio and the amount of increase of upward liquid flow rate. In this report, the above relation (3) was investigated experimentally as a step to develop the mechanistic model using the SCTF where the relation between the radial power ratio and the heat transfer enhancement has been made clear quantitatively. The degree of increase of heat transfer between two forced feed tests with the different flow rate in LPCI period was compared with the degree of heat transfer enhancement under a radial power ratio in the previous SCTF tests. The two forced feed tests were performed under the condition without any significant two-dimensional hydraulic behavior in core. The ratio of the mass flow rate between the two tests was about double. (author)
32 CFR 219.101 - To what does this policy apply?
2010-07-01
..., such as (i) research on regular and special education instructional strategies, or (ii) research on the effectiveness of or the comparison among instructional techniques, curricula, or classroom management methods... as provided in paragraph (b) of this section, this policy applies to all research involving human...
14 CFR 125.219 - Oxygen for medical use by passengers.
2010-01-01
... in conformity with the manufacturing, packaging, marking, labeling, and maintenance requirements of... CAPACITY OF 6,000 POUNDS OR MORE; AND RULES GOVERNING PERSONS ON BOARD SUCH AIRCRAFT Instrument and..., maintained under the certificate holder's approved maintenance program; (iii) Free of flammable contaminants...
Cationization of heparin for film applications
Czech Academy of Sciences Publication Activity Database
Šimkovic, I.; Mendichi, R.; Kelnar, Ivan; Filip, J.; Hricovíni, M.
2015-01-01
Roč. 115, 22 January (2015), s. 551-558 ISSN 0144-8617 Institutional support: RVO:61389013 Keywords : heparin * cationization * NMR Subject RIV: CD - Macromolecular Chemistry Impact factor: 4.219, year: 2015
African Journals Online (AJOL)
Timothy Ademakinwa
Keywords: Incubator, Biogas, Chicken egg, Temperature, Relative humidity, Hatchability. ABSTRACT. 219 ... hatching results are obtained with normal atmospheric air, which usually ... mixture of animal manures (cow dung, poultry and swine ...
48 CFR 1652.000 - Applicable clauses.
2010-10-01
.... 52.222-4Contract Work Hours and Safety Standards Act—Overtime Compensation—General. 52.222... Postretirement Benefits Other Than Pensions (PRB). 52.219-8Utilization of Small, Small Disadvantaged and Women...
Varianty Gellnerovy komedie Přístav manželství jako rozcestník jeho tvorby
Czech Academy of Sciences Publication Activity Database
Peisertová, Lucie
2012-01-01
Roč. 44, č. 2012 (2012), s. 201-219 ISSN 0231-5904 Institutional support: RVO:68378068 Keywords : Czech drama * Gellner, František * textual criticism Subject RIV: AJ - Letters, Mass-media, Audiovision
Arbuscular mycorrhizal fungi associating with roots of Alnus and Rubus in Europe and the Middle East
Czech Academy of Sciences Publication Activity Database
Pölme, S.; Öpik, M.; Moora, M.; Zobel, M.; Kohout, Petr; Oja, J.; Köljalg, U.; Tedersoo, L.
2016-01-01
Roč. 24, Part A (2016), s. 27-34 ISSN 1754-5048 Institutional support: RVO:67985939 Keywords : arbuscular mycorrhiza * fungi * biogeography Subject RIV: EH - Ecology, Behaviour Impact factor: 3.219, year: 2016
Clinical effect of Fuzheng quyu therapy in patients undergoing ...
African Journals Online (AJOL)
Tropical Journal of Pharmaceutical Research January 2017; 16 (1): 219-224 ... cervical carcinoma surgery, thus suggesting its potential clinical applications. ..... surgery. However, further clinical investigations before it can be recommended for ...
Antická dramata Jaroslava Vrchlického a jejich dobová recepce
Czech Academy of Sciences Publication Activity Database
Čadková, Daniela
2013-01-01
Roč. 136, 1-2 (2013), s. 189-219 ISSN 0024-4457 Institutional support: RVO:67985955 Keywords : J. Vrchlický * drama * National Theatre * classical tradition Subject RIV: AJ - Letters, Mass-media, Audiovision
Investigating the roles of MicroRNAs in biotic stress response induced by Rhizoctonia solani in rice
Energy Technology Data Exchange (ETDEWEB)
Syuhada, O. Nurfarahana; Kalaivani, N. [School of Environmental and Natural Resource Sciences, Faculty of Science and Technology, Universiti Kebangsaan Malaysia, 43600 Bangi, Selangor (Malaysia)
2014-09-03
Sheath blight disease, caused by Rhizoctonia solani 1802/KB was screened on two rice varieties, Oryza sativaindica cultivar MR219 and Oryza sativa indica cultivar UKMRC9. The disease symptom was severe in MR219 compared to UKMRC9. Total RNA from R. solani 1802/KB, infected rice leaves of MR219 and infected rice leaves of UKMRC9 were extracted using TRIzol reagent, purified and sent for small RNA sequencing. Three miRNA libraries were generated and analyzed. The libraries generated 65 805, 78 512 and 81 325 known miRNAs respectively. The structure of miRNA of these samples was predicted. The up-regulated and down-regulated of miRNAs target gene prediction and its target functions were discovered and were mainly related to the growth and development of metabolism, protein transport, transcriptional regulation, stress response, and hormone signaling and electron transfer. Sheath blight-induced differential expression of known miRNAs tends to targetMYB transcription factor, F-box proteins, NBS-LRR, leucine-rich repeat receptor protein kinases and zinc finger proteins. Detecting new miRNAs and measuring the expression profiles of known miRNAs is an important tasks required for a better understanding of various biological conditions. Therefore, further analysis using Gene Ontology Slim will be conducted to deduce some biological information from the datasets obtained.
Varietal improvement of irrigated rice under minimal water conditions
International Nuclear Information System (INIS)
Abdul Rahim Harun; Marziah Mahmood; Sobri Hussein
2010-01-01
Varietal improvement of irrigated rice under minimal water condition is a research project under Program Research of Sustainable Production of High Yielding Irrigated Rice under Minimal Water Input (IRPA- 01-01-03-0000/ PR0068/ 0504). Several agencies were involved in this project such as Malaysian Nuclear Agency (MNA), Malaysian Agricultural Research and Development Institute (MARDI), Universiti Putra Malaysia (UPM) and Ministry of Agriculture (MOA). The project started in early 2004 with approved IRPA fund of RM 275,000.00 for 3 years. The main objective of the project is to generate superior genotypes for minimal water requirement through induced mutation techniques. A cultivated rice Oryza sativa cv MR219 treated with gamma radiation at 300 and 400 Gray were used in the experiment. Two hundred gm M2 seeds from each dose were screened under minimal water stress in greenhouse at Mardi Seberang Perai. Five hundred panicles with good filled grains were selected for paddy field screening with simulate precise water stress regime. Thirty eight potential lines with required adaptive traits were selected in M3. After several series of selection, 12 promising mutant line were observed tolerance to minimal water stress where two promising mutant lines designated as MR219-4 and MR219-9 were selected for further testing under several stress environments. (author)
On Development of Medical Informatics Education via European Cooperation
Czech Academy of Sciences Publication Activity Database
Zvárová, Jana
1998-01-01
Roč. 50, - (1998), s. 219-223 ISSN 1386-5056 Keywords : information technologies * education * training * medical informatics * medical statistics * epidemiology Subject RIV: BB - Applied Statistics, Operational Research Impact factor: 0.357, year: 1998
2010-03-19
... approved in 1988, there have been changes in economic, social, and ecological conditions, new policies and... effect. The 2000 Planning Rule's transition provisions (36 CFR 219.35) --amended in 2002 and 2003, and...
77 FR 73516 - Federal Acquisition Regulation; Iran Threat Reduction
2012-12-10
... information provided. FOR FURTHER INFORMATION CONTACT: Ms. Cecelia L. Davis, Procurement Analyst, at 202-219... sector of Iran and impose sanctions with respect to transport of crude oil from Iran and evasion of...
Cholesterol and fat lowering with hydrophobic polysaccharide derivatives
Czech Academy of Sciences Publication Activity Database
Čopíková, J.; Taubner, T.; Tůma, J.; Synytsya, A.; Dušková, Dagmar; Marounek, Milan
2015-01-01
Roč. 116, č. 1 (2015), s. 207-214 ISSN 0144-8617 Institutional support: RVO:67985904 Keywords : hydrophobically modified polysaccharides * structure * thermal analysis Subject RIV: CE - Biochemistry Impact factor: 4.219, year: 2015
Plant species richness-productivity relationships in a low-productive boreal region
Czech Academy of Sciences Publication Activity Database
Axmanová, I.; Chytrý, M.; Danihelka, Jiří; Lustyk, P.; Kočí, M.; Kubešová, S.; Horsák, M.; Cherosov, M. M.; Gogoleva, P. A.
