International Nuclear Information System (INIS)
Ruth, T.J.; Dombsky, M.; D'Auria, J.M.; Ward, T.E.
1988-01-01
This monograph is a review of the literature through 1987 and covers the methods of producing the radioisotopes of astatine and the inorganic, nuclear, and organic chemistry of astatine. The discussion is limited to chemical and physical chemical properties of astatine. The monograph, after the introduction, is divided into chapters titled: production methods, nuclear spectroscopy, chemistry of astatine, separation and isolation (dry and wet), and selected procedures. 209 refs., 15 figs., 7 tabs
Formation and decomposition of astatine molecules
International Nuclear Information System (INIS)
Takahashi, Naruto; Ishikuro, Mituhiro; Baba Hiroshi
1989-01-01
A method determining the boiling points of elementary astatine and astatine iodide has been developed (K. Otozai and N. Takahashi, Radio. Chim. Acta 31, (1982) 201). Further, it was concluded from the simple rule among the boiling point of elementary halogens and interhalogen compounds that elementary astatine might exist in diatomic molecules as the other halogens. In the present work the reaction mechanisms of elementary astatine with radioactive iodine and organic solvents were studied by means of radiogaschromatography in order to obtain further experimental evidences for diatomic astaine molecules. The following conclusions were obtained by the analysis of reaction kinetics. Two astatine atoms are lost from the elementary astatine fraction per each radioactive decay of astatine. The astatine radical or hot atom liberated by the decay of the complementary astatine atom immediately reacts with iodine or organic solvents. Thus formed astatine compounds decompose in turn due to the decay of astatine
Organic astatine compounds, their preparation and properties
Energy Technology Data Exchange (ETDEWEB)
Vasaros, L; Berei, K
1985-01-01
Aromatic astatine compounds of possible medical application were prepared by high energy substitutions, by astatine-halogen, and by electrophil astatine-hydrogen substitutions at the Joint Institute of Nuclear Researches, Dubna. Physico-chemical properties of organic astatine compounds such as boiling point and evaporation heat, and the refraction and dissociation energy of carbon-astatine bonds were determined experimentally by gas chromatography. The results are compared with extrapolated data. (V.N.). 41 refs.; 7 figs.; 5 tables.
Bibliography of astatine chemistry and biomedical applications
International Nuclear Information System (INIS)
Berei, K.; Vasaros, L.
1992-02-01
An overall bibliography is presented on astatine chemistry and on the biomedical applications of its 211 At isotope. The references were grouped in the following chapters: General reviews; Discovery, Natural Occurence; Nuclear Data; Preparation, Handling, Radiation Risk; Physico-chemical Properties; Astatine Compounds and Chemical Reactions; Biological Effects and Applications. Entries are sorted alphabetically by authors name in each chapter, and cross-references to other chapters are provided if appropriate. (R.P.)
Recent advances in the organic chemistry of astatine
International Nuclear Information System (INIS)
Berei, K.; Vasaros, L.
1994-03-01
Investigation on the chemical behaviour of astatine in the last decade are surveyed. The survey covers the physical and chemical properties of astatine, synthesis and identification of organic astatine compounds, their physicochemical properties. A special chapter is devoted to biomedical applications, including inorganic 211 At species, 211 At-labelled proteins and drugs. An extensive bibliography of the related literature is given. (N.T.) 129 refs.; 12 figs.; 14 tabs
Experimental and computational evidence of halogen bonds involving astatine
Guo, Ning; Maurice, Rémi; Teze, David; Graton, Jérôme; Champion, Julie; Montavon, Gilles; Galland, Nicolas
2018-03-01
The importance of halogen bonds—highly directional interactions between an electron-deficient σ-hole moiety in a halogenated compound and an acceptor such as a Lewis base—is being increasingly recognized in a wide variety of fields from biomedicinal chemistry to materials science. The heaviest halogens are known to form stronger halogen bonds, implying that if this trend continues down the periodic table, astatine should exhibit the highest halogen-bond donating ability. This may be mitigated, however, by the relativistic effects undergone by heavy elements, as illustrated by the metallic character of astatine. Here, the occurrence of halogen-bonding interactions involving astatine is experimentally evidenced. The complexation constants of astatine monoiodide with a series of organic ligands in cyclohexane solution were derived from distribution coefficient measurements and supported by relativistic quantum mechanical calculations. Taken together, the results show that astatine indeed behaves as a halogen-bond donor—a stronger one than iodine—owing to its much more electrophilic σ-hole.
The reaction of astatine with aromatic diazonium compounds
International Nuclear Information System (INIS)
Visser, G.W.M.; Diemer, E.L.
1982-01-01
Astatine reacts prefrentially with that type of aromatic diazonium salt that decomposes via a radical reaction channel (homolytic breakage of the C-N bond). The dediazonation with p-aminobenzoic acid and p-toluidine as model compounds was investigated through estatin produced in the 209 Bi(α,2n) 211 At reaction. (author)
Measurement of the first ionization potential of astatine by laser ionization spectroscopy
Rothe, S.; Andreyev, A. N.; Antalic, S.; Borschevsky, A.; Capponi, L.; Cocolios, T. E.; De Witte, H.; Eliav, E.; Fedorov, D. V.; Fedosseev, V. N.; Fink, D. A.; Fritzsche, S.; Ghys, L.; Huyse, M.; Imai, N.; Kaldor, U.; Kudryavtsev, Yuri; Köster, U.; Lane, J. F. W.; Lassen, J.; Liberati, V.; Lynch, K. M.; Marsh, B. A.; Nishio, K.; Pauwels, D.; Pershina, V.; Popescu, L.; Procter, T. J.; Radulov, D.; Raeder, S.; Rajabali, M. M.; Rapisarda, E.; Rossel, R. E.; Sandhu, K.; Seliverstov, M. D.; Sjödin, A. M.; Van den Bergh, P.; Van Duppen, P.; Venhart, M.; Wakabayashi, Y.; Wendt, K. D. A.
2013-01-01
The radioactive element astatine exists only in trace amounts in nature. Its properties can therefore only be explored by study of the minute quantities of artificially produced isotopes or by performing theoretical calculations. One of the most important properties influencing the chemical behaviour is the energy required to remove one electron from the valence shell, referred to as the ionization potential. Here we use laser spectroscopy to probe the optical spectrum of astatine near the ionization threshold. The observed series of Rydberg states enabled the first determination of the ionization potential of the astatine atom, 9.31751(8) eV. New ab initio calculations are performed to support the experimental result. The measured value serves as a benchmark for quantum chemistry calculations of the properties of astatine as well as for the theoretical prediction of the ionization potential of superheavy element 117, the heaviest homologue of astatine. PMID:23673620
Automated astatination of biomolecules - a stepping stone towards multicenter clinical trials
DEFF Research Database (Denmark)
Aneheim, Emma; Albertsson, Per; Bäck, Tom
2015-01-01
To facilitate multicentre clinical studies on targeted alpha therapy, it is necessary to develop an automated, on-site procedure for conjugating rare, short-lived, alpha-emitting radionuclides to biomolecules. Astatine-211 is one of the few alpha-emitting nuclides with appropriate chemical...... vector, which can guide the radiation to the cancer cells. Consequently, an appropriate method is required for coupling the nuclide to the vector. To increase the availability of astatine-211 radiopharmaceuticals for targeted alpha therapy, their production should be automated. Here, we present a method...... challenging, alpha-emitting radionuclide. In this work, we describe the process platform, and we demonstrate the production of both astaine-211, for preclinical use, and astatine-211 labelled antibodies....
DEFF Research Database (Denmark)
Aneheim, Emma; Gustafsson, Anna; Albertsson, Per
2016-01-01
Effective treatment of metastasis is a great challenge in the treatment of different types of cancers. Targeted alpha therapy utilizes the short tissue range (50-100 μm) of α particles, making the method suitable for treatment of disseminated occult cancers in the form of microtumors or even single...... to the antibody arbitrarily on lysine residues. By instead coupling astatine to disulfide bridges in the antibody structure, the immunoreactivity of the antibody conjugates could possibly be increased. Here, the disulfide-based conjugation was performed using a new coupling reagent, maleimidoethyl 3......-(trimethylstannyl)benzamide (MSB), and evaluated for chemical stability in vitro. The immunoconjugates were subsequently astatinated, resulting in both high radiochemical yield and high specific activity. The MSB-conjugate was shown to be stable with a long shelf life prior to the astatination. In a comparison...
Some aspects of the organic, biological and inorganic chemistry of astatine
International Nuclear Information System (INIS)
Visser, G.W.M.
1982-01-01
Astatine has no stable isotopes and the radioactive isotopes with half-lives sufficiently long for chemical experiments ( 209 At, 210 At, 211 At) must be produced artificially with a cyclotron or with a high energy accelerator by spallation of Th. This thesis deals with the synthesis and chemistry of At-compounds and the determination of some of their properties. (C.F.)
International Nuclear Information System (INIS)
Sjoestroem, A.; Carlsson, J.; Lundqvist, H.; Koziorowski, J.
2003-01-01
A method for direct astatine labeling of proteins has been investigated. Binding sites for astatine were created by coupling of a nido-carborane derivative to a protein, the human epidermal growth factor (hEGF), using two different conjugation methods - by glutaraldehyde cross-linking or by introduction of sulfohydryl groups by Traut's reagent with subsequent linking of ANC-1 with m-maleimidobenzoyl-N-hydroxysulfosuccinimide ester. The conjugates were astatinated using the Chloramine-T method in high yield. The best labeling was obtained by the glutaraldehyde conjugate with an average yield of 68 ± 9%. In vitro stability tests indicated that the glutaraldehyde conjugated label was as stable as hEGF labeled with astatobenzoate. (author)
International Nuclear Information System (INIS)
Otozai, K.; Takahashi, N.
1982-01-01
After astatine (0) was mixed with 131 I 2 containing carrier I 2 , the sample was analyzed by means of radiogaschromatography and the peaks due to I 2 , AtI and At 2 were observed. Further, the boiling points were estimated from the retention volume in terms of the semi-empirical theory on gas chromatography. The boiling points of I 2 , AtI and At 2 were 457 +- 2,486 +- 2 and 503 +- 3K, respectively. The boiling point of At 2 obtained in the present work is far smaller than that expected by the extrapolation of lighter halogens. (orig.)
Czech Academy of Sciences Publication Activity Database
Sjostrom, A.; Tolmachev, V.; Lebeda, Ondřej; Koziorowski, J.; Carlsson, J.; Lundqvist, H.
2003-01-01
Roč. 256, č. 7 (2003), s. 191-197 ISSN 0236-5731 R&D Projects: GA AV ČR KSK4055109 Keywords : neutron-capture therapy * astatine-211 Subject RIV: CH - Nuclear ; Quantum Chemistry Impact factor: 0.472, year: 2003
Lifescience Database Archive (English)
Full Text Available Japanese medaka Oryzias latipes Oryzias_latipes_L.png 219.png Taxonomy icon (c) Database Center for Life Sci...ence licensed under CC Attribution2.1 Japan アイコン:メダカ HNI-Ⅱ系統バージョン bando 2010/02/15 15:31:07 2010/02/16 09:53:27 ...
211At-Rh(16-S4-diol) complex as a precursor for astatine radiopharmaceuticals
International Nuclear Information System (INIS)
Pruszynski, M.; Bilewicz, A.
2006-01-01
211 At is one of the most promising radionuclides in α-radioimmunotherapy (α-RIT). Unfortunately, biomolecules labeled by direct electrophilic astatination are unstable due to the rapid loss of 211 At under both in vitro and in vivo conditions. The present paper describes the results of our studies on attaching At - to the rhodium(III) complex with thioether ligand: 1,5,9,13-etrathiacyclohexadecane-3,11-diol (16-S4-diol). Rh 3+ was chosen as a moderately soft metal cation which should form very strong bonds with soft At - anions, but first of all because of the kinetic inertness of low spin rhodium(III) d 6 complexes. The 16-S4-diol ligand was selected due to formation of stable complexes with Rh 3+ . The experiments related to optimization of the reaction conditions were performed with the 131 I, basing on a chemical similarity of I - to At - . The experiments with 211 At were then carried out under the conditions found optimal for I - . The preliminary results are promising, and indicate a possibility for astatination of biomolecules by using the 211 At-Rh(16-S4-diol) complex
Complexation study on no-carrier-added astatine with insulin: A candidate radiopharmaceutical
Energy Technology Data Exchange (ETDEWEB)
Lahiri, Susanta [Chemical Sciences Division, Saha Institute of Nuclear Physics, 1/AF Bidhannagar, Kolkata 700 064 (India)], E-mail: susanta.lahiri@saha.ac.in; Roy, Kamalika [Chemical Sciences Division, Saha Institute of Nuclear Physics, 1/AF Bidhannagar, Kolkata 700 064 (India); Sen, Souvik [Berhampur Sadar Hospital, Berhampur, Murshidabad 742 101 (India)
2008-12-15
No-carrier-added astatine radionuclides produced in the {sup 7}Li-irradiated lead matrix were separated from bulk lead nitrate target by complexing At with insulin, followed by dialysis. The method offers simultaneous separation of At from lead as well as its complexation with insulin. The At-insulin complex might be a potential radiopharmaceutical in the treatment of hepatocellular carcinoma. The stability of At-insulin complex was checked by dialysis against deionized water and Ringer lactate (RL) solution. It has been found that the half-life of At-insulin complex is about {approx}12 h, when dialyzed against deionized water and is only 6 h, when dialyzed against RL solution having the same composition as blood serum. The 6 h half-life of this Insulin-At complex is perfect for killing cancer cells from external cell surfaces as the half-life of internalization of insulin molecule inside the cell is 7-12 h.
Rothe, Sebastian; Welander, Jakob Emanuel; Chrysalidis, Katerina; Day Goodacre, Thomas; Fedosseev, Valentine; Fiotakis, Spyridon; Forstner, Oliver; Heinke, Reinhard Matthias; Johnston, Karl; Kron, Tobias; Koester, Ulli; Liu, Yuan; Marsh, Bruce; Ringvall Moberg, Annie; Rossel, Ralf Erik; Seiffert, Christoph; Studer, Dominik; Wendt, Klaus; Hanstorp, Dag
2017-01-01
Negatively charged ions are mainly stabilized through the electron correlation effect. A measure of the stability of a negative ion is the electron affinity, which the energy gain by attaching an electron to a neutral atom. This fundamental quantity is, due to the almost general lack of bound excited states, the only atomic property that can be determined with high accuracy for negative ions. We will present the results of the first laser photodetachment studies of radioactive negative ions at CERN-ISOLDE. The photodetachment threshold for the radiogenic iodine isotope 128I was measured successfully, demonstrating the performance of the upgraded GANDALPH experimental beam line. The first detection of photo-detached astatine atoms marks a milestone towards the determination of the EA of this radioactive element.
International Nuclear Information System (INIS)
Eichler, B.; Son Chun, K.
1985-01-01
In order to investigate the adsorption of astatine and radon on a palladium surface some on- and off-line thermochromatographic experiments were carried out with 210 At and 220 Rn tracers. The partial molar adsorption enthalpy for zero covering was found to be ΔH/sub a//sup 0, loc./(At) = -(15S +- 10) kJ mole -1 and ΔH/sub a//sup 0, mob./(Rn) = -(37 +- 4) kJ mole -1 . The results are compared with theoretical and experimental values for other elements of the sixth period. The adsorption behaviour of At is in conformity with that of the p-metals on a palladium surface. (author)
Determination of the electron affinity of astatine and polonium by laser photodetachment
We propose to conduct the first electron affinity (EA) measurements of the two elements astatine (At) and polonium (Po). Collinear photo-detachment spectroscopy will allow us to measure these quantities with an uncertainty limited only by the spectral line width of the laser. We plan to use negative ion beams of the two radioactive elements At and Po, which are only accessible on-line and at ISOLDE. The feasibility of our proposed method and the functionality of the experimental setup have been demonstrated at ISOLDE in off-line tests by the clear observation of the photo-detachment threshold for stable iodine. This proposal is based on our Letter of Intent I-148.
Complexation study on no-carrier-added astatine with insulin: A candidate radiopharmaceutical
International Nuclear Information System (INIS)
Lahiri, Susanta; Roy, Kamalika; Sen, Souvik
2008-01-01
No-carrier-added astatine radionuclides produced in the 7 Li-irradiated lead matrix were separated from bulk lead nitrate target by complexing At with insulin, followed by dialysis. The method offers simultaneous separation of At from lead as well as its complexation with insulin. The At-insulin complex might be a potential radiopharmaceutical in the treatment of hepatocellular carcinoma. The stability of At-insulin complex was checked by dialysis against deionized water and Ringer lactate (RL) solution. It has been found that the half-life of At-insulin complex is about ∼12 h, when dialyzed against deionized water and is only 6 h, when dialyzed against RL solution having the same composition as blood serum. The 6 h half-life of this Insulin-At complex is perfect for killing cancer cells from external cell surfaces as the half-life of internalization of insulin molecule inside the cell is 7-12 h
2010-10-01
... 47 Telecommunication 2 2010-10-01 2010-10-01 false [Reserved] 25.219 Section 25.219 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES SATELLITE COMMUNICATIONS Technical Standards § 25.219 [Reserved] ...
International Nuclear Information System (INIS)
DIVINE, J.R.; PARSONS, G.L.
2008-01-01
A minor leak was detected in a drain line for Hood 2B located in the 222-S Laboratory. The line transfers radioactive waste, spent analytical standards, and chemicals used in various analytical procedures. Details are in the report provided by David Comstock, 2B NDE June 2008, work package LAB-WO-07-2012. Including the noted leak, the 222-S Laboratory has experienced two drain line leaks in approximately the last two years of operation. As a consequence, CH2M HILL Hanford Group, Inc. (CH2M HILL) requested the support of ChemMet, Ltd., PC (ChemMet) at the Hanford Site 222-S Laboratory. The corrosion expertise from ChemMet was required prior to preparation of a compatibility assessment for the 222-S Laboratory waste transfer system to assure the expected life of the piping system is extended as much as practicable. The system includes piping within the 222-S Laboratory and the 219-S Waste Storage and Transfer Facility and Operations Process. The ChemMet support was required for an assessment by 222-S staff to analyze what improvements to operational activities may be implemented to extend the tank/piping system life. This assessment will include a summary of the various material types, age, and locations throughout the facility. The assessment will also include a discussion of materials that are safe for drain line disposal on a regular basis, materials that are safe for disposal on a case-by-case basis including specific additional requirements such as flushing, neutralization to a specific pH, and materials prohibited from disposal. The assessment shall include adequate information for 222-S Laboratory personnel to make informed decisions in the future disposal of specific material types by discussing types of compatibility of system materials and potential wastes. The assessment is expected to contain some listing of acceptable waste materials but is not anticipated to be a complete or comprehensive list. Finally the assessment will encompass a brief discussion of
2010-10-01
... 46 Shipping 1 2010-10-01 2010-10-01 false Fees. 10.219 Section 10.219 Shipping COAST GUARD... Requirements for All Merchant Mariner Credentials § 10.219 Fees. (a) Use table 10.219(a) of this section to calculate the mandatory fees for MMCs and associated endorsements. Table 10.219(a) Fees If you apply for And...
Astatine-211 Radiochemistry: The Development Of Methodologies For High Activity Level Radiosynthesis
International Nuclear Information System (INIS)
Zalutsky, Michael R.
2012-01-01
Targeted radionuclide therapy is emerging as a viable approach for cancer treatment because of its potential for delivering curative doses of radiation to malignant cell populations while sparing normal tissues. Alpha particles such as those emitted by 211At are particularly attractive for this purpose because of their short path length in tissue and high energy, making them highly effective in killing cancer cells. The current impact of targeted radiotherapy in the clinical domain remains limited despite the fact that in many cases, potentially useful molecular targets and labeled compounds have already been identified. Unfortunately, putting these concepts into practice has been impeded by limitations in radiochemistry methodologies. A critical problem is that the synthesis of therapeutic radiopharmaceuticals provides additional challenges in comparison to diagnostic reagents because of the need to perform radio-synthesis at high levels of radioactivity. This is particularly important for α-particle emitters such as 211At because they deposit large amounts of energy in a highly focal manner. The overall objective of this project is to develop convenient and reproducible radiochemical methodologies for the radiohalogenation of molecules with the α-particle emitter 211At at the radioactivity levels needed for clinical studies. Our goal is to address two problems in astatine radiochemistry: First, a well known characteristic of 211At chemistry is that yields for electrophilic astatination reactions decline as the time interval after radionuclide isolation from the cyclotron target increases. This is a critical problem that must be addressed if cyclotrons are to be able to efficiently supply 211At to remote users. And second, when the preparation of high levels of 211At-labeled compounds is attempted, the radiochemical yields can be considerably lower than those encountered at tracer dose. For these reasons, clinical evaluation of promising 211At-labeled targeted
ASTATINE-211 RADIOCHEMISTRY: THE DEVELOPMENT OF METHODOLOGIES FOR HIGH ACTIVITY LEVEL RADIOSYNTHESIS
Energy Technology Data Exchange (ETDEWEB)
MICHAEL R. ZALUTSKY
2012-08-08
Targeted radionuclide therapy is emerging as a viable approach for cancer treatment because of its potential for delivering curative doses of radiation to malignant cell populations while sparing normal tissues. Alpha particles such as those emitted by 211At are particularly attractive for this purpose because of their short path length in tissue and high energy, making them highly effective in killing cancer cells. The current impact of targeted radiotherapy in the clinical domain remains limited despite the fact that in many cases, potentially useful molecular targets and labeled compounds have already been identified. Unfortunately, putting these concepts into practice has been impeded by limitations in radiochemistry methodologies. A critical problem is that the synthesis of therapeutic radiopharmaceuticals provides additional challenges in comparison to diagnostic reagents because of the need to perform radio-synthesis at high levels of radioactivity. This is particularly important for {alpha}-particle emitters such as 211At because they deposit large amounts of energy in a highly focal manner. The overall objective of this project is to develop convenient and reproducible radiochemical methodologies for the radiohalogenation of molecules with the {alpha}-particle emitter 211At at the radioactivity levels needed for clinical studies. Our goal is to address two problems in astatine radiochemistry: First, a well known characteristic of 211At chemistry is that yields for electrophilic astatination reactions decline as the time interval after radionuclide isolation from the cyclotron target increases. This is a critical problem that must be addressed if cyclotrons are to be able to efficiently supply 211At to remote users. And second, when the preparation of high levels of 211At-labeled compounds is attempted, the radiochemical yields can be considerably lower than those encountered at tracer dose. For these reasons, clinical evaluation of promising 211At
Andreyev, Andrei
2013-01-01
Part I: $\\beta$-delayed fission, laser spectroscopy and shape-coexistence studies with astatine beams; Part II: Delineating the island of deformation in the light gold isotopes by means of laser spectroscopy
Energy Technology Data Exchange (ETDEWEB)
Nestor, M.; Anniko, M. [Uppsala University, Unit of Otolaryngology and Head and Neck Surgery, Department of Surgical Sciences, Uppsala (Sweden); Persson, M. [Uppsala University, Unit of Urology, Department of Surgical Sciences, Uppsala (Sweden); Uppsala University, Unit of Biomedical Radiation Science, Department of Oncology, Radiology and Clinical Immunology, Uppsala (Sweden); Dongen, G.A.M.S. van [Vrije Universiteit Medical Center, Department of Otolaryngology/Head and Neck Surgery, Amsterdam (Netherlands); Jensen, H.J. [Righshospitalet, PET and Cyclotron Unit, Department of Clinical Physiology and Nuclear Medicine, Copenhagen (Denmark); Lundqvist, H.; Tolmachev, V. [Uppsala University, Unit of Biomedical Radiation Science, Department of Oncology, Radiology and Clinical Immunology, Uppsala (Sweden)
2005-11-01
The purpose of this study was to analyse the properties of the astatinated chimeric MAb (cMAb) U36 as a conjugate to selectively target and eradicate head and neck squamous cell carcinoma (HNSCC). cMAb U36 was labelled with {sup 211}At via the linker N-succinimidyl 4-(trimethylstannyl)benzoate (SPMB). The quality of the conjugate was extensively evaluated for binding and internalisation capacity, and compared with {sup 125}I-SPMB-cMAb U36. The cellular toxicity of the astatinated conjugate was assessed in two types of in vitro growth assay and compared with {sup 131}I-labelled cMAb U36 (directly labelled). Comparisons between {sup 211}At-cMAb U36 and {sup 125}I-cMAb U36 demonstrated an optimal functional capacity of the labelled products. Immunoreactivity and affinity assays showed high immunoreactive fractions (>93%), and an affinity in good agreement between the astatinated and iodinated antibodies. For both conjugates, specific binding to HNSCC cells could be demonstrated, as well as some internalisation. Retention of the astatinated conjugate was just slightly lower than for the iodinated conjugate and still reasonable for therapeutic use (31{+-}2% vs 42.6{+-}1.0% at 22 h), demonstrating no adverse effects from astatination of the antibody. Studies on cellular toxicity demonstrated a dose-dependent and antigen-specific cellular toxicity for {sup 211}At-cMAb U36, with about 10% cell survival at 50 decays per cell. The {sup 131}I-labelled conjugate was not as efficient, with a surviving cell fraction of about 50% at 55 decays per cell. (orig.)
International Nuclear Information System (INIS)
Nestor, M.; Anniko, M.; Persson, M.; Dongen, G.A.M.S. van; Jensen, H.J.; Lundqvist, H.; Tolmachev, V.
2005-01-01
The purpose of this study was to analyse the properties of the astatinated chimeric MAb (cMAb) U36 as a conjugate to selectively target and eradicate head and neck squamous cell carcinoma (HNSCC). cMAb U36 was labelled with 211 At via the linker N-succinimidyl 4-(trimethylstannyl)benzoate (SPMB). The quality of the conjugate was extensively evaluated for binding and internalisation capacity, and compared with 125 I-SPMB-cMAb U36. The cellular toxicity of the astatinated conjugate was assessed in two types of in vitro growth assay and compared with 131 I-labelled cMAb U36 (directly labelled). Comparisons between 211 At-cMAb U36 and 125 I-cMAb U36 demonstrated an optimal functional capacity of the labelled products. Immunoreactivity and affinity assays showed high immunoreactive fractions (>93%), and an affinity in good agreement between the astatinated and iodinated antibodies. For both conjugates, specific binding to HNSCC cells could be demonstrated, as well as some internalisation. Retention of the astatinated conjugate was just slightly lower than for the iodinated conjugate and still reasonable for therapeutic use (31±2% vs 42.6±1.0% at 22 h), demonstrating no adverse effects from astatination of the antibody. Studies on cellular toxicity demonstrated a dose-dependent and antigen-specific cellular toxicity for 211 At-cMAb U36, with about 10% cell survival at 50 decays per cell. The 131 I-labelled conjugate was not as efficient, with a surviving cell fraction of about 50% at 55 decays per cell. (orig.)
2010-01-01
... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Settlement. 280.219 Section 280.219... Enforcement § 280.219 Settlement. (a) Cases may be settled before service of a charging letter. In cases in which settlement is reached before service of a charging letter, a proposed charging letter will be...
49 CFR 21.9 - Compliance information.
2010-10-01
... 49 Transportation 1 2010-10-01 2010-10-01 false Compliance information. 21.9 Section 21.9 Transportation Office of the Secretary of Transportation NONDISCRIMINATION IN FEDERALLY-ASSISTED PROGRAMS OF THE DEPARTMENT OF TRANSPORTATION-EFFECTUATION OF TITLE VI OF THE CIVIL RIGHTS ACT OF 1964 § 21.9 Compliance information. (a) Cooperation and...
49 CFR 219.13 - Preemptive effect.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Preemptive effect. 219.13 Section 219.13 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION, DEPARTMENT OF TRANSPORTATION CONTROL OF ALCOHOL AND DRUG USE General § 219.13 Preemptive effect. (a) Under...
45 CFR 150.219 - Final determination.
2010-10-01
... 45 Public Welfare 1 2010-10-01 2010-10-01 false Final determination. 150.219 Section 150.219... Are Failing To Substantially Enforce HIPAA Requirements § 150.219 Final determination. If, after... the State a written notice of its final determination. The notice includes the following: (a...
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Employment. 219.140 Section 219.140 Foreign... DEVELOPMENT § 219.140 Employment. No qualified handicapped person shall, on the basis of handicap, be subjected to discrimination in employment under any program or activity conducted by the agency. The...
2010-07-01
... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Principles. 219.2 Section 219... Forest System Land and Resource Management Planning Purpose and Principles § 219.2 Principles. The planning regulations in this subpart are based on the following principles: (a) The first priority for...
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Construction. 219.17 Section 219.17 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION, DEPARTMENT OF TRANSPORTATION CONTROL OF ALCOHOL AND DRUG USE General § 219.17 Construction. Nothing in this part— (a) Restricts...
International Nuclear Information System (INIS)
Lindegren, S.; Andersson, H.; Baeck, T.; Jacobsson, L.; Karlsson, B.; Skarnemark, G.
2001-01-01
Monoclonal antibodies C215, reactive with colorectal carcinomas, and MOv18, reactive with most of the ovarian carcinomas, were radiohalogenated with [ 211 At]astatine. The radiohalogen was conjugate coupled to antibodies via the intermediate labelling reagent N-succinimidyl-3-(trimethylstannyl)benzoate (m-MeATE) in a two-step, single-pot reaction. Optimisation of the labelling of the reagent was achieved using N-iodosuccinimide, NIS, as the oxidising agent. The yields ranged from 69-95% in the labelling of 0.1-1.0 nmole of the m-MeATE precursor. Subsequent conjugation to antibodies resulted in yields of 58±7%. In vitro binding to tumour cells showed that the immunoreactivity of both antibodies was retained after astatine labelling
Rothe, Sebastian; Nörtershäuser, W
This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at ISOLDE, CERN, by the addition of an all-solid state tuneable titanium: sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE, CERN, and at ISAC, TRIUMF, radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.
International Nuclear Information System (INIS)
Rothe, Sebastian
2012-01-01
This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at CERN/ISOLDE by the addition of an all-solid state tunable titanium:sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE/CERN and at ISAC/TRIUMF radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.
Energy Technology Data Exchange (ETDEWEB)
Rothe, Sebastian
2012-09-24
This doctoral thesis describes the extension of the resonance ionization laser ion source RILIS at CERN/ISOLDE by the addition of an all-solid state tunable titanium:sapphire (Ti:Sa) laser system to complement the well-established system of dye lasers. Synchronous operation of the so called Dual RILIS system of Ti:Sa and dye lasers was investigated and the potential for increased ion beam intensity, reliability, and reduced setup time has been demonstrated. In-source resonance ionization spectroscopy was performed at ISOLDE/CERN and at ISAC/TRIUMF radioactive ion beam facilities to develop an efficient and selective three-colour ionization scheme for the purely radioactive element astatine. A LabVIEW based monitoring, control and measurement system was conceived which enabled, in conjunction with Dual RILIS operation, the spectroscopy of high lying Rydberg states, from which the ionization potential of the astatine atom was determined for the first time experimentally.
Radiobiological Effects of Alpha-Particles from Astatine-211: From DNA Damage to Cell Death
Energy Technology Data Exchange (ETDEWEB)
Claesson, Kristina
2011-05-15
In recent years, the use of high linear energy transfer (LET) radiation for radiotherapeutic applications has gained increased interest. Astatine-211 (211At) is an alpha-particle emitting radionuclide, promising for targeted radioimmunotherapy of isolated tumor cells and microscopic clusters. To improve development of safe radiotherapy using 211At it is important to increase our knowledge of the radiobiological effects in cells. During radiotherapy, both tumors and adjacent normal tissue will be irradiated and therefore, it is of importance to understand differences in the radio response between proliferating and resting cells. The aim of this thesis was to investigate effects in fibroblasts with different proliferation status after irradiation with alpha-particles from 211At or X-rays, from inflicted DNA damage, to cellular responses and biological consequences. Throughout this work, irradiation was performed with alpha-particles from 211A or X-rays. The induction and repair of double-strand breaks (DSBs) in human normal fibroblasts were investigated using pulsed-field gel electrophoresis and fragment analysis. The relative biological effectiveness (RBE) of 211At for DSB induction varied between 1.4 and 3.1. A small increase of DSBs was observed in cycling cells compared to stationary cells. The repair kinetics was slower after 211At and more residual damage was found after 24 h. Comparison between cells with different proliferation status showed that the repair was inefficient in cycling cells with more residual damage, regardless of radiation quality. Activation of cell cycle arrests was investigated using immunofluorescent labeling of the checkpoint kinase Chk2 and by measuring cell cycle distributions with flow cytometry analysis. After alpha-particle irradiation, the average number of Chk2-foci was larger and the cells had a more affected cell cycle progression for several weeks compared with X-irradiated cells, indicating a more powerful arrest after 211At
22 CFR 219.160 - Communications.
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Communications. 219.160 Section 219.160 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS OF HANDICAP IN... communication with applicants, participants, personnel of other Federal entities, and members of the public. (1...
37 CFR 1.219 - Early publication.
2010-07-01
... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Early publication. 1.219... COMMERCE GENERAL RULES OF PRACTICE IN PATENT CASES National Processing Provisions Publication of Applications § 1.219 Early publication. Applications that will be published under § 1.211 may be published...
2010-04-01
... Annuity), 234 (Lump-Sum Payments), and 222 (Family Relationships), certain requirements must be met before... used as evidence. Part 222 defines and explains family relationships for which evidence requirements... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Introduction. 219.1 Section 219.1 Employees...
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Definitions. 219.2 Section 219.2 Employees... some other person. Benefit means any employee annuity, spouse annuity, survivor annuity, or lump-sum... proves to the satisfaction of the Board that an individual meets a requirement for eligibility for...
2010-10-01
... TRANSPORTATION CONTROL OF ALCOHOL AND DRUG USE Post-Accident Toxicological Testing § 219.207 Fatality. (a) In the..., United States Code (but not the agent of the Secretary for purposes of the Federal Tort Claims Act...
Radiological risk of actinon (/sup 219/Rn)
Energy Technology Data Exchange (ETDEWEB)
Crawford, D.J.
1981-12-01
The research reported was designed to provide information on the following subjects: (1) development of the functional relations between exposure to the /sup 219/Rn decay chain and pertinent health effects; (2) specification of the circumstances under which a significant concentration of the decay chain may occur; (3) recommendation of an exposure standard which will provide protection of the public from significant elevation of health effects; and (4) an assessment of the impact of /sup 219/Rn on determinations of the concentration of the /sup 222/Rn decay chain and/or its precursors.
Radiological risk of actinon (219Rn)
International Nuclear Information System (INIS)
Crawford, D.J.
1981-12-01
The research reported was designed to provide information on the following subjects: (1) development of the functional relations between exposure to the 219 Rn decay chain and pertinent health effects; (2) specification of the circumstances under which a significant concentration of the decay chain may occur; (3) recommendation of an exposure standard which will provide protection of the public from significant elevation of health effects; and (4) an assessment of the impact of 219 Rn on determinations of the concentration of the 222 Rn decay chain and/or its precursors
2010-07-01
... System Land and Resource Management Planning Purpose and Principles § 219.1 Purpose. (a) Land and... management of these lands. (3) Sustainability, composed of interdependent ecological, social, and economic elements, embodies the principles of multiple-use and sustained-yield without impairment to the...
48 CFR 219.702 - Statutory requirements.
2010-10-01
..., DEPARTMENT OF DEFENSE SOCIOECONOMIC PROGRAMS SMALL BUSINESS PROGRAMS The Small Business Subcontracting Program 219.702 Statutory requirements. (1) Section 834 of Public Law 101-189, as amended (15 U.S.C. 637... on a corporate, division, or plant-wide basis will reduce administrative burdens while enhancing...
49 CFR 219.800 - Annual reports.
2010-10-01
..., DEPARTMENT OF TRANSPORTATION CONTROL OF ALCOHOL AND DRUG USE Annual Report § 219.800 Annual reports. (a) Each... also use the electronic version of the MIS form provided by the DOT. The Administrator may designate... submission to FRA. For information on where to submit MIS forms and for the electronic version of the form...