2013-01-01
Roč. 214, č. 2 (2013), s. 207-219 ISSN 1385-0237 Institutional support: RVO:67985939 Keywords : competitive excluison * forest herb layer * grassland Subject RIV: EF - Botanics Impact factor: 1.640, year: 2013
A complete degradation of organophosphates by microwave-assisted hydrolysis
Czech Academy of Sciences Publication Activity Database
Jansa, Petr; Čechová, Lucie; Janeba, Zlatko
2016-01-01
Roč. 3, č. 3 (2016), s. 219-226 ISSN 2213-3356 R&D Projects: GA MV VG20102015046 Institutional support: RVO:61388963 Keywords : organophosphates * microwave irradiation * hydrolysis Subject RIV: CC - Organic Chemistry
National Research Council Canada - National Science Library
Provan, Drew; Gribben, John
2010-01-01
... The molecular basis of hemophilia, 219 Paul LF Giangrande 4 The genetics of acute myeloid leukemias, 42 Carolyn J Owen & Jude Fitzgibbon 19 The molecular basis of von Willebrand disease, 233 Luciano Baronc...
Rijal, Ramesh; Arhzaouy, Khalid; Strucksberg, Karl-Heinz; Cross, Megan; Hofmann, Andreas; Schröder, Rolf; Clemen, Christoph S; Eichinger, Ludwig
2016-01-01
p97 (VCP) is a homo-hexameric triple-A ATPase that exerts a plethora of cellular processes. Heterozygous missense mutations of p97 cause at least five human neurodegenerative disorders. However, the specific molecular consequences of p97 mutations are hitherto widely unknown. Our in silico structural models of human and Dictyostelium p97 showed that the disease-causing human R93C, R155H, and R155C as well as Dictyostelium R154C, E219K, R154C/E219K p97 mutations constitute variations in surface-exposed locations. In-gel ATPase activity measurements of p97 monomers and hexamers revealed significant mutation- and species-specific differences. While all human p97 mutations led to an increase in ATPase activity, no changes could be detected for the Dictyostelium R154C mutant, which is orthologous to human R155C. The E219K mutation led to an almost complete loss of activity, which was partially recuperated in the R154C/E219K double-mutant indicating p97 inter-domain communication. By means of co-immunoprecipitation experiments we identified an UBX-domain containing Dictyostelium protein as a novel p97 interaction partner. We categorized all UBX-domain containing Dictyostelium proteins and named the interaction partner UBXD9. Pull-down assays and surface plasmon resonance analyses of Dictyostelium UBXD9 or the human orthologue TUG/ASPL/UBXD9 demonstrated direct interactions with p97 as well as species-, mutation- and ATP-dependent differences in the binding affinities. Sucrose density gradient assays revealed that both human and Dictyostelium UBXD9 proteins very efficiently disassembled wild-type, but to a lesser extent mutant p97 hexamers into monomers. Our results are consistent with a scenario in which p97 point mutations lead to differences in enzymatic activities and molecular interactions, which in the long-term result in a late-onset and progressive multisystem disease. Copyright © 2016 The Authors. Published by Elsevier GmbH.. All rights reserved.
Knowledge, attitude and practice of emergency contraceptives ...
African Journals Online (AJOL)
admin
contraceptives among female college students in Arba Minch ... those who mentioned pills as an emergency contraceptive method, 26.4% correctly ... The summary index for knowledge disclosed that 21.9% had good knowledge about EC.
Czech Academy of Sciences Publication Activity Database
Němcová, A.; Galal, O.; Skeldon, P.; Kuběna, Ivo; Šmíd, Miroslav; Briand, E.; Vickridge, I.; Ganem, J.-J.; Habazaki, H.
2016-01-01
Roč. 219, NOV (2016), s. 28-37 ISSN 0013-4686 Institutional support: RVO:68081723 Keywords : magnesium * anodic film * enrichment Subject RIV: JK - Corrosion ; Surface Treatment of Materials Impact factor: 4.798, year: 2016
National Oceanic and Atmospheric Administration, Department of Commerce — The Current, Temperature and Depth (CTD) data were collected by Naval Postgraduate School from Coastal Waters of California between 2-19 June, 1980 using ship...
Czech Academy of Sciences Publication Activity Database
Schifferová, Věra
18/42/, - (2004), s. 219-223 ISSN 0231-5955 Institutional research plan: CEZ:AV0Z9009908 Keywords : The interpretation of Comenius * the pupils of Edmund Husserl * rationalism and mysticism Subject RIV: AA - Philosophy ; Religion
African Journals Online (AJOL)
Lincoln User
Peer-reviewed paper: 10th World Conference on Animal Production. 219. Improving the quality of wool through the use of gene markers. T.O. Itenge. 1# .... International Wool Textile Organisation (IWTO) standards. Measurements included ...
Czech Academy of Sciences Publication Activity Database
Pečnerová, P.; Martínková, Natália
2012-01-01
Roč. 41, č. 3 (2012), s. 211-219 ISSN 0300-3256 Institutional research plan: CEZ:AV0Z60930519 Keywords : phylogeny * Sciurus * biogeography * colonisation Subject RIV: EG - Zoology Impact factor: 2.793, year: 2012
Czech Academy of Sciences Publication Activity Database
Solecka, J.; Rajnisz, A.; Postek, M.; Zajko, J.; Kawecki, R.; Havlíček, Vladimír; Bednarek, E.; Kozerski, L.
2012-01-01
Roč. 65, č. 4 (2012), s. 219-221 ISSN 0021-8820 Institutional support: RVO:61388971 Keywords : antimicrobial activity * DD-peptidase inhibitor * JS-2 Subject RIV: EE - Microbiology, Virology Impact factor: 2.191, year: 2012
Alternative models of entrance exams and access to higher education: the case of the Czech Republic
Czech Academy of Sciences Publication Activity Database
Konečný, Tomáš; Basl, J.; Mysliveček, Jan; Simonová, N.
2012-01-01
Roč. 63, č. 2 (2012), s. 219-235 ISSN 0018-1560 Institutional support: PRVOUK-P23 Keywords : higher education * admission exams * educational equity Subject RIV: AO - Sociology, Demography Impact factor: 0.937, year: 2012
75 FR 18076 - Changes in Flood Elevation Determinations
2010-04-09
...; Chairman, Coconino (08-09-1418P). Arizona Daily Sun. County Board of Supervisors, 219 East Cherry Avenue... February 13, 2009; The Honorable Paul Biane, June 19, 2009 060270 No: B-1044). of San Bernardino February...
South African Journal for Research in Sport, Physical Education and ...
African Journals Online (AJOL)
Perspective of coaches on LTAD of elite judo athletes: A comparative analysis · EMAIL FULL TEXT EMAIL FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Petrus L. Nolte, Cora Burnett, Wim Hollander, 219-228 ...
49 CFR 212.223 - Operating practices compliance inspector.
2010-10-01
...) Control of Alcohol and Drug Use (49 CFR part 219); (3) Rear End Marking Device Regulations (49 CFR part... regulations listed in paragraph (a) of this section, including the remedial action required to bring defective...
ORF Alignment: NC_003076 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available DNA-binding protein ... 19) ... Length = 153 ... Query: 160 GCVKGARGASGLCISH...GGGQRCQKPGCNKGAESKTTFCKTHGGGKRCEHLGCTKSAEGKT 219 ... GC KGAR ASG CISHGGG+RCQKP C KGAE KT +CK H...GGG+RCE+LGCTK AEG T Sbjct: 2 ... GCQKGARDASGRCISHGGGRRCQKPDCQKGAEGKTVYCKAHGGGRRCEYLGCTKGAEGST 61 ... Query: 280 K
ORF Alignment: NC_005027 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_005027 gi|32475765 >1zrn0 11 219 5 254 2e-04 ... ref|NP_868759.1| N-acetylglucosamine-6-phosha... ... N-acetylglucosamine-6-phoshatase or p-nitrophenyl ... phosphatase [Pirellula sp.] ... Len
Indian Academy of Sciences (India)
sriranga
Page 1. 219. RESONANCE │ March 2011. GENERAL │ ARTICLE. Email for Correspondence: ionguha@gmail.com. Science Smiles. Ayan Guha. Your Honor, I have proof that this accused linkage traced that 'bone' graffiti on the painting.
Two new species of the genus Xanthoxerampellia (Orchidaceae, Maxillariinae) from Antioquia, Colombia
Czech Academy of Sciences Publication Activity Database
Szlachetko, D. L.; Kolanowska, Marta
2017-01-01
Roč. 24, - (2017), s. 199-204 ISSN 1561-882X Institutional support: RVO:86652079 Keywords : biodiversity * Maxillariinae * Neotropics * orchids * taxonomy Subject RIV: EF - Botanics OBOR OECD: Plant sciences, botany Impact factor: 1.219, year: 2016
Slovanské kontexty Dvořákovy doby a Dvořákova díla
Czech Academy of Sciences Publication Activity Database
Tyllner, Lubomír
2014-01-01
Roč. 3, 1/2 (2014), s. 219-222 ISSN 1805-3866 Institutional support: RVO:68378076 Keywords : folkmusic * slavonic music * music ology * ethnomusicology * Antonín Dvořák Subject RIV: AC - Archeology, Anthropology, Ethnology
Czech Academy of Sciences Publication Activity Database
Jahn, Ullrich; Kafka, František; Pohl, Radek; Jones, P.G.
2009-01-01
Roč. 65, č. 52 (2009), s. 10917-10929 ISSN 0040-4020 Institutional research plan: CEZ:AV0Z40550506 Keywords : electron transfer * pyrrolidines * oxidation Subject RIV: CC - Organic Chemistry Impact factor: 3.219, year: 2009
... spine. Much less common causes in children include: Achondroplasia , a disorder of bone growth that causes the ... Carson BS, Rigamonti D, Ahn ES. Achondroplasia and other dwarfisms. ... PA: Elsevier Saunders; 2011:chap 219. Mistovich RJ, Spiegel ...