12 CFR 219.6 - Payment procedures.
2010-01-01
... obtain payment of costs incurred prior to the time the financial institution receives this notice. [Reg... PROVIDING FINANCIAL RECORDS; RECORDKEEPING REQUIREMENTS FOR CERTAIN FINANCIAL RECORDS (REGULATION S) Reimbursement to Financial Institutions for Providing Financial Records § 219.6 Payment procedures. (a) Notice...
2010-07-01
... Forest System Land and Resource Management Planning Definitions § 219.36 Definitions. Definitions of the... vision for a specific area of land or type of land within the plan area. Statements of desired conditions... species of plants or animals which are not indigenous to an area but valued for their contribution to...
2010-10-01
... TRANSPORTATION CONTROL OF ALCOHOL AND DRUG USE General § 219.5 Definitions. As used in this part— Accident or... alcohol) that has known mind- or function-altering effects on a human subject, specifically including any... ownership or control of the railroad and not operated or staffed by a salaried officer or employee of the...
36 CFR 219.20 - Ecological sustainability.
2010-07-01
... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Ecological sustainability... Sustainability § 219.20 Ecological sustainability. To achieve ecological sustainability, the responsible official... diversity and species diversity are components of ecological sustainability. The planning process must...
2010-10-01
... (Acquisition, Technology, and Logistics) its authority under paragraph 8(a)(1)(A) of the Small Business Act (15... DEFENSE SOCIOECONOMIC PROGRAMS SMALL BUSINESS PROGRAMS Contracting With the Small Business Administration (The 8(a) Program) 219.800 General. (a) By Partnership Agreement (PA) between the Small Business...
Energy Technology Data Exchange (ETDEWEB)
Wilbur, D. Scott [Univ. of Washington, Seattle, WA (United States)
2011-12-14
The overall objective of this research effort was to develop methods for labeling biomolecules with higher oxidation state species of At-211. This was to be done in an effort to develop reagents that had higher in vivo stability than the present carbon-bonded At-211-labeled compounds. We were unsuccessful in that effort, as none of the approaches studied provided reagents that were stable to in vivo deastatination. However, we gained a lot of information about At-211 in higher oxidation states. The studies proved to be very difficult as small changes in pH and other conditions appeared to change the nature of the species that obtained (by HPLC retention time analyses), with many of the species being unidentifiable. The fact that there are no stable isotopes of astatine, and the chemistry of the nearest halogen iodine is quite different, made it very difficult to interpret results of some experiments. With that said, we believe that a lot of valuable information was obtained from the studies. The research effort evaluated: (1) methods for chemical oxidation of At-211, (2) approaches to chelation of oxidized At-211, and (3) approaches to oxidation of astatophenyl compounds. A major hurdle that had to be surmounted to conduct the research was the development of HPLC conditions to separate and identify the various oxidized species formed. Attempts to develop conditions for separation of iodine and astatine species by normal and reversed-phase TLC and ITLC were not successful. However, we were successful in developing conditions (from a large number of attempts) to separate oxidized forms of iodine ([I-125]iodide, [I-125]iodate and [I-125]periodate) and astatine ([At-211]astatide, [At-211]astatate, [At-211]perastatate, and several unidentified At-211 species). Information on the basic oxidation and characterization of At-211 species is provided under Objective 1. Conditions were developed to obtain new At-211 labeling method where At-211 is chelated with the DOTA and
36 CFR 219.17 - Interaction with private landowners.
2010-07-01
... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Interaction with private landowners. 219.17 Section 219.17 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF... Sustainability § 219.17 Interaction with private landowners. The responsible official must seek to collaborate...
48 CFR 1353.219 - Small business programs.
2010-10-01
... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Small business programs. 1353.219 Section 1353.219 Federal Acquisition Regulations System DEPARTMENT OF COMMERCE CLAUSES AND FORMS FORMS Prescription of Forms 1353.219 Small business programs. Use Form CD-570, Small Business Set...
48 CFR 653.219 - Small business programs.
2010-10-01
... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Small business programs. 653.219 Section 653.219 Federal Acquisition Regulations System DEPARTMENT OF STATE CLAUSES AND FORMS FORMS Prescription of Forms 653.219 Small business programs. ...
48 CFR 52.219-22 - Small Disadvantaged Business Status.
2010-10-01
.... Status as a small business and status as a small disadvantaged business for general statistical purposes... Business Status. 52.219-22 Section 52.219-22 Federal Acquisition Regulations System FEDERAL ACQUISITION... Clauses 52.219-22 Small Disadvantaged Business Status. As prescribed in 19.308(b), insert the following...
49 CFR 1542.219 - Supplementing law enforcement personnel.
2010-10-01
... 49 Transportation 9 2010-10-01 2010-10-01 false Supplementing law enforcement personnel. 1542.219 Section 1542.219 Transportation Other Regulations Relating to Transportation (Continued) TRANSPORTATION SECURITY ADMINISTRATION, DEPARTMENT OF HOMELAND SECURITY CIVIL AVIATION SECURITY AIRPORT SECURITY Operations § 1542.219 Supplementing law...
20 CFR 219.23 - Evidence to prove death.
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Evidence to prove death. 219.23 Section 219... EVIDENCE REQUIRED FOR PAYMENT Evidence of Age and Death § 219.23 Evidence to prove death. (a) Preferred evidence of death. The best evidence of a person's death is— (1) A certified copy of or extract from the...
36 CFR 219.19 - Ecological, social, and economic sustainability.
2010-07-01
... economic sustainability. 219.19 Section 219.19 Parks, Forests, and Public Property FOREST SERVICE..., Social, and Economic Sustainability § 219.19 Ecological, social, and economic sustainability. Sustainability, composed of interdependent ecological, social, and economic elements, embodies the Multiple-Use...
7 CFR 58.219 - High pressure pumps and lines.
2010-01-01
... 7 Agriculture 3 2010-01-01 2010-01-01 false High pressure pumps and lines. 58.219 Section 58.219....219 High pressure pumps and lines. High pressure lines may be cleaned-in-place and shall be of such construction that dead ends, valves and the high pressure pumps can be disassembled for hand cleaning. The high...
Configurations and level structure of 219Rn
International Nuclear Information System (INIS)
Sheline, R.K.; Liang, C.F.; Paris, P.
1998-01-01
The level structure of 219 Rn has been studied using the alpha decay of 223 Ra and coincident gamma rays. While only modest changes are required in the level structure, and only above 342.8 keV, severe changes are required throughout the level scheme in the spin assigments. These changes allow the assignment of two sets of anomalous bands with K=5/2 ± and K=3/2 ± . The K=5/2 ± bands have configurations intermediate between the reflection asymmetric configuration and the g 9/2 shell model configuration, while the K=3/2 ± bands have configurations intermediate between the mixed reflection asymmetric configuration and the i 11/2 shell model configuration. Comparison of the systematics of 219 Rn with neighboring isotones, isobars, and isotopes shows clearly the collapse of the quadrupole-octupole-type configurations into the less degenerate shell model configurations. copyright 1998 The American Physical Society
14 CFR 21.9 - Replacement and modification articles.
2010-01-01
... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Replacement and modification articles. 21.9... CERTIFICATION PROCEDURES FOR PRODUCTS AND PARTS General § 21.9 Replacement and modification articles. (a) If a person knows, or should know, that a replacement or modification article is reasonably likely to be...
20 CFR 219.24 - Evidence of presumed death.
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Evidence of presumed death. 219.24 Section... EVIDENCE REQUIRED FOR PAYMENT Evidence of Age and Death § 219.24 Evidence of presumed death. When a person cannot be proven dead but evidence of death is needed, the Board may presume he or she died at a certain...
12 CFR 219.1 - Authority, purpose and scope.
2010-01-01
... 12 Banks and Banking 2 2010-01-01 2010-01-01 false Authority, purpose and scope. 219.1 Section 219.1 Banks and Banking FEDERAL RESERVE SYSTEM BOARD OF GOVERNORS OF THE FEDERAL RESERVE SYSTEM REIMBURSEMENT FOR PROVIDING FINANCIAL RECORDS; RECORDKEEPING REQUIREMENTS FOR CERTAIN FINANCIAL RECORDS...
43 CFR 2.19 - When will bureaus waive fees?
2010-10-01
... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false When will bureaus waive fees? 2.19 Section... OF INFORMATION ACT Requests for Records under the FOIA § 2.19 When will bureaus waive fees? (a) Fees... section and appendix D to this part. The burden is on you to justify entitlement to a fee waiver. Requests...
40 CFR 86.219-94 - CVS calibration.
2010-07-01
... 40 Protection of Environment 18 2010-07-01 2010-07-01 false CVS calibration. 86.219-94 Section 86.219-94 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED... Later Model Year Gasoline-Fueled New Light-Duty Vehicles, New Light-Duty Trucks and New Medium-Duty...
20 CFR 219.43 - Evidence of child's dependency.
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Evidence of child's dependency. 219.43... EVIDENCE REQUIRED FOR PAYMENT Evidence of Relationship § 219.43 Evidence of child's dependency. (a) When the dependency requirement must be met. Usually the dependency requirement must be met at one of the...
30 CFR 219.102 - Method of payment.
2010-07-01
... writing to the Minerals Management Service, Minerals Revenue Management, P.O. Box 5760, Denver, Colorado... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Method of payment. 219.102 Section 219.102 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR MINERALS REVENUE MANAGEMENT...
48 CFR 1852.219-73 - Small business subcontracting plan.
2010-10-01
... Provisions and Clauses 1852.219-73 Small business subcontracting plan. As prescribed in 1819.708-70(a), insert the following provision: Small Business Subcontracting Plan (MAY 1999) (a) This provision is not... contain FAR clause 52.219-9, “Small Business Subcontracting Plan.” The apparent low bidder must submit the...
49 CFR 173.219 - Life-saving appliances.
2010-10-01
... 49 Transportation 2 2010-10-01 2010-10-01 false Life-saving appliances. 173.219 Section 173.219... Life-saving appliances. (a) A life-saving appliance, self-inflating or non-self-inflating, containing small quantities of hazardous materials that are required as part of the life-saving appliance must...
36 CFR 219.18 - Role of advisory committees.
2010-07-01
... PLANNING National Forest System Land and Resource Management Planning Collaborative Planning for... variety of public purposes, particularly those groups organized to develop landscape goals (§ 219.12(b...
48 CFR 52.219-1 - Small Business Program Representations.
2010-10-01
... section 8(a), 8(d), 9, or 15 of the Small Business Act or any other provision of Federal law that... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Small Business Program....219-1 Small Business Program Representations. As prescribed in 19.308(a)(1), insert the following...
21 CFR 2.19 - Methods of analysis.
2010-04-01
... Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL GENERAL ADMINISTRATIVE RULINGS AND DECISIONS General Provisions § 2.19 Methods of analysis. Where the method of analysis... issues of the “Journal of the Association of Official Analytical Chemists”), which are incorporated by...
26 CFR 1.219-2 - Definition of active participant.
2010-04-01
... individuals whose compensation exceeds a certain amount accrue benefits under the plan. An individual whose... participant. However, any benefit that may vary with future compensation of an individual provides additional... 26 Internal Revenue 3 2010-04-01 2010-04-01 false Definition of active participant. 1.219-2...
9 CFR 93.219 - Declaration for poultry.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Declaration for poultry. 93.219... AGRICULTURE EXPORTATION AND IMPORTATION OF ANIMALS (INCLUDING POULTRY) AND ANIMAL PRODUCTS IMPORTATION OF CERTAIN ANIMALS, BIRDS, FISH, AND POULTRY, AND CERTAIN ANIMAL, BIRD, AND POULTRY PRODUCTS; REQUIREMENTS...
48 CFR 53.219 - Small Business Programs.
2010-10-01
... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Small Business Programs... (CONTINUED) CLAUSES AND FORMS FORMS Prescription of Forms 53.219 Small Business Programs. (a) The following form may be used in reporting small disadvantaged business contracting data: OF 312 (10/00), Small...
48 CFR 52.219-2 - Equal Low Bids.
2010-10-01
.... If the bidder is awarded a contract as a result of receiving priority consideration under this... AND FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 52.219-2 Equal...) amount to more than 50 percent of the contract price. (c) Failure to identify the labor surplus areas as...
12 CFR 219.23 - Recordkeeping and reporting requirements.
2010-01-01
... Funds § 219.23 Recordkeeping and reporting requirements. (a) Domestic and international funds transfers... recordkeeping and reporting requirements for domestic and international funds transfers by insured depository... usefulness in criminal, tax, or regulatory investigations or proceedings. These regulations are codified at...
12 CFR 219.5 - Conditions for payment.
2010-01-01
... financial records prior to the time the financial institution is notified of such event. (c) Itemized bill... FOR PROVIDING FINANCIAL RECORDS; RECORDKEEPING REQUIREMENTS FOR CERTAIN FINANCIAL RECORDS (REGULATION S) Reimbursement to Financial Institutions for Providing Financial Records § 219.5 Conditions for...
36 CFR 219.4 - Identification and consideration of issues.
2010-07-01
... capabilities and available resources, including current and likely Forest Service budgets; (iv) The scientific... restore ecological conditions that are similar to the biological and physical range of expected variability (§ 219.20(b)(1)); and (vii) Opportunities to contribute to knowledge about and preservation of...
48 CFR 552.219-76 - Mentor Requirements and Evaluation.
2010-10-01
... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Mentor Requirements and....219-76 Mentor Requirements and Evaluation. As prescribed in 519.7017(b), insert the following clause: Mentor Requirements and Evaluation (SEP 2009) (a) The purpose of the GSA Mentor-Protégé Program is for a...
48 CFR 752.219-71 - Mentor requirements and evaluation.
2010-10-01
... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Mentor requirements and....219-71 Mentor requirements and evaluation. As prescribed in AIDAR 719.273-11(b), insert the following clause: Mentor Requirements and Evaluation (July 13, 2007) (a) Mentor and Protégé firms shall submit an...
48 CFR 1852.219-79 - Mentor requirements and evaluation.
2010-10-01
... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Mentor requirements and... and Clauses 1852.219-79 Mentor requirements and evaluation. As prescribed in 1819.7215, insert the following clause: Mentor Requirements and Evaluation (MAY 2009) (a) The purpose of the NASA Mentor-Protégé...
33 CFR 135.219 - Notification of changes affecting certification.
2010-07-01
... SECURITY (CONTINUED) MARINE POLLUTION FINANCIAL RESPONSIBILITY AND COMPENSATION OFFSHORE OIL POLLUTION COMPENSATION FUND Financial Responsibility for Offshore Facilities § 135.219 Notification of changes affecting... Fund Administrator in writing when any changes occur which prevent the owner, operator, or guarantor...
20 CFR 725.219 - Duration of entitlement; child.
2010-04-01
... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Duration of entitlement; child. 725.219... of entitlement; child. (a) An individual is entitled to benefits as a child for each month beginning... month in which any one of the following events first occurs: (1) The child dies; (2) The child marries...
48 CFR 52.219-9 - Small business subcontracting plan.
2010-10-01
... Clauses 52.219-9 Small business subcontracting plan. As prescribed in 19.708(b), insert the following clause: Small Business Subcontracting Plan (OCT 2010) (a) This clause does not apply to small business... business, and women-owned small business concerns. If the offeror is submitting an individual contract plan...
Morphological differentiation of Streptomyces viridochromogenes E-219 on solid culture
International Nuclear Information System (INIS)
Liang Xinle; Zhu Jing; Jin Yingyan
2012-01-01
The Streptomyces viridochromogenes E-219 was derived from Streptomyces viridochromogenes CGMCC4.1119 treated with 60 Co γ-rays irradiation and protoplast fusion. With the help of fluorescent probes, fluorescence microscope and electron microscopy, the morphology and development of E-219 on solid surface culture were investigated in this study. The effect of agarslant culture time on the production of Avilamycin was also studied to provide theoretical basis for industrial fermentation of selecting the appropriate seed to culture on the agarslant culture medium. The results implied that the development of colonies of Streptomyces viridochromogenes accompanied the intermittent hyhae apoptosis, and the production of spores was from the active mycelium. The colonial morphology of strain E-219 was significantly different from the original strain CGMCC4h1119. There were variegated hyphae formation in the stage of spore germination and initial hyphae development (10 h) with the live and dead segments alternated in a highly regular fashion within the same hypha. After the early single colony formation, the third phase was followed by profuse growth of the live segments derived from the variegated hypha, then the second apoptosis of the mycelia (48 h) was occurred with another quick growth, and sporulation was occurred at 96 h. Strain CGMCC4.1119 had spiral sporotrichial and round conidiophores with spike, whereas strain E-219 had linear sporotrichial, smooth and dylindrical conidiophore. The results of shake flask experiments indicated that the spores of E-219 had that highest activity when cultured on agarslant culture medium and incubated for 106 h with the production of avilamycin up to 1200 mg/L. (authors)
36 CFR 219.15 - Interaction with American Indian tribes and Alaska Natives.
2010-07-01
... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Interaction with American Indian tribes and Alaska Natives. 219.15 Section 219.15 Parks, Forests, and Public Property FOREST... Collaborative Planning for Sustainability § 219.15 Interaction with American Indian tribes and Alaska Natives...
36 CFR 219.12 - Collaboration and cooperatively developed landscape goals.
2010-07-01
... cooperatively developed landscape goals. 219.12 Section 219.12 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE PLANNING National Forest System Land and Resource Management Planning Collaborative Planning for Sustainability § 219.12 Collaboration and cooperatively developed landscape goals. (a...
48 CFR 752.219-8 - Utilization of small business concerns and small disadvantaged business concerns.
2010-10-01
... business concerns and small disadvantaged business concerns. 752.219-8 Section 752.219-8 Federal... AND CONTRACT CLAUSES Texts of Provisions and Clauses 752.219-8 Utilization of small business concerns and small disadvantaged business concerns. The Foreign Assistance Act calls for USAID to give small...
48 CFR 1352.219-71 - Notification to delay performance (Deviation).
2010-10-01
... performance (Deviation). 1352.219-71 Section 1352.219-71 Federal Acquisition Regulations System DEPARTMENT OF....219-71 Notification to delay performance (Deviation). As prescribed in 48 CFR 1319.811-3(b), insert the following clause: Notification To Delay Performance (Deviation) (APR 2010) The contractor shall...
48 CFR 552.219-72 - Preparation, Submission, and Negotiation of Subcontracting Plans.
2010-10-01
..., and Negotiation of Subcontracting Plans. 552.219-72 Section 552.219-72 Federal Acquisition Regulations... Text of Provisions and Clauses 552.219-72 Preparation, Submission, and Negotiation of Subcontracting... Negotiation of Subcontracting Plans (JUN 2005) (a) An offeror, other than a small business concern, submitting...
48 CFR 1552.219-71 - Procedures for Participation in the EPA Mentor-Protege Program.
2010-10-01
... Participation in the EPA Mentor-Protege Program. 1552.219-71 Section 1552.219-71 Federal Acquisition Regulations... Texts of Provisions and Clauses 1552.219-71 Procedures for Participation in the EPA Mentor-Protege... EPA Mentor-Protege Program (OCT 2000) (a) This provision sets forth the procedures for participation...
27 CFR 28.219 - Return of wine withdrawn for export with benefit of drawback.
2010-04-01
... Exportation of Wine With Benefit of Drawback § 28.219 Return of wine withdrawn for export with benefit of... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Return of wine withdrawn for export with benefit of drawback. 28.219 Section 28.219 Alcohol, Tobacco Products and Firearms...
Lien, Huang-Wei; Yang, Chung-Hsiang; Cheng, Chia-Hsiung; Liao, Yung-Feng; Han, Yu-San; Huang, Chang-Jen
2013-12-13
Zebrafish synuclein-γ2 (sncgb) has been reported to be expressed specifically in the notochord. However, the mechanism by which the sncgb gene promoter is regulated has not been described. In this paper, we demonstrate that Zinc finger protein 219-like (ZNF219L) and sox9a are involved in the regulation of sncgb gene expression. Furthermore, we observed that over-expression of both ZNF219L and Sox9a resulted in increased sncgb expression. In addition, ZNF219L is physically associated with Sox9a, and simultaneous morpholino knockdown of znf219L and sox9a caused a synergistic decrease of sncgb expression in the notochord. Taken together, our results reveal that coordination of ZNF219L with Sox9a is involved in the regulation of notochord-specific expression of sncgb. Copyright © 2013 The Authors. Published by Elsevier Inc. All rights reserved.
International Nuclear Information System (INIS)
Shyful Azizi Abdul Rahman; Abdul Rahim Harun; Rusli Ibrahim; Khairuddin Abdul Rahim
2014-01-01
Developing a good crop production management package; drought resistance variety, effective water and nutrient management in rice production practices is crucial for global climate change adaptation. A research project under IAEA RAS5065 (Supporting Climate-Proofing Rice Production Systems (CRiPS) Based on Nuclear Applications) was conducted from 2012 to 2013, in collaboration with MARDI. Two advanced mutant lines, MR219-4 and MR219-9 were used in this research project to evaluate growth, yield potential and fertilizer uptake under different water input condition (flooded and aerobic). The advanced mutant line MR219-9 showed comparable growth, yield and nitrogen uptake under both flooded and aerobic conditions. The yield and yield components are not significantly different from the parent variety (MR219) but total N uptake was lower than MR219 regardless of water regime. The field trial showed that MR219-9 has a better total N content which is comparable to the aerobic rice variety (MRIA 1) and this indicates that this advance mutant line MR219-9 is a potential aerobic rice variety. (author)
25 CFR 166.219 - How do I acquire a permit through negotiation?
2010-04-01
... 25 Indians 1 2010-04-01 2010-04-01 false How do I acquire a permit through negotiation? 166.219 Section 166.219 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER GRAZING PERMITS Permit Requirements Obtaining A Permit § 166.219 How do I acquire a permit through negotiation? (a) Permits may be negotiated and granted by th...
International Nuclear Information System (INIS)
Abdul Rahim Harun; Zarith Shafika Kamarudin; Abdullah, M.Z.; Anna, L.P.K.; Sobri Hussain; Rusli Ibrahim; Khairuddin abdul Rahim
2012-01-01
Two advance rice mutant lines, MR219-4 and MR219-9 derived from mutagenesis of Oryza sativa cv. MR219 with gamma radiation at 300 Gy were evaluated in simulated drought condition in the greenhouse at Malaysian Nuclear Agency. The mutants were evaluated simultaneously with ARN1, a drought resistant variety and MR211 a susceptible cultivar as a check. Randomized complete block design with three replicates was used in the experiment. The evaluation and selection were done based on leaf rolling and leaf drying as well as other agronomic traits, such as, number of tillers per plant, plant height, flag leaf area, grain weight per plant, grain yield per plant, 100-grain weight, harvest index, panicle length and plant biomass. The mutants MR219-4 showed moderate tolerance and MR219-9 showed tolerance to drought respectively as compare to the check variety (ARN1, MR211) and control MR219. Leaf rolling, leaf drying, days to flowering and days to maturity are valuable secondary traits that may provide additional information for selection because of associating with the plant survival under water stress. Further research on expression of drought-tolerant lines under different drought conditions is essential in order to identify particular traits that are associated with drought tolerance and high yield potential. Similarly the importance of secondary traits, relative to other putative traits for drought tolerance, needs to be tested in various environments. (author)
49 CFR 219.701 - Standards for drug and alcohol testing.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Standards for drug and alcohol testing. 219.701... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION CONTROL OF ALCOHOL AND DRUG USE Drug and Alcohol Testing Procedures § 219.701 Standards for drug and alcohol testing. (a) Drug testing required or authorized by subparts B...
25 CFR 2.19 - Action by Area Directors and Education Programs officials on appeal.
2010-04-01
... Programs officials on appeal. (a) Area Directors, Area Education Programs Administrators, Agency... 25 Indians 1 2010-04-01 2010-04-01 false Action by Area Directors and Education Programs officials on appeal. 2.19 Section 2.19 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR PROCEDURES...
48 CFR 252.219-7004 - Small business subcontracting plan (test program).
2010-10-01
... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Small business... AND CONTRACT CLAUSES Text of Provisions And Clauses 252.219-7004 Small business subcontracting plan (test program). As prescribed in 219.708(b)(1)(B), use the following clause: Small Business...
48 CFR 252.219-7003 - Small business subcontracting plan (DoD contracts).
2010-10-01
... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Small business... AND CONTRACT CLAUSES Text of Provisions And Clauses 252.219-7003 Small business subcontracting plan (DoD contracts). As prescribed in 219.708(b)(1)(A), use the following clause: Small Business...
20 CFR 219.50 - When evidence of “living with” is required.
2010-04-01
... with” is required. Evidence of “living with” (see part 222 of this chapter on Family Relationships) is... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false When evidence of âliving withâ is required. 219.50 Section 219.50 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD...
MicroRNA-219 modulates NMDA receptor-mediated neurobehavioral dysfunction
DEFF Research Database (Denmark)
Kocerha, Jannet; Faghihi, Mohammad Ali; Lopez-Toledano, Miguel A
2009-01-01
significantly modulated behavioral responses associated with disrupted NMDA receptor transmission. Furthermore, pretreatment with the antipsychotic drugs haloperidol and clozapine prevented dizocilpine-induced effects on miR-219. Taken together, these data support an integral role for miR-219 in the expression...
48 CFR 219.7104 - Developmental assistance costs eligible for reimbursement or credit.
2010-10-01
... costs eligible for reimbursement or credit. 219.7104 Section 219.7104 Federal Acquisition Regulations... reimbursement or credit. (a) Developmental assistance provided under an approved mentor-protege agreement is... eligible for reimbursement are set forth in appendix I. (b) Before incurring any costs under the Program...
40 CFR 80.219 - Designation and downstream requirements for GPA gasoline.
2010-07-01
... 40 Protection of Environment 16 2010-07-01 2010-07-01 false Designation and downstream requirements for GPA gasoline. 80.219 Section 80.219 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY... sold or dispensed for use in motor vehicles at a retail outlet or wholesale purchaser-consumer facility...
20 CFR 219.33 - Evidence of a deemed valid marriage.
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Evidence of a deemed valid marriage. 219.33... EVIDENCE REQUIRED FOR PAYMENT Evidence of Relationship § 219.33 Evidence of a deemed valid marriage. (a) Preferred evidence. Preferred evidence of a deemed valid marriage is— (1) Evidence of a ceremonial marriage...
20 CFR 219.32 - Evidence of a common-law marriage.
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Evidence of a common-law marriage. 219.32... EVIDENCE REQUIRED FOR PAYMENT Evidence of Relationship § 219.32 Evidence of a common-law marriage. (a) Preferred evidence. Evidence of a common-law marriage must give the reasons why the informant believes that...
20 CFR 219.30 - When evidence of marriage is required.
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false When evidence of marriage is required. 219.30... EVIDENCE REQUIRED FOR PAYMENT Evidence of Relationship § 219.30 When evidence of marriage is required. (a) When an application is filed for benefits. Documentary evidence of marriage is required when an...
20 CFR 219.42 - When evidence of child's dependency is required.
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false When evidence of child's dependency is required. 219.42 Section 219.42 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE... child's dependency is required. Evidence of a child's dependency on the employee is required when— (a...
48 CFR 2452.219-70 - Small business subcontracting plan compliance.
2010-10-01
... of Provisions and Clauses 2452.219-70 Small business subcontracting plan compliance. As prescribed in 2419.708(d), insert the following provision: Small Business Subcontracting Plan Compliance (FEB 2006... the clause at FAR 52.219-9, Small Business Subcontracting Plan. (c) The government will consider...
Extraction and purification of {sup 227}Ac and development of solid {sup 219}Rn source
Energy Technology Data Exchange (ETDEWEB)
Tang, Quan; Qiu, Shoukang; Xiao, Detao; Zhou, Yaohui; An, Xiaogang [University of South China, Hengyang (China). Radon Key Laboratory of Hunan Province/School of Nuclear Science and Technology
2014-04-01
The method of {sup 227}Ac extraction and purification from high-grade uranium ore and the test results of solid {sup 219}Rn source made from {sup 227}Ac are reported in this paper. With five years of follow-up monitoring, radiochemical purity of {sup 227}Ac and the emanation power of solid {sup 219}Rn source has been checked by emanation method and γ-spectrometry, the results showed that {sup 228}Th, {sup 231}Pa and {sup 226}Ra have been effectively removed and the emanation power of {sup 219}Rn source is about 80%. The long-term test results also showed that the {sup 219}Rn emanation rate remains stable in a wide air humidity range (40% ∝ 90%). Though the {sup 219}Rn source has not been accurately calibrated yet, it has been applied in the research for delay coincidence measurement of {sup 223}Ra. (orig.)
Project management plan for Project W-178, 219-S secondary containment
International Nuclear Information System (INIS)
Buckles, D.I.
1995-01-01
This Project Management Plan (PMP) establishes the organizational responsibilities, control systems, and procedures for managing the execution of project activities for Project W-178, the 219-S Secondary Containment Upgrade. The scope of this project will provide the 219-S Facility with secondary containment for all tanks and piping systems. Tank 103 will be replaced with a new tank which will be designated as Tank 104. Corrosion protection shall be installed as required. The cells shall be cleaned and the surface repaired as required. The 219-S Waste Handling Facility (219-S Facility), located in the 200 West Area, was constructed in 1951 to support the 222-S Laboratory Facility. The 219-S Facility has three tanks, TK-101, TK-102, and TK-103, which receive and neutralize low level radioactive wastes from the 222-S Laboratory. For purposes of the laboratory, the different low level waste streams have been designated as high activity and intermediate activity. The 219-S Facility accumulates and treats the liquid waste prior to transferring it to SY Tank Farm in the 200-W Area. Transfers are normally made by pipeline from the 219-S Facility to the 241-SY Tank Farm. Presently transfers are being made by tanker truck to the 200-E Area Tank Farms due to the diversion box catch tank which has been removed from service
2010-04-01
... 25 Indians 1 2010-04-01 2010-04-01 false What happens if a residential program does not maintain residency levels required by this subpart? 39.219 Section 39.219 Indians BUREAU OF INDIAN AFFAIRS..., Student Counts, and Verifications Residential Programs § 39.219 What happens if a residential program does...
48 CFR 1052.219-73 - Department of the Treasury Mentor-Protégé Program.
2010-10-01
... Mentor-Protégé Program. 1052.219-73 Section 1052.219-73 Federal Acquisition Regulations System... and Clauses 1052.219-73 Department of the Treasury Mentor-Protégé Program. As described in DTAR 1019.202-70, insert the following provision: Department of the Treasury Mentor-Protégé Program (JAN 2000...
5 CFR 591.219 - How does OPM compute shelter price indexes?
2010-01-01
... REGULATIONS ALLOWANCES AND DIFFERENTIALS Cost-of-Living Allowance and Post Differential-Nonforeign Areas Cost-Of-Living Allowances § 591.219 How does OPM compute shelter price indexes? (a) In addition to rental...
20 CFR 219.35 - Evidence that a marriage has ended.
2010-04-01
... divorce or annulment; or (2) Evidence of the death (See § 219.23) of a party to the marriage. (b) Other..., the claimant must explain the reason therefor and submit other convincing evidence that the marriage...
48 CFR 852.219-72 - Evaluation factor for participation in the VA mentor-protégé program.
2010-10-01
... participation in the VA mentor-protégé program. 852.219-72 Section 852.219-72 Federal Acquisition Regulations... Texts of Provisions and Clauses 852.219-72 Evaluation factor for participation in the VA mentor-protégé... the VA Mentor-Protégé Program (DEC2009) This solicitation contains an evaluation factor or sub-factor...
Lien, Huang-Wei; Yang, Chung-Hsiang; Cheng, Chia-Hsiung; Hung, Chin-Chun; Liao, Wei-Hao; Hwang, Pung-Pung; Han, Yu-San; Huang, Chang-Jen
2013-01-01
The notochord is required for body plan patterning in vertebrates, and defects in notochord development during embryogenesis can lead to diseases affecting the adult. It is therefore important to elucidate the gene regulatory mechanism underlying notochord formation. In this study, we cloned the zebrafish zinc finger 219-like (ZNF219L) based on mammalian ZNF219, which contains nine C2H2-type zinc finger domains. Through whole-mount in situ hybridization, we found that znf219L mRNA is mainly expressed in the zebrafish midbrain-hindbrain boundary, hindbrain, and notochord during development. The znf219L morpholino knockdown caused partial abnormal notochord phenotype and reduced expression of endogenous col2a1a in the notochord specifically. In addition, ZNF219L could recognize binding sites with GGGGG motifs and trigger augmented activity of the col2a1a promoter in a luciferase assay. Furthermore, in vitro binding experiments revealed that ZNF219L recognizes the GGGGG motifs in the promoter region of the zebrafish col2a1a gene through its sixth and ninth zinc finger domains. Taken together, our results reveal that ZNF219L is involved in regulating the expression of col2a1a in zebrafish notochord specifically.
Wilbur, D. Scott; Chyan, Ming-Kuan; Hamlin, Donald K.; Nguyen, Holly; Vessella, Robert L.
2011-01-01
Evaluation of monoclonal antibody (MAb) fragments (e.g. Fab′, Fab or engineered fragments) as cancer-targeting reagents for therapy with the α-particle emitting radionuclide astatine-211 (211At) has been hampered by low in vivo stability of the label and a propensity of these proteins localize to kidneys. Fortunately, our group has shown that the low stability of the 211At label, generally a meta- or para-[211At]astatobenzoyl conjugate, on MAb Fab′ fragments can be dramatically improved by use of closo-decaborate(2-) conjugates. However, the higher stability of radiolabeled MAb Fab′ conjugates appears to result in retention of the radioactivity in kidneys. This investigation was conducted to evaluate whether the retention of radioactivity in kidney might be decreased by the use of acid-cleavable hydrazone between the Fab′ and the radiolabeled closo-decaborate(2-) moiety. Five conjugation reagents containing sulfhydryl-reactive maleimide groups, a hydrazone functionality and a closo-decaborate(2-) moiety were prepared. In four of the five conjugation reagents, a discrete polyethylene glycol (PEG) linker was used, and one substituent adjacent to the hydrazone was varied (phenyl, benzoate, anisole or methyl) to provide varying acid-sensitivity. In the initial studies, the five maleimido-closo-decaborate(2-) conjugation reagents were radioiodinated (125I or 131I), then conjugated with an anti-PSMA Fab′ (107-1A4 Fab′). Biodistributions of the five radioiodinated Fab′ conjugates were obtained in nude mice at 1, 4 and 24 h post injection (pi). In contrast to closo-decaborate(2-) conjugated to 107-1A4 Fab′ through a non-cleavable linker, two conjugates containing either a benzoate or a methyl substituent on the hydrazone functionality displayed clearance rates from kidney, liver and spleen that were similar to those obtained with directly radioiodinated Fab′ (i.e. no conjugate). The maleimido-closo-decaborate(2-) conjugation reagent containing a benzoate
2010-10-01
... Representation for the Small Business Competitiveness Demonstration Program. 52.219-19 Section 52.219-19 Federal... Representation for the Small Business Competitiveness Demonstration Program. As prescribed in 19.1008(a), insert the following provision: Small Business Concern Representation for the Small Business Competitiveness...
2010-07-01
... clothing, magazines and periodicals, and items which may be personally used by the veteran. 21.219 Section....219 Supplies consisting of clothing, magazines and periodicals, and items which may be personally used... will be supplied. (b) Furnishing magazines and periodicals. Appropriate past issues of magazines...
Evaluation of 3 Inch SN-219 Failure and S and SX Tank Farm Saltwell Piping
International Nuclear Information System (INIS)
ELSEN, J.J.
2000-01-01
Evaluation of direct buried piping currently in use or designated for future Saltwell pumping in S and SX Farms. Documented evaluation of failed S-103 saltwell pumping transfer line 3 inch SN-219. This evaluation is intended to reflect current status of Saltwell piping, when taken in context with referenced documents
29 CFR 779.219 - Unified operation may be achieved without common control or common ownership.
2010-07-01
... Act May Apply; Enterprise Coverage Unified Operation Or Common Control § 779.219 Unified operation may... through “unified operation.” It is clear from the definition that if the described activities are performed through unified operation they will be part of the enterprise whether they are performed by one...
48 CFR 1852.219-74 - Use of rural area small businesses.
2010-10-01
... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Use of rural area small... and Clauses 1852.219-74 Use of rural area small businesses. As prescribed in 1819.7103, insert the following clause: Use of Rural Area Small Business (SEP 1990) (a) Definitions. Rural area means any county...
48 CFR 52.219-8 - Utilization of small business concerns.
2010-10-01
... management and daily business operations of which are controlled by one or more veterans. Women-owned small... Clauses 52.219-8 Utilization of small business concerns. As prescribed in 19.708(a), insert the following clause: Utilization of Small Business Concerns (MAY 2004) (a) It is the policy of the United States that...
48 CFR 52.219-20 - Notice of Emerging Small Business Set-Aside.
2010-10-01
... Clauses 52.219-20 Notice of Emerging Small Business Set-Aside. As prescribed in 19.1008(b), insert the following provision: Notice of Emerging Small Business Set-Aside (JAN 1991) Offers or quotations under this acquisition are solicited from emerging small business concerns only. Offers that are not from an emerging...
48 CFR 52.219-6 - Notice of Total Small Business Set-Aside.
2010-10-01
... Clauses 52.219-6 Notice of Total Small Business Set-Aside. As prescribed in 19.508(c), insert the following clause: Notice of Total Small Business Set-Aside (JUN 2003) (a) Definition. Small business concern... qualified as a small business under the size standards in this solicitation. (b) General. (1) Offers are...
48 CFR 852.219-9 - VA Small business subcontracting plan minimum requirements.
2010-10-01
... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false VA Small business... Provisions and Clauses 852.219-9 VA Small business subcontracting plan minimum requirements. As prescribed in subpart 819.709, insert the following clause: VA Small Business Subcontracting Plan Minimum Requirements...
48 CFR 52.219-7 - Notice of Partial Small Business Set-Aside.
2010-10-01
... Clauses 52.219-7 Notice of Partial Small Business Set-Aside. As prescribed in 19.508(d), insert the following clause: Notice of Partial Small Business Set-Aside (JUN 2003) (a) Definitions. Small business..., and qualified as a small business under the size standards in this solicitation. (b) General. (1) A...
36 CFR 223.219 - Sustainable harvest of special forest products.
2010-07-01
... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Sustainable harvest of....219 Sustainable harvest of special forest products. (a) Sustainable harvest levels. Prior to offering... product's sustainable harvest level. A special forest product's sustainable harvest level is the total...
18 CFR 367.2190 - Account 219, Accumulated other comprehensive income.
2010-04-01
... COMPANY ACT OF 2005, FEDERAL POWER ACT AND NATURAL GAS ACT UNIFORM SYSTEM OF ACCOUNTS FOR CENTRALIZED SERVICE COMPANIES SUBJECT TO THE PROVISIONS OF THE PUBLIC UTILITY HOLDING COMPANY ACT OF 2005, FEDERAL POWER ACT AND NATURAL GAS ACT Balance Sheet Chart of Accounts Proprietary Capital § 367.2190 Account 219...
50 CFR 216.219 - Renewal and modifications of Letters of Authorization.
2010-10-01
... OCEANIC AND ATMOSPHERIC ADMINISTRATION, DEPARTMENT OF COMMERCE MARINE MAMMALS REGULATIONS GOVERNING THE TAKING AND IMPORTING OF MARINE MAMMALS Taking of Marine Mammals Incidental to Explosive Severance.... Gulf of Mexico § 216.219 Renewal and modifications of Letters of Authorization. (a) A Letter of...
Code Assessment of SPACE 2.19 using LSTF Steam Generator Tube Rupture Test
Energy Technology Data Exchange (ETDEWEB)
Kim, Minhee; Kim, Seyun [KHNP CRI, Daejeon (Korea, Republic of)
2016-10-15
The SPACE is a best estimated two-phase three-field thermal-hydraulic analysis code used to analyze the safety and performance of pressurized water reactors. As a result of the development, the 2.19 version of the code was released through the successive various verification and validation works. The present work is on the line of expanding the work by Kim et al. In this study, results produced by the SPACE 2.19 code were compared with the experimental data from JAERI's LSTF Test Run LSTF SB-SG-06 experiment simulating a Steam Generator Tube Rupture (SGTR) transient. In order to identify the predictability of SPACE 2.19, the LSTF steam generator tube rupture test was simulated. To evaluate the computed results, LSTF SB-SG-06 test data simulating the SGTR and the RELAP5/ MOD3.1 are used. The calculation results indicate that the SPACE 2.19 code predicted well the sequence of events and the major phenomena during the transient, such as the asymmetric loop behavior, reactor coolant system cooldown and heat transfer by natural circulation, the primary and secondary system depressurization by the pressurizer auxiliary spray and the steam dump using the intact loop steam generator relief valve.
Code Assessment of SPACE 2.19 using LSTF 10% Main Steam-Line-Break Test
Energy Technology Data Exchange (ETDEWEB)
Kim, Minhee; Kim, Seyun [KHNP CRI, Daejeon (Korea, Republic of)
2016-10-15
The Safety and Performance Analysis Code for Nuclear Power Plants (SPACE) has been developed in recent years by the Korea Hydro and Nuclear Power Co. through collaborative works with other Korean nuclear industries and research institutes. As a result of the development, the 2.19 version of the code was released through the successive various verification and validation works. In this study, results produced by the SPACE 2.19 code were compared with the experimental data from JAERI's LSTF Test Run SBSL- 01 for a 10% main steam line break transient in a pressurized water reactor. The LSTF 10% main steam line break test were simulated using the SPACE 2.19 for code V and V work. The overall comparisons between the SPACE 2.19 code prediction and the LSTF Test Run SB-SL-01 experimental data are reasonably satisfactory. The comparisons were conducted in terms of the variations of mass flow rate, void fraction, pressure, collapsed liquid level, temperature, and system flow rate for the transient. In addition, the input model was modified for simulation accuracy of PZR pressure based on the calculated results. The correction of PORV setpoint affects to simulate the PORV open and close phenomena similarly with experiments. From the modification, the computed results show a reasonable agreement with experimental data in overall transient time.
Occurrence of rhyolytic tuffs at deep sea drilling project site 219 on the Laccadive Ridge
Digital Repository Service at National Institute of Oceanography (India)
Siddiquie, H.N.; Sukheswala, R.N.
A study of thin sections from the lower and middle parts of Unit 5 (Paleocene) from Site 219 shows that these largely consist of acidic or rhyolitic tuffs. The overlying limestones in Unit 5 (Paleocene) and Unit 4 (Lower Eocene) also contain...
48 CFR 352.219-71 - Mentor-protégé program reporting requirements.
2010-10-01
... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Mentor-protégé program... Clauses 352.219-71 Mentor-protégé program reporting requirements. As prescribed in 319.270-1(b), the Contracting Officer shall insert the following clause: Mentor-Protégé Program Reporting Requirements (January...
48 CFR 652.219-72 - Department of State Mentor-Protégé Program.
2010-10-01
... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Department of State Mentor....219-72 Department of State Mentor-Protégé Program. As prescribed in 619.202-70(o)(1), insert the following provision: Department of State Mentor-Protégé Program (APR 2004) (a) Large and small businesses...
48 CFR 552.219-75 - GSA Mentor-Protégé Program.
2010-10-01
... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false GSA Mentor-ProtégÃ....219-75 GSA Mentor-Protégé Program. As prescribed in 519.7017(a), insert the following clause: GSA Mentor-ProtéGé Program (SEP 2009) (a) Prime contractors, including small businesses, are encouraged to...
48 CFR 952.219-70 - DOE Mentor-Protege program.
2010-10-01
... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false DOE Mentor-Protege program... FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 952.219-70 DOE Mentor.... DOE Mentor-Protege Program (MAY 2000) The Department of Energy has established a Mentor-Protege...
36 CFR 219.11 - Monitoring and evaluation for adaptive management.
2010-07-01
... OF AGRICULTURE PLANNING National Forest System Land and Resource Management Planning The Framework for Planning § 219.11 Monitoring and evaluation for adaptive management. (a) Plan monitoring strategy... national, regional, and local supply and demand for products, services, and values. Special consideration...
20 CFR 219.31 - Evidence of a valid ceremonial marriage.
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Evidence of a valid ceremonial marriage. 219... marriage. (a) Preferred evidence. Preferred evidence of a ceremonial marriage is— (1) A copy of the public record of the marriage, certified by the custodian of the record or by a Board employee; (2) A copy of a...
International Nuclear Information System (INIS)
Gilbert, R.O.; Simpson, J.C.; Engel, D.W.; Kinnison, R.R.
1984-03-01
For NS201 the estimated average 239 240 Pu to 241 Am ratios for vegetation and soil are 7.3 and 11.5, respectively, where the 241 Am data were obtained using wet chemistry. The geometric mean 90 Sr to 137 Cs ratios for vegetation and soil at NS201 are estimated to be 1.1 and 1.9. These results suggest that the true (population) median 239 240 Pu to 241 Am and 90 Sr to 137 Cs ratios are smaller for vegetation than for soil at NS201. For NS219 and NS221 the estimated average 239 240 Pu to 241 Am ratios for surface soil at NS219 and NS221 are 2.8 and 0.78, respectively. There is an obvious statistical difference in the average 239 240 Pu to 241 Am ratios at these sites. The geometric mean 239 240 Pu to 241 Am ratios for vegetation samples at NS219 and NS221 are estimated to be 3.2 and 0.82, respectively. The data suggest there may be a difference in the 239 240 Pu to 241 Am ratios for soil and vegetation at NS219, but not at NS221. The geometric mean 90 Sr to 137 Cs ratio for surface soil at NS219 and NS221 combined is 0.93. The geometric mean 90 Sr to 137 Cs ratio for vegetation for the two sites (pooled data) is estimated to be 1.8. 43 references, 42 figures, 7 tables
2010-07-01
... many times I may receive reimbursement for tour renewal travel? 302-3.219 Section 302-3.219 Public Contracts and Property Management Federal Travel Regulation System RELOCATION ALLOWANCES RELOCATION....219 Is there a limit on how many times I may receive reimbursement for tour renewal travel? (a) If you...
I219V polymorphism in hMLH1 gene in patients affected with ulcerative colitis.
Vietri, Maria Teresa; Riegler, Gabriele; De Paola, Marialaura; Simeone, Serena; Boggia, Maria; Improta, Alessia; Parisi, Mariarita; Molinari, Anna Maria; Cioffi, Michele
2009-04-01
hMLH1 gene, lying on chromosome 3p21-23, is a key factor of the mismatch repair (MMR) complex, which amends DNA replication errors. MMR alterations are involved in the development of both hereditary and sporadic forms of colorectal carcinoma related to ulcerative colitis (UC). I219V Polymorphism is located on exon 8 of hMLH1 and provides an aminoacidic substitution of isoleucine to valine, on the protein codon 219. This may affect the speed and fidelity of protein synthesis because of a tRNA paucity or changes in the mRNA secondary structure. Most of the hereditary nonpolyposis colon cancer-associated missense mutations of hMLH1 cause structural changes of the amino- or carboxy-terminal regions, involving the domains that interact with ATP and hPMS2. In this study, we analyzed the hMLH1 I219V polymorphism frequency in colectomized patients with UC. Venous blood from 100 ulcerative patients and 97 apparently healthy subjects has been collected. Out of 100 patients affected with UC, 75 noncolectomized showed an alternating course of disease, while 25 did not respond to the common drugs, and underwent colectomy. Genotyping was performed by polymerase chain reaction and following enzymatic digestion by BccI. No significant differences were found between patients with UC and controls both for genotype and allele frequencies. However, our data show a significant association when colectomized and noncolectomized patients are compared. The frequencies of G homozygosity were 28% in colectomized and 10.7% in noncolectomized patients (p < 0.05, chi(2) = 4.4, Odds ratio = 3.3). The allele frequencies of allele A were 52% in colectomized and 68% in noncolectomized patients; while those of allele G were 48% and 32%, respectively. I219V polymorphism in hMLH1 could influence the clinical course of the disease and lead to resistance to therapy.
48 CFR 852.219-71 - VA mentor-protégé program.
2010-10-01
... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false VA mentor-protégÃ....219-71 VA mentor-protégé program. As prescribed in 819.7115(a), insert the following clause: VA Mentor-Protégé Program (DEC 2009) (a) Large businesses are encouraged to participate in the VA Mentor-Protégé...
48 CFR 3052.219-71 - DHS mentor-protégé program.
2010-10-01
... 48 Federal Acquisition Regulations System 7 2010-10-01 2010-10-01 false DHS mentor-protégÃ... CONTRACT CLAUSES Text of Provisions and Clauses 3052.219-71 DHS mentor-protégé program. As prescribed in (HSAR) 48 CFR 3019.708-70(b), insert the following clause: DHS Mentor-Protégé Program (JUN 2006) (a...
48 CFR 1852.219-77 - NASA Mentor-Protégé Program.
2010-10-01
... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true NASA Mentor-ProtégÃ... and Clauses 1852.219-77 NASA Mentor-Protégé Program. As prescribed in 1819.7215, insert the following clause: NASA Mentor-Protégé Program (MAY 2009) (a) Prime contractors are encouraged to participate in the...
48 CFR 752.219-70 - USAID Mentor-Protégé Program.
2010-10-01
... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false USAID Mentor-ProtégÃ....219-70 USAID Mentor-Protégé Program. As prescribed in 719.273-11(a), insert the following provision: USAID Mentor-Protégé Program (July 13, 2007) (a) Large and small business are encouraged to participate...
Conceptual design report, 219-S secondary containment upgrade, Project W-178
International Nuclear Information System (INIS)
Beyer, J.J.
1993-05-01
The 219-S Facility is located in the 200-West Area on the Hanford Site and was constructed in 1951. The facility receives and treats liquid, low-level mixed waste from the 222-S Laboratory prior to transfer of that waste to the SY Tank Farm. The 219-S Facility consists of Cell A containing Tanks 101 and 102 and Cell B containing Tank 103 and a spare space. Project W-178 will modify the 219-S Facility to bring it into compliance with the tank system standards in WAC 173-303-640. The secondary containment upgrade will consist of a stainless steel cell liner in both Cell A and the spare space in Cell B. Additionally, Cell B will be modified by taking Tank 103 out of service and installing a new tank: Tank 104. The construction work will be accomplished in phases to minimize service interruption to the 222-S Laboratory. The proposed design and construction method is the most cost effective of four alternatives evaluated during a value engineering session. Project W-178 is a fiscal year 1995 Line Item. Total estimated construction costs of the project are $2,600,000; other project costs are $710,000. The total project cost is $3,300,000
Murai, Kiyohito; Sun, Guoqiang; Ye, Peng; Tian, E; Yang, Su; Cui, Qi; Sun, Guihua; Trinh, Daniel; Sun, Olivia; Hong, Teresa; Wen, Zhexing; Kalkum, Markus; Riggs, Arthur D; Song, Hongjun; Ming, Guo-li; Shi, Yanhong
2016-03-11
Dysregulated expression of miR-219, a brain-specific microRNA, has been observed in neurodevelopmental disorders, such as schizophrenia (SCZ). However, its role in normal mammalian neural stem cells (NSCs) and in SCZ pathogenesis remains unknown. We show here that the nuclear receptor TLX, an essential regulator of NSC proliferation and self-renewal, inhibits miR-219 processing. miR-219 suppresses mouse NSC proliferation downstream of TLX. Moreover, we demonstrate upregulation of miR-219 and downregulation of TLX expression in NSCs derived from SCZ patient iPSCs and DISC1-mutant isogenic iPSCs. SCZ NSCs exhibit reduced cell proliferation. Overexpression of TLX or inhibition of miR-219 action rescues the proliferative defect in SCZ NSCs. Therefore, this study uncovers an important role for TLX and miR-219 in both normal neurodevelopment and in SCZ patient iPSC-derived NSCs. Moreover, this study reveals an unexpected role for TLX in regulating microRNA processing, independent of its well-characterized role in transcriptional regulation.
Directory of Open Access Journals (Sweden)
Jing Yang
2018-01-01
Full Text Available MicroRNAs play significant roles in the development of cancer and may serve as promising therapeutic targets. In our previous work, miR-219-5p was identified as one of the important metastasis-related microRNAs in HCC. Here we demonstrated that miR-219-5p expression was elevated in HCC tissues and was associated with vascular invasion and dismal prognosis. In multivariate analysis, miR-219-5p was identified as an independent prognostic indicator for HCC patients. Functional mechanism analyses showed that miR-219-5p promoted HCC cell proliferation and invasion in in vitro, as well as in vivo, tumor growth and metastasis in nude mice models bearing human HCC tumors. In addition, cadherin 1 (CDH1 was revealed to be a downstream target of miR-219-5p in HCC cells. In conclusion, miR-219-5p promotes tumor growth and metastasis of HCC by regulating CDH1 and can serve as a prognostic marker for HCC patients.
ECNJEFI. A JEFI based 219-group neutron cross-section library: User's manual
International Nuclear Information System (INIS)
Stad, R.C.L. van der; Gruppelaar, H.
1992-07-01
This manual describes the contents of the ECNJEF1 library. The ECNJEF1 library is a JEF1.1 based 219-group AMPX-Master library for reactor calculations with the AMPX/SCALE-system, e.g. the PASC-3 system as implemented at the Netherlands Energy Research Foundation in Petten, Netherlands. The group cross-section data were generated with NJOY and NPTXS/XLACS-2 from the AMPX system. The data on the ECNJEF1 library allows resolved-resonance treatment by NITAWL and/or unresolved resonance self-shielding by BONAMI. These codes are based upon the Nordheim and Bondarenko methods, respectively. (author). 10 refs., 7 tabs
VizieR Online Data Catalog: K2-19b light curve (Armstrong+, 2015)
Armstrong, D. J.; Santerne, A.; Veras, D.; Barros, S. C. C.; Demangeon, O.; Lillo-Box, J.; McCormac, J.; Osborn, H. P.; Tsantaki, M.; Almenara, J.-M.; Barrado, D.; Boisse, I.; Bonomo, A. S.; Brown, D. J. A.; Bruno, G.; Rey Cerda, J.; Courcol, B.; Deleuil, M.; Diaz, R. F.; Doyle, A. P.; Hebrard, G.; Kirk, J.; Lam, K. W. F.; Pollacco, D. L.; Rajpurohit, A.; Spake, J.; Walker, S. R.
2015-08-01
The Near Infrared Transiting ExoplanetS (NITES) Telescope is a semi-robotic 0.4m (f/10) Meade LX200GPS Schmidt-Cassegrain telescope installed at the ORM, La Palma. One transit of K2-19b was observed on 2015 Feb 28. The telescope was defocused slightly to 3.3 FWHM and 814 images of 20s exposure time were obtained with 5s dead time between each. Observations were obtained without a filter. The table presents data taken with the NITES telescope shown in Figure 1 of the publication. (1 data file).
Polychlorinated biphenyls (PCB) analysis report for solid sample from 219S tank 104
International Nuclear Information System (INIS)
Ross, G.A.
1998-01-01
A sample of solids was obtained from tank 104 of 219S via a peristaltic pump equipped with a stainless steel tube and Norprenel tubing (Phthalate free). The sample obtained in a glass jar with Teflon 2 lid, was analyzed for PCBs as Aroclor mixtures. A soxhlet extraction procedure was used to extract the Aroclors from the sample. Analysis was performed using dual column confirmation gas chromatography/electron capture detection (GC/ECD). The extraction method closely follows SW-846 method 3540C and the analysis follows SW-846 method
Polychlorinated biphenyls (PCB) analysis report for solid sample from 219S tank 101
International Nuclear Information System (INIS)
Diaz, L.A.
1998-01-01
One waste sample that was obtained with solids from tank 101 of 219S via a peristaltic pump equipped with a stainless steel tube and Norprene tubing (Phthalate free) was obtained in a glass jar with teflon lid was analyzed (with duplicate, matrix spike, and matrix spike duplicate) for PCBs as Aroclor mixtures by the Inorganic/Organic Chemistry Group. A soxhlet extraction procedure was used for extraction of the Aroclors from the sample. Analysis was performed using dual column confirmation gas chromatography/electron capture detection (GC/ECD). Results are presented
International Nuclear Information System (INIS)
Maina, T.; Stolz, B.; Albert, R.; Bruns, C.; Koch, P.; Maecke, H.
1994-01-01
A new derivative of octreotide SDZ 219-387 [PnAO-(D)Phe 1 -octreotide] was synthesized, which binds specifically and with high affinity to somatostatin receptors in vitro (pK i =9.79±0.16). This new somatostatin analogue chelates technetium-99m under mild labelling conditions in good yields. The resulting [ 99m Tc]SDZ 219-387 was stable up to 6 h after labelling and could be isolated in a pure radiochemical and chemical form by high-perfomance liquid chromatographic purification. The intravenous administration of purified [ 99m Tc]SDZ 219-387 revealed that the radioligand was rapidly cleared from circulation, and tumour uptake of 0.38% ID/g was observed at 1.5 h post injection. [ 99m Tc]SDZ 219-387 specifically interacted with somatostatin binding sites on the tumour. However, the radioligand is highly lipophilic and excreted mainly through the hepatobiliary system. As a consequence, [ 99m Tc]SDZ 219-387 exhibits increased background activity and therefore is not appropriate for the in vivo visualization of somatostatin receptor-positive tumours and/or their metastases in the abdomen. (orig.)
Directory of Open Access Journals (Sweden)
Mariana Schroeder
2018-03-01
Full Text Available Consumption of a low calorie diet is the most common approach to lose weight. While generally effective at first, it is frequently followed by a relapse where the pre-diet weight is regained, and often exceeded. This pattern of repeated weight loss/regain is referred to as weight cycling and the resulting metabolic response varies greatly between individuals. Objective: We attempted to address the issue of individual differences in the response to weight cycling in male mice. Methods: We first exposed adult wild type mice to repeated cycles of high/low fat food. Next, using a lentiviral approach, we knocked-down or over-expressed miR-219 in the ventromedial hypothalamus (VMH of an additional mouse cohort and performed a full metabolic assessment. Results: Exposure of wild type males to weight cycling resulted in the division of the cohort into subsets of resistant versus metabolic-syndrome-prone (MS animals, which differed in their metabolic profile and hypothalamic miR-219 levels. Lentiviral knock-down of miR-219 in the VMH led to exacerbation of metabolic syndrome. In contrast, over-expression of miR-219 resulted in moderation of the metabolic syndrome phenotype. Conclusions: Our results suggest a role for miR-219 in the mediation of the metabolic phenotype resulting from repeated weight cycling. Keywords: Weight cycling, Metabolic syndrome, miRNAs, Ventromedial hypothalamus, High fat diet, Diabetes
Miah, Gous; Rafii, Mohd Y; Ismail, Mohd R; Puteh, Adam B; Rahim, Harun A; Latif, Mohammad A
2017-07-01
The rice cultivar MR219 is famous for its better yield and long and fine grain quality; however, it is susceptible to blast disease. The main objective of this study was to introgress blast resistance genes into MR219 through marker-assisted selection (MAS). The rice cultivar MR219 was used as the recurrent parent, and Pongsu Seribu 1 was used as the donor. Marker-assisted foreground selection was performed using RM6836 and RM8225 to identify plants possessing blast resistance genes. Seventy microsatellite markers were used to estimate recurrent parent genome (RPG) recovery. Our analysis led to the development of 13 improved blast resistant lines with Piz, Pi2 and Pi9 broad-spectrum blast resistance genes and an MR219 genetic background. The RPG recovery of the selected improved lines was up to 97.70% with an average value of 95.98%. Selected improved lines showed a resistance response against the most virulent blast pathogen pathotype, P7.2. The selected improved lines did not express any negative effect on agronomic traits in comparison with MR219. The research findings of this study will be a conducive approach for the application of different molecular techniques that may result in accelerating the development of new disease-resistant rice varieties, which in turn will match rising demand and food security worldwide. © 2016 Society of Chemical Industry. © 2016 Society of Chemical Industry.
Astatine-211 labeling. A study towards automatic production of astatinated antibodies
International Nuclear Information System (INIS)
Emma Aneheim; Per Albertsson; Sture Lindegren; Holger Jensen
2015-01-01
Targeted alpha therapy is especially interesting for therapy of microscopic cancer tumors due to short path length and high linear energy transfer of the alpha particles. One of the most promising nuclides for targeted alpha therapy is 211 At. To facilitate larger clinical studies using 211 At, the current manual synthesis of radiolabeled antibodies would benefit from being transferred into an automated method. In this work, successful modifications of the manual synthesis have been performed in order to adapt it to automation. The automatic synthesis has also been tested using the modified synthesis method. (author)
The corrosion Characteristics and Behaviors of the Ti-2.19Al-2.35Zr alloy
International Nuclear Information System (INIS)
Kim, Tae Hoon; Kang, Chang Sun; Baek, Jong Hyuk; Kim, Hyun Gil; Choi, Byoung Kwon; Jeong, Yong Hwan
2007-01-01
Ti-2.19Al-2.35Zr alloy is being considered as a steam generator tube material for the advanced pressurized water reactor (PWR) which is being developed by KAERI for the purpose of seawater desalination as well as a small scale electricity production. The main operational environment of SMART differs somewhat from that of a commercial PWR. That is, a heat-exchange tube is always exposed to a high temperature/pressure condition and an ammonia water chemistry is designed as a pH controlling agent without an addition of boric acid. The excellent mechanical and corrosion resistance properties are required for the steam generator tube material in SMART. Thus Ti-2.19Al-2.35Zr alloy was studied to investigate of the corrosion characteristics and behaviors of the Ti- 2.19Al-2.35Zr alloy in a simulated-SMART loop
International Nuclear Information System (INIS)
1995-01-01
The U.S. Department of Energy (DOE) is proposing to: (1) replace the 222-S Laboratory (222-S) radioactive liquid waste drain lines to the 219-S Waste Handling Facility (219-S); (2) upgrade 219-S by replacing or upgrading the waste storage tanks and providing secondary containment and seismic restraints to the concrete cells which house the tanks; and (3) replace the transfer lines from 219-S to the 241-SY Tank Farm. This environmental assessment (EA) has been prepared in compliance with the National Environmental Policy Act (NEPA) of 1969, as amended, the Council on Environmental Quality Regulations for Implementing the Procedural Provisions of NEPA (40 Code of Federal Regulations [CFR] 1500-1508), and the DOE Implementing Procedures for NEPA (10 CFR 1021). 222-S is used to perform analytical services on radioactive samples in support of the Tank Waste Remediation System and Hanford Site environmental restoration programs. Activities conducted at 222-S include decontamination of analytical processing and support equipment and disposal of nonarchived radioactive samples. These activities generate low-level liquid mixed waste. The liquid mixed waste is drained through pipelines in the 222-S service tunnels and underground concrete encasements, to two of three tanks in 219-S, where it is accumulated. 219-S is a treatment, storage, and/or disposal (TSD) unit, and is therefore required to meet Washington Administrative Code (WAC) 173-303, Dangerous Waste Regulations, and the associated requirements for secondary containment and leak detection. The service tunnels are periodically inspected by workers and decontaminated as necessary to maintain as low as reasonably achievable (ALARA) radiation levels. Although no contamination is reaching the environment from the service tunnels, the risk of worker exposure is present and could increase. 222-S is expected to remain in use for at least the next 30 years to serve the Hanford Site environmental cleanup mission
International Nuclear Information System (INIS)
Shahidan Yob; Nor Ishadi Ismail; Kamarudin Buyong
2015-01-01
Control of the fuel-efficient plant operations are key to gamma irradiation service in MINTec-Sinagama. Without an efficient operation, irradiation services will be disrupted and lead to customer product failed to be completed in a set time. Additionally, downtime each time operation is also important to monitor to ensure that the fuel-efficient plant exceeded 85% in each month. In this paper MINTec plant operations data collection-Sinagama made during the year 2011-2015. Analysis carried out against downtime, the extent of damage and the action according to the classification of plant problems. This data collection is important for pattern characterization solution that can be made to the irradiator IR219, JS10000 in MINTec-Sinagama. (author)
Project specific quality assurance plan for Project W-178, 219-S secondary containment
International Nuclear Information System (INIS)
Buckles, D.I.
1994-01-01
The scope of this Quality Assurance Program Plan (QAPP) is to provide a system of Quality Assurance reviews and verifications on the design, procurement and construction of the 219-S Secondary Containment Upgrade. The reviews and verifications will be on activities associated with design, procurement, and construction of the Secondary Containment Upgrade which includes, but is not limited to demolition, removal, new tank installation, tank 103 isolation, tank cell refurbishment, electrical, instrumentation, piping/tubing including supports, pump and valves, and special coatings. The full project scope is defined in the project Functional Design Criteria (FDC), SD-W178-FDC-001, and all activities must be in compliance with this FDC and related design documentation
Directory of Open Access Journals (Sweden)
Alessandra Mosca
2018-04-01
Full Text Available The risk for Alzheimer’s disease (AD is associated with the presence of the 4 allele of Apolipoprotein E (APOE gene and, recently, with a novel genetic variant of the RNF219 gene. This study aimed at evaluating interactions between APOE-4 and RNF219/G variants in the modulation of behavioral and cognitive features of two cohorts of patients suffering from mild cognitive impairment (MCI or AD. We enrolled a total of 173 female MCI or AD patients (83 MCI; 90 AD. Subjects were screened with a comprehensive set of neuropsychological evaluations and genotyped for the APOE and RNF219 polymorphic variants. Analysis of covariance was performed to assess the main and interaction effects of APOE and RNF219 genotypes on the cognitive and behavioral scores. The analysis revealed that the simultaneous presence of APOE-4 and RNF219/G variants results in significant effects on specific neuropsychiatric scores in MCI and AD patients. In MCI patients, RNF219 and APOE variants worked together to impact the levels of anxiety negatively. Similarly, in AD patients, the RNF219 variants were found to be associated with increased anxiety levels. Our data indicate a novel synergistic activity APOE and RNF219 in the modulation of behavioral traits of female MCI and AD patients.
48 CFR 3052.219-72 - Evaluation of prime contractor participation in the DHS mentor-protégé program.
2010-10-01
... contractor participation in the DHS mentor-protégé program. 3052.219-72 Section 3052.219-72 Federal... Evaluation of prime contractor participation in the DHS mentor-protégé program. As prescribed in (HSAR) 48... the DHS Mentor-Protégé Program (JUN 2006) This solicitation contains a source selection factor or...
Long, Ju; Yan, Shanhuo; Lao, Kegan; Pang, Wanrong; Ye, Xuehe; Sun, Lei
2014-04-01
α-Thalassemia is a common single-gene genetic disease that can cause Hb Bart's hydrops fetalis and Hb H disease in tropical and subtropical regions. When examining conventional thalassemia genes, an only detected --(SEA) genotype sample needs further analysis. In doing so, we found a novel 21.9kb deletion (Qinzhou type deletion). The deletion position of the novel 21.9kb deletion is from 14373bp to 36299bp of the α-globin gene cluster (NG_000006.1); thus, there exists a 21927bp sequence deletion, into which a 29bp sequence is added. After sequence analysis, a group of Gap-PCR primers were synthesized to diagnose this novel thalassemia genotype. Through pedigree analysis, we deduced that the propositus obtained the novel alleles from her mother. The genotype of this propositus is --(SEA)/-α(21.9) and its phenotype conforms to the characteristics of Hb H disease, establishing that the combination between -α(21.9) genotype and α(0) genotype can lead to Hb H disease. By molecular analysis, we established that this case fits the characteristic of an α(+) thalassemia genotype. © 2013.
75 FR 25844 - Class Deviation From FAR 52.219-7, Notice of Partial Small Business Set-Aside
2010-05-10
... Small Business Set-Aside AGENCY: Defense Logistics Agency, DoD. ACTION: Notice. SUMMARY: This is to...) regarding partial small business set-asides for Defense Logistics Agency (DLA), Defense Energy Support..., DESC is requesting a class deviation from FAR Clause 52.219-7, Notice of Partial Small Business Set...
Directory of Open Access Journals (Sweden)
Huizi Lei
Full Text Available BACKGROUND AIMS: Gastric cancer is the most frequent gastrointestinal tumor in adults and is the most lethal form of human cancer. Despite of the improvements in treatments, the underlying mechanism of gastric carcinogenesis is not well known. To define novel modulators that regulate susceptibility to tumorgenesis, we focused on miR-219-2-3p. METHODS: Quantitative RT-PCR was employed to investigate the level of miR-219-2-3p in gastric cancer (GC tissues (n = 113 and their matched adjacent normal tissues (n = 113. In vitro cell proliferation, apoptosis assays, cell migration, and invasion assays were performed to elucidate biological effects of miR-219-2-3p. Since silencing of miRNA by promoter CpG island methylation may be an important mechanism in tumorgenesis, GC cells were treated with 5-aza-2'-deoxycytidine and trichostatin A, and expression changes of miR-219-2-3p were subsequently examined by quantitative RT-PCR. Finally, the methylation status of CpG island upstream of miR-219-2-3p was analyzed by methylation-specific PCR in GC tissues (n = 22. RESULTS: miR-219-2-3p was down-regulated in GC and cell lines. In addition, the experiments documented the lower expression of miR-219-2-3p in GC specimens with higher grade and later stage tumors. Meanwhile, miR-219-2-3p exerted antiproliferative, proapoptotic, and antimetastatic roles and reduced levels of p-ERK1/2 in GC cells. Furthermore, 5-aza-2'-deoxycytidine and trichostatin A increased the expression (~2 fold of miR-219-2-3p in GC cells. By methylation-specific PCR, DNA methylation in the upstream region of miR-219-2-3p was detected in both adjacent normal tissues and cancer tissues. As expected, the methylation level was considerably higher in the miR-219-2-3p down-regulated group than up-regulated group. CONCLUSIONS: miR-219-2-3p is potentially involved in gastric cancer progression and metastasis by regulating ERK1/2-related signal pathways, which may provide a novel therapeutic strategy
Incidence and predictors of difficult laryngoscopy in 11,219 pediatric anesthesia procedures.
Heinrich, Sebastian; Birkholz, Torsten; Ihmsen, Harald; Irouschek, Andrea; Ackermann, Andreas; Schmidt, Joachim
2012-08-01
Difficult laryngoscopy in pediatric patients undergoing anesthesia. This retrospective analysis was conducted to investigate incidence and predictors of difficult laryngoscopy in a large cohort of pediatric patients receiving general anesthesia with endotracheal intubation. Young age and craniofacial dysmorphy are predictors for the difficult pediatric airway and difficult laryngoscopy. For difficult laryngoscopy, other general predictors are not yet described. Retrospectively, from a 5-year period, data from 11.219 general anesthesia procedures in pediatric patients with endotracheal intubation using age-adapted Macintosh blades in a single center (university hospital) were analyzed statistically. The overall incidence of difficult laryngoscopy [Cormack and Lehane (CML) grade III and IV] was 1.35%. In patients younger than 1 year, the incidence of CML III or IV was significantly higher than in the older patients (4.7% vs 0.7%). ASA Physical Status III and IV, a higher Mallampati Score (III and IV) and a low BMI were all associated (P pediatric anesthesia is lower than in adults. Our results show that the risk of difficult laryngoscopy is much higher in patients below 1 year of age, in underweight patients and in ASA III and IV patients. The underlying disease might also contribute to the risk. If the Mallampati score could be obtained, prediction of difficult laryngoscopy seems to be reliable. Our data support the existing recommendations for a specialized anesthesiological team to provide safe anesthesia for infants and neonates. © 2012 Blackwell Publishing Ltd.