Optimal Mirrleesean taxation in a Ben-Porath economy
Czech Academy of Sciences Publication Activity Database
Kapička, Marek
2015-01-01
Roč. 7, č. 2 (2015), s. 219-248 ISSN 1945-7707 Institutional support: RVO:67985998 Keywords : optimal tax es * unobservable human capital * income tax es Subject RIV: AH - Economics Impact factor: 2.567, year: 2015
Formulation and Characterization of Glutaraldehyde Cross-Linked ...
African Journals Online (AJOL)
... drug/polymer ratio, volume of cross linking agent and volume of surfactant were ... The microspheres were characterized for entrapment efficiency, drug loading, ... size distribution (105 – 219 μm) and an entrapment efficiency of up to 73 %.
Czech Academy of Sciences Publication Activity Database
Bryja, Josef; Galan, M.; Charbonnel, N.; Cosson, J.-F.
2005-01-01
Roč. 5, č. 1 (2005), s. 173-176 ISSN 1471-8278 Institutional research plan: CEZ:AV0Z6093917 Keywords : water vole * population genetics Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.219, year: 2005
Czech Academy of Sciences Publication Activity Database
Kohout, Petr; Bahram, M.; Polme, S.; Tedersoo, L.
2017-01-01
Roč. 30, Dec 2017 (2017), s. 112-121 ISSN 1754-5048 Institutional support: RVO:67985939 Keywords : ericoid mycorrhiza * fungal diversity * host effect Subject RIV: EH - Ecology, Behaviour OBOR OECD: Ecology Impact factor: 3.219, year: 2016
Measurement of dose equivalent distribution on-board commercial jet aircraft
Czech Academy of Sciences Publication Activity Database
Kubančák, Ján; Ambrožová, Iva; Ploc, Ondřej; Pachnerová Brabcová, Kateřina; Štěpán, Václav; Uchihori, Y.
2014-01-01
Roč. 162, č. 3 (2014), s. 215-219 ISSN 0144-8420 Institutional support: RVO:61389005 Keywords : aircrew dosimetry * space weather * CERF Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 0.913, year: 2014
Septin 9 hypermethylation contributes to migration and resistance to ...
African Journals Online (AJOL)
radiotherapy and chemotherapy are widely used but its outcomes are ... Multiple studies have shown that septin 9 gene spanning a region of 219 kb in the genome and encoding different ... suggested a tumor-suppressor role [10]. Despite.
Groin Exploration for the Nonpalpable Testes: A Single Center ...
African Journals Online (AJOL)
Laparoscopy enables the evaluation of the position, size, and the structural ... presentation, side involved, type of investigation done, mode of management ... 9 (21.9%) required admission for between 1 and 4 days (median. 3 days) either ...
Full Text Available ... Administration 385,227 views 3:38 Coping With Depression - Duration: 4:50. Veterans Health Administration 7,915 ... Health Administration 1,219 views 1:16 Connected Care 2017 - Duration: 7:19. Veterans Health Administration 1, ...
Meče 11.-13. století z území Moravy
Czech Academy of Sciences Publication Activity Database
Žákovský, P.; Hošek, Jiří; Sedláčková, L.
2013-01-01
Roč. 38, č. 1 (2013), s. 219-270 ISSN 0231-5823 R&D Projects: GA ČR GAP405/12/2289 Institutional support: RVO:67985912 Keywords : sword * Middle Ages * Moravia Subject RIV: AC - Archeology, Anthropology, Ethnology
Full Text Available ... action today; no cure tomorrow - Duration: 3:10. World Health Organization 75,362 views 3:10 Wash ' ... handwash? With soap and water - Duration: 1:27. World Health Organization 219,427 views 1:27 Hand ...
77 FR 76936 - Defense Federal Acquisition Regulation Supplement; Technical Amendments
2012-12-31
...; List of Subjects in 48 CFR Parts 201, 203, 204, 215, 219, 245, and 252 Government procurement. Manuel... clause 52.203-13, Contractor Code of Business Ethics and Conduct, is the DoD Office of Inspector General...
Kester, Bernadette
1998-01-01
textabstractReview of: Cinema and the Great War. Andrew Kelly, Londen, New York (Routledge), 1997, 219 p.History by Hollywood. The use and abuse of the American past. Robert Brant Toplin, Chicago (Urbana), 1996, 267 p.
Hasselfield, Matthew; Moodley, Kavilan; Bond, J. Richard; Das, Sudeep; Devlin, Mark J.; Dunkley, Joanna; Dunner, Rolando; Fowler, Joseph W.; Gallardo, Patricio; Gralla, Megan B.;
2013-01-01
We describe the measurement of the beam profiles and window functions for the Atacama Cosmology Telescope (ACT), which operated from 2007 to 2010 with kilopixel bolometer arrays centered at 148, 218, and 277 GHz. Maps of Saturn are used to measure the beam shape in each array and for each season of observations. Radial profiles are transformed to Fourier space in a way that preserves the spatial correlations in the beam uncertainty to derive window functions relevant for angular power spectrum analysis. Several corrections are applied to the resulting beam transforms, including an empirical correction measured from the final cosmic microwave background (CMB) survey maps to account for the effects of mild pointing variation and alignment errors. Observations of Uranus made regularly throughout each observing season are used to measure the effects of atmospheric opacity and to monitor deviations in telescope focus over the season. Using the WMAP-based calibration of the ACT maps to the CMB blackbody, we obtain precise measurements of the brightness temperatures of the Uranus and Saturn disks at effective frequencies of 149 and 219 GHz. For Uranus we obtain thermodynamic brightness temperatures T(149/U) = 106.7 +/- 2.2 K and T(219/U) = 100.1 +/- 3.1 K. For Saturn, we model the effects of the ring opacity and emission using a simple model and obtain resulting (unobscured) disk temperatures of T(149/S) = 137.3 +/- 3.2 K and T(219/S) = 137.3 +/- 4.7 K.
Characterization of Pu-contaminated soils from Nuclear Site 201 at the Nevada Test Site
International Nuclear Information System (INIS)
Lee, S.Y.; Tamura, T.; Larsen, I.L.
1983-01-01
Distribution and characteristics of Pu-bearing radioactive particles throughout five soil profiles from Nuclear Site (NS) 201 were investigated. Concentrations of 239 240 Pu and 241 Am decreased with depth and most of the contamination was contained in the top 5 cm except in profile 4 where it extended to 10 cm. The mean activity ratio of 239 240 Pu to 241 Am and its standard error were 5.8 +- 0.3 (N=42). Most of the total radioactivity of the soils was contributed by 0.25 to 2 mm sand size fraction which comprised 20 to 50% by weight of the soils. The radioactive particles in the 0.25 to 2 mm size fraction occurred as spherical glass particles or as glass coatings on sand particles. The glass coatings had gas voids in the matrix but were not as porous as the radioactive particles from NS 219. After impact grinding the >0.25-mm size fractions for one hour, 85% of the initial activity in a NS 201 sample remained with the particles on the 0.25 mm sieve, whereas in the NS 219 sample only 10% remained. The results show that the radioactive particles from NS 201 were much more stable against the impact grinding force than those from NS 219. Therefore, the NS 201 soils would be expected to have a lower probability of producing respirable-size radioactive particles by saltation during wind erosion. 19 references, 3 figures, 3 tables
African Journals Online (AJOL)
Items 51 - 100 of 219 ... Vol 9, No 2 (2018), Domestic amnesty for international crimes and the ... of Nigeria's international obligations in curbing domestic violence, Abstract PDF ... Nigerian copyright laws in the age of social media, Abstract PDF.
Lifescience Database Archive (English)
Full Text Available l group: DG00147 ... Treatment of mild-to-moderate phenylketonuria (PKU) ... CAS: 69056-38-8 PubChem: 7848860 ChEBI: 32120 ChEMBL: CHEMBL1201775 LigandBox: D01798 NIKKAJI: J1.219.960K ...
What Are the Common Treatments for Menstrual Irregularities?
... NICHD Research Information Find a Study More Information Amenorrhea About NICHD Research Information Find a Study More ... Society for Reproductive Medicine. (2008). Current evaluation of amenorrhea. Fertility and Sterility, 90 , S219–S225. Apgar, B. S., ...
Relationship between patient satisfactions with diabetes care and ...
African Journals Online (AJOL)
2013-08-05
Aug 5, 2013 ... Bener, et al.: Patients satisfaction evaluation and management of diabetes care. 219 ... socioeconomic status (SES), females and the elderly.[5‑8] .... the subject was standing bare feet and with normal straight posture. Weight ...
Design and synthesis of bombykol analogues for probing pheromone-binding protein–ligand interactions
Czech Academy of Sciences Publication Activity Database
Mansurova, M.; Klusák, Vojtěch; Nešněrová, P.; Muck, A.; Doubský, J.; Svatoš, Aleš
2009-01-01
Roč. 65, č. 5 (2009), s. 1069-1076 ISSN 0040-4020 Institutional research plan: CEZ:AV0Z40550506 Keywords : bombykol * pheromone * binding protein * nanoLC Subject RIV: CC - Organic Chemistry Impact factor: 3.219, year: 2009
What can be efficiently reduced to the Kolmogorov-random strings?