International Nuclear Information System (INIS)
Khazrouni, S.
1985-06-01
Using α-particle and γ-ray spectroscopy, it has been possible to establish the high spin pattern in 215 Fr and propose a decay scheme up to I π = (47/2 + ) containing six isomeric states. These results are interpreted using the recent version of the deformed Woods-Saxon model and the Strutinsky normalisation technique. A similar study in 219 Ac has revealed the existence of two quasi-bands each formed of states of alternating parity and connected by strong E1 transitions. This data for 219 Ac fits better with the stable octupole deformation model, mainly because of the high-spin parity doublets observed for the first time, than with the α-cluster model [fr
Tank 103, 219-S Facility at 222-S Laboratory, analytical results for the final report
International Nuclear Information System (INIS)
Fuller, R.K.
1998-01-01
This is the final report for the polychlorinated biphenyls analysis of Tank-103 (TK-103) in the 219-S Facility at 222-S Laboratory. Twenty 1-liter bottles (Sample numbers S98SO00074 through S98SO00093) were received from TK-103 during two sampling events, on May 5 and May 7, 1998. The samples were centrifuged to separate the solids and liquids. The centrifuged sludge was analyzed for PCBs as Aroclor mixtures. The results are discussed on page 6. The sample breakdown diagram (Page 114) provides a cross-reference of sample identification of the bulk samples to the laboratory identification number for the solids. The request for sample analysis (RSA) form is provided as Page 117. The raw data is presented on Page 43. Sample Description, Handling, and Preparation Twenty samples were received in the laboratory in 1-Liter bottles. The first 8 samples were received on May 5, 1998. There were insufficient solids to perform the requested PCB analysis and 12 additional samples were collected and received on May 7, 1998. Breakdown and sub sampling was performed on May 8, 1998. Sample number S98SO00084 was lost due to a broken bottle. Nineteen samples were centrifuged and the solids were collected in 8 centrifuge cones. After the last sample was processed, the solids were consolidated into 2 centrifuge cones. The first cone contained 9.7 grams of solid and 13.0 grams was collected in the second cone. The wet sludge from the first centrifuge cone was submitted to the laboratory for PCB analysis (sample number S98SO00102). The other sample portion (S98SO00103) was retained for possible additional analyses
48 CFR 653.219-71 - DOS form DS-4053, Department of State Mentor-Protégé Program Application.
2010-10-01
..., Department of State Mentor-Protégé Program Application. 653.219-71 Section 653.219-71 Federal Acquisition...-4053, Department of State Mentor-Protégé Program Application. As prescribed in 619.102-70(i), DS-4053 is prescribed for use in applying for an agreement under the Department of State Mentor-Protégé...
Yan, Guangqi; Wang, Xue; Yang, Mingliang; Lu, Li; Zhou, Qing
2017-01-01
Oral squamous cell carcinoma (OSCC) is a prevalent oral disease with a high morbidity and mortality rate. Several long non-coding RNAs (lncRNAs) were identified as important regulators of carcinogenesis. However, the pathogenic implications of TUG1 in OSCC are still unclear. In the present study, the expression of TUG1 was increased in OSCC cells. Knockdown of TUG1 inhibited cell proliferation, migration, and invasion, and induced cell cycle arrest at G0/G1 phase, whereas overexpression of TUG1 exerted the opposite effect on OSCC cells. A reciprocal repressive interaction between TUG1 and miR-219 was found, and miR-219 inhibition abolished the tumor-suppressive effect of TUG1 knockdown on cell growth and motility. Furthermore, bioinformatics analysis and luciferase reporter assay showed that FMNL2 was a direct target of miR-219. Restoration of FMNL2 abrogated the miR-219-induced inhibition of cell proliferation, cell cycle progression, migration, and invasion. Besides, overexpression of TUG1 promoted tumor growth and metastasis in vivo . Clinically, the expression of TUG1 and FMNL2 were increased, but miR-219 was decreased in primary tumors compared to non-tumor tissues. Both the upregulated TUG1, and FMNL2 and the downregulated miR-219 was associated with advanced stage of OSCC and poor overall survival. Notably, multivariate analyses confirmed that FMNL2 was an independent risk factor for OSCC. In conclusion, our data revealed that TUG1 confers oncogenic function in OSCC and TUG1/miR-219/FMNL2 axis may be a novel therapeutic strategy in this disease.
Tanweer, Fatah A.; Rafii, Mohd Y.; Sijam, Kamaruzaman; Rahim, Harun A.; Ahmed, Fahim; Ashkani, Sadegh; Latif, Mohammad A.
2015-01-01
Blast is the most common biotic stress leading to the reduction of rice yield in many rice-growing areas of the world, including Malaysia. Improvement of blast resistance of rice varieties cultivated in blast endemic areas is one of the most important objectives of rice breeding programs. In this study, the marker-assisted backcrossing strategy was applied to improve the blast resistance of the most popular Malaysian rice variety MR219 by introgressing blast resistance genes from the Pongsu Seribu 2 variety. Two blast resistance genes, Pi-b and Pi-kh, were pyramided into MR219. Foreground selection coupled with stringent phenotypic selection identified 15 plants homozygous for the Pi-b and Pi-kh genes, and background selection revealed more than 95% genome recovery of MR219 in advanced blast resistant lines. Phenotypic screening against blast disease indicated that advanced homozygous blast resistant lines were strongly resistant against pathotype P7.2 in the blast disease endemic areas. The morphological, yield, grain quality, and yield-contributing characteristics were significantly similar to those of MR219. The newly developed blast resistant improved lines will retain the high adoptability of MR219 by farmers. The present results will also play an important role in sustaining the rice production of Malaysia. PMID:26734013
International Nuclear Information System (INIS)
Panini, G.C.; Siciliano, F.; Lioi, A.
1987-01-01
The main characteristics of a P 3 coupled 219-group neutron 36-group gamma-ray library in the AMPX-II Master Interface Format obtained processing ENDF/B-IV data by means of various AMPX-II System modules are presented in this note both for the more reprocessing aspects and features of the generated component files-neutrons, photon and secondary gamma-ray production cross sections. As far as the neutron data are concerned there is the avaibility of 186 data sets regarding most significant fission products. Results of the additional validation of the neutron data pertaining to eighteen benchmark experiments are also given. Some calculational tests on both neutron and coupled data emphasize the important role of the secondary gamma-ray data in nuclear criticality safety calculations
Astatine-211 labelled proteins and their stability in vivo
International Nuclear Information System (INIS)
Yi Changhou; Jin Jannan; Zhang Shuyuan; Wang Ketai; Zhang Dayuan; Zhou Maolun
1989-01-01
211 At or 131 I labelled proteins, e.g. 211 At-IgG or 211 At-BSA (bovine serum albumin) were prepared by 211 At reaction with the diazo-compound of para-aminobenzoic acid, which is then conjugated with IgG or BSA via an acylation reaction. The 211 At-carbon bond was found metabolically stable under in vivo conditions. For the labelling of proteins with 211 At or 131 I, other methods of direct oxidation are also described. The results show that for the labelling of proteins with 211 At, high rate of incorporation can be obtained with hydrogen peroxide as oxidant, but the labelling of proteins with 131 I is more favourable with the strong oxidant Chloramine-T. (author) 12 refs.; 6 figs
H.P. Endtz (Hubert); J.W. Mouton (Johan); J.G. den Hollander (Jan); N.P.W.C.J. van den Braak (Nicole); H.A. Verbrugh (Henri)
1997-01-01
textabstractThe in vitro activity of trovafloxacin (CP-99,219), a new fluoroquinolone, was compared with the in vitro activities of other commonly used quinolones and other antimicrobial agents against 445 gram-positive microorganisms isolated between 1986 and 1995 from
International Nuclear Information System (INIS)
Longo, R C; MartInez, E; Dieguez, O; Vega, A; Gallego, L J
2007-01-01
Using the modified embedded atom model in conjunction with a self-consistent tight-binding method, we investigated the lowest-energy structures of Fe monolayers and isolated Fe n clusters (n = 2-19) supported on the Ni(111) surface. In keeping with experimental findings, our calculations predict that the atoms of the monolayer occupy face-centred cubic (fcc) rather than hexagonal close-packed (hcp) sites. Likewise in agreement with experiment we found that Fe layers stack with a pseudomorphic fcc structure up to two monolayers, beyond which they stack as bcc(110). The structures of supported Fe clusters are predicted to be two-dimensional islands maximizing the number of nearest-neighbour bonds among the adsorbed Fe atoms, and their average magnetic moments per atom decrease towards that of the supported Fe monolayer almost monotonically as n increases. Finally, a pair of Fe 3 clusters on Ni(111) were found to exhibit virtually no interaction with each other even when separated by only one atomic row, i.e. so long as they do not coalesce they retain their individual magnetic properties
Contribution of weight status to asthma prevalence racial disparities, 2-19 year olds, 1988-2014.
Akinbami, Lara J; Rossen, Lauren M; Fakhouri, Tala H I; Simon, Alan E; Kit, Brian K
2017-08-01
Racial disparities in childhood asthma prevalence increased after the 1990s. Obesity, which also varies by race/ethnicity, is an asthma risk factor but its contribution to asthma prevalence disparities is unknown. We analyzed nationally representative National Health Examination and Nutrition Survey data for 2-19 year olds with logistic regression and decomposition analyses to assess the contributions of weight status to racial disparities in asthma prevalence, controlling for sex, age, and income status. From 1988-1994 to 2011-2014, asthma prevalence increased more among non-Hispanic black (NHB) (8.4% to 18.0%) than non-Hispanic white (NHW) youth (7.2% to 10.3%). Logistic regression showed that obesity was an asthma risk factor for all groups but that a three-way "weight status-race/ethnicity-time" interaction was not significant. That is, weight status did not modify the race/ethnicity association with asthma over time. In decomposition analyses, weight status had a small contribution to NHB/NHW asthma prevalence disparities but most of the disparity remained unexplained by weight status or other asthma risk factors (sex, age and income status). NHB youth had a greater asthma prevalence increase from 1988-1994 to 2011-2014 than NHW youth. Most of the racial disparity in asthma prevalence remained unexplained after considering weight status and other characteristics. Published by Elsevier Inc.
Directory of Open Access Journals (Sweden)
Daryush Talei
2013-01-01
Full Text Available Germination is a key process in plants' phenological cycles. Accelerating this process could lead to improvment of the seedling growth as well as the cultivation efficiency. To achieve this, the effect of microwave frequency on the germination of rice seeds was examined. The physiological feedbacks of the MR 219 rice variety in terms of seed germination rate (GR, germination percentage (GP, and mean germination time (MGT were analyzed by exposing its seeds to 2450 MHz of microwave frequency for one, four, seven, and ten hours. It was revealed that exposing the seeds to the microwave frequency for 10 hours resulted in the highest GP. This treatment led to 100% of germination after three days with a mean germination time of 2.1 days. Although the other exposure times of microwave frequency caused the moderate effects on germination with a GPa3 ranged from 93% to 98%, they failed to reduce the MGTa3. The results showed that ten-hour exposure times of microwave frequency for six days significantly facilitated and improved the germination indices (primary shoot and root length. Therefore, the technique is expected to benefit the improvement of rice seed germination considering its simplicity and efficacy in increasing the germination percentage and rate as well as the primary shoot and root length without causing any environmental toxicity.
Pang, Wanrong; Long, Ju; Weng, Xunjin; Fan, Qiongying; Sun, Lei; Pan, Zhijian; Fan, Zuqian
2018-01-01
Different types of deletional α-thalassemia (α-thal) have been reported by researchers in China. This study describes one family carrying -α 21.9 (NG_000006.1: g.14373_36299delinsGGGAAGGGTGGGTGGGAATAACAGCTTTT), -α 2.4 (NG_000006.1: g.36860_39251del) and - - THAI (Thailand) (NG_000006.1: g.10664_44164del) alleles in Guangxi Zhuang Autonomous Region, People's Republic of China (PRC), and reports the frequencies of these types in the population of this region. The proband was a 4-year-old girl, who screened positive for thalassemia, although the thalassemia genotype results were normal when screened using the routine kits. Samples of the proband's parents were also collected to perform further analyses. Two real-time gap-polymerase chain reaction (gap-PCR) systems were designed for separate detection of - - THAI and screening for -α 21.9 and -α 2.4 . The genotype of the proband was -α 21.9 /-α 2.4 , and the two variants were inherited from her parents. In the frequency study, five - - THAI , four -α 21.9 and 11 -α 2.4 positive individuals were detected in the 3410 random samples. Thus, allele frequencies of -α 21.9 , - - THAI and -α 2.4 in the population of southern Guangxi were determined as 0.059, 0.073 and 0.161%, respectively. This is the first report of an individual carrying the -α 21.9 /-α 2.4 genotype, and the first report of the detection of -α 21.9 , -α 2.4 and - - THAI in a single family. The total frequency for these alleles was 0.293% in southern Guangxi, suggesting that the thalassemia clinical center in this region should utilize a screening kit that allows detection of these types of deletions for a more comprehensive evaluation of thalassemia risk.
International Nuclear Information System (INIS)
Asma Ilyani Kadar; Sobri Hussein; Abdul Rahim Harun; Fazliana Mohd Saaya
2014-01-01
Mutation technique is a conventional breeding technique and it is very effective in improving of main crop characteristics such as yield traits, resistance to diseases and pests and nutritional qualities. In this study, MR219 seeds were treated with Carbon ion radiation (60 Gy) by AVF-Cyclotron at the Japan Atomic Energy Research Institute (JAERI), Takasaki, Japan and were planted at the Malaysian Nuclear Agency up to third mutant generation (M3). Thirty one M3 mutant lines (ML1 to ML31) were evaluated on morphological, yield and yield components, and were compared to the parental variety, MR219. Analysis of variance revealed that there was a significant difference among mutant lines in culm height, days to flowering, number of tillers, number of panicles, 1000 grain weight, total grain weight, total of dry matter, alkaline spreading value, gel consistency, amylose content, ash, crude protein, fat, dietary fibre, carbohydrate and energy. Mutant line ML21 had the best performance in majority of yield components and vegetative traits as compared to others mutant lines and parental variety. For nutritional composition, mutant lines namely ML31, ML21, ML10, ML19 were improved in crude protein content, dietary fibre and carbohydrate content. The estimation of glycemic index revealed that two mutant lines namely ML3 and ML30 can be consumed by diabetics. (author)
Folding model analysis of 58Ni + 64Ni elastic and inelastic scattering at Elab=203.8 and 219.2 MeV
International Nuclear Information System (INIS)
Ruiz, J.A.; Ferrero, J.L.; Bilwes, B.; Bilwes, R.
1992-01-01
Angular distributions of elastic scattering of 58 Ni by 64 Ni and inelastic scattering leading to the first 2 + state in 58 Ni or in 64 Ni were measured at E lab =203.8 and 219.2 MeV. The data were analyzed in the frame of the folding model. A renormalization N of the folding potential consistently lower than unity (N∼0.65) is needed to reproduce the elastic scattering data. Coupled-channel calculations including the main inelastic channels explain partly this discrepancy. They reproduce the elastic and inelastic scattering data with a renormalization of N∼0.8 at both energies. Interference between Coulomb and nuclear excitation is shown to play an important role in the repulsive character of the polarization potential. (author) 38 refs.; 6 figs.; 1 tab
Bekkenk, MW; Geelen, FAMJ; Vader, PCV; Heule, F; Geerts, ML; van Vloten, WA; Meijer, CJLM; Willemze, R
2000-01-01
To evaluate our diagnostic and therapeutic guidelines, clinical and long-term follow-up data of 219 patients with primary or secondary cutaneous CD30(+) lympho proliferative disorders were evaluated. The study group included 118 patients with lymphomatoid papulosis (LyP; group 1), 79 patients with
Bekkenk, M. W.; Geelen, F. A.; van Voorst Vader, P. C.; Heule, F.; Geerts, M. L.; van Vloten, W. A.; Meijer, C. J.; Willemze, R.
2000-01-01
To evaluate our diagnostic and therapeutic guidelines, clinical and long-term follow-up data of 219 patients with primary or secondary cutaneous CD30(+) lymphoproliferative disorders were evaluated. The study group included 118 patients with lymphomatoid papulosis (LyP; group 1), 79 patients with
Energy Technology Data Exchange (ETDEWEB)
Narita, Norio; Hori, Yasunori; Kusakabe, Nobuhiko; Takeda, Yoichi; Tamura, Motohide [Astrobiology Center, 2-21-1 Osawa, Mitaka, Tokyo, 181-8588 (Japan); Hirano, Teruyuki [Department of Earth and Planetary Sciences, Tokyo Institute of Technology, 2-12-1 Ookayama, Meguro-ku, Tokyo 152-8551 (Japan); Fukui, Akihiko; Yanagisawa, Kenshi [Okayama Astrophysical Observatory, National Astronomical Observatory of Japan, Asakuchi, Okayama 719-0232 (Japan); Sanchis-Ojeda, Roberto [Department of Astronomy, University of California, Berkeley, CA 94720 (United States); Winn, Joshua N. [Department of Physics, and Kavli Institute for Astrophysics and Space Research, Massachusetts Institute of Technology, Cambridge, MA 02139 (United States); Ryu, Tsuguru; Onitsuka, Masahiro [National Astronomical Observatory of Japan, 2-21-1 Osawa, Mitaka, Tokyo, 181-8588 (Japan); Kudo, Tomoyuki [Subaru Telescope, 650 North A’ohoku Place, Hilo, HI 96720 (United States); Delrez, Laetitia; Gillon, Michael; Jehin, Emmanuel [Institut d’Astrophysique et de Géophysique, Université de Liège, Allée du 6 Août 17, Bat. B5C, B-4000 Liège (Belgium); McCormac, James [Department of Physics, University of Warwick, Gibbet Hill Road, Coventry CV4 7AL (United Kingdom); Holman, Matthew [Smithsonian Astrophysical Observatory, 60 Garden Street, Cambridge, MA 02138 (United States); Izumiura, Hideyuki, E-mail: norio.narita@nao.ac.jp [SOKENDAI (The Graduate University for Advanced Studies), 2-21-1 Osawa, Mitaka, Tokyo, 181-8588 (Japan)
2015-12-10
K2-19 (EPIC201505350) is an interesting planetary system in which two transiting planets with radii ∼7 R{sub ⊕} (inner planet b) and ∼4 R{sub ⊕} (outer planet c) have orbits that are nearly in a 3:2 mean-motion resonance. Here, we present results of ground-based follow-up observations for the K2-19 planetary system. We have performed high-dispersion spectroscopy and high-contrast adaptive-optics imaging of the host star with the HDS and HiCIAO on the Subaru 8.2 m telescope. We find that the host star is a relatively old (≥8 Gyr) late G-type star (T{sub eff} ∼ 5350 K, M{sub s} ∼ 0.9 M{sub ⊙}, and R{sub s} ∼ 0.9 R{sub ⊙}). We do not find any contaminating faint objects near the host star that could be responsible for (or dilute) the transit signals. We have also conducted transit follow-up photometry for the inner planet with KeplerCam on the FLWO 1.2 m telescope, TRAPPISTCAM on the TRAPPIST 0.6 m telescope, and MuSCAT on the OAO 1.88 m telescope. We confirm the presence of transit timing variations (TTVs), as previously reported by Armstrong and coworkers. We model the observed TTVs of the inner planet using the synodic chopping formulae given by Deck and Agol. We find two statistically indistinguishable solutions for which the period ratios (P{sub c}/P{sub b}) are located slightly above and below the exact 3:2 commensurability. Despite the degeneracy, we derive the orbital period of the inner planet P{sub b} ∼ 7.921 days and the mass of the outer planet M{sub c} ∼ 20 M{sub ⊕}. Additional transit photometry (especially for the outer planet) as well as precise radial-velocity measurements would be helpful to break the degeneracy and to determine the mass of the inner planet.
Directory of Open Access Journals (Sweden)
D. A. Fink
2015-02-01
Full Text Available A Laser Ion Source and Trap (LIST for a thick-target, isotope-separation on-line facility has been implemented at CERN ISOLDE for the production of pure, laser-ionized, radioactive ion beams. It offers two modes of operation, either as an ion guide, which performs similarly to the standard ISOLDE resonance ionization laser ion source (RILIS, or as a more selective ion source, where surface-ionized ions from the hot ion-source cavity are repelled by an electrode, while laser ionization is done within a radio-frequency quadrupole ion guide. The first physics application of the LIST enables the suppression of francium contamination in ion beams of neutron-rich polonium isotopes at ISOLDE by more than 1000 with a reduction in laser-ionization efficiency of only 20. Resonance ionization spectroscopy is performed directly inside the LIST device, allowing the study of the hyperfine structure and isotope shift of ^{217}Po for the first time. Nuclear decay spectroscopy of ^{219}Po is performed for the first time, revealing its half-life, α-to-β-decay branching ratio, and α-particle energy. This experiment demonstrates the applicability of the LIST at radioactive ion-beam facilities for the production and study of pure beams of exotic isotopes.
Jacobson, Denise L.; Williams, Paige; Tassiopoulos, Katherine; Melvin, Ann; Hazra, Rohan; Farley, John
2011-01-01
Background Hypercholesterolemia is common in perinatally HIV-infected (HIV+) children, but little is known about the clinical course and management in this population. Methods We studied HIV+ children in a multisite prospective cohort study (PACTG 219C) and considered follow-up for two years after development of hypercholesterolemia. We estimated the time to and factors associated with resolution of hypercholesterolemia and described changes in ARV regimen and use of lipid-lowering medications. We defined incident hypercholesterolemia as entry total cholesterol (cholesterol) hypercholesterolemia as two consecutive cholesterol hypercholesterolemia. Results Among 240 incident hypercholesterolemia cases, 81 (34%) had resolution to normal cholesterol within two years of follow-up (median follow-up = 1.9 years). The median age of cases was 10.3 years with 54% Non-Hispanic black and 53% male. Resolution to normal cholesterol was more likely in children who changed ARV regimen (adjusted Hazard Ratio (aHR) = 2.37, 95%CI 1.45, 3.88) and who were ≥ 13 years old (aHR=2.39, 95%CI 1.33, 4.27). Types of regimen changes varied greatly and 15 children began statins. Conclusions The majority of children who develop hypercholesterolemia maintain elevated levels over time, potentially placing them at risk for premature cardiovascular morbidity. PMID:21602698
Fabbian, Fabio; Gallerani, Massimo; Pala, Marco; De Giorgi, Alfredo; Salmi, Raffaella; Dentali, Francesco; Ageno, Walter; Manfredini, Roberto
2014-11-01
Using a regional Italian database, we evaluated the relationship between renal dysfunction and in-hospital mortality (IHM) in patients with acute stroke (ischemic/hemorrhagic). Patients were classified on the basis of renal damage: without renal dysfunction, with chronic kidney disease (CKD), and with end-stage renal disease (ESRD). Of a total of 186,219 patients with a first episode of stroke, 1626 (0.9%) had CKD and 819 (0.4%) had ESRD. Stroke-related IHM (total cases) was independently associated with CKD, ESRD, atrial fibrillation (AF), age, and Charlson comorbidity index (CCI). In patients with ischemic stroke (n=154,026), IHM remained independently associated with CKD, ESRD, AF, and CCI. In patients with hemorrhagic stroke (n=32,189), variables that were independently associated with IHM were CKD, ESRD, and AF. Renal dysfunction is associated with IHM related to stroke, both ischemic and hemorrhagic, with even higher odds ratios than those of other established risk factors, such as age, comorbidities, and AF. © The Author(s) 2013.
Directory of Open Access Journals (Sweden)
Spande Thomas F
2007-09-01
Full Text Available Abstract Background The 5,8-disubstituted indolizidines are the largest class of poison-frog alkaloids found in anuran skin, and are of considerable interest because of their inhibitory effects on the neuronal nicotinic acetylcholine receptors. Many synthetic strategies for the construction of this nucleus have been reported: however, a flexible route has not been reported to date. Results Synthesis of lactam chiral building blocks for the flexible synthesis of the title alkaloids has been achieved using a Michael-type conjugate addition reaction to a chiral cyclic enamine ester as the key step in constructing the trisubstituted piperidine ring system. To demonstrate the usefulness of these chiral building blocks, syntheses of (--203A, (--205A from 1, and (--219F from 2 have been achieved. Conclusion The total synthesis of (--203A, (--205A, and (--219F was achieved, and the absolute stereochemistry of natural 203A was determined to be 5S, 8R, 9S. In addition, the relative stereochemistry of natural 219F was determined.
Yu, Yu; Qian, Lei; Cui, Jiuwei
2017-09-01
Current evidence suggests that the neutrophil-to-lymphocyte ratio (NLR) may be a biomarker for poor prognosis in lung cancer, although this association remains controversial. Therefore, a meta-analysis was performed to evaluate the association between NLR and lung cancer outcome. A systematic literature search was performed through the PubMed, Embase and Cochrane Library databases (until July 30, 2016), to identify studies evaluating the association between NLR and overall survival (OS) and/or progression-free survival (PFS) among patients with lung cancer. Based on the results of this search, data from 18 studies involving 7,219 patients with lung cancer were evaluated. The pooled hazard ratio (HR) suggested that elevated pretreatment NLR predicted poor OS [HR=1.46, 95% confidence interval (CI): 1.30-1.64] and poor PFS (HR=1.42, 95% CI: 1.15-1.75) among patients with lung cancer. Subgroup analysis revealed that the prognostic value of NLR for predicting poor OS increased among patients who underwent surgery (HR=1.50, 95% CI: 1.21-1.84) or patients with early-stage disease (HR=1.64, 95% CI: 1.37-1.97). An NLR cut-off value of ≥4 significantly predicted poor OS (HR=1.56, 95% CI: 1.31-1.85) and PFS (HR=1.54, 95% CI: 1.13-1.82), particularly in the cases of small-cell lung cancer. Thus, the results of the present meta-analysis suggested that an elevated pretreatment NLR (e.g., ≥4) may be considered as a biomarker for poor prognosis in patients with lung cancer.
Mazzilli, Rossella; Cimadomo, Danilo; Vaiarelli, Alberto; Capalbo, Antonio; Dovere, Lisa; Alviggi, Erminia; Dusi, Ludovica; Foresta, Carlo; Lombardo, Francesco; Lenzi, Andrea; Tournaye, Herman; Alviggi, Carlo; Rienzi, Laura; Ubaldi, Filippo Maria
2017-12-01
To evaluate the impact of the male factor on the outcomes of intracytoplasmic sperm injection (ICSI) cycles combined with preimplantation genetic testing for aneuploidies (PGT-A). Observational longitudinal cohort study. Private in vitro fertilization (IVF) center. A total of 1,219 oocyte retrievals divided into five study groups according to sperm parameters: normozoospermia (N), moderate male factor (MMF), severe oligoasthenoteratozoospermia (OAT-S), obstructive azoospermia (OA), and nonobstructive azoospermia (NOA). ICSI with ejaculated/surgically retrieved sperm, blastocyst culture, trophectoderm-based quantitative polymerase chain reaction PGT-A, and frozen-warmed euploid embryo transfer (ET). The primary outcome measures were fertilization, blastocyst development, and euploidy rates; the secondary outcome measures were live birth and miscarriage rates. Perinatal and obstetrical outcomes were monitored as well. A total of 9,042 metaphase II oocytes were inseminated. The fertilization rate was significantly reduced in MMF, OAT-S, OA, and NOA compared with N (74.8%, 68.7%, 67.3%, and 53.1% vs. 77.2%). The blastocyst rate per fertilized oocyte was significantly reduced in MMF and NOA compared with N (48.6% and 40.6% vs. 49.3%). The timing of blastocyst development also was affected in OA and NOA. Logistic regression analysis adjusted for confounders highlighted NOA as a negative predictor of obtaining an euploid blastocyst per OPU (odds ratio 0.5). When the analysis was performed per obtained blastocyst, however, no correlation between male factor and euploidy rate was observed. Embryo transfers also resulted in similar live birth and miscarriage rates. No impact of sperm factor on obstetrical/perinatal outcomes was observed. Severe male factor impairs early embryonic competence in terms of fertilization rate and developmental potential. However, the euploidy rate and implantation potential of the obtained blastocysts are independent from sperm quality
Probabilistic risk assessment: Number 219
International Nuclear Information System (INIS)
Bari, R.A.
1985-01-01
This report describes a methodology for analyzing the safety of nuclear power plants. A historical overview of plants in the US is provided, and past, present, and future nuclear safety and risk assessment are discussed. A primer on nuclear power plants is provided with a discussion of pressurized water reactors (PWR) and boiling water reactors (BWR) and their operation and containment. Probabilistic Risk Assessment (PRA), utilizing both event-tree and fault-tree analysis, is discussed as a tool in reactor safety, decision making, and communications. (FI)
Breton, Jacques; Lavergne, Jérôme; Wakeham, Marion C; Nabedryk, Eliane; Jones, Michael R
2007-06-05
In native reaction centers (RCs) from photosynthetic purple bacteria the primary quinone (QA) and the secondary quinone (QB) are interconnected via a specific His-Fe-His bridge. In Rhodobacter sphaeroides RCs the C4=O carbonyl of QA forms a very strong hydrogen bond with the protonated Npi of His M219, and the Ntau of this residue is in turn coordinated to the non-heme iron atom. The second carbonyl of QA is engaged in a much weaker hydrogen bond with the backbone N-H of Ala M260. In previous work, a Trp side chain was introduced by site-directed mutagenesis at the M260 position in the RC of Rb. sphaeroides, resulting in a complex that is completely devoid of QA and therefore nonfunctional. A photochemically competent derivative of the AM260W mutant was isolated that contains a Cys side chain at the M260 position (denoted AM260(W-->C)). In the present work, the interactions between the carbonyl groups of QA and the protein in the AM260(W-->C) suppressor mutant have been characterized by light-induced FTIR difference spectroscopy of the photoreduction of QA. The QA-/QA difference spectrum demonstrates that the strong interaction between the C4=O carbonyl of QA and His M219 is lost in the mutant, and the coupled CO and CC modes of the QA- semiquinone are also strongly perturbed. In parallel, a band assigned to the perturbation of the C5-Ntau mode of His M219 upon QA- formation in the native RC is lacking in the spectrum of the mutant. Furthermore, a positive band between 2900 and 2400 cm-1 that is related to protons fluctuating within a network of highly polarizable hydrogen bonds in the native RC is reduced in amplitude in the mutant. On the other hand, the QB-/QB FTIR difference spectrum is essentially the same as for the native RC. The kinetics of electron transfer from QA- to QB were measured by the flash-induced absorption changes at 780 nm. Compared to native RCs the absorption transients are slowed by a factor of about 2 for both the slow phase (in the
Final Report for grant entitled "Production of Astatine-211 for U.S. Investigators"
Energy Technology Data Exchange (ETDEWEB)
Wilbur, Daniel Scott
2012-12-12
Alpha-particle emitting radionuclides hold great promise in the therapy of cancer, but few alpha-emitters are available to investigators to evaluate. Of the alpha-emitters that have properties amenable for use in humans, 211At is of particular interest as it does not have alpha-emitting daughter radionuclides. Thus, there is a high interest in having a source of 211At for sale to investigators in the US. Production of 211At is accomplished on a cyclotron using an alpha-particle beam irradiation of bismuth metal. Unfortunately, there are few cyclotrons available that can produce an alpha particle beam for that production. The University of Washington has a cyclotron, one of three in the U.S., that is currently producing 211At. In the proposed studies, the things necessary for production and shipment of 211At to other investigators will be put into place at UW. Of major importance is the efficient production and isolation of 211At in a form that can be readily used by other investigators. In the studies, production of 211At on the UW cyclotron will be optimized by determining the best beam energy and the highest beam current to maximize 211At production. As it would be very difficult for most investigators to isolate the 211At from the irradiated target, the 211At-isolation process will be optimized and automated to more safely and efficiently obtain the 211At for shipment. Additional tasks to make the 211At available for distribution include obtaining appropriate shipping vials and containers, putting into place the requisite standard operating procedures for Radiation Safety compliance at the levels of 211At activity to be produced / shipped, and working with the Department of Energy, Isotope Development and Production for Research and Applications Program, to take orders, make shipments and be reimbursed for costs of production and shipment.
International Nuclear Information System (INIS)
Meyer, G.J.; Roessler, K.; Stoecklin, G.
1979-01-01
Systematic studies of the astatodiazoniation reaction and a comparison with iododediazoniation under comparable conditions are reported. The yields for all astatohalobenzenes and -toluenes were nearly constant and unaffected by the nature of the diazonium compound, its isomeric form, and the number of isomers used at the same time. Only astatofluorobenzenes were obtained at higher yields. An electron-transfer mechanism is proposed for dediazoniation at these low halide concentration levels. At sufficient thermal excitation levels the electron transfer leads to the dissociation of nitrogen, while the phenyl and halogen radicals recombine. The isomer distribution found for some of the derivatives from dediazoniation may also be due to steric effects
International Nuclear Information System (INIS)
Foulon, Catherine F.; Alston, Kevin L.; Zalutsky, Michael R.
1998-01-01
We report herein the preparation and biological evaluation of two radioastatinated biotin conjugates, (3-[ 211 At]astatobenzoyl)norbiotinamide and ((5-[ 211 At]astato-3-pyridinyl)carbonyl)norbiotinamide. Both conjugates were stable in the presence of human serum and cerebrospinal fluid as well as murine serum, indicating a resistance to degradation to biotinidase. The normal tissue clearance of (3-[ 211 At]astatobenzoyl)norbiotinamide and ((5-[ 211 At]astato-3-pyridinyl)carbonyl)norbiotinamide was rapid, as observed previously with their iodo analogues. Also reported are the first syntheses of N-succinimidyl 5-[ 211 At]astato-3-pyridinecarboxylate and 3-[ 211 At]astatoaniline, two reagents of potential utility for labeling proteins and peptides with 211 At
Microdosimetry of astatine-211 and comparison with that of iodine-125
International Nuclear Information System (INIS)
Unak, T.
2001-01-01
211 At is an alpha and Auger emitter radionuclide and has been frequently used for labeling of different kind of chemical agents. 125 I is also known as an effective Auger emitter. The radionuclides which emit short range and high LET radiations such as alpha particles and Auger electrons have high radiotoxic effectiveness on the living systems. The microdosimetric data are suitable to clarify the real radiotoxic effectiveness and to get the detail of diagnostic and therapeutic application principles of these radionuclides. In this study, the energy and dose absorptions by cell nucleus from alpha particles and Auger electrons emitted by 211 At have been calculated using a Monte Carlo calculation program (code: UNMOC). For these calculations two different model corresponding to the cell nucleus have been used and the data obtained were compared with the data earlier obtained for 125 I. As a result, the radiotoxicity of 211 At is in the competition with 125 I. In the case of a specific agent labelled with 211 At or 125 I is incorporated into the cell or cell nucleus, but non-bound to DNA or not found very close to it, 211 At should considerably be much more radiotoxic than 125 I, but in the case of the labelled agent is bound to DNA or take a place very close to it, the radiotoxicity of 125 I should considerably be higher than 211 At. (author)
International Nuclear Information System (INIS)
Wilbur, Daniel Scott
2016-01-01
This research is a collaborative effort between the research groups of the PIs, Dr. D. Scott Wilbur in the Department of Radiation Oncology at the University of Washington (UW) and Matthew O'Hara at the Pacific Northwest National Laboratory (PNNL). In this report only those studies conducted at UW and the budget information from UW will be reported. A separate progress and financial report will be provided by PNNL. This final report outlines the experiments (Tasks) conducted and results obtained at UW from July 1, 2013 thru June 30, 2016 (2-year project with 1 year no-cost extension). The report divides the information on the experiments and results obtained into the 5 specific objectives of the research efforts and the Tasks within those objectives. This format is used so that it is easy to see what has been accomplished in each area. A brief summary of the major findings from the studies is provided below. Summary of Major Findings from Research/Training Activities at UW: Anion and cation exchange columns did not provide adequate 211 At capture and/or extraction results under conditions studied to warrant further evaluation; PEG-Merrifield resins containing mPEG350, mPEG750, mPEG2000 and mPEG5000 were synthesized and evaluated; All of the mPEG resins with different sized mPEG moieties conjugated gave similar 211 At capture (>95%) from 8M HCl solutions and release with conc. NH 4 OH (~50-80%), but very low quantities were released when NaOH was used as an eluent; Capture and release of 211 At when loading [ 211 At]astatate appeared to be similar to that of [ 211 At]astatide on PEG columns, but further studies need to be conducted to confirm that; Capture of 211 At on PEG columns was lower (e.g. 80-90%) from solutions of 8M HNO 3 , but higher capture rates (e.g. 99%) can be obtained when 10M HNO 3 is mixed with an equal quantity of 8M HCl; Addition of reductants to the 211 At solutions did not appear to change the percent capture, but may have an effect on the % extracted; There was some indication that the PEG-Merrifield resins could be saturated (perhaps with Bi) resulting in lower capture percentages, but more studies need to be done to confirm that; A target dissolution chamber, designed and built at PNNL, works well with syringe pumps so it can be used in an automated system; Preliminary semi-automated 211 At isolation studies have been conducted with full-scale target dissolution and 211 At isolation using a PEG column on the Hamilton automated system gave low overall recoveries, but HNO 3 was used (rather than HCl) for loading the 211 At and flow rates were not optimized; Results obtained using PEG columns are high enough to warrant further development on a fully automated system; Results obtained also indicate that additional studies are warranted to evaluate other types of columns for 211 At separation from bismuth, which allow use of HNO 3 /HCl mixtures for loading and NaOH for eluting 211 At. Such a column could greatly simplify the overall isolation process and make it easier to automate.