Czech Academy of Sciences Publication Activity Database
Allender, E.; Buhrman, H.; Koucký, Michal
2006-01-01
Roč. 138, č. 1 (2006), s. 2-19 ISSN 0168-0072 Institutional research plan: CEZ:AV0Z10190503 Keywords : Kolmogorov complexity * Kolmogorov random strings * completeness Subject RIV: BA - General Mathematics Impact factor: 0.582, year: 2006
Volcanic activity in Late Variscan Krkonoše Piedmont Basin: petrological and geochemical constraints
Czech Academy of Sciences Publication Activity Database
Ulrych, Jaromír; Štěpánková, Jana; Novák, Jiří Karel; Pivec, Edvín; Prouza, V.
2002-01-01
Roč. 8, 3-4 (2002), s. 219-234 ISSN 1335-096X R&D Projects: GA AV ČR(CZ) IAA3013903 Keywords : Late Palaeozoic volcanism * Krkonoše Piedmont Basin * geochemistry Subject RIV: DB - Geology ; Mineralogy
Sol–gel preparation of selected lanthanide aluminium garnets
Czech Academy of Sciences Publication Activity Database
Dubnikova, N.; Garskaite, E.; Pinkas, J.; Bezdička, Petr; Beganskiene, A.; Kareiva, A.
2010-01-01
Roč. 55, č. 2 (2010), s. 213-219 ISSN 0928-0707 Institutional research plan: CEZ:AV0Z40320502 Keywords : lanthanide aluminium garnets * sol-gel processing Subject RIV: CA - Inorganic Chemistry Impact factor: 1.525, year: 2010
Czech Academy of Sciences Publication Activity Database
Caprara, G. V.; Barbaranelli, C.; Pastorelli, C.; Čermák, Ivo; Rozsa, S.
2001-01-01
Roč. 15, č. 3 (2001), s. 219-237 ISSN 0890-2070 Institutional research plan: CEZ:AV0Z7025918 Keywords : emotional predictors of aggression * Guilt * Negative Affectivity Subject RIV: AN - Psychology Impact factor: 1.081, year: 2001
Synthesis of Tungsten Diselenide Nanoparticles by Chemical Vapor Condensation Method
Directory of Open Access Journals (Sweden)
Oleg V. Tolochko
2015-09-01
Full Text Available Crystalline tungsten diselenide (WSe2 nanoparticles have been synthesized by a gas phase reaction using tungsten hexacarbonyl and elemental selenium as precursors. The WSe2 nanoparticle morphology varies from the spherical shape to flake-like layered structures. Mean size in smaller dimension are less than 5 nm and the number of layers decreased linearly with decreasing of reaction time and concentration of carbonyl in the gas phase. The mean value of interlayer distance in <0001> direction is comparable with the microscopic values. The selenium-to-tungsten atomic ratios of 2.07, 2.19 and 2.19 were determined respectively, approach to the stoichiometric ratio of 2:1. Main impurities are oxygen and carbon and strongly interrelated with carbonyl concentration in the gas phase.DOI: http://dx.doi.org/10.5755/j01.ms.21.3.7356
International Nuclear Information System (INIS)
Wahid, Ahmad Nazrul Abd; Rahim, Sahibin Abd; Rahim, Khairuddin Abdul; Harun, Abdul Rahim
2015-01-01
This study was carried out to evaluate the efficiency use of the nitrogen fertilizer on aerobic rice varieties MR219-4 and MR219-9 which were grown aerobically under field capacity water potential at the controlled environment area or shield house. Direct 15 N isotope tracer method was used in this study, whereby the 15 N isotope was utilized as a tracer for nitrogen nutrient uptake. 15 N isotope presence in the samples is determined by using emission spectrometer analysis and percentage of total nitrogen is determined by using Kjeldahl method. 15 N atom access value contained in the sample will be used in determining the effectiveness of the use of nitrogen in fertilizers through the specific calculation formulas. In this work, the data several data of nitrogen derived from fertilizer (Ndff), total nitrogen, nitrogen uptake and nitrogen use efficiency was obtained
Chinma, Chiemela Enyinnaya; Anuonye, Julian Chukwuemeka; Simon, Omotade Comfort; Ohiare, Raliat Ozavize; Danbaba, Nahemiah
2015-10-15
This study determined the effect of germination (48 h) on the physicochemical and antioxidant characteristics of rice flour from three rice varieties from Nigeria. Local rice varieties (Jamila, Jeep and Kwandala) were evaluated and compared to an improved variety (MR 219). Physicochemical and antioxidant properties of flours were determined using standard methods. Protein, magnesium, phosphorus, potassium and antioxidant properties of rice flours increased after germination while phytic acid and total starch contents decreased. Foaming capacity and stability of rice flours increased after germination. Germination resulted to changes in pasting and thermal characteristics of rice flours. Germinated rice flours had better physicochemical and antioxidant properties with reduced phytic acid and starch contents compared to MR 219, which can be utilized as functional ingredients in the preparation of rice-based products. Copyright © 2015 Elsevier Ltd. All rights reserved.
Study of the nickel-fullerene nano-structured thin films
Czech Academy of Sciences Publication Activity Database
Vacík, Jiří; Naramoto, H.; Narumi, K.; Yamamoto, S.; Abe, H.
2004-01-01
Roč. 219, č. 20 (2004), s. 862-866 ISSN 0168-583X Institutional research plan: CEZ:AV0Z1048901 Keywords : nickel * fullerene * magnesium oxide Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.997, year: 2004
Pöökpuud kuupaisel : [luuletused] / L{u00E1szl̤ Nagy ; tlk. Ly Seppel, Andres Ehin
Nagy, L{u00E1szl̤
2004-01-01
Sisu: Pöökpuud kuupaistel ; Härmaehtes maipidu ; Kes kannab siis teisele kaldale armastuse? ; Linna vapp ; Haljas ingel ; Bart̤k ja kiskjad ; Pulmad ; Ümbersünd hõbedasse ; Elagu puud. Eluloolisi andmeid autori kohta lk. 219-220
Lõugas, Anne, 1951-
1998-01-01
Eestiga seotud vanema kunsti kogu on kujunenud välja eri ajaetappidel ja eri allikatest. Käsitletakse 1939-1944 Eestist väljaviidud kunstiteoseid, kirjandust baltisakslaste ümberasumisest. Poznani Rahvusmuuseumis asuvate Eestiga seotud baltisaksa maalide nimekiri lk. 205-219
DEFF Research Database (Denmark)
Stensballe, L G; Trautner, S; Kofoed, P-E
2002-01-01
detection was defined as any test being positive. RESULTS: RSV antigen was detected in 84 (13%) children, the prevalence being 19% (41/219) among infants aged 230) in older children. Sensitivity of antigen detection was higher in NPA (92...
The banana (Musa acuminata) genome and the evolution of monocotyledonous plants
Czech Academy of Sciences Publication Activity Database
D´Hont, A.; Denoeud, F.; Aury, J. M.; Baurens, F. Ch.; Carreel, F.; Garsmeur, O.; Noel, B.; Bocs, S.; Droc, G.; Rouard, M.; Da Silva, C.; Jabbari, K.; Cardi, C.; Poulain, J.; Souquet, M.; Labadie, K.; Jourda, C.; Lengellé, J.; Rodier-Goud, M.; Alberti, A.; Bernard, M.; Correa, M.; Ayyampalayam, S.; Mckain, M. R.; Leebens-Mack, J.; Burgess, D.; Freeling, M.; Mbéguié-A-Mbéguié, D.; Chabannes, M.; Wicker, T.; Panaud, O.; Barbosa, J.; Hřibová, Eva; Heslop-Harrison, P.; Habas, R.; Rivallan, R.; Francois, P.; Poiron, C.; Kilian, A.; Burthia, D.; Jenny, Ch.; Bakry, F.; Brown, S.; Guignon, V.; Kema, G.; Dita, M.; Waalwijk, C.; Joseph, S.; Dievart, A.; Jaillon, O.; Leclercq, J.; Argout, X.; Lyons, E.; Almeida, A.; Jeridi, M.; Doležel, Jaroslav; Roux, N.; Risterucci, A. M.; Weissenbach, J.; Ruiz, M.; Glaszmann, J. Ch.; Quétier, F.; Yahiaoui, N.; Wincker, P.
2012-01-01
Roč. 488, č. 7410 (2012), s. 213-219 ISSN 0028-0836 Institutional research plan: CEZ:AV0Z50380511 Keywords : IN-SITU HYBRIDIZATION * SEQUENCE COUNT DATA * DNA-SEQUENCES Subject RIV: ED - Physiology Impact factor: 38.597, year: 2012
Full Text Available ... 362 views 3:10 Wash 'Em - Hand Hygiene Music Video - Duration: 5:46. Jefferson Health 412,404 ... 219,427 views 1:27 Hand hygiene FULL music video - Duration: 2:33. AlfredHealthTV 25,194 views ...
South African Journal of Philosophy - Vol 22, No 3 (2003)
African Journals Online (AJOL)
Eliminative materialism and the integrity of science · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Michael M. Pitman, 207-219. http://dx.doi.org/10.4314/sajpem.v22i3.31370 ...
Cytochemical study of carp neutrophil granulocytes after acute exposure to cadmium
Czech Academy of Sciences Publication Activity Database
Drastichová, J.; Švestková, E.; Lusková, Věra; Svobodová, Z.