The potential of 211Astatine for NIS-mediated radionuclide therapy in prostate cancer
International Nuclear Information System (INIS)
Willhauck, Michael J.; Sharif Samani, Bibi-Rana; Goeke, Burkhard; Wolf, Ingo; Senekowitsch-Schmidtke, Reingard; Stark, Hans-Juergen; Meyer, Geerd J.; Knapp, Wolfram H.; Morris, John C.; Spitzweg, Christine
2008-01-01
We reported recently the induction of selective iodide uptake in prostate cancer cells (LNCaP) by prostate-specific antigen (PSA) promoter-directed sodium iodide symporter (NIS) expression that allowed a significant therapeutic effect of 131 I. In the current study, we studied the potential of the high-energy alpha-emitter 211 At, also transported by NIS, as an alternative radionuclide after NIS gene transfer in tumors with limited therapeutic efficacy of 131 I due to rapid iodide efflux. We investigated uptake and therapeutic efficacy of 211 At in LNCaP cells stably expressing NIS under the control of the PSA promoter (NP-1) in vitro and in vivo. NP-1 cells concentrated 211 At in a perchlorate-sensitive manner, which allowed a dramatic therapeutic effect in vitro. After intrapertoneal injection of 211 At (1 MBq), NP-1 tumors accumulated approximately 16% ID/g 211 At (effective half-life 4.6 h), which resulted in a tumor-absorbed dose of 1,580 ± 345 mGy/MBq and a significant tumor volume reduction of up to 82 ± 19%, while control tumors continued their growth exponentially. A significant therapeutic effect of 211 At has been demonstrated in prostate cancer after PSA promoter-directed NIS gene transfer in vitro and in vivo suggesting a potential role for 211 At as an attractive alternative radioisotope for NIS-targeted radionuclide therapy, in particular in smaller tumors with limited radionuclide retention time. (orig.)
Sci-Thur AM: YIS – 01: New technologies for astatine-211 targeted alpha therapy research
Energy Technology Data Exchange (ETDEWEB)
Crawford, Jason; Yang, Hua; Schaffer, Paul; Ruth, Thomas [University of Victoria, Victoria, BC (Canada); TRIUMF, Vancouver, BC (Canada)
2016-08-15
Purpose: The short-range, densely ionizing α-particles emitted by {sup 211}At (t{sub 1/2}=7.2h) are well suited for the treatment of diffuse microscopic disease, using cancer targeting biomolecules. {sup 211}At availability is limited by the rarity of α-cyclotrons required for standard production. Image-based dosimetry is also limited for {sup 211}At, which emits low intensity X-rays. Our goal was to leverage state-of-the-art infrastructure at TRIUMF to produce and evaluate two related isotopes, {sup 211}Rn (t{sub 1/2}=14.6h, 73% decay to {sup 211}At) as a generator for {sup 211}At, and {sup 209}At (t{sub 1/2}=5.4h, X-ray/gamma-ray emitter) as a novel 211At surrogate for preclinical imaging studies. Methods: Produced by spallation of uranium with 480 MeV protons, mass separated ion beams of short-lived francium isotopes were implanted into NaCl targets where {sup 211}Rn or {sup 209}At were produced by radioactive decay, in situ. {sup 211}Rn was transferred to dodecane from which {sup 211}At was efficiently extracted and evaluated for clinical applicability. High energy SPECT/CT was evaluated for measuring {sup 209}At activity distributions in mice and phantoms. Results: Our small scale {sup 211}Rn/{sup 211}At generator system provided high purity {sup 211}At samples. The methods are immediately scalable to the level of radioactivity required for in vivo experiments with {sup 211}At. {sup 209}At-based high energy SPECT imaging was determined suitable for pursuing image-based dosimetry in mouse tumour models. In the future, we will utilize quantitative {sup 209}At-SPECT for image-based dose calculations. Conclusion: These early studies provided a foundation for future endeavours with {sup 211}At-based α-therapy. Canada is now significantly closer to clinical targeted α-therapy of cancer.
Teze, David; Sergentu, Dumitru-Claudiu; Kalichuk, Valentina; Barbet, Jacques; Deniaud, David; Galland, Nicolas; Maurice, Rémi; Montavon, Gilles
2017-05-31
211 At is a most promising radionuclide for targeted alpha therapy. However, its limited availability and poorly known basic chemistry hamper its use. Based on the analogy with iodine, labelling is performed via astatobenzoate conjugates, but in vivo deastatination occurs, particularly when the conjugates are internalized in cells. Actually, the chemical or biological mechanism responsible for deastatination is unknown. In this work, we show that the C-At "organometalloid" bond can be cleaved by oxidative dehalogenation induced by oxidants such as permanganates, peroxides or hydroxyl radicals. Quantum mechanical calculations demonstrate that astatobenzoates are more sensitive to oxidation than iodobenzoates, and the oxidative deastatination rate is estimated to be about 6 × 10 6 faster at 37 °C than the oxidative deiodination one. Therefore, we attribute the "internal" deastatination mechanism to oxidative dehalogenation in biological compartments, in particular lysosomes.
Production of Astatine-211 at the Duke University Medical Center for its regional distribution
Energy Technology Data Exchange (ETDEWEB)
Zalutsky, Michael [Duke University Medical Center, Durham, NC (United States)
2016-01-01
Systemic targeted radiation therapy and radioimmunotherapy continue to be important tools in the treatment of certain cancers. Because of their high energy and short path length, alpha particle emitters such as 211At are more effective than either external beam x- ray or in vivo beta radiation in delivering potentially curative doses of radiation. The limited clinical trials that have been conducted to date have yielded encouraging responses in some patients, e.g., malignant brain tumors. In order to escalate the additional necessary research and development in radiochemistry, radiobiology and efficacy evaluation of alpha particle radiotherapeutics, it is universally agreed that access to an affordable, reliable supply of 211At is warranted. In conjunction with the Department of Energy's intent to enhance stable and radioactive isotope availability for research applications, it is the primary objective of this project to improve 211At production and purification capabilities at Duke so that this radionuclide can be supplied to researchers at other institutions throughout the US.The most widely used 211At production method involves the α,2n reaction on Bismuth using a cyclotron with beams ≤ 28 MeV. Yields can be enhanced with use of an internal target that allows for a higher alpha fluence plus efficient heat dissipation in the target. Both of these items are in place at Duke; however, in order to support production for multi-institutional use, irradiation campaigns in excess of 50 µAp and four hours duration will be needed. Further, post-irradiation processing equipment is lacking that will enable the distribution process. Financial support is sought for i) a shielded, ventilated processing/containment hood; ii) development of a post-irradiation target retrieval system; iii) fabrication of a 211At distillation and recovery module and iv) a performance review and, where needed, an enhancement of seven major subsystems that comprise the CS-30 Cyclotron. With these modifications in place, routine production of ≥200 mCi of At-211 should be readily achievable, given our methodological development of At-211 target preparation, internal target irradiation and dry distillation to recover the radionuclide.
Use of interhalogen exchange for preparation of astatine-benzene and iodo-benzene
International Nuclear Information System (INIS)
Kolachkovski, A.; Khalkin, V.A.
1976-01-01
Experimental testing of interhalogen exchange between the solid and liquid phases has been carried out at 155 deg C with particular reference to a NaOH-Na 131 I-BrPh system. Iodine transition rate is dependent on the process duration and alkali amount. The relative amounts of 131 IPh resultant from the reaction of interhalogen exchange is evaluated by paper chromatography. The results obtained may be considered as those which provide experimental support for the assumed efficiency of the production of 131 IPh based on the reaction of interhalogen exchange to yield 70-80% 131 IPh
International Nuclear Information System (INIS)
Ogawa, Kazuma; Mizuno, Yoshiaki; Washiyama, Kohshin; Shiba, Kazuhiro; Takahashi, Naruto; Kozaka, Takashi; Watanabe, Shigeki; Shinohara, Atsushi; Odani, Akira
2015-01-01
Introduction: Sigma receptors are overexpressed in a variety of human tumors, making them potential targets for radionuclide receptor therapy. We have previously synthesized and evaluated 131 I-labeled (+)-2-[4-(4-iodophenyl)piperidino]cyclohexanol [(+)-[ 131 I]pIV], which has a high affinity for sigma receptors. Therefore, (+)-[ 131 I]pIV significantly inhibited tumor cell proliferation in tumor-bearing mice. In the present study, we report the synthesis and the in vitro and in vivo characterization of (+)-[ 211 At]pAtV, an 211 At-labeled sigma receptor ligand, that has potential use in alpha-radionuclide receptor therapy. Methods: The radiolabeled sigma receptor ligand (+)-[ 211 At]pAtV was prepared using a standard halogenation reaction generating a 91% radiochemical yield with 98% purity after HPLC purification. The partition coefficient of (+)-[ 211 At]pAtV was measured. Cellular uptake experiments and in vivo biodistribution experiments were performed using a mixed solution of (+)-[ 211 At]pAtV and (+)-[ 125 I]pIV; the human prostate cancer cell line DU-145, which expresses high levels of the sigma receptors, and DU-145 tumor-bearing mice. Results: The lipophilicity of (+)-[ 211 At]pAtV was similar to that of (+)-[ 125 I]pIV. DU-145 cellular uptake and the biodistribution patterns in DU-145 tumor-bearing mice at 1 h post-injection were also similar between (+)-[ 211 At]pAtV and (+)-[ 125 I]pIV. Namely, (+)-[ 211 At]pAtV demonstrated high uptake and retention in tumor via binding to sigma receptors. Conclusion: These results indicate that (+)-[ 211 At]pAtV could function as an new agent for alpha-radionuclide receptor therapy.
Ogawa, Kazuma; Mizuno, Yoshiaki; Washiyama, Kohshin; Shiba, Kazuhiro; Takahashi, Naruto; Kozaka, Takashi; Watanabe, Shigeki; Shinohara, Atsushi; Odani, Akira
2015-11-01
Sigma receptors are overexpressed in a variety of human tumors, making them potential targets for radionuclide receptor therapy. We have previously synthesized and evaluated (131)I-labeled (+)-2-[4-(4-iodophenyl)piperidino]cyclohexanol [(+)-[(131)I]pIV], which has a high affinity for sigma receptors. Therefore, (+)-[(131)I]pIV significantly inhibited tumor cell proliferation in tumor-bearing mice. In the present study, we report the synthesis and the in vitro and in vivo characterization of (+)-[(211)At]pAtV, an (211)At-labeled sigma receptor ligand, that has potential use in alpha-radionuclide receptor therapy. The radiolabeled sigma receptor ligand (+)-[(211)At]pAtV was prepared using a standard halogenation reaction generating a 91% radiochemical yield with 98% purity after HPLC purification. The partition coefficient of (+)-[(211)At]pAtV was measured. Cellular uptake experiments and in vivo biodistribution experiments were performed using a mixed solution of (+)-[(211)At]pAtV and (+)-[(125)I]pIV; the human prostate cancer cell line DU-145, which expresses high levels of the sigma receptors, and DU-145 tumor-bearing mice. The lipophilicity of (+)-[(211)At]pAtV was similar to that of (+)-[(125)I]pIV. DU-145 cellular uptake and the biodistribution patterns in DU-145 tumor-bearing mice at 1h post-injection were also similar between (+)-[(211)At]pAtV and (+)-[(125)I]pIV. Namely, (+)-[(211)At]pAtV demonstrated high uptake and retention in tumor via binding to sigma receptors. These results indicate that (+)-[(211)At]pAtV could function as an new agent for alpha-radionuclide receptor therapy. Copyright © 2015 Elsevier Inc. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
Hlodak, M [Univerzita Komenskeho v Bratislave, Prirodovedecka fakulta, Ustav laboratorneho vyskumu geomaterialov, 84215 Bratislava (Slovakia)
2012-04-25
Soil contamination by different PTSD may have different geogenic and anthropogenic origin and occurs in all countries of the world. The aim of this paper is to evaluate the soils contamination of a lower plain of the Hron River. This paper used the results of the thesis Soil contamination of the Hron River floodplain by trace elements (As, Cd, Cu, Hg, Pb, Zn) [1]. Soil contamination was evaluated by: Act. 219/2008 Coll. on the protection and use of agricultural land, by anthropogenic factor (AF), geo-accumulation index (IgeoE) and Tomlinson index - the index of the pollution load (PLI). (author)
Directory of Open Access Journals (Sweden)
Marie Hélène C. Torres
2014-12-01
Full Text Available Ensaios de Teoria e Prática de Tradução. A tradução na sala de aula. Maria Alice Araújo Ferreira, Germana Henriques Pereira de Souza e Sabine Gorovitz (Org., Brasília: Editora da UnB, 2014. 219 p.
Directory of Open Access Journals (Sweden)
Fiona Hey
Full Text Available The WNT signalling pathway controls many developmental processes and plays a key role in maintenance of intestine renewal and homeostasis. Glycogen Synthase Kinase 3 (GSK3 is an important component of the WNT pathway and is involved in regulating β-catenin stability and expression of WNT target genes. The mechanisms underpinning GSK3 regulation in this context are not completely understood, with some evidence suggesting this occurs through inhibitory N-terminal serine phosphorylation in a similar way to GSK3 inactivation in insulin signaling. To investigate this in a physiologically relevant context, we have analysed the intestinal phenotype of GSK3 knockin mice in which N-terminal serines 21/9 of GSK3α/β have been mutated to non-phosphorylatable alanine residues. We show that these knockin mutations have very little effect on overall intestinal integrity, cell lineage commitment, β-catenin localization or WNT target gene expression although a small increase in apoptosis at villi tips is observed. Our results provide in vivo evidence that GSK3 is regulated through mechanisms independent of N-terminal serine phosphorylation in order for β-catenin to be stabilised.
Directory of Open Access Journals (Sweden)
Marie Hélène C. Torres
2014-12-01
Full Text Available http://dx.doi.org/10.5007/2175-7968.2014v2n34p294 Ensaios de Teoria e Prática de Tradução. A tradução na sala de aula. Maria Alice Araújo Ferreira, Germana Henriques Pereira de Souza e Sabine Gorovitz (Org., Brasília: Editora da UnB, 2014. 219 p.
Torres, Marie Hélène C.
2014-01-01
http://dx.doi.org/10.5007/2175-7968.2014v2n34p294 Ensaios de Teoria e Prática de Tradução. A tradução na sala de aula. Maria Alice Araújo Ferreira, Germana Henriques Pereira de Souza e Sabine Gorovitz (Org.), Brasília: Editora da UnB, 2014. 219 p.
Rehm, Colin D; Drewnowski, Adam; Monsivais, Pablo
2015-01-01
Dietary guidance emphasizes plain low-fat and skim milk over whole, reduced-fat, and flavored milk (milk eligible for replacement [MER]). The objective of this study was to evaluate the population-level impact of such a change on energy, macronutrient and nutrient intakes, and diet cost. Cross-sectional modeling study. Data from the 2001-2002 and 2003-2004 National Health and Nutrition Examination Survey. A total of 8,112 children aged 2-19 years. Energy, macronutrient, and micronutrient intake before and after replacement of MER with low-fat or skim milk. Survey-weighted linear regression models. Milk eligible for replacement accounted for 46% of dairy servings. Among MER consumers, replacement with skim or low-fat milk would lead to a projected reduction in energy of 113 (95% confidence interval [CI], 107-119) and 77 (95% CI, 73-82) kcal/d and percent energy from saturated fat by an absolute value of 2.5% of total energy (95% CI, 2.4-2.6) and 1.4% (95% CI, 1.3-1.5), respectively. Replacement of MER does not change diet costs or calcium and potassium intake. Substitution of MER has the potential to reduce energy and total and saturated fat intake with no impact on diet costs or micronutrient density. The feasibility of such replacement has not been examined and there may be negative consequences if replacement is done with non-nutrient-rich beverages. Copyright © 2015. Published by Elsevier Inc.
Publications | Page 219 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
... (restricted access). Conventional energy generation is a fundamental cause for competing demands on natural resources of both water and energy sectors, and is a significant contributor to anthropogenic climate change. This research seeks to identify barriers to wide-scale penetration of renewable energy technologies.
28 CFR 2.19 - Information considered.
2010-07-01
... is imprisoned about the financial, social, psychological, and emotional harm done to, or loss... Commission with specific facts and reasoning relevant to the statutory criteria for parole (18 U.S.C. 4206..., to be most helpful, a recommendation should state its underlying factual basis and reasoning. However...
219 ORIGINAL ARTICLE SEROPREVALENCE OF HEPATITIS C ...
African Journals Online (AJOL)
boaz
ABSTRACT. Background: Hepatitis C virus (HCV) infection is a major public health concern. The aim of this study was to ascertain the seroprevalence and risk factors of HCV antibodies among pregnant women in Anyigba, Kogi State North Central Nigeria. Materials and methods:Blood samples (5mls) were collected from ...
2010-01-01
... institution means any office of a bank, savings bank, card issuer as defined in section 103 of the Consumers Credit Protection Act (15 U.S.C. 1602(n)), industrial loan company, trust company, savings association, building and loan, or homestead association (including cooperative banks), credit union, or consumer...
Publications | Page 219 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Science-policy dialogues for water security : addressing vulnerability and adaptation to global change in the arid Americas (restricted access) ... Impact of maternal and child health private expenditure on poverty and inequity in Bangladesh : out-of-pocket payments by patients at Ministry of Health and Family Welfare ...
2010-07-01
... planning framework. Land and resource management planning is a flexible process for fitting solutions to... responsible for national planning. National planning includes the Forest Service national strategic plan... Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE PLANNING National Forest...
12 CFR 219.24 - Retention period.
2010-01-01
... PROVIDING FINANCIAL RECORDS; RECORDKEEPING REQUIREMENTS FOR CERTAIN FINANCIAL RECORDS (REGULATION S... period of time, taking into consideration the nature of the record and the amount of time that has...
12 CFR 219.3 - Cost reimbursement.
2010-01-01
... that the financial institution use programming or other higher level technical services of a computer... (private sector) set out in the Employment Cost Trends section of the National Compensation Survey (http... PROVIDING FINANCIAL RECORDS; RECORDKEEPING REQUIREMENTS FOR CERTAIN FINANCIAL RECORDS (REGULATION S...
49 CFR 219.23 - Railroad policies.
2010-10-01
... approved forms for mandatory post-accident toxicological testing under subpart C of this part provides the... start of alcohol testing under the railroad's alcohol misuse prevention program and to each person... the work day the covered employee is required to be in compliance with this part is that period when...
2010-01-01
... financial records or information related to: (a) Security interests, bankruptcy claims, debt collection. Any... loan insurance program. (c) Nonidentifiable information. Financial records that are not identified with.... (f) Federally required reports. Financial records required to be reported in accordance with any...
2010-04-01
..., emotional or mental illness, and specific learning disabilities. The term “physical or mental impairment... person means any person who has a physical or mental impairment that substantially limits one or more.... As used in this definition, the phrase: (1) Physical or mental impairment includes— (i) Any...
2010-10-01
..., DEPARTMENT OF TRANSPORTATION HAZARDOUS MATERIALS AND OIL TRANSPORTATION HAZARDOUS MATERIALS PROGRAM... with the disposition of previous applications for waiver of preemption determinations. [Amdt. 107-3, 41...
Publications | Page 219 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Using Technology to Document Violations: Enabling Sex Worker Communities to Document Violence Against Them in India and Cambodia (open access). The project achieved the following; a significant shift in advocacy strategies from reactive to proactive strategies with a potential impact on the lives and wellbeing of ...
32 CFR 219.107 - IRB membership.
2010-07-01
... counsel in safeguarding the rights and welfare of human subjects. In addition to possessing the... subjects, such as children, prisoners, pregnant women, or handicapped or mentally disabled persons... IRB consists entirely of men or entirely of women, including the institution's consideration of...
48 CFR 219.1005 - Applicability.
2010-10-01
... objects, which otherwise meet criteria in FAR subpart 19.10. (b) The targeted industry categories for DoD are: North American Industry Classification System (NAICS) Description NAICS Code (1) Pharmaceutical... Navigation System and Instrument Manufacturing 334511 (10) (i) Cellular and Other Wireless Telecommunications...
211 At-labeled agents for alpha-immunotherapy: On the in vivo stability of astatine-agent bonds
Ayed , Tahra ,; Pilmé , Julien; Tézé , David; Bassal , Fadel ,; Barbet , Jacques ,; Chérel , Michel; Champion , Julie ,; Maurice , Rémi; Montavon , Gilles ,; Galland , Nicolas ,
2016-01-01
International audience; The application of 211 At to targeted cancer therapy is currently hindered by the rapid deastatination that occurs in vivo. As the deastatination mechanism is unknown, we tackled this issue from the viewpoint of the intrinsic properties of At-involving chemical bonds. An apparent correlation has been evidenced between in vivo stability of 211 At-labeled compounds and the AtÀR (R ¼ C, B) bond enthalpies obtained from relativistic quantum mechanical calculations. Further...
International Nuclear Information System (INIS)
Foulon, Catherine F.; Schoultz, Bent W.; Zalutsky, Michael R.
1997-01-01
Biotinyl-3-[ 211 At]astatoanilide ([ 211 At]AtBA) was prepared in more than 80% yield by destannylation. In vitro, [ 211 At]AtBA exhibited a high affinity for streptavidin, and was stable after incubation in human serum, cerebrospinal fluid and distilled water, whereas it was rapidly degraded in mouse serum. HPLC analysis showed that the main degradation pathway in mouse serum was the cleavage of [ 211 At]astatoaniline. In mice, [ 211 At]AtBA and its 125 I-labeled analogue cleared rapidly from most tissues; however, there was some evidence for dehalogenation of both tracers
Energy Technology Data Exchange (ETDEWEB)
Wilbur, Daniel Scott [Univ. of Washington, Seattle, WA (United States)
2016-07-19
This research is a collaborative effort between the research groups of the PIs, Dr. D. Scott Wilbur in the Department of Radiation Oncology at the University of Washington (UW) and Matthew O’Hara at the Pacific Northwest National Laboratory (PNNL). In this report only those studies conducted at UW and the budget information from UW will be reported. A separate progress and financial report will be provided by PNNL. This final report outlines the experiments (Tasks) conducted and results obtained at UW from July 1, 2013 thru June 30, 2016 (2-year project with 1 year no-cost extension). The report divides the information on the experiments and results obtained into the 5 specific objectives of the research efforts and the Tasks within those objectives. This format is used so that it is easy to see what has been accomplished in each area. A brief summary of the major findings from the studies is provided below. Summary of Major Findings from Research/Training Activities at UW: Anion and cation exchange columns did not provide adequate 211At capture and/or extraction results under conditions studied to warrant further evaluation; PEG-Merrifield resins containing mPEG350, mPEG750, mPEG2000 and mPEG5000 were synthesized and evaluated; All of the mPEG resins with different sized mPEG moieties conjugated gave similar 211At capture (>95%) from 8M HCl solutions and release with conc. NH4OH (~50-80%), but very low quantities were released when NaOH was used as an eluent; Capture and release of 211At when loading [211At]astatate appeared to be similar to that of [211At]astatide on PEG columns, but further studies need to be conducted to confirm that; Capture of 211At on PEG columns was lower (e.g. 80-90%) from solutions of 8M HNO3, but higher capture rates (e.g. 99%) can be obtained when 10M HNO3 is mixed with an equal quantity of 8M HCl; Addition of reductants to the 211At solutions did not appear to change the percent capture, but may have an effect on the % extracted; There was some indication that the PEG-Merrifield resins could be saturated (perhaps with Bi) resulting in lower capture percentages, but more studies need to be done to confirm that; A target dissolution chamber, designed and built at PNNL, works well with syringe pumps so it can be used in an automated system; Preliminary semi-automated 211At isolation studies have been conducted with full-scale target dissolution and 211At isolation using a PEG column on the Hamilton automated system gave low overall recoveries, but HNO3 was used (rather than HCl) for loading the 211At and flow rates were not optimized; Results obtained using PEG columns are high enough to warrant further development on a fully automated system; Results obtained also indicate that additional studies are warranted to evaluate other types of columns for 211At separation from bismuth, which allow use of HNO3/HCl mixtures for loading and NaOH for eluting 211At. Such a column could greatly simplify the overall isolation process and make it easier to automate.
Directory of Open Access Journals (Sweden)
Jun Li
2014-01-01
Full Text Available Background. Several common single-nucleotide polymorphisms (SNPs at apolipoprotein E (ApoE have been linked with late onset sporadic Alzheimer’s disease and declining normative cognitive ability in elder people, but we are unclear about their relationship with cognition in children. Results. We studied -491A/T, -427T/C, and -219G/T promoter polymorphisms and ε2/ε3/ε4 at ApoE among children with mental retardation (MR, n=130, borderline MR (n=124, and controls (n=334 from an iodine deficiency area in China. The allelic and genotypic distribution of individual locus did not significantly differ among three groups with Mantel-Haenszel χ2 test (P>0.05. However, frequencies of haplotype of -491A/-427T/-219T/ε4 were distributed as MR > borderline MR > controls (P uncorrected = 0.004, indicating that the presence of this haplotype may increase the risk of disease. Conclusions. In this large population-based study in children, we did not find any significant association between single locus of the four common ApoE polymorphisms (-491A/T, -427T/C, -219T/G, and ε2/3/4 and MR or borderline MR. However, we found that the presence of ATTε4 haplotype was associated with an increased risk of MR and borderline MR. Our present work may help enlarge our knowledge of the cognitive role of ApoE across the lifespan and the mechanisms of human cognition.
Haslach, Erica M; Huang, Huisuo; Dirain, Marvin; Debevec, Ginamarie; Geer, Phaedra; Santos, Radleigh G; Giulianotti, Marc A; Pinilla, Clemencia; Appel, Jon R; Doering, Skye R; Walters, Michael A; Houghten, Richard A; Haskell-Luevano, Carrie
2014-06-12
Human obesity has been linked to genetic factors and single nucleotide polymorphisms (SNPs). Melanocortin-4 receptor (MC4R) SNPs have been associated with up to 6% frequency in morbidly obese children and adults. A potential therapy for individuals possessing such genetic modifications is the identification of molecules that can restore proper receptor signaling and function. These compounds could serve as personalized medications improving quality of life issues as well as alleviating diseases symptoms associated with obesity including type 2 diabetes. Several hMC4 SNP receptors have been pharmacologically characterized in vitro to have a decreased, or a lack of response, to endogenous agonists such as α-, β-, and γ2-melanocyte stimulating hormones (MSH) and adrenocorticotropin hormone (ACTH). Herein we report the use of a mixture based positional scanning combinatorial tetrapeptide library to discover molecules with nM full agonist potency and efficacy to the L106P, I69T, I102S, A219V, C271Y, and C271R hMC4Rs. The most potent compounds at all these hMC4R SNPs include Ac-His-(pI)DPhe-Tic-(pNO2)DPhe-NH2, Ac-His-(pCl)DPhe-Tic-(pNO2)DPhe-NH2, Ac-His-(pCl)DPhe-Arg-(pI)Phe-NH2, and Ac-Arg-(pCl)DPhe-Tic-(pNO2)DPhe-NH2, revealing new ligand pharmacophore models for melanocortin receptor drug design strategies.
International Nuclear Information System (INIS)
Larsen, R.H.; Bruland, O.S.; Hoff, P.; Alstad, J.; Lindmo, T.; Rofstad, E.K.
1994-01-01
The potential usefulness of α-particle radioimmunotherapy in the treatment of osteosarcoma was studied in vitro by using the monoclonal antibody TP-3 and cells of three human osteosarcoma cell lines (OHS, SAOS and KPDX) differing in antigen expression. Cell survival curves were established after treatment with (a) 211 At-TP-3 of different specific activities, (b) 211 At-labeled bovine serum albumin (BSA), (c) free 211 At and (d) external-beam X rays. The three osteosarcoma cell lines showed similar survival curves, whether treated with external-beam X rays, 211 At-BSA or free 211 At. The D o 's were lower for free 211 At than for 211 At-BSA. The survival curves for 211 At-TP-3 treatment, on the other hand, differed significantly among the cell lines, suggesting that sensitivity to 211 At-TP-3 treatment was governed by cellular properties other than sensitivity to external-beam X rays. The cellular property most important for sensitivity to 211 At-TP-3 treatment was the antigen expression. Cell inactivation after 211 At-TP-3 treatment increased substantially with increasing specific activity of the 211 At-TP-3. At high specific activities, the cytotoxic effect of 211 At-TP-3 was significantly higher than that of 211 At-BSA. In conclusion, 211 At-TP-3 has the potential to give clinically favorable therapeutic ratios in the treatment of osteosarcoma. 39 refs., 5 figs., 2 tabs
36 CFR 219.21 - Social and economic sustainability.
2010-07-01
... AGRICULTURE PLANNING National Forest System Land and Resource Management Planning Ecological, Social, and... national, regional, and local scales. Social analyses address human life-styles, cultures, attitudes... management on the well-being of communities and regions, and the net benefit of uses, values, products, or...
49 CFR 219.403 - Voluntary referral policy.
2010-10-01
... section, the railroad treats the referral and subsequent handling, including counseling and treatment, as confidential. (3) The railroad will, to the extent necessary for treatment and rehabilitation, grant the employee a leave of absence from the railroad for the period necessary to complete primary treatment and...
49 CFR 219.101 - Alcohol and drug use prohibited.
2010-10-01
...) Under the influence of or impaired by alcohol; (ii) Having .04 or more alcohol concentration in the breath or blood; or (iii) Under the influence of or impaired by any controlled substance. (3) No employee... distribution is through documented over the counter sales (Schedule V only). (c) Railroad rules. Nothing in...
29 CFR 1910.219 - Mechanical power-transmission apparatus.
2010-07-01
... dimensions specified in this paragraph shall apply to all guards, except horizontal overhead belts, rope... drives of twenty (20) inch centers or under shall be not less than one-fourth inch from the nearest... one-fourth (11/4) inches inside diameter, or larger. If made of metal shapes or bars, their section...
75 FR 219 - Availability of Funds and Collection of Checks
2010-01-05
...;Prices of new books are listed in the first FEDERAL REGISTER issue of each #0;week. #0; #0; #0; #0;#0.... FOR FURTHER INFORMATION CONTACT: Jeffrey S. H. Yeganeh, Financial Services Manager (202/728-5801), or...
12 CFR 219.21 - Authority, purpose and scope.
2010-01-01
... amended by the Annunzio-Wylie Anti-Money Laundering Act of 1992 (Pub. L. 102-550, Title XV; 106 Stat. 3672... recordkeeping and reporting requirements will assist in the prosecution of money laundering activities and are...
37 CFR 2.19 - Revocation or withdrawal of attorney.
2010-07-01
...., a corporate officer or general partner of a partnership). In the case of joint applicants or joint... a trademark case may withdraw upon application to and approval by the Director or, when applicable..., DEPARTMENT OF COMMERCE RULES OF PRACTICE IN TRADEMARK CASES Representation by Attorneys Or Other Authorized...
Lifescience Database Archive (English)
Full Text Available KXSRTLPFELIIALDXSLQAXGQLXLDD GESIQTYVDNKYSFIQFDVVSSPSSSAYKLQSTIXNNNYNGTASLIINSIQIYGSPSVQQ VIVNGSPINSFNAVSDSTLSVSNLQLALDESLKXFWIX...SLIINSIQIYGSPSVQQ VIVNGSPINSFNAVSDSTLSVSNLQLALDESLKXFWIXLK Frame B: knin*n*kknetfvfinyffcyciilxcwiiisiim*isr...fixvvvisfqlnqpphmlhqlmvfqlplkxlelyhln*llpwixhykqxvnyxwmm vnqfkpmliintlsfnsmlxphhlhlptnynqpxsitiimvpll*slilsk
24 CFR 200.219 - Content of certification.
2010-04-01
... URBAN DEVELOPMENT GENERAL INTRODUCTION TO FHA PROGRAMS Participation and Compliance Requirements... as a result of HUD audits, management reviews or other governmental investigations; (iv) There has... Federal Government or of a State Government from doing business with such Department or Agency; (vii) The...
219-IJBCS-Article-Dr R N -Nwaoguikpe
African Journals Online (AJOL)
RHUMSIKI
The mechanism of action of the drug is based on its ability to ... ml of distilled water were mixed with each extract, then ... for 48 hours. The two–liquid phase layers were then separated ... gravitational force of 1500 x g for 15 minutes using the ...
49 CFR 219.300 - Mandatory reasonable suspicion testing.
2010-10-01
... or body odors of the employee. (2) A railroad must require a covered employee to submit to a drug... body odors of the employee. Such observations may include indications of the chronic and withdrawal...
48 CFR 1052.219-71 - Subcontracting Plan.
2010-10-01
... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Subcontracting Plan. 1052... Subcontracting Plan. As prescribed in DTAR 1019.708-70(b), insert the following provision: Subcontracting Plan (MAR 2002) As part of its initial proposal, each large business offeror must submit a contracting plan...
30 CFR 219.410 - What does this subpart contain?
2010-07-01
... GOMESA revenues are reserved for the following purposes: (1) Projects and activities for the purposes of... projects. (5) Planning assistance and administrative costs not-to-exceed 3 percent of the amounts received... Center, Building 85; MS-350B1; Denver, CO 80225-0165, or at (303) 231-3429. ...
34 CFR 685.219 - Public Service Loan Forgiveness Program.
2010-07-01
... duty for training or attendance at a service school. For civilians, “Military service” means service on... Revenue Code; (4) A Tribal college or university; or (5) A private organization that— (i) Provides the following public services: Emergency management, military service, public safety, law enforcement, public...
49 CFR 219.9 - Responsibility for compliance.
2010-10-01
..., or has caused death or injury, a penalty not to exceed $100,000 per violation may be assessed; and... requirement is subject to a civil penalty of at least $650 and not more than $25,000 per violation, except that: Penalties may be assessed against individuals only for willful violations; where a grossly...
49 CFR 397.219 - Waiver determination and order.
2010-10-01
... rational basis; (3) Whether the highway routing designation of the State, political subdivision thereof, or... readily identifiable by the Administrator as one who may be affected by the order. A copy of each order is... with § 397.223, an order issued under this section constitutes the final agency decision regarding...
49 CFR 219.203 - Responsibilities of railroads and employees.
2010-10-01
... duty tour. An employee who has been transported to receive medical care is not released from duty for... testing does not excuse such refusal by the employee timely to provide the required specimens. (c) Place...