2005-01-01
Roč. 21, č. 3 (2005), s. 215-219 ISSN 0175-8659 Institutional research plan: CEZ:AV0Z60930519 Keywords : peripheral-blood leukocytes * cadmium * common carp Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 0.563, year: 2005
Sociálně založené nerovnosti ve zdraví: současný vývoj ve světě a stav u nás
Czech Academy of Sciences Publication Activity Database
Šolcová, Iva; Kebza, V.
2002-01-01
Roč. 46, č. 3 (2002), s. 219-224 ISSN 0009-062X Institutional research plan: CEZ:AV0Z7025918 Keywords : inequalities in health * SES * self-reported health Subject RIV: AN - Psychology Impact factor: 0.190, year: 2002
Životní strategie šídlatek prověřená stovkami milionů let
Czech Academy of Sciences Publication Activity Database
Čtvrtlíková, Martina
2016-01-01
Roč. 64, č. 3 (2016), s. 110-112 ISSN 0044-4812 Grant - others:AV ČR(CZ) StrategieAV21/9 Program:StrategieAV Institutional support: RVO:60077344 Keywords : aquatic plant * Isoetes * stress tolerance Subject RIV: EF - Botanics
Cancer therapy with alpha-emitters labeled peptides.
Dadachova, Ekaterina
2010-05-01
Actively targeted alpha-particles offer specific tumor cell killing action with less collateral damage to surrounding normal tissues than beta-emitters. During the last decade, radiolabeled peptides that bind to different receptors on the tumors have been investigated as potential therapeutic agents both in the preclinical and clinical settings. Advantages of radiolabeled peptides over antibodies include relatively straightforward chemical synthesis, versatility, easier radiolabeling, rapid clearance from the circulation, faster penetration and more uniform distribution into tissues, and less immunogenicity. Rapid internalization of the radiolabeled peptides with equally rapid re-expression of the cell surface target is a highly desirable property that enhances the total delivery of these radionuclides into malignant sites. Peptides, such as octreotide, alpha-melanocyte-stimulating hormone analogues, arginine-glycine-aspartic acid-containing peptides, bombesin derivatives, and others may all be feasible for use with alpha-emitters. The on-going preclinical work has primarily concentrated on octreotide and octreotate analogues labeled with Bismuth-213 and Astatine-211. In addition, alpha-melanocyte-stimulating hormone analogue has been labeled with Lead-212/Bismuth-212 in vivo generator and demonstrated the encouraging therapeutic efficacy in treatment of experimental melanoma. Obstacles that continue to obstruct widespread acceptance of alpha-emitter-labeled peptides are primarily the supply of these radionuclides and concerns about potential kidney toxicity. New sources and methods for production of these medically valuable radionuclides and better understanding of mechanisms related to the peptide renal uptake and clearance should speed up the introduction of alpha-emitter-labeled peptides into the clinic. Copyright 2010 Elsevier Inc. All rights reserved.
International Nuclear Information System (INIS)
Demartis, S.; Tarli, L.; Neri, D.; Borsi, L.; Zardi, L.
2001-01-01
Angiogenesis is a characteristic feature of many aggressive tumours and other disorders. Antibodies capable of binding to new blood vessels, but not to mature vessels, could be used as selective targeting agents for immunoscintigraphic and radioimmunotherapeutic applications. Here we show that scFv(L19), a recombinant human antibody fragment with sub-nanomolar affinity for the ED-B domain of fibronectin, a marker of angiogenesis, can be stably labelled with iodine-125 and astatine-211 with full retention of immunoreactivity, using a trimethyl-stannyl benzoate bifunctional derivative. Biodistribution studies in mice bearing two different types of tumour grafted subcutaneously, followed by ex vivo micro-autoradiographic analysis, revealed that scFv(L19) rapidly localises around tumour blood vessels, but not around normal vessels. Four hours after intravenous injection of the stably radioiodinated scFv(L19), tumour to blood ratios were 6:1 in mice bearing the F9 murine teratocarcinoma and 9:1 in mice bearing an FE8 rat sarcoma. As expected, all other organs (including kidney) contained significantly less radioactivity than the tumour. Since the ED-B domain of fibronectin has an identical sequence in mouse and man, scFv(L19) is a pan-species antibody and the results presented here suggest clinical utility of radiolabelled scFv(L19) for the scintigraphic detection of angiogenesis in vivo. Furthermore, it should now be possible to investigate scFv(L19) for the selective delivery of 211 At to the tumour neovasculature, causing the selective death of tumour endothelial cells and tumour collapse. (orig.)
African Journals Online (AJOL)
raoul
. ;17(1): 5026-5027. This article on PubMed. 2. Sukkarieh Troy, Smaldone Marc, Shah Bharat. Multiples foreign bodies in the anterior and posterior urethra.Int Braz J Urol. 2004 May-. Jun;30(3):219-20. . This article on PubMed.
75 FR 27973 - Airworthiness Directives; Rolls-Royce plc RB211-524C2 Series Turbofan Engines
2010-05-19
... RB211-524C2 Series Turbofan Engines AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice... Rolls-Royce plc (RR) model RB211-524C2-19 and RB211-524C2-B-19 turbofan engines. These engines are...
Experiment list: SRX188790 [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available 8 cells or in CF tests against SV40, RSV or adenoviruses, mycoplasma contamination was detected and elimin...ated in 1972, (PMID: 6081590) 27983248,67.5,68.3,219 GSM1006655: U2OS.UV.SIRT3; Hom
Dny otevřených dveří se Sbírce vodních a mokřadních rostlin
Czech Academy of Sciences Publication Activity Database
Navrátilová, Jana
2017-01-01
Roč. 25, č. 5 (2017), s. 23-24 Grant - others:AV ČR(CZ) StrategieAV21/9 Program:StrategieAV Institutional support: RVO:67985939 Keywords : open day * collection * plants Subject RIV: EF - Botanics OBOR OECD: Plant sciences, botany
Economic analysis of Soybean Farming in Northern Nigeria | Ojiako ...
African Journals Online (AJOL)
t=2.39) and own farm-gate price (t=2.19) have positive and significant influence on ... training workshops and Field Days would help to update them on the appropriate use of new technologies and build up their knowledge and experience.
Lifescience Database Archive (English)
Full Text Available 2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Web...tschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and Da
Lifescience Database Archive (English)
Full Text Available .2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Web...ltschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and D
Lifescience Database Archive (English)
Full Text Available ndro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped BLAST and PSI-....2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Web
Lifescience Database Archive (English)
Full Text Available ndro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped BLAST and PSI-....2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Web
Bulletin of Materials Science | Indian Academy of Sciences
Indian Academy of Sciences (India)
pp 219-224 Electrochemistry ... test revealed good protection of base metal by zinc coating obtained from developed electrolyte. ... Titania doped triaxial porcelain: Enhancement of strength by controlled heat treatment .... Nanowires: properties, applications and synthesis via porous anodic aluminium oxide template.
2012-03-23
... at the Environmental Protection Agency, Region 5, Air and Radiation Division, 77 West Jackson... reference, Intergovernmental relations, Nitrogen dioxide, Ozone, Reporting and recordkeeping requirements... plant exemption in Subpart TT of Parts 218 and 219 does not apply to industrial wastewater. This...
Czech Academy of Sciences Publication Activity Database
Harada, T.; Takenaka, S.; Iyota, K.; Shiraki, T.; Moku, M.; Katagiri, C.; Košťál, Vladimír
2013-01-01
Roč. 16, č. 3 (2013), s. 219-222 ISSN 1226-8615 Institutional support: RVO:60077344 Keywords : temperature dynamics * distribution * heat tolerance Subject RIV: ED - Physiology Impact factor: 0.875, year: 2013 http://www.sciencedirect.com/science/article/pii/S1226861513000150#
Mechanisms and evolution of deceptive pollination in orchids
Czech Academy of Sciences Publication Activity Database
Jersáková, Jana; Johnson, S.D.; Kindlmann, Pavel
2006-01-01
Roč. 81, - (2006), s. 219-235 ISSN 1464-7931 Institutional research plan: CEZ:AV0Z60870520 Keywords : cross-pollination * floral deception * geitonogamy * inbreeding * nectar * Orchidaceae * pollinaria * reward * self-pollination Subject RIV: EF - Botanics Impact factor: 5.565, year: 2006
Identification of critical time-consuming student support activities in e-learning
De Vries, Fred; Kester, Liesbeth; Sloep, Peter; Van Rosmalen, Peter; Pannekeet, Kees; Koper, Rob
2005-01-01
Please cite the original publication: De Vries, F., Kester, L., Sloep, P., Van Rosmalen, P., Pannekeet, K., & Koper, R. (2005). Identification of critical time-consuming student support activities in e-learning. Research in Learning Technology (ALT-J), 13(3), 219-229.
Flow-induced vibration of circular cylindrical structures
International Nuclear Information System (INIS)
Chen, S.S.
1985-06-01
This report summarizes the flow-induced vibration of circular cylinders in quiescent fluid, axial flow, and crossflow, and applications of the analytical methods and experimental data in design evaluation of various system components consisting of circular cylinders. 219 figs., 30 tabs
Czech Academy of Sciences Publication Activity Database
Drelinkiewicz, A.; Waksmundzka-Góra, A.; Sobczak, J.; Stejskal, Jaroslav
2007-01-01
Roč. 333, č. 2 (2007), s. 219-228 ISSN 0926-860X Institutional research plan: CEZ:AV0Z40500505 Keywords : 2-ethyl-9,10- anthraquinone * polyaniline * palladium catalysts Subject RIV: CD - Macromolecular Chemistry Impact factor: 3.166, year: 2007
Complexation of Eu3+ with a macrocyclic lactam receptor: Experimental and theoretical study
Czech Academy of Sciences Publication Activity Database
Makrlík, E.; Záliš, Stanislav; Sedláková, Zdeňka; Vaňura, P.
2013-01-01
Roč. 1038, APR 2013 (2013), s. 216-219 ISSN 0022-2860 Institutional support: RVO:61388955 ; RVO:61389013 Keywords : europium * macrocyclic lactam receptor * complexation Subject RIV: CF - Physical ; Theoretical Chemistry; CD - Macromolecular Chemistry (UMCH-V) Impact factor: 1.599, year: 2013
Czech Academy of Sciences Publication Activity Database
Mihalca, A. D.; Jirků, Miloslav; Malonza, P. K.; Modrý, David
2009-01-01
Roč. 74, č. 3 (2009), s. 219-223 ISSN 0165-5752 Institutional research plan: CEZ:AV0Z60220518 Keywords : Isospora * Agama * Kenya * coccidium * Apicomplexa Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.911, year: 2009
Neonatal Anaplasma platys infection in puppies: Further evidence for possible vertical transmission
Czech Academy of Sciences Publication Activity Database
Matei, I.A.; Stuen, S.; Modrý, David; Degan, A.; D'Amico, G.; Mihalca, A. D.
2017-01-01
Roč. 219, 1 January (2017), s. 40-41 ISSN 1090-0233 Institutional support: RVO:60077344 Keywords : Anaplasma platys * canine * vertical transmission Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine OBOR OECD: Veterinary science Impact factor: 1.802, year: 2016
Czech Academy of Sciences Publication Activity Database
Nicolas, S.; Vobořil, Dalibor
2017-01-01
Roč. 117, č. 2 (2017), s. 173-219 ISSN 0003-5033 Institutional support: RVO:68081740 Keywords : Collin dynamometer * experimental psychology * history of psychology Subject RIV: AN - Psychology OBOR OECD: Psychology (including human - machine relations) Impact factor: 0.358, year: 2016
South African Medical Journal - Vol 45, No 2 (1971)
African Journals Online (AJOL)
A new adjunct to the treatment and management of depression: intravenous infusion of ... The use of proteolytic enzymes (chymoral) in sporting injuries · EMAIL FREE FULL TEXT EMAIL ... Simmy Bank, D.G. Burns, I.N. Marks, D Stein, 219-225 ...
219 The Revised Edition of Korean Calendar for Allergenic Pollens
Oh, Jae-won; Kim, Joo-Hwa; Kim, Seong-Won; Kang, Im-Joo; Kim, Bong-Seong; Kook, Myung-Hee; Park, Kang-Seo; Lee, Ha-Baik; Kim, Kyu Rang; Choi, Young-Jean
2012-01-01
Background The old version of pollen calendar was used until this year in South Korea. That calendar did not reflect current pollen distribution and concentrations that can be influenced by changes in weather and environment. A new pollen calendar of allergenic pollens was made based on the data on pollen concentrations obtained in 8 regions nationwide between 1997 and 2009 in South Korea. Methods The distribution of pollen grains was assessed every day at 8 areas (Seoul, Guri, Busan, Daegu, Jeonju, Kwangju, Kangneung, and Jeju) nationwide for 12 years between July 1, 1997 and June 30, 2009. Pollen were collected by using Burkard 7-day sampler (Burkard manufacturing Co Ltd, Hertfordshire, UK), and the collected pollens were sent every week to Hanyang Guri Hospital. Then pollens were strained with Calberla's fuchsin staining solution and were identified. The number of pollen grains per m3 was calculated. Results Alder, birch and Japanese cedar started to appear in February. Japanese cedar showed a highest pollen concentration in Jeju. Pine became the highest pollen in May, and the pollen concentrations of oak and birch also became high. Common ragweed appeared in the middle of August and showed the highest pollen concentration in the middles of September. Japanese hop showed a high concentration between the middle of August and the end of September, and mugwort appeared in the middles of August and its concentration increased up until early September. Birch appeared earlier in Kangneung, and pine showed a higher pollen concentration than in the other areas. In Daegu, Oriental thuja, alder and juniper produced a large concentration of pollens. Pine produced a large concentration of pollens between the middle of April and the end of May. Weeds showed higher concentrations in September and mugwort appeared earlier than common ragweed. In Busan where is the southeast city, the time of flowering is relatively early, and alder and Oriental thuja appeared earliest among all areas. In Kwangju, Oriental thuja and hazelnut appeared in early February. In Jeju which is the end of southern island, Japanese cedar showed a higher pollen concentration than the other areas Conclusions New information on pollen distributions and concentrations should be provided for the general publics or allergic patients through the website in order to prevent the occurrence of pollinosis.
48 CFR 52.219-28 - Post-Award Small Business Program Rerepresentation.
2010-10-01
... influence on a national basis in a kind of business activity in which a number of business concerns are... position, ownership or control of materials, processes, patents, license agreements, facilities, sales...
28 CFR 2.219 - Maximum terms of imprisonment and supervised release.
2010-07-01
... contraband into prison 3 years 2 years. 22-2704 Child prostitution: abducting or harboring 3 years (10 years...) or child sex abuse 3 years (10 years if SOR) 2 years. 22-401, 4502 [22-501, 3202] Assault: with... statute for offense circumstances) 3 years 2 years. 22-1101(a), (c)(1) [22-901] Cruelty to children 1st...
48 CFR 352.219-70 - Mentor-protégé program.
2010-10-01
... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Mentor-protégé program... Mentor-protégé program. As prescribed in 319.270-1(a), the Contracting Officer shall insert the following provision: Mentor-Protégé Program (January 2010) (a) Large business prime contractors serving as mentors in...
: tous les projets | Page 219 | CRDI - Centre de recherches pour le ...
International Development Research Centre (IDRC) Digital Library (Canada)
Sujet: URBAN YOUTH, CRIME PREVENTION, YOUTH UNREST, ORGANIZED CRIME, VIOLENCE, MARGINALISM. Région: Guatemala, North and Central America, Honduras, El Salvador, South America. Programme: Gouvernance et justice. Financement total : CA$ 464,000.00. Prévention de la violence chez les jeunes ...
Clinicopathological study on refractory epilepsy treated by several epilepsy surgeries
Directory of Open Access Journals (Sweden)
Yan LI
2018-04-01
Full Text Available Objective To observe and investigate the clinicopathological features and types of refractory epilepsy treated by several epilepsy surgeries. Methods There were 19 patients with age less than 20 years who underwent 2 (16/19 or 3 (3/19 epilepsy surgeries. After pathological examination, pathological diagnosis and subtype was made according to focal cortical dysplasia (FCD classification proposed by International League Against Epilepsy (ILAE Diagnostic Methods Commission in 2011 and World Health Organization (WHO Classification of Tumors of Central Nervous System in 2007. Results The operation intervals were 1-10 years (average 4.24 years. The pathological diagnoses after first operation were FCDⅠb in 2 cases (2/19, FCDⅡa in 2 cases (2/19, FCDⅢa in one case (1/19, FCDⅢd in one case (1/19, 5 cases of tumor lesions [2 (2/19 of astrocytoma, one (1/19 of oligoastrocytoma, one (1/ 19 of mixed germ cell tumor, one (1/19 of hysembryoplastic neuroepithelial tumor (DNT], one case (1/19 of hamartoma, one case (1/19 of angioma, one case (1/19 of heterotopic gray matter, and 4 cases (4/19 of ulegyria. The last one (1/19 underwent corpus callosal incision. Pathological diagnoses after reoperation were FCDⅢa in 4 cases (4/19, FCDⅢb in 4 cases (4/19, FCDⅢc in one case (1/19, FCDⅢd in 8 cases (8/19, dual pathology (FCDⅢa with oligoastrocytoma and with glial scar and/or ulegyria in 2 cases (2/19. Patients were followed up for 0.50-5.00 years after second or third operation (average 2.34 years, and the results showed Engel Ⅰ in 10 patients (10/19, Engel Ⅱ in 6 patients (6/19 and Engel Ⅲ in 3 patients (3/19. The rate of good prognosis was 84.21%. Conclusions The pathological diagnoses of brain tissue resected from patients accepting several epilepsy surgeries are mainly FCD Ⅲ and dual pathology. It is suggested that the second or third operation would be effective for refractory epilepsy patients who underwent surgery already. DOI: 10
An On-Line Computerized Personnel-Payroll Dream.
Francis, E. E.
1979-01-01
Niles Township School District 219, Skokie, Illinois, has rebuilt its personnel and payroll program. The new system provides a data bank for storage of any and all information required by both the personnel and payroll departments on each district employee. (Author/MLF)
Biological activity of sugarcane pyroligneous acid against ...
African Journals Online (AJOL)
aghomotsegin
2013-10-23
Oct 23, 2013 ... most used for charcoal production is the Pinus elliottii var. .... de produtos naturais para o controle de Bemisia tabaci biótipo B .... larva. J. Econ. Entomol. 76:219-222. Zandersons J, Gravitis J, Kokorevics A, Zhurinsh A, ...