32 CFR 219.116 - General requirements for informed consent.
2010-07-01
... statement that participation is voluntary, refusal to participate will involve no penalty or loss of...) Nothing in this policy is intended to limit the authority of a physician to provide emergency medical care...
48 CFR 219.704 - Subcontracting plan requirements.
2010-10-01
... business firms specifically identified in the subcontracting plan. Notifications shall be in writing and... SYSTEM, DEPARTMENT OF DEFENSE SOCIOECONOMIC PROGRAMS SMALL BUSINESS PROGRAMS The Small Business... business concerns shall include subcontracts with historically black colleges and universities and minority...
1935 15' Quad #219 Aerial Photo Mosaic Index
Earth Data Analysis Center, University of New Mexico — Aerial Photo Reference Mosaics contain aerial photographs that are retrievable on a frame by frame basis. The inventory contains imagery from various sources that...
48 CFR 652.219-73 - Mentor Requirements and Evaluation.
2010-10-01
... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Mentor Requirements and... Mentor Requirements and Evaluation. As prescribed in 619.202-70(o)(2), insert the following clause: Mentor Requirements and Evaluation (APR 2004) (a) Mentor and protégé firms shall submit an evaluation to...
48 CFR 1552.219-70 - Mentor-Protege Program.
2010-10-01
... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Mentor-Protege Program... Mentor-Protege Program. As prescribed in 1519.203(a), insert the following clause: Mentor-Protege Program OCT 2000 (a) The Contractor has been approved to participate in the EPA Mentor-Protege program. The...
48 CFR 1052.219-75 - Mentor Requirements and Evaluation.
2010-10-01
... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Mentor Requirements and... Mentor Requirements and Evaluation. As prescribed in DTAR 1019.202-70, insert the following clause: Mentor Requirements and Evaluation (JAN 2000) (a) Mentor and protégé firms shall submit an evaluation to...
49 CFR 219.213 - Unlawful refusals; consequences.
2010-10-01
... inconsistent with the employee's health, whether such refusal was made in good faith and based on medical..., as appropriate, also consider the following: (1) Whether the railroad made a good faith determination...
47 CFR 90.219 - Use of signal boosters.
2010-10-01
... to operate radio systems in the frequency bands above 150 MHz may employ signal boosters at fixed... fill in only weak signal areas and cannot extend the system's normal signal coverage area. (b) Class A... effective radiated power (ERP) of the unit to a maximum of 5 watts under all conditions. Class B broadband...
49 CFR 219.405 - Co-worker report policy.
2010-10-01
... dependence on alcohol or a drug or by another identifiable and treatable mental or physical disorder... and treatable mental or physical disorder— (1) The railroad must return the employee to service within... effects of alcohol and drugs on occupational or transportation safety. (f) Follow-up tests. A railroad may...
49 CFR 1544.219 - Carriage of accessible weapons.
2010-10-01
...) Flights for which screening is conducted. The provisions of § 1544.201(d), with respect to accessible weapons, do not apply to a law enforcement officer (LEO) aboard a flight for which screening is required..., county, or state law enforcement officer who is a direct employee of a government agency. (ii) Be sworn...
All projects related to | Page 219 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Integrated Approach to Address Food and Nutrition Security in the ... Could integrated garden and nutrition programs at schools help address the problem? .... LABOUR POLICY, GENDER EQUALITY, ECONOMIC ANALYSIS, LABOUR ...
Lifescience Database Archive (English)
Full Text Available igf*n *iahvq*kigalsgpflvsrtgdvg*tkywdktsnih**ipqkvlvh*dsrtvamevgir *gvcnnspakwtsp...lihligf*n *iahvq*kigalsgpflvsrtgdvg*tkywdktsnih**ipqkvlvh*dsrtvamevgir *gvcnnspakwtspeng*r*qwmvdaqslkeviillt
48 CFR 52.219-28 - Post-Award Small Business Program Rerepresentation.
2010-10-01
... influence on a national basis in a kind of business activity in which a number of business concerns are... position, ownership or control of materials, processes, patents, license agreements, facilities, sales...
48 CFR 552.219-74 - Section 8(a) Direct Award.
2010-10-01
... contracting activity shall give advance notice to SBA before it issues a final notice terminating performance... prior to processing any advance payments or novation agreements. The contracting activity may assign contract administration functions to a contract administration office. (c) The Contractor agrees: (1) To...
28 CFR 2.219 - Maximum terms of imprisonment and supervised release.
2010-07-01
... contraband into prison 3 years 2 years. 22-2704 Child prostitution: abducting or harboring 3 years (10 years...) or child sex abuse 3 years (10 years if SOR) 2 years. 22-401, 4502 [22-501, 3202] Assault: with... statute for offense circumstances) 3 years 2 years. 22-1101(a), (c)(1) [22-901] Cruelty to children 1st...
Fission in Empire-II version 2.19 beta1, Lodi
International Nuclear Information System (INIS)
Sin, M.
2003-01-01
This is a description of the fission model implemented presently in EMPIRE-II. This package offers two ways to calculate the fission probability selected by parameters in the optional input. Fission barriers, fission transmission coefficients, fission cross sections and fission files are calculated
Sexospécificités | Page 219 | CRDI - Centre de recherches pour le ...
International Development Research Centre (IDRC) Digital Library (Canada)
Uncontrolled development was threatening to destroy the forest environment and the traditional way of life of the hill people of Ratanakiri. Researchers worked with the villagers to produce unique maps and resource use plans that convinced the government of the people's traditional resource use and management rights, ...
Polychlorinated biphenyls (PCB) analysis report for solid sample for 219S tank 102
International Nuclear Information System (INIS)
Ross, G.A.
1997-01-01
One waste sample was analyzed (with duplicate, matrix spike, and matrix spike duplicate) for PCBs as Aroclor mixtures by the Inorganic/Organic Chemistry Group. A soxhlet extraction procedure was used for extraction of the Aroclors from the sample. Analysis was performed using dual column confirmation gas chromatography/electron capture detection (GC/ECD). Extraction follows closely method 354 C of SW-846, analysis follows SW-846 method 8082. A cross reference of laboratory sample number to the customer identification is given in a table
219 The Revised Edition of Korean Calendar for Allergenic Pollens
Oh, Jae-won; Kim, Joo-Hwa; Kim, Seong-Won; Kang, Im-Joo; Kim, Bong-Seong; Kook, Myung-Hee; Park, Kang-Seo; Lee, Ha-Baik; Kim, Kyu Rang; Choi, Young-Jean
2012-01-01
Background The old version of pollen calendar was used until this year in South Korea. That calendar did not reflect current pollen distribution and concentrations that can be influenced by changes in weather and environment. A new pollen calendar of allergenic pollens was made based on the data on pollen concentrations obtained in 8 regions nationwide between 1997 and 2009 in South Korea. Methods The distribution of pollen grains was assessed every day at 8 areas (Seoul, Guri, Busan, Daegu, Jeonju, Kwangju, Kangneung, and Jeju) nationwide for 12 years between July 1, 1997 and June 30, 2009. Pollen were collected by using Burkard 7-day sampler (Burkard manufacturing Co Ltd, Hertfordshire, UK), and the collected pollens were sent every week to Hanyang Guri Hospital. Then pollens were strained with Calberla's fuchsin staining solution and were identified. The number of pollen grains per m3 was calculated. Results Alder, birch and Japanese cedar started to appear in February. Japanese cedar showed a highest pollen concentration in Jeju. Pine became the highest pollen in May, and the pollen concentrations of oak and birch also became high. Common ragweed appeared in the middle of August and showed the highest pollen concentration in the middles of September. Japanese hop showed a high concentration between the middle of August and the end of September, and mugwort appeared in the middles of August and its concentration increased up until early September. Birch appeared earlier in Kangneung, and pine showed a higher pollen concentration than in the other areas. In Daegu, Oriental thuja, alder and juniper produced a large concentration of pollens. Pine produced a large concentration of pollens between the middle of April and the end of May. Weeds showed higher concentrations in September and mugwort appeared earlier than common ragweed. In Busan where is the southeast city, the time of flowering is relatively early, and alder and Oriental thuja appeared earliest among all areas. In Kwangju, Oriental thuja and hazelnut appeared in early February. In Jeju which is the end of southern island, Japanese cedar showed a higher pollen concentration than the other areas Conclusions New information on pollen distributions and concentrations should be provided for the general publics or allergic patients through the website in order to prevent the occurrence of pollinosis.
36 CFR 219.23 - The role of science in assessments, analyses, and monitoring.
2010-07-01
... SERVICE, DEPARTMENT OF AGRICULTURE PLANNING National Forest System Land and Resource Management Planning... be led by a Chief Scientist selected by the Deputy Chief of Research and Development. When...
48 CFR 52.219-16 - Liquidated Damages-Subcontracting Plan.
2010-10-01
... following clause: Liquidated Damages—Subcontracting Plan (JAN 1999) (a) Failure to make a good faith effort... has failed to make such good faith effort, the Contracting Officer shall give the Contractor written notice specifying the failure and permitting the Contractor to demonstrate what good faith efforts have...
48 CFR 52.219-12 - Special 8(a) Subcontract Conditions.
2010-10-01
... all of the requirements of Contract No. __ [insert number of contract] for the consideration stated... (CONTINUED) CLAUSES AND FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 52... into Contract No. __ [insert number of contract] with the __ [insert name of contracting agency] to...
People and things. CERN Courier, November 1981, v. 21(9)
International Nuclear Information System (INIS)
Anon.
1981-01-01
The article reports on achievements of various people, staff changes and position opportunities within the CERN organization and contains news updates on upcoming or past events. At the end of August a circulating electron beam was achieved for the first time in the VUV (vacuum ultraviolet) ring of the US National Synchrotron Light Source at Brookhaven. Commissioning of the X-ray ring of the NSLS is imminent. From 11-14 January, an International Colloquium on Baryon Nonconservation (ICOBAN) will be held at the Tata Institute of Fundamental Research, Bombay.From 17-23 February an International Conference on Instrumentation for Colliding Beam Physics will be held at the Stanford Linear Accelerator Center. A Europhysics Conference on 'Computing in Accelerator Design and Operation' will be held in Warsaw from 21-24 September 1982. A team at Los Alamos, led by Charles Brau, has demonstrated the principle of a high efficiency free electron laser. Work has started on a prototype magnet to confirm the design of a 2 GeV electron microtron under study at Argonne for use in nuclear and particle physics research. On 2 October a new ion source and injector system, known as ABEL, was inaugurated at Berkeley. The X-ray synchrotron radiation produced by electron storage rings could provide improved diagnosis in conditions such as coronary artery disease. Fermilab is proposing to set up an on-site Latin America Center for Fundamental Physics and Technology to assist scientists and engineers from developing countries
Molecular dynamics study of the dominant-negative E219K polymorphism in human prion protein
Jahandideh, Samad; Jamalan, Mostafa; Faridounnia, Maryam|info:eu-repo/dai/nl/338666923
2015-01-01
Human prion diseases are associated with misfolding or aggregation of the Human Prion Protein (HuPrP). Missense mutations in the HuPrP gene, contribute to conversion of HuPrP(C) to HuPrP(Sc) and amyloid formation. Based on our previous comprehensive study, three missense mutations, from two
Yeast Interacting Proteins Database: YPL031C, YPL219W [Yeast Interacting Proteins Database
Lifescience Database Archive (English)
Full Text Available ting the cellular response to nutrient levels and environmental conditions and progression through the cell ...e cellular response to nutrient levels and environmental conditions and progression through the cell cycle R
49 CFR Appendix C to Part 219 - Post-Accident Testing Specimen Collection
2010-10-01
... the transfer of the blood tubes on the second line of STEP 5 (the chain of custody block). E. Collect... (the chain of custody block). F. Seal the Individual Employee Kit a. The blood and urine specimens have... railroad representatives handling the box shall document chain of custody of the shipping box and shall...
219 Enumah et al., Afr J Tradit Complement Altern Med. (2016) 13(3 ...
African Journals Online (AJOL)
The practice of medicine continues to evolve in Sub-Saharan Africa, and its .... notes were taken to enhance and supplement future data acquisition and analysis. .... especially given the modern trend in advertising for what the pastor dubbed ..... conceptualization of her illness speaks to a larger phenomenon that is noted ...
7 CFR 2.19 - Under Secretary for Food, Nutrition, and Consumer Services.
2010-01-01
... nutrition assistance program benefits to be so distributed. (v) Develop food plans for use in establishing supplemental nutrition assistance benefit levels, and assess the nutritional impact of Federal food programs... eating qualities of food served in homes and institutions. (iv) Develop materials to aid the public in...
32 CFR 219.101 - To what does this policy apply?
2010-07-01
..., such as (i) research on regular and special education instructional strategies, or (ii) research on the effectiveness of or the comparison among instructional techniques, curricula, or classroom management methods... as provided in paragraph (b) of this section, this policy applies to all research involving human...
New research initiatives program. Project W-219: chemistry in comet comae. Final report
International Nuclear Information System (INIS)
Huebner, W.F.
1978-02-01
The scientific objective to investigate theoretically chemical reactions in the comae of comets was accomplished using a one-dimensional model. Ninety-eight species, which involved 441 reactions in the presence of wavelength-dependent solar radiation, were considered in a time-dependent calculation, which includes effects resulting from ultraviolet opacity
Evaluation report on SCTF Core-II test S2-19
International Nuclear Information System (INIS)
Ohnuki, Akira; Iwamura, Takamichi; Iguchi, Tadashi; Abe, Yutaka; Murao, Yoshio; Adachi, Hiromichi.
1991-03-01
Experimental studies using Slab Core Test Facility (SCTF) have revealed that the heat transfer enhancement in higher power bundles is mainly governed by the radial power ratio in core during the reflood in PWR-LOCA. As a physical mechanism for the heat transfer enhancement, it can be considered from the experimental evidence that the increase of upward steam flow rate in a higher power bundle which is caused by the higher steam production rate in the bundle gives the higher upward liquid flow rate in the bundle and the increase of the liquid flow rate gives the heat transfer enhancement. In order to develop a mechanistic model for the heat transfer enhancement based on this idea, the following relations should be identified quantitatively: (1) Relation between the steam production rate and the upward liquid flow rate, (2) Cross flow rate above the quench front and (3) Relation between the degree of heat transfer enhancement due to radial power ratio and the amount of increase of upward liquid flow rate. In this report, the above relation (3) was investigated experimentally as a step to develop the mechanistic model using the SCTF where the relation between the radial power ratio and the heat transfer enhancement has been made clear quantitatively. The degree of increase of heat transfer between two forced feed tests with the different flow rate in LPCI period was compared with the degree of heat transfer enhancement under a radial power ratio in the previous SCTF tests. The two forced feed tests were performed under the condition without any significant two-dimensional hydraulic behavior in core. The ratio of the mass flow rate between the two tests was about double. (author)
Taiwo et al., Afr J Tradit Complement Altern Med., (2017) 14 (1): 219 ...
African Journals Online (AJOL)
isolate a novel compound whose structure was elucidated from the analysis of the .... The crude extract was dissolved in 500 ml of water and 2.0 L of acetone was ..... at 2.97 Å was retrieved from the RCSB database (www.rcsb.org), PDB code.
48 CFR 52.219-23 - Notice of Price Evaluation Adjustment for Small Disadvantaged Business Concerns.
2010-10-01
... black college or university means an institution determined by the Secretary of Education to meet the... application was submitted. In this case, in order to receive the benefit of a price evaluation adjustment, an... integral part of such a college or university before November 14, 1986. Minority institution means an...
Codon 219 polymorphism of PRNP in healthy caucasians and Creutzfeldt-Jakob disease patients
Energy Technology Data Exchange (ETDEWEB)
Petraroli, R.; Pocchiari, M. [Instituto Superiore di Sanita, Rome (Italy)
1996-04-01
A number of point and insert mutations of the PrP gene (PRNP) have been linked to familial Creutzfeldt-Jakob disease (CJD) and Gerstmann-Straussler-Scheinker disease (GSS). Moreover, the methionine/valine homozygosity at the polymorphic codon 129 of PRNP may cause a predisposition to sporadic and iatrogenic CJD or may control the age at onset of familial cases carrying either the 144-bp insertion or codon 178, codon 198, and codon 210 pathogenic mutations in PRNP. In addition, the association of methionine or valine at codon 129 and the point mutation at codon 178 on the same allele seem to play an important role in determining either fatal familial insomnia or CJD. However, it is noteworthy that a relationship between codon 129 polymorphism and accelerated pathogenesis (early age at onset or shorter duration of the disease) has not been seen in familial CJD patients with codon 200 mutation or in GSS patients with codon 102 mutation, arguing that other, as yet unidentified, gene products or environmental factors, or both, may influence the clinical expression of these diseases. 17 refs.
48 CFR 352.219-70 - Mentor-protégé program.
2010-10-01
... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Mentor-protégé program... Mentor-protégé program. As prescribed in 319.270-1(a), the Contracting Officer shall insert the following provision: Mentor-Protégé Program (January 2010) (a) Large business prime contractors serving as mentors in...
14 CFR 120.219 - Handling of test results, record retention, and confidentiality.
2010-01-01
.../headquarters_offices/avs/offices/aam/drug_alcohol/. (3) A service agent may prepare the MIS report on behalf of an employer. However, a company official (e.g., Designated Employer Representative as defined in 49...
20 CFR 219.34 - When evidence that a marriage has ended is required.
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false When evidence that a marriage has ended is... a marriage has ended is required. Evidence of how a previous marriage ended may be required to determine whether a later marriage is valid. If a widow or widower remarried after the employee's death and...
SUBTASK 2.19 – OPERATIONAL FLEXIBILITY OF CO2 TRANSPORT AND STORAGE
Energy Technology Data Exchange (ETDEWEB)
Jensen, Melanie; Schlasner, Steven; Sorensen, James; Hamling, John
2014-12-31
Carbon dioxide (CO2) is produced in large quantities during electricity generation and by industrial processes. These CO2 streams vary in terms of both composition and mass flow rate, sometimes substantially. The impact of a varying CO2 stream on pipeline and storage operation is not fully understood in terms of either operability or infrastructure robustness. This study was performed to summarize basic background from the literature on the topic of operational flexibility of CO2 transport and storage, but the primary focus was on compiling real-world lessons learned about flexible operation of CO2 pipelines and storage from both large-scale field demonstrations and commercial operating experience. Modeling and pilot-scale results of research in this area were included to illustrate some of the questions that exist relative to operation of carbon capture and storage (CCS) projects with variable CO2 streams. It is hoped that this report’s real-world findings provide readers with useful information on the topic of transport and storage of variable CO2 streams. The real-world results were obtained from two sources. The first source consisted of five full-scale, commercial transport–storage projects: Sleipner, Snøhvit, In Salah, Weyburn, and Illinois Basin–Decatur. These scenarios were reviewed to determine the information that is available about CO2 stream variability/intermittency on these demonstration-scale projects. The five projects all experienced mass flow variability or an interruption in flow. In each case, pipeline and/or injection engineers were able to accommodate any issues that arose. Significant variability in composition has not been an issue at these five sites. The second source of real- world results was telephone interviews conducted with experts in CO2 pipeline transport, injection, and storage during which commercial anecdotal information was acquired to augment that found during the literature search of the five full-scale projects. The experts represented a range of disciplines and hailed from North America and Europe. Major findings of the study are that compression and transport of CO2 for enhanced oil recovery (EOR) purposes in the United States has shown that impurities are not likely to cause transport problems if CO2 stream composition standards are maintained and pressures are kept at 10.3 MPa or higher. Cyclic, or otherwise intermittent, CO2 supplies historically have not impacted in-field distribution pipeline networks, wellbore integrity, or reservoir conditions. The U.S. EOR industry has demonstrated that it is possible to adapt to variability and intermittency in CO2 supply through flexible operation of the pipeline and geologic storage facility. This CO2 transport and injection experience represents knowledge that can be applied in future CCS projects. A number of gaps in knowledge were identified that may benefit from future research and development, further enhancing the possibility for widespread application of CCS. This project was funded through the Energy & Environmental Research Center–U.S. Department of Energy Joint Program on Research and Development for Fossil Energy-Related Resources Cooperative Agreement No. DE-FC26-08NT43291. Nonfederal funding was provided by the IEA Greenhouse Gas R&D Programme.
: tous les projets | Page 219 | CRDI - Centre de recherches pour le ...
International Development Research Centre (IDRC) Digital Library (Canada)
Sujet: URBAN YOUTH, CRIME PREVENTION, YOUTH UNREST, ORGANIZED CRIME, VIOLENCE, MARGINALISM. Région: Guatemala, North and Central America, Honduras, El Salvador, South America. Programme: Gouvernance et justice. Financement total : CA$ 464,000.00. Prévention de la violence chez les jeunes ...
14 CFR 125.219 - Oxygen for medical use by passengers.
2010-01-01
... in conformity with the manufacturing, packaging, marking, labeling, and maintenance requirements of... CAPACITY OF 6,000 POUNDS OR MORE; AND RULES GOVERNING PERSONS ON BOARD SUCH AIRCRAFT Instrument and..., maintained under the certificate holder's approved maintenance program; (iii) Free of flammable contaminants...
Lopez, Maria I. Hernandez; And Others
In 1962 and again in 1965, a group of sixth and ninth grade students in selected schools in four Puerto Rican communities were interviewed to investigate the factors influencing students' decision to withdraw from school before completing twelfth grade and to identify some characteristics of dropouts. Of 616 students interviewed in 1962, 20.9% of…
Energy Technology Data Exchange (ETDEWEB)
Smith, D.L.; Mattas, R.F. [comps.
1997-07-01
The objective of this task is to develop the required data base and demonstrate the performance of a liquid lithium-vanadium advanced blanket design. The task has two main activities related to vanadium structural material and liquid lithium system developments. The vanadium alloy development activity included four subtasks: (1.1) baseline mechanical properties of non irradiated base metal and weld metal joints; (1.2) compatibility with liquid lithium; (1.3) material irradiation tests; and (1.4) development of material manufacturing and joining methods. The lithium blanket technology activity included four subtasks: (2.1) electrical insulation development and testing for liquid metal systems; (2.2) MHD pressure drop and heat transfer study for self-cooled liquid metal systems; (2.3) chemistry of liquid lithium; and (2.4) design, fabrication and testing of ITER relevant size blanket mockups. A summary of the progress and results obtained during the period 1995 and 1996 in each of the subtask areas is presented in this report.
2010-08-31
... you about submitting personal information such as social security numbers and birth dates. Docket: To... Withdrawal of Complaints, Objections, and Petitions for Review; Settlement This section provides for the procedures and time periods for withdrawal of complaints, the withdrawal of findings and/or preliminary...
Directory of Open Access Journals (Sweden)
Benjamín García-Hernández
2014-12-01
Full Text Available Cusculium, a hapax used by Pliny in its accusative form, has a Pre-Roman base (cuscu- that is found throughout western Mediterranean countries; the same root appears in coscus, referring to certain types of worm. Given its Latin ending, the word could be used to designate both the tree (cusculius «kermes oak» and its acorns (cusculium. Coccolubis is a compound adjective, the first element of which is the diminutive of coccum («grain of kermes», which carries the same Mediterranean root as the previous word. Given its use as an epithet for a type of vine, its second element may be seen to contain the base of the noun uua. Its original form may have therefore been coccoluuis («of red grape». The Navarran term cuzculubita («oak apple», however, suggests that a Pre-Roman compound may have existed.
2010-09-16
... FEDERAL COMMUNICATIONS COMMISSION [AU Docket No. 10-107; DA 10-1630] Wireless Telecommunications... Auction 89. FOR FURTHER INFORMATION CONTACT: Wireless Telecommunications Bureau, Auctions and Spectrum... by the Chief, Wireless Telecommunications Bureau pursuant to authority delegated by 47 CFR 0.131...
International Nuclear Information System (INIS)
Smith, D.L.; Mattas, R.F.
1997-07-01
The objective of this task is to develop the required data base and demonstrate the performance of a liquid lithium-vanadium advanced blanket design. The task has two main activities related to vanadium structural material and liquid lithium system developments. The vanadium alloy development activity included four subtasks: (1.1) baseline mechanical properties of non irradiated base metal and weld metal joints; (1.2) compatibility with liquid lithium; (1.3) material irradiation tests; and (1.4) development of material manufacturing and joining methods. The lithium blanket technology activity included four subtasks: (2.1) electrical insulation development and testing for liquid metal systems; (2.2) MHD pressure drop and heat transfer study for self-cooled liquid metal systems; (2.3) chemistry of liquid lithium; and (2.4) design, fabrication and testing of ITER relevant size blanket mockups. A summary of the progress and results obtained during the period 1995 and 1996 in each of the subtask areas is presented in this report
Contribution to the study of disintegration schemes of "2"2"7Th and of "2"1"9Rn
International Nuclear Information System (INIS)
Cluzeau, Serge
1965-01-01
After some theoretical recalls on the unified model, notably for regions of complete layers, for regions far from these layers, and for intermediate regions, and on angular correlations (γ ray shower, α-γ ray shower), this research thesis reports the study of total angular moments and of nucleus parities for some excitation states, for some elements of the "2"2"7Ac family. For this purpose, an alpha-gamma and gamma-gamma coincidence spectrometer has been developed. The author reports the study of the spectrometer performance, and discusses experimental results [fr
Directory of Open Access Journals (Sweden)
Mohammad Mu’az Hashim
2015-09-01
Full Text Available Nitrogen (N use efficiency is usually less than 50%, and it remains a major problem in rice cultivation. Controlled release fertilizer (CRF technology is one of the well-known efforts to overcome this problem. The efficiency of CRF, however, is very much dependent on the timing of nutrient release. This study was conducted to determine the precise time of N uptake by rice as a guideline to develop efficient CRF. Fertilizer N uptake by rice at different growth stages was investigated by using 15N isotopic technique. Rice was planted in pots, with 15N urea as N source at the rate of 120 kg/hm2. Potassium and phosphorus were applied at the same rate of 50 kg/hm2. Standard agronomic practices were employed throughout the growing periods. Rice plants were harvested every two weeks until maturation at the 14th week and analyzed for total N and 15N content. Nitrogen derived from fertilizer was calculated. Total N uptake in plants consistently increased until the 11th week. After that, it started to plateau and finally declined. Moreover, N utilization by rice plants peaked at 50%, which occurred during the 11th week after transplanting. N derived from fertilizer in rice plants were in the range of 18.7% to 40.0% in all plant tissues. The remaining N was derived from soil. Based on this study, N release from CRF should complete by the 11th week after planting to ensure the maximum fertilizer N uptake by rice plants. Efficient CRF should contribute to higher N derived from fertilizer which also resultedin a higher total N uptake by rice plants, increasing the potential of rice to produce higher yield while at the same time of reducing loss.
2012-07-10
... jurisdiction over the action without regard to the amount in controversy, and the case will be tried before a... complainant, the agency will redact them in accordance with the Privacy Act of 1974, 5 U.S.C. 552a, and other... confidentiality laws. However, in addition to the Privacy Act, a variety of confidentiality provisions may protect...
2010-10-01
... employees for the past 12 months (check this column if size standard stated in solicitation is expressed in terms of number of employees) or Offeror's average annual gross revenue for the last 3 fiscal years (check this column if size standard stated in solicitation is expressed in terms of annual receipts...
Kanehiro Kitayama; Dieter Mueller-Dombois
1995-01-01
The development of the Hawaiian montane rainforest was investigated along a 4.1-million-year soil age gradient at 1200 m elevation under two levels of precipitation, the mesic (c. 2500 mm annual rainfall) vs. wet (> 4000 mm)age gradient. Earlier analyses suggested that soil fertility and foliar nutrient concentrations of common canopy species changed unimodally on...
2011-02-15
... inspection AD 97-17-04R1, and to allow automatic eddy current inspection per engine manual Section 72-33-31.... That AD currently requires revisions to the engine manufacturer's time limits section (TLS) to include... modifies the TLS of the manufacturer's engine manual and an air carrier's approved continuous airworthiness...
2010-10-01
...″ W.), and Bonilla Point, British Columbia (48°35′30″ N./124°43′00″ W.); in Jefferson and Island... following coastal bays and estuaries in California, Oregon, and Washington: (i) San Francisco Bay, San Pablo Bay, and Suisun Bay in California. All tidally influenced areas of San Francisco Bay, San Pablo Bay...
International Nuclear Information System (INIS)
Jaszczak, R.J.
1995-12-01
Research is described in the following areas: development and evaluation quantitatively of reconstruction algorithms with improved compensations for attenuation, scatter, and geometric collimator response; evaluation of single photon emission computed tomography (SPECT) quantification of iodine 123 and astatine 211; and the development and evaluation of SPECT pinhole imaging for low and medium energy photons
Energy Technology Data Exchange (ETDEWEB)
Jaszczak, R.J.
1995-12-01
Research is described in the following areas: development and evaluation quantitatively of reconstruction algorithms with improved compensations for attenuation, scatter, and geometric collimator response; evaluation of single photon emission computed tomography (SPECT) quantification of iodine 123 and astatine 211; and the development and evaluation of SPECT pinhole imaging for low and medium energy photons.
Negative Ion Source Development and Photodetachment Studies at ISOLDE
AUTHOR|(CDS)2254068; Hanstorp, Dag; Rothe, Sebastian
Astatine is one of the rarest elements on earth. The small amount of existing astatine is either created in decay chains of heavier elements or artificially. One of its longer lived isotopes, 211At, is of interest for targeted alpha therapy, a method of treating cancer by using the alpha decay of radioactive elements directly at the location of a tumor. However, its chemical properties are yet to be determined due to the short life time of astatine. A milestone towards the determination of the electronegativity of astatine was the measurement of its ionization potential (IP) at CERN-ISOLDE. However, its electron affinity (EA, the binding energy of the additional electron in a negative ion), is still to be measured. In order to determine the EA of radioisotopes by laser photodetachment spectroscopy, the Gothenburg ANion Detector for Affinity measurements by Laser Photodetachment (GANDALPH) has been built in recent years. As a proof-of-principle, the EA of the 128I negative ion, produced at the CERN-ISOLDE rad...
An Expert System for Managing Storage Space Constraints Aboard United States Naval Vessels
1991-12-01
d. solvents, thinners, primers, cmpounds, varnishes , and lacquers i e. alcohol, acetone, ether, and naphtha; f. greases * nd pastes Except for...suffocation. Malocarbon liquids are compounds of carbon containing any of the halogen elements ( fluorine , chlorine, bromine, iodine, or astatine. (Examples are
Workshop on selected aspects of radiochemistry
International Nuclear Information System (INIS)
1991-11-01
The aspects chosen for the workshop are: isotope preparation, separation methods; radiochemical methods and analyses; environmental protection and radiochemistry; the chemistry of the fifth halogen, astatine. From the 28 contributions presented at the workshop, 24 are of relevance in the INIS and EDB scope and are separately retrievable from the database. (BBR) [de
Development and therapeutic application of internally emitting radiopharmaceuticals
International Nuclear Information System (INIS)
Adelstein, S.J.; Bloomer, W.D.
1980-01-01
This project is concerned with developing the potential of alpha-emitting radionuclides as agents for radiotherapy. Among the available α-emitters, astatine-211 appears most promising for testing the efficacy of α-emitters for therapeutic applications because: (1) it has some chemical similarities to iodine, an element that can readily be incorporated into numerous proteins and peptides; (2) it has a half life that is long enough to permit chemical manipulation yet short enough to minimize destruction of healthy cells; and (3) α-emission is associated with 100% of its decays. If appropriate biological carriers can be labeled with an alpha emitter such as 211 At, they could be of great utility in several areas of therapeutic medicine where elimination of specific cell populations is desired. While previous attempts to astatinate proteins using standard iodination techniques have been unsuccessful, effective labeling of proteins with astatine by first synthesizing an aryl astatide and then coupling this compound to the protein via an acylation has been achieved. Undergoing current investigation are several different aryl astatide-followed-by-acylation approaches including an astatinated Bolton-Hunter type reagent using concanavalin A (ConA) and melanocyte stimulating hormone (MSH) as model compounds
Yan, Guangqi; Wang, Xue; Yang, Mingliang; Lu, Li; Zhou, Qing
2017-01-01
Oral squamous cell carcinoma (OSCC) is a prevalent oral disease with a high morbidity and mortality rate. Several long non-coding RNAs (lncRNAs) were identified as important regulators of carcinogenesis. However, the pathogenic implications of TUG1 in OSCC are still unclear. In the present study, the expression of TUG1 was increased in OSCC cells. Knockdown of TUG1 inhibited cell proliferation, migration, and invasion, and induced cell cycle arrest at G0/G1 phase, whereas overexpression of TU...
International Nuclear Information System (INIS)
Selan, J.C.
1983-01-01
During the operating license review for Hatch 2, the Nuclear Regulatory Commission (NRC) staff raised a concern about the capability of the Class 1E reactor protection system (RPS) to operate after suffering sustained, abnormal voltage or frequency conditions from a non-Class 1E power supply. Abnormal voltage or frequency conditions could be produced as a result of one of the following causes: combinations of undetected, random single failures of the power supply components, or multiple failures of the power supply components caused by external phenomena such as a seismic event. The purpose of this report is to evaluate the licensees submittal with respect to the NRC criteria and present the reviewer's conclusion on the adequacy of the design modifications to protect the RPS from abnormal voltage and frequency conditions
77 FR 62316 - Holiday CVS, L.L.C., d/b/a CVS/Pharmacy Nos. 219 and 5195; Decision and Order
2012-10-12
... testimony centered on certain prescriptions that presented a collection of red flags that no reasonable and... Warrants at both Respondents and interviewed various employees of each store's pharmacy departments.... Merrill stated that ``once the limit [wa]s reached,'' customers who then presented oxycodone prescriptions...
Energy Technology Data Exchange (ETDEWEB)
Ulrickson, M.A.; Stevens, P.L.; Hino, T.; Hirohata, Y. [eds.
1996-12-01
This report contains the viewgraphs from the proceedings of US/Japan Workshop on High Heat Flux Components and Plasma Surface Interactions for Next Fusion Devices. Some of the general topics covered by this report are: PFC/PSI in tokamak and helical devices; development of high heat flux components; PSIS and plasma facing materials;tritium; and material damage.
Bohannon, Robert G.
2006-01-01
This map was produced from several larger digital datasets. Topography was derived from Shuttle Radar Topography Mission (SRTM) 85-meter digital data. Gaps in the original dataset were filled with data digitized from contours on 1:200,000-scale Soviet General Staff Sheets (1978-1997). Contours were generated by cubic convolution averaged over four pixels using TNTmips surface-modeling capabilities. Minor artifacts resulting from the auto-contouring technique are present. Streams were auto-generated from the SRTM data in TNTmips as flow paths. Flow paths were limited in number by their Horton value on a quadrangle-by-quadrangle basis. Peak elevations were averaged over an area measuring 85 m by 85 m (represented by one pixel), and they are slightly lower than the highest corresponding point on the ground. Cultural data were extracted from files downloaded from the Afghanistan Information Management Service (AIMS) Web site (http://www.aims.org.af). The AIMS files were originally derived from maps produced by the Afghanistan Geodesy and Cartography Head Office (AGCHO). Because cultural features were not derived from the SRTM base, they do not match it precisely. Province boundaries are not exactly located. This map is part of a series that includes a geologic map, a topographic map, a Landsat natural-color-image map, and a Landsat false-color-image map for the USGS/AGS (Afghan Geological Survey) quadrangles covering Afghanistan. The maps for any given quadrangle have the same open-file number but a different letter suffix, namely, -A, -B, -C, and -D for the geologic, topographic, Landsat natural-color, and Landsat false-color maps, respectively. The open-file report (OFR) numbers for each quadrangle range in sequence from 1092 - 1123. The present map series is to be followed by a second series, in which the geology is reinterpreted on the basis of analysis of remote-sensing data, limited fieldwork, and library research. The second series is to be produced by the USGS in cooperation with the AGS and AGCHO.