On satellite lines anomalies in OH excited states
International Nuclear Information System (INIS)
Elitzur, M.
1976-01-01
It is argued that different pumps produce similar distributions of populations in the first two excited states of OH. The pattern observed recently in G 219.3 - 07 by Whiteoak and Gardner can be due either to radiative or collisional pump. (author)
2013-07-03
...). The Project would provide the transmission infrastructure and capacity to deliver approximately 3,000... Code of Federal Regulations (CFR) 1610.2(c) and 36 CFR 219.8. The impacts of these potential amendments...-13; 8:45 am] BILLING CODE 4310-22-P ...
The identification of geopolymer affinity in specific cases of clay materials
Czech Academy of Sciences Publication Activity Database
Perná, Ivana; Hanzlíček, Tomáš; Šupová, Monika
2014-01-01
Roč. 102, December (2014), s. 213-219 ISSN 0169-1317 R&D Projects: GA MPO FR-TI2/390 Institutional support: RVO:67985891 Keywords : geopolymer * raw material * infrared spectroscopy * shale Subject RIV: JI - Composite Materials Impact factor: 2.467, year: 2014
1383-IJBCS-Article- Hounnankpan yedohonhon
African Journals Online (AJOL)
KODJIO NORBERT
. Notes de phytopathologie soudanaise. Compt. Rend. Congrès. Africaniste, Dakar, Sénégal, 518-528. Natabou DF. 1987. Des plantes médicinales de la République Populaire du Bénin, p. 219. Parker C, Riches CR. 1993. Parasittic Weeds.
Lifescience Database Archive (English)
Full Text Available dro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped BLAST and PSI-B...2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Web
Status of the Grid Computing for the ALICE Experiment in the Czech Republic
Czech Academy of Sciences Publication Activity Database
Adamová, Dagmar; Chudoba, Jiří; Kouba, T.; Lorenzo, P.M.; Saiz, P.; Švec, Jan; Hampl, Josef
2010-01-01
Roč. 219, č. 7 (2010), s. 1-9 E-ISSN 1742-6596 Institutional research plan: CEZ:AV0Z10480505; CEZ:AV0Z10100521 Keywords : accelerators * PARTICLE PHYSICS * computer data analysis Subject RIV: BF - Elementary Particles and High Energy Physics
Comparison of Qinzhou bay wetland landscape information extraction by three methods
Directory of Open Access Journals (Sweden)
X. Chang
2014-04-01
and OO is 219 km2, 193.70 km2, 217.40 km2 respectively. The result indicates that SC is in the f irst place, followed by OO approach, and the third DT method when used to extract Qingzhou Bay coastal wetland.
Fungi associated with decomposing deadwood in a natural beech-dominated forest
Czech Academy of Sciences Publication Activity Database
Baldrian, Petr; Zrůstová, Petra; Tláskal, Vojtěch; Davidová, Anna; Merhautová, Věra; Vrška, T.
2016-01-01
Roč. 23, OCT 2016 (2016), s. 109-122 ISSN 1754-5048 R&D Projects: GA ČR GA13-27454S Institutional support: RVO:61388971 Keywords : Deadwood * Decomposition * White-rot Subject RIV: EE - Microbiology, Virology Impact factor: 3.219, year: 2016
Three anisotropic benchmark problems for adaptive finite element methods
Czech Academy of Sciences Publication Activity Database
Šolín, Pavel; Čertík, O.; Korous, L.
2013-01-01
Roč. 219, č. 13 (2013), s. 7286-7295 ISSN 0096-3003 R&D Projects: GA AV ČR IAA100760702 Institutional support: RVO:61388998 Keywords : benchmark problem * anisotropic solution * boundary layer Subject RIV: BA - General Mathematics Impact factor: 1.600, year: 2013
Host plant quality mediates competition between arbuscular mycorrhizal fungi
Czech Academy of Sciences Publication Activity Database
Knegt, B.; Jansa, Jan; Franken, O.; Engelmoer, D.J.P.; Werner, G.D.A.; Bucking, H.; Kiers, E. T.
2016-01-01
Roč. 20, April (2016), s. 233-240 ISSN 1754-5048 R&D Projects: GA MŠk(CZ) LK11224 Institutional support: RVO:61388971 Keywords : Biological market * Competitive exclusion * Cooperation Mutualism Subject RIV: EE - Microbiology, Virology Impact factor: 3.219, year: 2016
Boer, Hendrik; Emons, P.A.A.; Emons, P.A.A.
2004-01-01
We assessed the relation between accurate beliefs about HIV transmission and inaccurate beliefs about HIV transmission and emotional reactions to people with AIDS (PWA) and AIDS risk groups, stigmatizing attitudes and motivation to protect from HIV. In Chiang Rai, northern Thailand, 219 respondents
2010-10-25
... Accounting Service or Missile Defense Agency. (2) For DoD, the authority to acknowledge receipt or reject... DEPARTMENT OF DEFENSE Defense Acquisition Regulations System 48 CFR Parts 219 and 252 [DFARS Case 2009-D002] Defense Federal Acquisition Regulation Supplement; Electronic Subcontracting Reporting...
77 FR 17352 - Federal Acquisition Regulation; Women-Owned Small Business (WOSB) Program
2012-03-26
...-AL97 Federal Acquisition Regulation; Women-Owned Small Business (WOSB) Program Correction In rule...) * * * -- (24) 52.219-29, Notice of Set-Aside for Economically Disadvantaged Women-Owned Small Business (EDWOSB... Disadvantaged Women- Owned Small Business Concerns. * * * * * Notice of Set-Aside for Economically Disadvantaged...
48 CFR 3019.708-70 - Solicitation provision and contract clauses.
2010-10-01
... HOMELAND SECURITY, HOMELAND SECURITY ACQUISITION REGULATION (HSAR) SOCIOECONOMIC PROGRAMS SMALL BUSINESS PROGRAMS The Small Business Subcontracting Program 3019.708-70 Solicitation provision and contract clauses. (a) The contracting officer shall insert the clause at (HSAR) 48 CFR 3052.219-70, Small Business...
Czech Academy of Sciences Publication Activity Database
Mizera, Jiří; Řanda, Zdeněk; Košťák, M.
2010-01-01
Roč. 284, č. 1 (2010), s. 211-219 ISSN 0236-5731 Institutional research plan: CEZ:AV0Z10480505 Keywords : Jurassic-Cretaceous boundary * Nordvik Peninsula * Iridium anomaly Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 0.777, year: 2010
2011-12-06
... Project Hydroelectric Authority; Notice of Preliminary Permit Application Accepted for Filing and... Federal Power Act (FPA), proposing to study the feasibility of the Scooteney Outlet Drop Hydroelectric..., Grand Coulee Project Hydroelectric Authority, P.O. Box 219, Ephrata, WA 98823; phone: (509) 754-2227...
Czech Academy of Sciences Publication Activity Database
Fundová, Petra; Funda, David P.; Kovář, D.; Holý, R.; Navara, M.; Tlaskalová-Hogenová, Helena
2013-01-01
Roč. 58, č. 3 (2013), s. 219-224 ISSN 0015-5632 R&D Projects: GA MZd NS10054 Institutional support: RVO:61388971 Keywords : INTESTINAL EPITHELIAL-CELLS * GM- CSF * TOLL-LIKE RECEPTORS Subject RIV: EE - Microbiology, Virology Impact factor: 1.145, year: 2013
Dense Alternating Sign Matrices and Extensions
Czech Academy of Sciences Publication Activity Database
Fiedler, Miroslav; Hall, F.J.; Stroev, M.
2014-01-01
Roč. 444, 1 March (2014), s. 219-226 ISSN 0024-3795 Institutional support: RVO:67985807 Keywords : alternating sign matrix * dense matrix * totally unimodular matrix * combined matrix * generalized complementary basic matrix Subject RIV: BA - General Mathematics Impact factor: 0.939, year: 2014
Regenerative Medicine for Battlefield Injuries
2014-10-01
Manual of Experimental Embryology . University of Chicago Press, Chicago. Harris JS, Bemenderfer TB, Wessel AR, Kacena MA (2013) A review of mouse...proliferation and apoptosis . Dev Dynam 219:237-247. Patterson TE, Kumagal K, Griffith L, Muschler GF (2008) Cellular strategies for enhancement
Czech Academy of Sciences Publication Activity Database
Kubrycht, J.; Borecký, Jiří; Souček, P.; Ježek, Petr
2004-01-01
Roč. 49, č. 3 (2004), s. 219-246 ISSN 0015-5632 R&D Projects: GA MZd NJ6747 Institutional research plan: CEZ:AV0Z5011922 Keywords : CDR1 * immunoglobulin Subject RIV: EE - Microbiology, Virology Impact factor: 1.034, year: 2004
Czech Academy of Sciences Publication Activity Database
Janeczko, A.; Biesaga-Koscielniak, J.; Dziurka, M.; Filek, M.; Hura, K.; Jurczyk, B.; Kula, M.; Oklešťková, Jana; Novák, Ondřej; Rudolphi-Skórska, E.; Skoczowski, A.
2018-01-01
Roč. 37, č. 1 (2018), s. 199-219 ISSN 0721-7595 Institutional support: RVO:61389030 Keywords : Androstenedione * Frost resistance * Langmuir analysis * Phytohormones * Soluble sugars * Winter wheat Subject RIV: EF - Botanics OBOR OECD: Plant sciences, botany Impact factor: 2.073, year: 2016
Taylor, Purcell; El-Sabawi, Taleed; Cangin, Causenge
2016-01-01
Objective: To improve the CAGE (Cut down, Annoyed, Guilty, Eye opener) questionnaire's predictive accuracy in screening college students. Participants: The sample consisted of 219 midwestern university students who self-administered a confidential survey. Methods: Exploratory factor analysis, confirmatory factor analysis, receiver operating…
No effect of ploidy level in plant response to competition in a common garden experiment
Czech Academy of Sciences Publication Activity Database
Münzbergová, Zuzana
2007-01-01
Roč. 92, - (2007), s. 211-219 ISSN 0024-4066 R&D Projects: GA AV ČR KJB6111303 Institutional research plan: CEZ:AV0Z60050516 Keywords : adaptation * Asteraceae * Bromus erectus Subject RIV: EF - Botanics Impact factor: 2.368, year: 2007
Energy Technology Data Exchange (ETDEWEB)
Wahid, Ahmad Nazrul Abd, E-mail: a-nazrul@nuclearmalaysia.gov.my [Faculty of Science and Technology, Universiti Kebangsaan Malaysia, Bangi, 43600, Selangor (Malaysia); Malaysian Nuclear Agency, Bangi, 43000 Kajang, Selangor (Malaysia); Rahim, Sahibin Abd, E-mail: haiyan@ukm.edu.my [Faculty of Science and Technology, Universiti Kebangsaan Malaysia, Bangi, 43600, Selangor (Malaysia); Rahim, Khairuddin Abdul; Harun, Abdul Rahim [Malaysian Nuclear Agency, Bangi, 43000 Kajang, Selangor (Malaysia)
2015-09-25
This study was carried out to evaluate the efficiency use of the nitrogen fertilizer on aerobic rice varieties MR219-4 and MR219-9 which were grown aerobically under field capacity water potential at the controlled environment area or shield house. Direct {sup 15}N isotope tracer method was used in this study, whereby the {sup 15}N isotope was utilized as a tracer for nitrogen nutrient uptake. {sup 15}N isotope presence in the samples is determined by using emission spectrometer analysis and percentage of total nitrogen is determined by using Kjeldahl method. {sup 15}N atom access value contained in the sample will be used in determining the effectiveness of the use of nitrogen in fertilizers through the specific calculation formulas. In this work, the data several data of nitrogen derived from fertilizer (Ndff), total nitrogen, nitrogen uptake and nitrogen use efficiency was obtained.
Breastfeeding practices in a public health field practice area in Sri Lanka: a survival analysis
Directory of Open Access Journals (Sweden)
Agampodi Thilini C
2007-10-01
Full Text Available Abstract Background Exclusive breastfeeding up to the completion of the sixth month of age is the national infant feeding recommendation for Sri Lanka. The objective of the present study was to collect data on exclusive breastfeeding up to six months and to describe the association between exclusive breastfeeding and selected socio-demographic factors. Methods A clinic based cross-sectional study was conducted in the Medical Officer of Health area, Beruwala, Sri Lanka in June 2006. Mothers with infants aged 4 to 12 months, attending the 19 child welfare clinics in the area were included in the study. Infants with specific feeding problems (cleft lip and palate and primary lactose intolerance were excluded. Cluster sampling technique was used and consecutive infants fulfilling the inclusion criteria were enrolled. A total of 219 mothers participated in the study. The statistical tests used were survival analysis (Kaplan-Meier survival curves and Cox proportional Hazard model. Results All 219 mothers had initiated breastfeeding. The median duration of exclusive breastfeeding was four months (95% CI 3.75, 4.25. The rates of exclusive breastfeeding at 4 and 6 months were 61.6% (135/219 and 15.5% (24/155 respectively. Bivariate analysis showed that the Muslim ethnicity (p = 0.004, lower levels of parental education (p Conclusion The rate of breastfeeding initiation and exclusive breastfeeding up to the fourth month is very high in Medical Officer of Health area, Beruwala, Sri Lanka. However exclusive breastfeeding up to six months is still low and the prevalence of inappropriate feeding practices is high.
Blood electrolyte disturbances during severe hypoglycemia in Korean patients with type 2 diabetes.
Kang, Mi Yeon
2015-09-01
To investigate abnormalities in blood electrolyte levels during severe hypoglycemia in Korean patients with type 2 diabetes mellitus (T2DM) in a clinical setting. Blood electrolyte levels in adult T2DM patients during severe hypoglycemia were collected from January 1, 2008 to December 31, 2012. Patients who maintained normal serum creatinine and blood urea nitrogen levels were utilized in the study. Severe hypoglycemia was defined as a condition requiring medical assistance, such as administering carbohydrates when serum glucose levels less than 70 mg/dL were observed, in conjunction with other symptoms of hypoglycemia. A total of 1,068 patients who visited the emergency room with severe hypoglycemia were screened, of which 219 patients were included in this study. The incidence of abnormal levels for any electrolyte was 47%. Hypokalemia (type of electrolyte disturbance observed at 21.9%. A decrease in serum potassium levels was associated with decreases in blood glucose levels (r = 0.151, p = 0.025). During severe hypoglycemia, median blood glucose levels, incidence of tachycardia (> 100 beats per minute) and severe hypertension (≥ 180/120 mmHg) were 30 mg/dL (range, 14 to 62) and 35 mg/dL (range, 10 to 69; p = 0.04), 18.8% and 7.2% (p = 0.02), and 20.8% and 10.2% (p = 0.05) in the hypokalemia and normokalemia groups, respectively. During severe hypoglycemia, hypokalemia occurred in 21.9% of T2DM patients and was associated with tachycardia and severe hypertension. Therefore, the results suggest that severe hypoglycemia may increase cardiovascular events in T2DM.
Energy Technology Data Exchange (ETDEWEB)
Hasselfield, Matthew [Department of Astrophysical Sciences, Peyton Hall, Princeton University, Princeton, NJ 08544 (United States); Moodley, Kavilan [Astrophysics and Cosmology Research Unit, School of Mathematics, Statistics, and Computer Science, University of KwaZulu-Natal, Durban 4041 (South Africa); Bond, J. Richard; Hajian, Amir; Hincks, Adam D.; Nolta, Michael R. [Canadian Institute for Theoretical Astrophysics, University of Toronto, Toronto, ON M5S 3H8 (Canada); Das, Sudeep [High Energy Physics Division, Argonne National Laboratory, 9700 South Cass Avenue, Lemont, IL 60439 (United States); Devlin, Mark J.; Marsden, Danica; Schmitt, Benjamin L. [Department of Physics and Astronomy, University of Pennsylvania, 209 South 33rd Street, Philadelphia, PA 19104 (United States); Dunkley, Joanna [Department of Astrophysics, Oxford University, Oxford OX1 3RH (United Kingdom); Dünner, Rolando; Gallardo, Patricio [Departamento de Astronomía y Astrofísica, Facultad de Física, Pontificía Universidad Católica, Casilla 306, Santiago 22 (Chile); Fowler, Joseph W.; Niemack, Michael D. [NIST Quantum Devices Group, 325 Broadway Mailcode 817.03, Boulder, CO 80305 (United States); Gralla, Megan B.; Marriage, Tobias A. [Department of Physics and Astronomy, The Johns Hopkins University, 3400 North Charles Street, Baltimore, MD 21218-2686 (United States); Halpern, Mark [Department of Physics and Astronomy, University of British Columbia, Vancouver, BC V6T 1Z4 (Canada); Page, Lyman A. [Joseph Henry Laboratories of Physics, Jadwin Hall, Princeton University, Princeton, NJ 08544 (United States); Partridge, Bruce [Department of Physics and Astronomy, Haverford College, Haverford, PA 19041 (United States); and others
2013-11-01
We describe the measurement of the beam profiles and window functions for the Atacama Cosmology Telescope (ACT), which operated from 2007 to 2010 with kilopixel bolometer arrays centered at 148, 218, and 277 GHz. Maps of Saturn are used to measure the beam shape in each array and for each season of observations. Radial profiles are transformed to Fourier space in a way that preserves the spatial correlations in the beam uncertainty to derive window functions relevant for angular power spectrum analysis. Several corrections are applied to the resulting beam transforms, including an empirical correction measured from the final cosmic microwave background (CMB) survey maps to account for the effects of mild pointing variation and alignment errors. Observations of Uranus made regularly throughout each observing season are used to measure the effects of atmospheric opacity and to monitor deviations in telescope focus over the season. Using the WMAP-based calibration of the ACT maps to the CMB blackbody, we obtain precise measurements of the brightness temperatures of the Uranus and Saturn disks at effective frequencies of 149 and 219 GHz. For Uranus we obtain thermodynamic brightness temperatures T{sub U}{sup 149}= 106.7 ± 2.2 K and T{sub U}{sup 219}= 100.1 ± 3.1 K. For Saturn, we model the effects of the ring opacity and emission using a simple model and obtain resulting (unobscured) disk temperatures of T{sub S}{sup 149}= 137.3 ± 3.2 K and T{sub S}{sup 219}= 137.3 ± 4.7 K.