International Nuclear Information System (INIS)
Ulrickson, M.A.; Stevens, P.L.; Hino, T.; Hirohata, Y.
1996-12-01
This report contains the viewgraphs from the proceedings of US/Japan Workshop on High Heat Flux Components and Plasma Surface Interactions for Next Fusion Devices. Some of the general topics covered by this report are: PFC/PSI in tokamak and helical devices; development of high heat flux components; PSIS and plasma facing materials;tritium; and material damage
1984-01-01
emerging to suggest that the origin of domestication lies not locally but in Mesoamerica . Recent C-14 dated plant remains from 7 the Carlston-Annis site in...concept of horticulture that originated in Mesoamerica (Chomko and Crawford 1978:405). Whatever the source or inspiration of the appearance of food pro...historic period. Land-Use and Modification The records search on land-use and ownership primarily centered upon the available information in the Elbert
Directory of Open Access Journals (Sweden)
Perumal Palanivell
2015-01-01
Full Text Available High cation exchange capacity and organic matter content of crude humic substances from compost could be exploited to reduce ammonia loss from urea and to as well improve rice growth and soil chemical properties for efficient nutrients utilization in lowland rice cultivation. Close-dynamic air flow system was used to determine the effects of crude humic substances on ammonia volatilization. A pot experiment was conducted to determine the effects of crude humic substances on rice plant growth, nutrients uptake, nutrients recovery, and soil chemical properties using an acid soil mixed with three rates of crude humic substances (20, 40, and 60 g pot−1. Standard procedures were used to evaluate rice plant dry matter production, nutrients uptake, nutrients recovery, and soil chemical properties. Application of crude humic substances increased ammonia volatilization. However, the lowest rate of crude humic substances (20 g pot−1 significantly improved total dry matter, nutrients uptake, nutrients recovery, and soil nutrients availability compared with crude humic substances (40 and 60 g pot−1 and the normal fertilization. Apart from improving growth of rice plants, crude humic substances can be used to ameliorate acid soils in rice cultivation. The findings of this study are being validated in our ongoing field trials.
2012-10-12
... trade commodities and that can be said to be the end product of either innovation or substantial effort... schedule II controlled substances by competitors of the applicant. See Penick, 68 FR at 6947, 6949; Johnson... be a windfall to Respondents' competitors and would put Respondents at a competitive disadvantage...
International Nuclear Information System (INIS)
1982-09-01
The Systematic Evaluation Program was initiated in February 1978 by the US Nuclear Regulatory Commission to review the designs of older operating nuclear reactor plants to reconfirm and document their safety. The review provides (1) an assessment of how these plants compare with current licensing safety requirements relating to selected issues, (2) a basis for deciding on how these differences should be resolved in an integrated plant review, and (3) a documented evaluation of plant safety. This report documents the review of the Oyster Creek Nuclear Generating Station (located in Ocean County, New Jersey), one of ten plants reviewed under Phase II of this program, and indicates how 137 topics selected for review under Phase I of the program were addressed. Equipment and procedural changes have been identified as a result of the review. It is expected that this report will be one of the bases in considering the issuance of a full-term operating license in place of the existing provisional operating license
Sawyer, Aaron M.; Borduin, Charles M.
2011-01-01
Objective: Although current evidence suggests that the positive effects of multisystemic therapy (MST) on serious crime reach as far as young adulthood, the longer term impact of MST on criminal and noncriminal outcomes in midlife has not been evaluated. In the present study, the authors examined a broad range of criminal and civil court outcomes…
DEFF Research Database (Denmark)
Harsted, Steen; Mieritz, Rune M; Bronfort, Gert
2016-01-01
BACKGROUND: In order for measurements to be clinically useful, data on psychometric conditions such as reliability should be available in the population for which the measurements are intended to be used. This study comprises a test-retest design separated by 7 to 14 days, and evaluates the intra...
Directory of Open Access Journals (Sweden)
Gustavo Malagón Londoño
2008-12-01
Full Text Available
DEFF Research Database (Denmark)
Jørgensen, Michael Søgaard
1999-01-01
The report analyses barriers and incentivres to cleaner production in Tanznaia based on experiences in three demonstration projects with around 25 companies.An outline for a policy study on cleaner production in Tanzania and for the strengthening of cleaner production in Tanzania is given....
Energy Technology Data Exchange (ETDEWEB)
Maspero, M.; Meijer, G.J.; Lagendijk, J.J.W.; Berg, C.A.T. van den [Department of Radiotherapy, UMC Utrecht (Netherlands); Seevinck, P.R.; Viergever, M.A. [Image Science Institute, UMC Utrecht (Netherlands)
2015-06-15
Purpose: To develop an image processing method for MRI-based generation of electron density maps, known as pseudo-CT (pCT), without usage of model- or atlas-based segmentation, and to evaluate the method in the pelvic and head-neck region against CT. Methods: CT and MRI scans were obtained from the pelvic region of four patients in supine position using a flat table top only for CT. Stratified CT maps were generated by classifying each voxel based on HU ranges into one of four classes: air, adipose tissue, soft tissue or bone.A hierarchical region-selective algorithm, based on automatic thresholding and clustering, was used to classify tissues from MR Dixon reconstructed fat, In-Phase (IP) and Opposed-Phase (OP) images. First, a body mask was obtained by thresholding the IP image. Subsequently, an automatic threshold on the Dixon fat image differentiated soft and adipose tissue. K-means clustering on IP and OP images resulted in a mask that, via a connected neighborhood analysis, allowing the user to select the components corresponding to bone structures.The pCT was estimated through assignment of bulk HU to the tissue classes. Bone-only Digital Reconstructed Radiographs (DRR) were generated as well. The pCT images were rigidly registered to the stratified CT to allow a volumetric and voxelwise comparison. Moreover, pCTs were also calculated within the head-neck region in two volunteers using the same pipeline. Results: The volumetric comparison resulted in differences <1% for each tissue class. A voxelwise comparison showed a good classification, ranging from 64% to 98%. The primary misclassified classes were adipose/soft tissue and bone/soft tissue. As the patients have been imaged on different table tops, part of the misclassification error can be explained by misregistration. Conclusion: The proposed approach does not rely on an anatomy model providing the flexibility to successfully generate the pCT in two different body sites. This research is founded by ZonMw IMDI Programme, project name: “RASOR sharp: MRI based radiotherapy planning using a single MRI sequence”, project number: 10-104003010.
Energy Technology Data Exchange (ETDEWEB)
Patton, T; Du, K; Bayouth, J [University of Wisconsin, Madison, WI (United States); Christensen, G; Reinhardt, J [University of Iowa, Iowa City, IA (United States)
2016-06-15
Purpose: Ventilation change caused by radiation therapy (RT) can be predicted using four-dimensional computed tomography (4DCT) and image registration. This study tested the dependency of predicted post-RT ventilation on effort correction and pre-RT lung function. Methods: Pre-RT and 3 month post-RT 4DCT images were obtained for 13 patients. The 4DCT images were used to create ventilation maps using a deformable image registration based Jacobian expansion calculation. The post-RT ventilation maps were predicted in four different ways using the dose delivered, pre-RT ventilation, and effort correction. The pre-RT ventilation and effort correction were toggled to determine dependency. The four different predicted ventilation maps were compared to the post-RT ventilation map calculated from image registration to establish the best prediction method. Gamma pass rates were used to compare the different maps with the criteria of 2mm distance-to-agreement and 6% ventilation difference. Paired t-tests of gamma pass rates were used to determine significant differences between the maps. Additional gamma pass rates were calculated using only voxels receiving over 20 Gy. Results: The predicted post-RT ventilation maps were in agreement with the actual post-RT maps in the following percentage of voxels averaged over all subjects: 71% with pre-RT ventilation and effort correction, 69% with no pre-RT ventilation and effort correction, 60% with pre-RT ventilation and no effort correction, and 58% with no pre-RT ventilation and no effort correction. When analyzing only voxels receiving over 20 Gy, the gamma pass rates were respectively 74%, 69%, 65%, and 55%. The prediction including both pre- RT ventilation and effort correction was the only prediction with significant improvement over using no prediction (p<0.02). Conclusion: Post-RT ventilation is best predicted using both pre-RT ventilation and effort correction. This is the only prediction that provided a significant improvement on agreement. Research support from NIH grants CA166119 and CA166703, a gift from Roger Koch, and a Pilot Grant from University of Iowa Carver College of Medicine.
DEFF Research Database (Denmark)
Kilpelaeinen, T. O.; den Hoed, M.; Ong, K. K.
2011-01-01
High birth weight is associated with adult body mass index (BMI). We hypothesized that birth weight and BMI may partly share a common genetic background.......High birth weight is associated with adult body mass index (BMI). We hypothesized that birth weight and BMI may partly share a common genetic background....
Chen, Xianglei
2010-01-01
Enrollment in graduate and first-professional education in the United States has increased in recent years--from about 2 million students in fall 1995 to more than 2.6 million students in fall 2007 (Snyder, Dillow, and Hoffman 2009, tables 206 and 207). Increasing enrollments overall raise questions regarding the types of students entering…
Energy Technology Data Exchange (ETDEWEB)
Ali, I; Oyewale, S; Ahmad, S; Algan, O [University of Oklahoma Health Sciences, Oklahoma City, OK (United States); Alsbou, N [Department of Electrical and Computer Engineering, Ada, OH (United States)
2014-06-01
Purpose: To investigate quantitatively patient motion effects on the localization accuracy of image-guided radiation with fiducial markers using axial CT (ACT), helical CT (HCT) and cone-beam CT (CBCT) using modeling and experimental phantom studies. Methods: Markers with different lengths (2.5 mm, 5 mm, 10 mm, and 20 mm) were inserted in a mobile thorax phantom which was imaged using ACT, HCT and CBCT. The phantom moved with sinusoidal motion with amplitudes ranging 0–20 mm and a frequency of 15 cycles-per-minute. Three parameters that include: apparent marker lengths, center position and distance between the centers of the markers were measured in the different CT images of the mobile phantom. A motion mathematical model was derived to predict the variations in the previous three parameters and their dependence on the motion in the different imaging modalities. Results: In CBCT, the measured marker lengths increased linearly with increase in motion amplitude. For example, the apparent length of the 10 mm marker was about 20 mm when phantom moved with amplitude of 5 mm. Although the markers have elongated, the center position and the distance between markers remained at the same position for different motion amplitudes in CBCT. These parameters were not affected by motion frequency and phase in CBCT. In HCT and ACT, the measured marker length, center and distance between markers varied irregularly with motion parameters. The apparent lengths of the markers varied with inverse of the phantom velocity which depends on motion frequency and phase. Similarly the center position and distance between markers varied inversely with phantom speed. Conclusion: Motion may lead to variations in maker length, center position and distance between markers using CT imaging. These effects should be considered in patient setup using image-guided radiation therapy based on fiducial markers matching using 2D-radiographs or volumetric CT imaging.
International Nuclear Information System (INIS)
Ali, I; Oyewale, S; Ahmad, S; Algan, O; Alsbou, N
2014-01-01
Purpose: To investigate quantitatively patient motion effects on the localization accuracy of image-guided radiation with fiducial markers using axial CT (ACT), helical CT (HCT) and cone-beam CT (CBCT) using modeling and experimental phantom studies. Methods: Markers with different lengths (2.5 mm, 5 mm, 10 mm, and 20 mm) were inserted in a mobile thorax phantom which was imaged using ACT, HCT and CBCT. The phantom moved with sinusoidal motion with amplitudes ranging 0–20 mm and a frequency of 15 cycles-per-minute. Three parameters that include: apparent marker lengths, center position and distance between the centers of the markers were measured in the different CT images of the mobile phantom. A motion mathematical model was derived to predict the variations in the previous three parameters and their dependence on the motion in the different imaging modalities. Results: In CBCT, the measured marker lengths increased linearly with increase in motion amplitude. For example, the apparent length of the 10 mm marker was about 20 mm when phantom moved with amplitude of 5 mm. Although the markers have elongated, the center position and the distance between markers remained at the same position for different motion amplitudes in CBCT. These parameters were not affected by motion frequency and phase in CBCT. In HCT and ACT, the measured marker length, center and distance between markers varied irregularly with motion parameters. The apparent lengths of the markers varied with inverse of the phantom velocity which depends on motion frequency and phase. Similarly the center position and distance between markers varied inversely with phantom speed. Conclusion: Motion may lead to variations in maker length, center position and distance between markers using CT imaging. These effects should be considered in patient setup using image-guided radiation therapy based on fiducial markers matching using 2D-radiographs or volumetric CT imaging
Palanivell, Perumal; Ahmed, Osumanu Haruna; Ab Majid, Nik Muhamad; Jalloh, Mohamadu Boyie; Susilawati, Kasim
2015-01-01
High cation exchange capacity and organic matter content of crude humic substances from compost could be exploited to reduce ammonia loss from urea and to as well improve rice growth and soil chemical properties for efficient nutrients utilization in lowland rice cultivation. Close-dynamic air flow system was used to determine the effects of crude humic substances on ammonia volatilization. A pot experiment was conducted to determine the effects of crude humic substances on rice plant growth, nutrients uptake, nutrients recovery, and soil chemical properties using an acid soil mixed with three rates of crude humic substances (20, 40, and 60 g pot(-1)). Standard procedures were used to evaluate rice plant dry matter production, nutrients uptake, nutrients recovery, and soil chemical properties. Application of crude humic substances increased ammonia volatilization. However, the lowest rate of crude humic substances (20 g pot(-1)) significantly improved total dry matter, nutrients uptake, nutrients recovery, and soil nutrients availability compared with crude humic substances (40 and 60 g pot(-1)) and the normal fertilization. Apart from improving growth of rice plants, crude humic substances can be used to ameliorate acid soils in rice cultivation. The findings of this study are being validated in our ongoing field trials.
2010-06-09
..., depending upon the bidding activity for the license. Equations and examples are shown in Attachment B of the.... Balancing the potential need for bidders to use withdrawals to avoid winning incomplete combinations of...
Directory of Open Access Journals (Sweden)
Hongmi Lee
2012-10-01
Full Text Available Previous studies have reported conflicting findings on whether item repetition has beneficial or detrimental effects on source memory. To reconcile such contradictions, we investigated whether the degree of pre-exposure of items can be a potential modulating factor. The experimental procedures spanned two consecutive days. On Day 1, participants were exposed to a set of unfamiliar faces. On Day 2, the same faces presented on the previous day were used again in half of the participants, whereas novel faces were used for the other half. Day 2 procedures consisted of three successive phases: item repetition, source association, and source memory test. In the item repetition phase, half of the face stimuli were repeatedly presented while participants were making male/female judgments. During the source association phase, both the repeated and the unrepeated faces appeared in one of the four locations on the screen. Finally, participants were tested on the location in which a given face was presented during the previous phase and reported the confidence of their memory. Source memory accuracy was measured as the percentage of correct non-guess trials. As results, we found a significant interaction between prior exposure and repetition. Repetition impaired source memory when the items had been pre-exposed on Day 1, while it led to greater accuracy in novel ones. These results show that pre-experimental exposure can modulate the effects of repetition on associative binding between an item and its contextual information, suggesting that pre-existing representation and novelty signal interact to form new episodic memory.
Directory of Open Access Journals (Sweden)
Mathias Djalma Appelt
2007-11-01
Full Text Available Avaliou-se o efeito da suplementação de dietas com diferentes promotores de crescimento sobre o desempenho e rendimento de carcaça de frangos de corte de 1 a 42 dias de idade. Foram utilizados 576 pintos da linhagem Cobb 500, machos, alojados em cama reutilizada, distribuídos em um delineamento inteiramente casualizado, em esquema fatorial 2 x 3 (forma física da ração x diferentes promotores de crescimento, totalizando 6 tratamentos, com 6 repetições e 16 aves por unidade experimental. As características de desempenho avaliadas foram ganho de peso, peso final, consumo de ração, conversão alimentar, mortalidade e o índice de eficiência produtiva. Avaliou-se também o rendimento de carcaça, bem como rendimento em cortes, coração, fígado e gordura abdominal. Os resultados obtidos demonstram não haver efeito dos tratamentos estudados sobre as características de desempenho e rendimento de carcaça.This study evaluated the supplementation effect of diets with different growth promoters on the performance and carcass yield in broilers from 1 to 42 days of age. Five hundred seventy six broilers of the Coob 500 lineage were used, all males, lodged in reused litter, allocated according to a completely randomized design in a 2 x 3 factorial scheme (physical forms of the ration x growth promoters, totalizing 6 treatments, 6 repetitions per treatment and 16 broilers per experimental unit. The performance parameters evaluated were weight gain, final weight, feed consumption, feed conversion, mortality and index productive efficiency. The carcass yield was also evaluated, as the cuts yield and percentage of abdominal fat at 42 days. The results demonstrated no effect of the treatments studied on the performance characteristics and carcass yield.
$\\beta$-delayed fission, laser spectroscopy and shape-coexistence studies with radioactive At beams
We propose to study the $\\beta$-delayed fission, laser spectroscopy and radioactive decay of the newly available pure beams of neutron-deficient and neutron-rich astatine (Z=85) isotopes. The fission probability and the fission fragment distribution of the even-even isotopes $^{194,196}$Po following the $\\beta$-decay of the isotopes $^{194,196}$At will be studied with the Windmill setup. In-source laser spectroscopy will be performed on the entire astatine isotopic chain, using a combination of the Windmill setup, ISOLTRAP MR-ToF and ISOLDE Faraday. Radioactive decay data will be acquired at the Windmill setup throughout those studies and contribute to the global understanding of the phenomenon of shape coexistence in the neutron-deficient lead region.
A simple method for labelling proteins with 211At via diazotized aromatic diamine
International Nuclear Information System (INIS)
Wunderlich, G.; Franke, W.-G.; Fischer, S.; Dreyer, R.
1987-01-01
A simple and rapid method for labelling proteins with 211 At by means of a 1,4-diaminobenzene link is described. This link is transformed into the diazonium salt and subsequently reactions of both 211 At and proteins with the diazonium salt take place simultaneously. For possibly high yields of astatized protein an appropriate temperature of 273 K was found. The results demonstrate the difference between the reaction mechanisms of iodine and astatine with proteins. (author)
The Installation Restoration Program Toxicology Guide. Volume 2
1987-05-01
Periodic Table: fluorine , chlorine, bromine, iodine, and astatine. Fluorine is the most active of all chemical elements. 5/87 LIST OF ABBREVIATIONS...fire- retardant varnishes and as an aminizing agent for cotton fabric (901). 37.2 ENVIRONMENTAL FATE A1D EXPOSURE PATHWAYS 37.2.1 Transport in Soil...subject to packaging and labeling regulations. Directive on Paints, Varnishes . Printing Inks. Adhesives and Similar Product; (1334) Pentachlorophenol
International Nuclear Information System (INIS)
Koziorowski, J.
1998-01-01
Radiohalogens are widely used in nuclear medicine, both as tool for diagnostic in vivo imaging, and in radionuclide therapy. This study deals with the use of radiohalogens; separation, precursor synthesis, labeling and biological behavior. The focus is on 211 At and 124 I, the former being a candidate for nuclide therapy and the latter potentially useful for diagnostic imaging and Auger-electron based radiotherapy. For astatine the separation, labeling and some biological behavior is described, and for iodine the latter two. Astatine was separated from an irradiated bismuth target by dry distillation. A novel cryotrap was developed for the isolation of astatine and subsequent synthesis of radiolabeled compounds. 5-[ 211 At]astato-2'-deoxyuridine (AUdR) and N-succinimidyl-4-[ 211 At]astatobenzoate (SAB) were synthesized in 95% respectively 90% radiochemical yields. The former is incorporated into DNA of proliferating cells and can therefore be used as an endoradiotherapeutic agent. The latter is a conjugate for the astatination of proteins. Human epidermal growth factor (hEGF) was tagged with astatine using three approaches: a) direct labeling of native hEGF, b) conjugation with SAB, and c) direct labeling of an hEGF - 7-(3-aminopropyl)-7,8-dicarba-nido-undecaborate(1-) conjugate. The overall labeling yields were 3.5% for direct labeling, 44% for SAB and 70% for the hEGF-nido-carborane conjugate. A new route to N-succinimidyl 3- and 4- [ 124 I]iodobenzoate, two reagents for radioiodination of proteins is described affording 90% radiochemical yield. Three radioiodinated analogs of PK11195, 1-(2-chlorophenyl)-N-methyl-N-(1-methylpropyl)isoquinoline-3-carboxyam ide, a peripheral-type benzodiazepine receptor antagonist, were synthesized. All three analogs were obtained in >90% radiochemical yield. Synthesis and application of 5-[ 124 I]iodo-2'-deoxyuridine (IUdR) is presented. The closo-dodecaborate anion was evaluated as prosthetic group for radioiodination of
Energy Technology Data Exchange (ETDEWEB)
None
1976-10-14
The design and performance of a solar hot water system for can washing at the Campbell Soup Plant in Sacramento, California, are presented. The collector field is located on the roof of the finished products warehouse of the Campbell Soup Sacramento plant. Water is supplied from a 3.8 cm (1/sup 1///sub 2/ in.) supply line which is located directly below an existing roof access hatch. A supply pipe will be brought up through that hatch. The water flow will then be split into two manifold lines which supply the dual rows of flat plate collectors. The preheated water from the flat plates is then passed into six sets of parallel connected concentrators. Each set consist of eight 1.83 x 3.05 m (6 x 10 foot) modules connected in series. The water from these units is gathered in a 3.8 cm (1/sup 1///sub 2/ in.) insulated pipe which transports it to the storage tank. This pipe will be attached to an existing pipe run until it reaches the can washing building. From there the pipe will follow the can washing building around to the storage tank. The storage tank is a 75,200 1 (20,000 gal) steel tank which is coated internally with a USDA approved phenolic liner. The outside of the tank is insulated. A 2.2 kw (3 hp) motor is used to pump the stored water for the tank into the can washing line. Detail drawings and descriptions of the collector field, installation, piping, controls, data acquisition equipment, and roof structure are included. Furthermore, a program schedule with equipment and manpower costs for successfully completing Phase II of this contract is included. Also included is an organization chart of the Phase II program personnel. (WHK)
Ribeiro, Maria; Broekmans, Maarten; Sims, Ian
2016-01-01
This RILEM AAR 1.2 Atlas is complementary to the petrographic method described in RILEM AAR 1.1. It is designed and intended to assist in the identification of alkali-reactive rock types in concrete aggregate by thin-section petrography. Additional issues include: • optical thin-section petrography conforming to RILEM AAR 1.1 is considered the prime assessment method for aggregate materials, being effective regarding cost and time. Unequivocal identification of minerals in very-fine grained rock types may however require use of supplementary methods. • the atlas adheres to internationally adopted schemes for rock classification and nomenclature, as recommended in AAR 1.1. Thus, rock types are classified as igneous, sedimentary or metamorphic based upon mineral content, microstructure and texture/fabric. • in addition, the atlas identifies known alkali-reactive silica types in each rock type presented. It also identifies consistent coincidence between certain lithologies and silica types; however, it ref...
Sims, Ian
2016-01-01
This book contains the full set of RILEM Recommendations which have been produced to enable engineers, specifiers and testing houses to design and produce concrete which will not suffer damage arising from alkali reactions in the concrete. There are five recommended test methods for aggregates (designated AAR-1 to AAR-5), and an overall recommendation which describes how these should be used to enable a comprehensive aggregate assessment (AAR-0). Additionally, there are two Recommended International Specifications for concrete (AAR-7.1 & 7.2) and a Preliminary International Specification for dams and other hydro structures (AAR-7.3), which describe how the aggregate assessment can be combined with other measures in the design of the concrete to produce a concrete with a minimised risk of developing damage from alkali-aggregate reactions.
Energy Technology Data Exchange (ETDEWEB)
Wang, Yi; Park, Yang-Kyun; Doppke, Karen P. [Department of Radiation Oncology, Massachusetts General Hospital, Harvard Medical School, Boston, MA (United States)
2015-06-15
Purpose: This study evaluated the performance of the electron Monte Carlo dose calculation algorithm in RayStation v4.0 for an Elekta machine with Agility™ treatment head. Methods: The machine has five electron energies (6–8 MeV) and five applicators (6×6 to 25×25 cm {sup 2}). The dose (cGy/MU at d{sub max}), depth dose and profiles were measured in water using an electron diode at 100 cm SSD for nine square fields ≥2×2 cm{sup 2} and four complex fields at normal incidence, and a 14×14 cm{sup 2} field at 15° and 30° incidence. The dose was also measured for three square fields ≥4×4 cm{sup 2} at 98, 105 and 110 cm SSD. Using selected energies, the EBT3 radiochromic film was used for dose measurements in slab-shaped inhomogeneous phantoms and a breast phantom with surface curvature. The measured and calculated doses were analyzed using a gamma criterion of 3%/3 mm. Results: The calculated and measured doses varied by <3% for 116 of the 120 points, and <5% for the 4×4 cm{sup 2} field at 110 cm SSD at 9–18 MeV. The gamma analysis comparing the 105 pairs of in-water isodoses passed by >98.1%. The planar doses measured from films placed at 0.5 cm below a lung/tissue layer (12 MeV) and 1.0 cm below a bone/air layer (15 MeV) showed excellent agreement with calculations, with gamma passing by 99.9% and 98.5%, respectively. At the breast-tissue interface, the gamma passing rate is >98.8% at 12–18 MeV. The film results directly validated the accuracy of MU calculation and spatial dose distribution in presence of tissue inhomogeneity and surface curvature - situations challenging for simpler pencil-beam algorithms. Conclusion: The electron Monte Carlo algorithm in RayStation v4.0 is fully validated for clinical use for the Elekta Agility™ machine. The comprehensive validation included small fields, complex fields, oblique beams, extended distance, tissue inhomogeneity and surface curvature.
2012-01-01
Windows. To determine differences be- tween the groups and between time points, one-way analysis of variances (ANOVAs) and paired Student ’ t-tests were...Katz, “Neuropathic pain in patients with upper-extremity nerve injury,” Physiotherapy Canada, vol. 62, no. 3, pp. 190–201, 2010. Pain Research and
Directory of Open Access Journals (Sweden)
Anna Madoeuf
2014-09-01
Full Text Available Saluons la réédition, aux éditions Parenthèses, dans la collection Eupalinos, d’À travers le mur, de Jean-Charles Depaule, ouvrage qui est tant une contribution rare et originale aux études urbaines, qu’un opus d’anthropologie sur l’espace habité, de même qu’une source de références multiples, notamment littéraires. « Rêver des lourdes portes, des passages en chicane et plus encore, peut-être des moucharabiehs perdus […] ». Cette sollicitation onirique et énigmatique, quatrième de couverture ...
Creusat, Laurence
2003-01-01
Robert Ross, maître de conférence à l'université de Leiden, écrit et publie depuis vingt ans des ouvrages sur l'histoire de l'Afrique du Sud. Son dernier livre qui prend comme point de départ l'introduction de l'agriculture dans ce pays, il y a de cela 1 500 ans, et le conclut avec l'arrivée à la présidence de N. Mandela, est un bel exemple d'étude synthétique réussie sur l'histoire de ce pays. Le mérite de ce livre est de montrer clairement comment le passé explique le présent, commen...
Goncalves, Philippe; Brandt, Sönke; Nicollet, Christian; Tucker, Robert
2017-05-01
Determining the possible tectonic regimes active during the Neoproterozoic is crucial for the knowledge of the evolution of the super-continent Gondwana. In Madagascar, that occupies a key position in Gondwana, there is an on-going debate regarding the location of possible suture zones and the implications in terms of paleo-geography. Recognizing high-pressure to ultra-high pressure conditions in mafic rocks is commonly viewed as a strong argument for paleo-subduction zones. Ishwar-Kumar et al. (2015) report unusual high pressure conditions (24 kbar) in Neoproterozoic to Cambrian rocks from North-Central Madagascar (Andriamena Complex). They propose a geodynamic model in which exhumation of the high pressure terranes from up to 80 km to 40 km occurred via vertical extrusion during the collision of various crustal blocks after subduction and closure of an oceanic domain during the formation of Gondwana in the late Neoproterozoic to Cambrian. We question this model and in particular the (ultra-)high pressure conditions reported, because their estimation is based on a misinterpretation of the petrography and inaccurate thermodynamic modeling for the crucial metabasite sample. The authors suggest that garnet-quartz coronas around orthopyroxene and ilmenite coexist with clinopyroxene. The postulated garnet-clinopyroxene-quartz assemblage is interpreted to document an eclogite facies overprint. However, the presence of abundant plagioclase in the sample and the lack of high jadeite content in clinopyroxene clearly refute the postulated eclogite facies conditions. According to the presented photographs clinopyroxene is part of the rock matrix. We therefore suggest that the sample represents a common two-pyroxene granulite, formed at mid- to low-pressure granulite facies conditions of > 700 °C and Madagascar, this interpretation is not justified by the data presented by Ishwar-Kumar et al. (2015).
King, Trude V.V.; Hoefen, Todd M.; Kokaly, Raymond F.; Livo, Keith E.; Johnson, Michaela R.; Giles, Stuart A.
2013-01-01
This map shows the spatial distribution of selected iron-bearing minerals and other materials derived from analysis of airborne HyMap™ imaging spectrometer (hyperspectral) data of Afghanistan collected in late 2007. This map is one in a series of U.S. Geological Survey/Afghanistan Geological Survey quadrangle maps covering Afghanistan. Flown at an altitude of 50,000 feet (15,240 meters (m)), the HyMap™ imaging spectrometer measured reflected sunlight in 128 channels, covering wavelengths between 0.4 and 2.5 μm. The data were georeferenced, atmospherically corrected and converted to apparent surface reflectance, empirically adjusted using ground-based reflectance measurements, and combined into a mosaic with 23-m pixel spacing. Variations in water vapor and dust content of the atmosphere, in solar angle, and in surface elevation complicated correction; therefore, some classification differences may be present between adjacent flight lines. The reflectance spectrum of each pixel of HyMap™ imaging spectrometer data was compared to the reference materials in a spectral library of minerals, vegetation, water, and other materials. Minerals occurring abundantly at the surface and those having unique spectral features were easily detected and discriminated, while minerals having slightly different compositions but similar spectral features were less easily discriminated; thus, some map classes consist of several minerals having similar spectra, such as “Goethite and jarosite.” A designation of “Not classified” was assigned to the pixel when there was no match with reference spectra.
ORF Alignment: NC_006582 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ] ... Length = 219 ... Query: 8 ... WNDVIGGEFQKTYYLELREFLKREYKEQTVYPHMNDLFNAFHYTPFEQVKVVILGQDPYH 67 ... WNDVI...GGEFQKTYYLELREFLKREYKEQTVYPHMNDLFNAFHYTPFEQVKVVILGQDPYH Sbjct: 1 ... WNDVI
ORF Alignment: NC_004061 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... Length = 84 ... Query: 160 IKTNDLVTINYCIYENNKKLDKFNVEKFKFIVSQNNFIPELNNKLINHFTNDVI...FFKINF 219 ... IKTNDLVTINYCIYENNKKLDKFNVEKFKFIVSQNNFIPELNNKLINHFTNDVIFFKINF Sbjct: 1 ... IKTNDLVTINYCIYENNKKLDKFNVEKFKFIVSQNNFIPELNNKLINHFTNDVIFFKINF 60 ...
ORF Alignment: NC_004311 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... Length = 70 ... Query: 219 DKLKRALEAERSFTANSAHELRTPIAAALAQTQRLIAETQDKAARDRGEQIEAALHRLSR 278 ... DKLKRALEAERSFTANSAHEL...RTPIAAALAQTQRLIAETQDKAARDRGEQIEAALHRLSR Sbjct: 1 ... DKLKRALEAERSFTANSAHELRTPIAAALAQTQRLIAETQDKAARDRGEQIEAALHRLSR 60 ...
ORF Alignment: NC_002696 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available 219 ... Query: 38 ... RVLLFQPFTIPSASMEPNLYQGDYIIVSKFSYGWSKHSIPFSPPIIKGRIFDRAPKRGDI 97 ... RVLLFQPFTIPSAS...MEPNLYQGDYIIVSKFSYGWSKHSIPFSPPIIKGRIFDRAPKRGDI Sbjct: 1 ... RVLLFQPFTIPSASMEPNLYQGDYI
ORF Alignment: NC_003155 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available 109 ... Query: 219 ATAESIRAFIRQNLHDPELSPPVIAAAHHISLSYLHRIFQQQAQGETVAAYIRSQRLEGA 27...8 ... ATAESIRAFIRQNLHDPELSPPVIAAAHHISLSYLHRIFQQQAQGETVAAYIRSQRLEGA Sbjct: 1 ... ATAESIRAFIRQNLHDPELSPPVIAAAHHISLSYLHRIFQQQAQGETVAAYIRSQRLEGA 60 ...
78 FR 48152 - Advisory Committee on Student Financial Assistance; Meeting
2013-08-07
..., 80 F Street NW., Suite 413, Washington DC 20202-7582, (202) 219- 2099. SUPPLEMENTARY INFORMATION: The... at (202) 219-3032. You may also contact the Advisory Committee staff directly at (202) 219-2099. The..., August 21, 2013 by contacting Ms. Tracy Jones at (202) 219-2099 or via email at [email protected
75 FR 29739 - Advisory Committee on Student Financial Assistance: Hearing
2010-05-27
..., Capitol Place, 80 F Street, NW., Suite 413, Washington, DC 20202-7582, (202) 219-2099. Individuals who use... (202) 219-2099 or via e-mail at [email protected] . We will attempt to meet requests after this... at (202) 219-3032. You may also contact the Advisory Committee staff directly at (202) 219-2099. The...
Charge radii and electromagnetic moments of At-211195
Cubiss, J. G.; Barzakh, A. E.; Seliverstov, M. D.; Andreyev, A. N.; Andel, B.; Antalic, S.; Ascher, P.; Atanasov, D.; Beck, D.; Bieroń, J.; Blaum, K.; Borgmann, Ch.; Breitenfeldt, M.; Capponi, L.; Cocolios, T. E.; Day Goodacre, T.; Derkx, X.; De Witte, H.; Elseviers, J.; Fedorov, D. V.; Fedosseev, V. N.; Fritzsche, S.; Gaffney, L. P.; George, S.; Ghys, L.; Heßberger, F. P.; Huyse, M.; Imai, N.; Kalaninová, Z.; Kisler, D.; Köster, U.; Kowalska, M.; Kreim, S.; Lane, J. F. W.; Liberati, V.; Lunney, D.; Lynch, K. M.; Manea, V.; Marsh, B. A.; Mitsuoka, S.; Molkanov, P. L.; Nagame, Y.; Neidherr, D.; Nishio, K.; Ota, S.; Pauwels, D.; Popescu, L.; Radulov, D.; Rapisarda, E.; Revill, J. P.; Rosenbusch, M.; Rossel, R. E.; Rothe, S.; Sandhu, K.; Schweikhard, L.; Sels, S.; Truesdale, V. L.; Van Beveren, C.; Van den Bergh, P.; Wakabayashi, Y.; Van Duppen, P.; Wendt, K. D. A.; Wienholtz, F.; Whitmore, B. W.; Wilson, G. L.; Wolf, R. N.; Zuber, K.
2018-05-01
Hyperfine-structure parameters and isotope shifts of At-211195 have been measured for the first time at CERN-ISOLDE, using the in-source resonance-ionization spectroscopy method. The hyperfine structures of isotopes were recorded using a triad of experimental techniques for monitoring the photo-ion current. The Multi-Reflection Time-of-Flight Mass Spectrometer, in connection with a high-resolution electron multiplier, was used as an ion-counting setup for isotopes that either were affected by strong isobaric contamination or possessed a long half-life; the ISOLDE Faraday cups were used for cases with high-intensity beams; and the Windmill decay station was used for short-lived, predominantly α -decaying nuclei. The electromagnetic moments and changes in the mean-square charge radii of the astatine nuclei have been extracted from the measured hyperfine-structure constants and isotope shifts. This was only made possible by dedicated state-of-the-art large-scale atomic computations of the electronic factors and the specific mass shift of atomic transitions in astatine that are needed for these extractions. By comparison with systematics, it was possible to assess the reliability of the results of these calculations and their ascribed uncertainties. A strong deviation in the ground-state mean-square charge radii of the lightest astatine isotopes, from the trend of the (spherical) lead isotopes, is interpreted as the result of an onset of deformation. This behavior bears a resemblance to the deviation observed in the isotonic polonium isotopes. Cases for shape coexistence have been identified in At,199197, for which a significant difference in the charge radii for ground (9 /2- ) and isomeric (1 /2+ ) states has been observed.
International Nuclear Information System (INIS)
1995-07-01
This report is a transcript of an interview of Dr. Patricia Wallace Durbin by representatives of the US DOE Office of Human Radiation Research. Dr. Durbin was selected for this interview because of her knowledge of the human plutonium injections and her recollections of key figures, especially Joseph Hamilton. After a brief biographical sketch Dr. Durbin discusses her loss of research funding from DOE, her recollections concerning research into strontium metabolism as part of Project Sunshine, her recollections relating to the rationale for studies of human metabolism of radionuclides, her remembrances of Dr. Hamilton's Astatine and Plutonium research, and her experiences in gathering archival records concerning these researches
ORF Alignment: NC_004741 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ASSNQLSALPELPV Sbjct: 1 ... SETSLDLSCLGLRSLPRLPDNLDEINVSNNQLSMLPELPRALKELNASSNQLSALPELPV 60 ... Query: 180 RDDHIIRIFWLNQNRITAIPE...SILGLSSDSVVNLRENQLS 219 ... RDDHIIRIFWLNQNRITAIPESILGLSSDSVVNLRENQLS Sbjct: 121 RDDHIIRIFWLNQNRITAIPESILGLSSDSVVNLRENQLS 160
ORF Alignment: NC_004347 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available -1] ... Length = 219 ... Query: 21 ... AAEPLVIGAEDDWAPYCALDKQSGQPLGLAPELVKAVFATEKLEIAFRPLPFARCMHDAK 80 ... ... ... AAEPLVIGAEDDWAPYCALDKQSGQPLGLAPELVKAVFATEKLEIAFRPLPFARCMHDAK Sbjct: 1 ... AA...EPLVIGAEDDWAPYCALDKQSGQPLGLAPELVKAVFATEKLEIAFRPLPFARCMHDAK 60 ... Query: 141 YTYPTDFMDNTKITRFEAKSDAQILEMLVRGRVD
ORF Alignment: ch_oct10_gene_aa_db [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available 0000004359 [Cryptosporidium hominis] ... Length = 172 ... Query: 219 DIDECKEGSHSCSHICVNTRGSFVCECPKGYTLDK...NQQDCIDINECQENSGLGPCEFGCK 278 ... DIDECKEGSHSCSHICVNTRGSFVCECPKGYTLDKNQQDCIDINECQENSGLGPCEFGCK Sbjct: 1 ... DIDECKEGSHSCSHICVNTR
ORF Alignment: NC_004463 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... 110] ... Length = 44 ... Query: 219 HFVNRGDTLASIARKNHISAAELARANGLDPSAKLKLGTKL 259 ... HFVNRGDTLASIARKNHIS...AAELARANGLDPSAKLKLGTKL Sbjct: 1 ... HFVNRGDTLASIARKNHISAAELARANGLDPSAKLKLGTKL 41
48 CFR 1819.7302 - NASA contract clauses.
2010-10-01
... to Public Law 97-219 (the Small Business Innovation Development Act of 1982). (b) Contracting... pursuant to Public Law 97-219 (the Small Business Innovation Development Act of 1982). (c) Contracting... Law 97-219 (the Small Business Innovation Development Act of 1982). (d) Contracting officers shall...
75 FR 55314 - Advisory Committee on Student Financial Assistance: Meeting
2010-09-10
... later than Monday, September 20, 2010 by contacting Ms. Tracy Jones at (202) 219- 2099 or via e-mail at..., 80 F Street, NW., Suite 413, Washington, DC 20202-7582, (202) 219-2099. SUPPLEMENTARY INFORMATION.... You may also contact the Advisory Committee staff directly at (202) 219-2099. The registration...
76 FR 52943 - Advisory Committee on Student Financial Assistance: Meeting
2011-08-24
... later than Monday, September 5, 2011 by contacting Ms. Tracy Jones at (202) 219- 2099 or via e-mail at..., Washington DC 20202-7582, (202) 219-2099. Individuals who use a telecommunications device for the deaf (TTY...-3032. You may also contact the Advisory Committee staff directly at (202) 219-2099. The registration...
76 FR 7551 - Advisory Committee on Student Financial Assistance: Hearing
2011-02-10
...-7582, (202) 219-2099. Individuals who use a telecommunications device for the deaf (TDD) may call the.... Tracy Jones at (202) 219-2099 or via email at [email protected] . We will attempt to meet...-3032. You may also contact the Advisory Committee staff directly at (202) 219-2099. The registration...
76 FR 44317 - Advisory Committee on Student Financial Assistance: Meeting
2011-07-25
... later than Monday, August 1, 2011 by contacting Ms. Tracy Jones at (202) 219-2099 or via e-mail at tracy..., 80 F Street, NW., Suite 413, Washington DC 20202-7582, (202) 219-2099. Individuals who use a...-3032. You may also contact the Advisory Committee staff directly at (202) 219-2099. The registration...
77 FR 42490 - Advisory Committee on Student Financial Assistance: Meeting
2012-07-19
..., 80 F Street NW., Suite 413, Washington, DC 20202-7582, (202) 219-2099. SUPPLEMENTARY INFORMATION: The...-3032. You may also contact the Advisory Committee staff directly at (202) 219-2099. The registration..., 2012 by contacting Ms. Tracy Jones at (202) 219-2099 or via email at [email protected] . We...
Mancini, F R; Paul, D; Gauvreau, J; Volatier, J L; Vin, K; Hulin, M
2015-01-01
This study aimed to estimate the exposure to seven additives (benzoates, parabens, nitrites, nitrates, BHA, BHT and aspartame) in children aged less than 3 years old in France. A conservative approach, combining individual consumption data with maximum permitted levels, was carried out for all the additives. More refined estimates using occurrence data obtained from products' labels (collected by the French Observatory of Food Quality) were conducted for those additives that exceeded the acceptable daily intake (ADI). Information on additives' occurrence was obtained from the food labels. When the ADI was still exceeded, the exposure estimate was further refined using measured concentration data, if available. When using the maximum permitted level (MPL), the ADI was exceeded for benzoates (1.94 mg kg(-1) bw day(-1)), nitrites (0.09 mg kg(-1) bw day(-1)) and BHA (0.39 mg kg(-1) bw day(-1)) in 25%, 54% and 20% of the entire study population respectively. The main food contributors identified with this approach were current foods as these additives are not authorised in specific infant food: vegetable soups and broths for both benzoates and BHA, delicatessen and meat for nitrites. The exposure estimate was significantly reduced when using occurrence data, but in the upper-bound scenario the ADI was still exceeded significantly by the age group 13-36 months for benzoates (2%) and BHA (1%), and by the age group 7-12 months (16%) and 13-36 months (58%) for nitrites. Measured concentration data were available exclusively for nitrites and the results obtained using these data showed that the nitrites' intake was below the ADI for all the population considered in this study. These results suggest that refinement of exposure, based on the assessment of food levels, is needed to estimate the exposure of children to BHA and benzoates for which the risk of exceeding the ADI cannot be excluded when using occurrence data.
Haslach, Erica M.; Huang, Huisuo; Dirain, Marvin; Debevec, Ginamarie; Geer, Phaedra; Santos, Radleigh G.; Giulianotti, Marc A.; Pinilla, Clemencia; Appel, Jon R.; Doering, Skye R.; Walters, Michael A.; Houghten, Richard A.; Haskell-Luevano, Carrie
2014-01-01
Human obesity has been linked to genetic factors and single nucleotide polymorphisms (SNPs). Melanocortin-4 receptor (MC4R) SNPs have been associated with up to 6% frequency in morbidly obese children and adults. A potential therapy for individuals possessing such genetic modifications is the identification of molecules that can restore proper receptor signaling and function. These compounds could serve as personalized medications improving quality of life issues as well as alleviating diseas...
Directory of Open Access Journals (Sweden)
Editorial
2017-01-01
Full Text Available The authors and their affiliations were listed as follows: Ranko Golijanin*†, Bojan Kujundžić†, Zoran Milosavljević‡, Dragan R. Milovanovi槆†, Zlatibor Andjelković║, Miroslav Obrenović¶, Radivoje Nikolić**†† *Department of Dentistry, ‡Department of Histology and Embriology, §Department of Pharmacology and Toxicology, **Department of Surgery, Faculty of Medical Sciences, University of Kragujevac, Kragujevac, Serbia; †Faculty of Dental Medicine, ¶Faculty of Medicine, University of East Sarajevo, Foča, Republic of Srpska, Bosnia and Herzegovina; ††Clinical Center “Kragujevac”, Kragujevac, Serbia Listed the authors and their affiliations should read as: Ranko Golijanin*†, Bojan Kujundžić†, Zoran Milosavljević‡, Dragan R. Milovanovi槆†, Zlatibor Andjelković║, Miroslav Obrenović¶, Radivoje Nikolić**†† *Department of Dentistry, ‡Department of Histology and Embriology, §Department of Pharmacology and Toxicology, **Department of Surgery, Faculty of Medical Sciences, University of Kragujevac, Kragujevac, Serbia; ║Department of Histology, Faculty of Medicine, University of Priština, Kosovska Mitrovica, Serbia; †Faculty of Dental Medicine, ¶Faculty of Medicine, University of East Sarajevo, Foča, Republic of Srpska, Bosnia and Herzegovina; ††Clinical Center “Kragujevac”, Kragujevac, Serbia Link to the corrected article 10.2298/VSP130627076G
DEFF Research Database (Denmark)
Back, T.; Haraldsson, B.; Hultborn, R
2009-01-01
of the glomerular filtration rate (GFR). The renal toxicity was evaluated at levels close to the dose limit for the bone marrow and well within the range for therapeutic efficacy on tumors. Astatinated MX35-F(ab')(2) monoclonal antibodies were administered intravenously to nude mice. Both non-tumor-bearing animals...... manifested late. Examination of the kidney sections showed histologic changes that were overall subdued. Following alpha-RIT with (211)At-MX35-F(ab')(2) at levels close to the dose limit of severe myelotoxicity, the effects found on renal function were relatively small, with only minor to moderate reductions...... in GFR. These results suggest that a mean absorbed dose to the kidneys of approximately 10 Gy is acceptable, and that the kidneys would not be the primary dose-limiting organ in systemic alpha-RIT when using (211)At-MX35-F(ab')(2) Udgivelsesdato: 2009/12...
New developments of the in-source spectroscopy method at RILIS/ISOLDE
Marsh, B A; Imai, N; Seliverstov, M D; Rothe, S; Sels, S; Capponi, L; Rossel, R E; Franchoo, S; Wendt, K; Focker, G J; Kalaninova, Z; Sjoedin, A M; Popescu, L; Nicol, T; Huyse, M; Radulov, D; Atanasov, D; Kesteloot, N; Borgmann, Ch; Cocolios, T E; Lecesne, N; Ghys, L; Pauwels, D; Rapisarda, E; Kreim, S; Liberati, V; Wolf, R N; Andel, B; Schweikhard, L; Lane, J; Derkx, X; Kudryavtsev, Yu; Zemlyanoy, S G; Fedosseev, V N; Lynch, K M; Rosenbusch, M; Van Duppen, P; Lunney, D; Manea, V; Barzakh, A E; Andreyev, A N; Truesdale, V; Flanagan, K T; Molkanov, P L; Koester, U; Van Beveren, C; Wienholtz, F; Goodacre, T Day; Antalic, S; Bastin, B; De Witte, H; Fink, D A; Fedorov, D V
2013-01-01
At the CERN ISOLDE facility, long isotope chains of many elements are produced by proton-induced reactions in target materials such as uranium carbide. The Resonance Ionization Laser Ion Source (RILIS) is an efficient and selective means of ionizing the reaction products to produce an ion beam of a chosen isotope. Coupling the RILIS with modern ion detection techniques enables highly sensitive studies of nuclear properties (spins, electromagnetic moments and charge radii) along an isotope chain, provided that the isotope shifts and hyperfine structure splitting of the atomic transitions can be resolved. At ISOLDE the campaign to measure the systematics of isotopes in the lead region (Pb, Bi, Tl and Po) has been extended to include the gold and astatine isotope chains. Several developments were specifically required for the feasibility of the most recent measurements: new ionization schemes (Po, At); a remote controlled narrow line-width mode of operation for the RILIS Ti:sapphire laser (At, Au, Po); isobar fr...
International Nuclear Information System (INIS)
Korotkin, Yu.S.; Ter-Akop'yan, G.M.; Popeko, A.G.; Drobina, T.P.; Zhuravleva, E.L.
1982-01-01
The results of experiments on further concentration of a new natural spontaneously fissionable nuclide, the concentrates of which form the Cheleken geothermal brines have been obtained, are presented. The conclusions are drown about the chemical nature of a new spontaneously fissionable nuclide. It is a chalcophile element which copreipitates with sulphides of copper, lead, arsenic and mercury from weakly acid solutions. The behaviour of the new nuclide in sulphide systems in many respects is similar to the behaviour of polonium, astatine and probably of bismuth. The most probable stable valence of the new nuclide varies from +1 up to +3. The data available on the chemical behaviour of the new nuclide as well as the analysis over contamination by spontaneously fissionable isotopes permit to state that the new natural spontaneously fissionable nuclide does not relate to the known isotopes
Is Electronegativity a Useful Descriptor for the 'Pseudo-Alkali-Metal' NH4?
International Nuclear Information System (INIS)
Whiteside, Alexander; Xantheas, Sotiris S.; Gutowski, Maciej S.
2011-01-01
Molecular ions in the form of 'pseudo-atoms' are common structural motifs in chemistry, with properties that are transferrable between different compounds. We have determined the electronegativity of the 'pseudo-alkali metal' ammonium (NH4) and evaluated its reliability as a descriptor in comparison to the electronegativities of the alkali metals. The computed properties of its binary complexes with astatine and of selected borohydrides confirm the similarity of NH4 to the alkali metal atoms, although the electronegativity of NH4 is relatively large in comparison to its cationic radius. We paid particular attention to the molecular properties of ammonium (angular anisotropy, geometric relaxation, and reactivity), which can cause deviations from the behaviour expected of a conceptual 'true alkali metal' with this electronegativity. These deviations allow for the discrimination of effects associated with the polyatomic nature of NH4.
Boiling points of the superheavy elements 117 and 118
International Nuclear Information System (INIS)
Takahashi, N.
2001-01-01
It has been shown that the relativistic effect on the electrons reveal in the heavy element region. What kind of changes will appear in the heavy elements because of the relativistic effects? Can we observe the changes? We observed that the boiling points of astatine and radon are lower than that extrapolated values from lighter elements in the same groups. Systematic behavior of the elements on the boiling point was examined and a new method for the estimation of the boiling points of the superheavy elements in the halogen and rare gases has been found. The estimated values of the elements 117 and 118 are 618 and 247 K, respectively which are considerably lower than those obtained until now. If these values are correct the production of the superheavy elements with heavy ions reaction may be affected. Further, the chemical properties may be fairly different from the lighter elements. (author)
DEFF Research Database (Denmark)
Lyckesvärd, Madeleine Nordén; Delle, Ulla; Kahu, Helena
2014-01-01
Childhood exposure to ionizing radiation increases the risk of developing thyroid cancer later in life and this is suggested to be due to higher proliferation of the young thyroid. The interest of using high-LET alpha particles from Astatine-211 ((211)At), concentrated in the thyroid by the same...... mechanism as (131)I [1], in cancer treatment has increased during recent years because of its high efficiency in inducing biological damage and beneficial dose distribution when compared to low-LET radiation. Most knowledge of the DNA damage response in thyroid is from studies using low-LET irradiation...... and much less is known of high-LET irradiation. In this paper we investigated the DNA damage response and biological consequences to photons from Cobolt-60 ((60)Co) and alpha particles from (211)At in normal primary thyrocytes of different cell cycle status. For both radiation qualities the intensity...
ORF Alignment: EHA1 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available Entamoeba histolytica HM-1:IMSS] ... Length = 219 ... Query: 344 EPAQADPENTYADGEGVEKCDAGKGPVKFTIHCVNKVGTSVPVTGAKFKVIIRSN...DGNEI 403 ... EPAQADPENTYADGEGVEKCDAGKGPVKFTIHCVNKVGTSVPVTGAKFKVIIRSNDGNEI Sbjct: 1 ... ... EPAQADPENTYADGEGVEKCDAGKGPVKFTIHCVNKVGTSVPVTGAKFKVIIRSNDGNEI 60 ... Query: 464 GVEG
ORF Alignment: EHA1 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available tamoeba histolytica HM-1:IMSS] ... Length = 219 ... Query: 344 EPAQADPENTYADGEGVEKCDAGKGPVKFTIHCVNKVGTAVPVTGAKFKVIIRSN...DGNEI 403 ... EPAQADPENTYADGEGVEKCDAGKGPVKFTIHCVNKVGTAVPVTGAKFKVIIRSNDGNEI Sbjct: 1 ... E...PAQADPENTYADGEGVEKCDAGKGPVKFTIHCVNKVGTAVPVTGAKFKVIIRSNDGNEI 60 ... Query: 464 GVEGGV
Directory of Open Access Journals (Sweden)
Yao Blaise Koffi
2009-12-01
Full Text Available La relation pluie-débit fait l'objet de nombreuses études, à cause de son importance dans la mise en œuvre de nombreux projets de développement. La communauté scientifique, dans le souci de faire face aux problèmes d'eau, tels que les inondations et les sècheresses, utilise différents modèles. Mais ces modèles sont généralement confrontés à la non-linéarité de la relation pluie-débit. Dans le cas du Bandama Blanc, objet de cette étude, cette non-linéarité est accentuée par la présence de plusieurs barrages à vocation agro-pastorale situés dans la partie nord de la zone d'étude et qui utilisent les eaux de ce fleuve. Ce mémoire de thèse traite donc de la modélisation des débits mensuels du Bandama Blanc, aux stations de Bada, Marabadiassa, Tortiya et Bou, à l'aide des réseaux de neurones, déjà éprouvés dans ce contexte de relation non-linéaire. Elle projette de fournir des outils plus robustes aux hydrologues africains pour la simulation et la prévision des débits des rivières jaugées. Pour atteindre cet objectif, deux Perceptrons Multicouches entraînés avec l'algorithme de la rétropropagation de l'erreur ont été construits. Le premier modèle a été utilisé seulement en simulation et le second en simulation et en prévision. Le modèle conceptuel GR2M, a été utilisé pour valider les résultats obtenus avec les réseaux de neurones. Pour cette étude, une importante base de données climatiques (pluie et température et hydrométriques (débits mensuels a été utilisée. Les résultats obtenus sont forts satisfaisants et nettement supérieurs à ceux obtenus avec le modèle conceptuel global GR2M. En effet, les réseaux de neurones parviennent à expliquer plus de 70 % de la variation des débits, avec des coefficients de corrélation de Pearson qui excèdent 0,80. Cependant ces modèles arrivent difficilement à simuler et à faire la prévision des débits extrêmes (étiages et crues, à cause probablement du nombre réduit de données à notre disposition et de la séparation des bases de calage et de validation.The rainfall-runoff relationship is the subject of many studies because of its importance in the implementation of many development projects. The scientific community, in order to cope with water problems such as floods and droughts, used different models. But these models are usually faced with the non-linearity of the rainfall-runoff relationship. In the case of the Bandama Blanc purpose of this study, this non-linearity is enhanced by the presence of several agro-pastoral dams located in the northern part of the study area and using the waters of this river. This thesis therefore deals with the modeling of flows of Bandama Blanc hydrometric stations (Bada Marabadiassa, Tortiya and Bou using neural networks already experienced in the context of non-linear relationship. It plans to provide more robust tools to African hydrologist in the simulation and forecasting of river flows. To achieve this goal, two Multilayer Perceptrons trained with the backpropagation algorithm of error have been built. The first model was used only in simulation and the second in simulation and prediction. The conceptual model GR2M was used to validate the results obtained with neural networks. An extensive database climate (rainfall and temperature and river monthly flow was used in this study. The results obtained are very satisfactory and well above those obtained with the overall conceptual model GR2M. Indeed, neural networks are able to explain more than 70% of the variation in rates, with Pearson correlation coefficients exceeding 0.80. However, these models have difficulty to simulate and predict extremes flow probably because of the reduced number of data at our disposal and separation of bases calibration and validation.
2013-02-08
... activities (Section 219 of the Act), as well as the Women and Minority Business Enterprise requirements (Sec... activities (Section 219 of the Act), as well as the Women and Minority Business Enterprise requirements (Sec... below has been submitted to the Office of Management and Budget (OMB) for review, as required by the...
1989-01-01
8217The Nature and Status of Ethnobotany," Chronica Botanica , Vol 6, pp 219-221. Jones, Volney H. 1957. "Botany," The Identification of Non- artifactual...Chronica Botanica , Vol. 6, pp. 219-221. CULTURAL Ethnobotany, general JONES, VOLNEY H., 1957, Botany. In Taylor, W., (editor), The Identification of Non
Journal of Chemical Sciences | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Journals; Journal of Chemical Sciences; Volume 119; Issue 3. Issue front cover thumbnail. Volume 119, Issue 3. May 2007, pages 219-274. pp 219-230. Engineering macrocyclic figure-eight motif · V Haridas Harinder Singh Yogesh K Sharma Kashmiri Lal · More Details Abstract Fulltext PDF. The design and ...
DEFF Research Database (Denmark)
Larsen, Lesli H; Echwald, Søren Morgenthaler; Sørensen, Thorkild I A
2005-01-01
)) for mutations in MC4R. A total of 14 different mutations were identified of which two, Ala219Val and Leu325Phe, were novel variants. The variant receptor, Leu325Phe, was unable to bind [Nle4,d-Phe7]-alphaMSH, whereas the Ala219Val variant showed a significantly impaired melanotan II induction of cAMP, compared...
Functional design criteria radioactive liquid waste line replacement, Project W-087. Revision 3
International Nuclear Information System (INIS)
McVey, C.B.
1994-01-01
This document provides the functional design criteria for the 222-S Laboratory radioactive waste drain piping and transfer pipeline replacement. The project will replace the radioactive waste drain piping from the hot cells in 222-S to the 219-S Waste Handling Facility and provide a new waste transfer route from 219-S to the 244-S Catch Station in Tank Farms
77 FR 21161 - National Forest System Land Management Planning
2012-04-09
... 219 National Forest System Land Management Planning; Final Rule #0;#0;Federal Register / Vol. 77 , No... Forest Service 36 CFR Part 219 RIN 0596-AD02 National Forest System Land Management Planning AGENCY... Agriculture is adopting a new National Forest System land management planning rule (planning rule). The new...
48 CFR 1319.811-3 - Contract clauses.
2010-10-01
... shall insert the clause 1352.219-71, Notification to Delay Performance (Deviation), in solicitations and...) Direct Award (Deviation), in direct contracts and purchase orders processed under the Partnership... 1352.219-72, Notification of Competition Limited to Eligible 8(a) Concerns, Alternate III (Deviation...
Lifescience Database Archive (English)
Full Text Available za... 219 1e-55 tr|A6N1H0|A6N1H0_ORYSI Magnesium-protoporphyrin ix monomethyl es... 219 1e-55 tr|Q40093|Q40093_IPONI PNIL34...LAEFEPQLVY 429 Y M P++SGSVD AEFEPQLVY Sbjct: 134 AYLMPPIESGSVDFAEFEPQLVY 156 >tr|Q40093|Q40093_IPONI PNIL34
76 FR 76318 - Defense Federal Acquisition Regulation Supplement; Technical Amendments
2011-12-07
... Defense Business Transformation Agency Contracting Office. PART 204--ADMINISTRATIVE MATTERS 204.402...) * * * (iii) For special notices for small business events, follow the procedures at PGI 205.207(d)(ii). PART... Economy Act order. PART 219--SMALL BUSINESS PROGRAMS 0 22. Section 219.202-1 is added to read as follows...
Why Innovations in Agriculture are Necessary?
Indian Academy of Sciences (India)
... of people living below poverty line (21.9%, 2011-12). Ensuring food security for increasing population and for millions of people living below poverty line (21.9%, 2011-12). Major source of livelihood (about 54.5% workers are engaged in agriculture). Major demand driver for the growth of other sectors of the economy.
African Journals Online (AJOL)
Items 201 - 219 of 219 ... Vol 5 (2014), Understanding the legal fundamentals of project finance contracts, Abstract PDF. Grace Chinyere Young. Vol 7 (2016), Unfair dismissal in Nigeria: Imperative for a departure from the common law, Abstract PDF. Emmanuel OC Obidimma, MI Anushiem, UMJ Ekeneme. Vol 6 (2015), United ...
On the theory of time dilation in chemical kinetics
Baig, Mirza Wasif
2017-10-01
The rates of chemical reactions are not absolute but their magnitude depends upon the relative speeds of the moving observers. This has been proved by unifying basic theories of chemical kinetics, which are transition state theory, collision theory, RRKM and Marcus theory, with the special theory of relativity. Boltzmann constant and energy spacing between permitted quantum levels of molecules are quantum mechanically proved to be Lorentz variant. The relativistic statistical thermodynamics has been developed to explain quasi-equilibrium existing between reactants and activated complex. The newly formulated Lorentz transformation of the rate constant from Arrhenius equation, of the collision frequency and of the Eyring and Marcus equations renders the rate of reaction to be Lorentz variant. For a moving observer moving at fractions of the speed of light along the reaction coordinate, the transition state possess less kinetic energy to sweep translation over it. This results in the slower transformation of reactants into products and in a stretched time frame for the chemical reaction to complete. Lorentz transformation of the half-life equation explains time dilation of the half-life period of chemical reactions and proves special theory of relativity and presents theory in accord with each other. To demonstrate the effectiveness of the present theory, the enzymatic reaction of methylamine dehydrogenase and radioactive disintegration of Astatine into Bismuth are considered as numerical examples.
Energy Technology Data Exchange (ETDEWEB)
Nestor, Marika, E-mail: marika.nestor@bms.uu.s [Unit of Otolaryngology and Head and Neck Surgery, Department of Surgical Sciences, Uppsala University, S-751 85 Uppsala (Sweden); Unit of Biomedical Radiation Sciences, Department of Oncology, Radiology and Clinical Immunology, Uppsala University, S-751 85 Uppsala (Sweden); Sundstroem, Magnus [Unit of Molecular Pathology, Department of Genetics and Pathology, Uppsala University (Sweden); Anniko, Matti [Unit of Otolaryngology and Head and Neck Surgery, Department of Surgical Sciences, Uppsala University, S-751 85 Uppsala (Sweden); Tolmachev, Vladimir [Unit of Biomedical Radiation Sciences, Department of Oncology, Radiology and Clinical Immunology, Uppsala University, S-751 85 Uppsala (Sweden)
2011-01-15
Aim: The monoclonal antibody cetuximab, targeting the epidermal growth factor receptor (EGFR), is a promising molecular targeting agent to be used in combination with radiation for anticancer therapy. In this study, effects of cetuximab in combination with alpha-emitting radioimmunotherapy (RIT) in a panel of cultured human squamous cell carcinomas (SCCs) were assessed. Methods: SCC cell lines were characterized and treated with cetuximab in combination with anti-CD44v6 RIT using the astatinated chimeric monoclonal antibody U36 ({sup 211}At-cMAb U36). Effects on {sup 211}At-cMAb U36 uptake, internalization and cell proliferation were then assessed in SCC cells. Results: Cetuximab in combination with {sup 211}At-cMAb U36 mediated increased growth inhibition compared to RIT or cetuximab alone in two cell lines. However, cetuximab also mediated radioprotective effects compared to RIT alone in two cell lines. The radioprotective effects occurred in the cell lines in which cetuximab clearly inhibited cell growth during radiation exposure. Cetuximab treatment also influenced {sup 211}At-cMAb-U36 uptake and internalization, suggesting interactions between CD44v6 and EGFR. Conclusions: Results from this study demonstrate the vast importance of further clarifying the mechanisms of cetuximab and radiation response, and the relationship between EGFR and suitable RIT targets. This is important not only in order to avoid potential radioprotective effects, but also in order to find and utilize potential synergistic effects from these combinations.
Study of Neutron-Deficient $^{202-205}$Fr Isotopes with Collinear Resonance Ionization Spectroscopy
De Schepper, Stijn; Cocolios, Thomas; Budincevic, Ivan
The scope of this master’s thesis is the study of neutron-deficient $^{202−205}$Fr isotopes. These isotopes are inside the neutron-deficient lead region, a region that has shown evidence of shape coexistence. For this thesis, this discussion is limited to the phenomenon where a low lying excited state has a different shape than the ground state. Shape coexistence is caused by intruder states. These are single-particle Shell Model states that are perturbed in energy due to the interaction with a deformed core. In the neutron-deficient lead region the main proton intruder orbit is the 3s$_{1/2}$orbit. When going towards more neutron-deficient isotopes, deformation increases. The $\\pi3s_{1/2}$orbit will rise in energy and will eventually become the ground state in odd- A bismuth (Z=83) isotopes. It is also observed in odd-A astatine (Z=85) isotopes, already in less neutron-deficient nuclei. The same phenomenon is expected to be present francium (Z=87) isotopes already at $^{199}$Fr. Although it is currently ...
International Nuclear Information System (INIS)
Adelstein, S.J.; Zalutsky, M.; Bloomer, W.
1981-01-01
This project is concerned with developing the potential of alpha-emitting radionuclides as agents for radiotherapy. Alpha-emitters seem ideally suited for his application because their high linear energy transfer and short range permit the deposition of considerable energy in a very small volume of tissue. Unlike the beta particles of 131 I which have a range of about 1 to 2 mm in tissue, 5 to 7 MeV alpha particles would traverse only a few cell diameters. Among the available alpha-emitters, 211 At appears most promising for therapeutic applications because, (1) it has some chemical similarities to iodine, an element that can readily be incorporated into numerous proteins and peptides, (2) it has a half-life that is long enough to permit chemical manipulation yet short enough to minimize destruction of healthy cells due to degradation of the label over time, (3) it can be produced conveniently using a cyclotron, and (4) alpha emission is associated with 100% of its decays with no accompanying beta emission. In the past year the evaluation of an astatine-tellurium colloid as an agent for the destruction of malignant ascites has been completed. The therapeutic efficacy of 211 At-tellurium colloid has been compared with that of several beta-emitting radiocolloids. Studies on the application of monoclonal antibodies as carriers for selective delineation and destruction of malignant cell populations have also been initiated
Energy Technology Data Exchange (ETDEWEB)
Adelstein, S.J.; Zalutsky, M.; Bloomer, W.
1981-01-01
This project is concerned with developing the potential of alpha-emitting radionuclides as agents for radiotherapy. Alpha-emitters seem ideally suited for his application because their high linear energy transfer and short range permit the deposition of considerable energy in a very small volume of tissue. Unlike the beta particles of /sup 131/I which have a range of about 1 to 2 mm in tissue, 5 to 7 MeV alpha particles would traverse only a few cell diameters. Among the available alpha-emitters, /sup 211/At appears most promising for therapeutic applications because, (1) it has some chemical similarities to iodine, an element that can readily be incorporated into numerous proteins and peptides, (2) it has a half-life that is long enough to permit chemical manipulation yet short enough to minimize destruction of healthy cells due to degradation of the label over time, (3) it can be produced conveniently using a cyclotron, and (4) alpha emission is associated with 100% of its decays with no accompanying beta emission. In the past year the evaluation of an astatine-tellurium colloid as an agent for the destruction of malignant ascites has been completed. The therapeutic efficacy of /sup 211/At-tellurium colloid has been compared with that of several beta-emitting radiocolloids. Studies on the application of monoclonal antibodies as carriers for selective delineation and destruction of malignant cell populations have also been initiated.
Alpha particle emitters in medicine
International Nuclear Information System (INIS)
Fisher, D.R.
1989-09-01
Radiation-induced cancer of bone, liver and lung has been a prominent harmful side-effect of medical applications of alpha emitters. In recent years, however, the potential use of antibodies labeled with alpha emitting radionuclides against cancer has seemed promising because alpha particles are highly effective in cell killing. High dose rates at high LET, effectiveness under hypoxic conditions, and minimal expectancy of repair are additional advantages of alpha emitters over antibodies labeled with beta emitting radionuclides for cancer therapy. Cyclotron-produced astatine-211 ( 211 At) and natural bismuth-212 ( 212 Bi) have been proposed and are under extensive study in the United States and Europe. Radium-223 ( 223 Ra) also has favorable properties as a potential alpha emitting label, including a short-lived daughter chain with four alpha emissions. The radiation dosimetry of internal alpha emitters is complex due to nonuniformly distributed sources, short particle tracks, and high relative specific ionization. The variations in dose at the cellular level may be extreme. Alpha-particle radiation dosimetry, therefore, must involve analysis of statistical energy deposition probabilities for cellular level targets. It must also account fully for nonuniform distributions of sources in tissues, source-target geometries, and particle-track physics. 18 refs., 4 figs
Studies of Stable Octupole Deformations in the Radium Region
2002-01-01
The purpose of the present project is to locate and identify states in the atomic nuclei possessing stable pearshaped octupole deformation. Such states, formally related to the structures known in molecular physics, manifest themselves as families of parity doublets in odd nuclei.\\\\ \\\\ The best possibilities for observing stable octupole deformations are offered in the Ra-region. Both theoretical calculations and experimental indications support such expectations. Such indications are the non-observation of two-phonon octupole vibrational states in the ISOLDE studies of the even-even radium nuclei, and the reversed sign of the decoupling factor of the ground state band in |2|2|5Ra observed in the single-neutron transfer reactions. In order to establish the predicted strong E1 and E3-transitions between the parity doublets in odd nuclei with stable octupole deformations it is proposed to study conversion electrons in odd-mass francium radium and radon isotopes following the @b-decay of francium and astatine. \\...
International Nuclear Information System (INIS)
Chatal, J. F.
2000-01-01
The antibodies can be satisfactorily labelled with technitium-99 m or indium-111 for tumor immunoscintigraphy. The immunoscintigraphy is not useful for the primary tumor diagnosis. It can be useful for the diagnosis of the some cancer extension and for recurrent tumor visualization. The immunoscintigraphy is widely competed with Positron Emission Tomography (PET) which gives accurate results. In the future the immunoscintigraphy, in pre-therapeutic stage, contribute to the estimation of the dose delivered to the tumor and to normal organs for adopting or not a radioimmunotherapy. The antibodies can also be labeled with Iodine-131 for an application in radioimmunotherapy (RIT). The RIT is efficient in the non-Hodgkin's lymphoma treatment because of their great radiosensitivity. Until now the results have been very modest in solid tumor treatment but methodological and biotechnological progresses have to improve the efficiency especially for the small tumors. In the future iodine-131 which requires the confinement (very expensive) of patients will be substituted by yttrium-90 beta emitter, more energetic than iodine-131 and can be injected in walking case. In the long term, the alpha emitter radionuclides (astatine-211 or bismuth-213) can be used for hematologic cancer treatment. In conclusion the future of radiolabeled monoclonal antibodies is essentially therapeutic. The radioimmunotherapy associated to the chemotherapy give promising perspectives for the radiosensitive cancer treatment and in general small solid tumor treatment (F.M.)
Nuclear and chemical data for life sciences
International Nuclear Information System (INIS)
Moumita Maiti; Indian Institute of Technology Roorkee, Roorkee, Uttarakhand
2013-01-01
Use of reactor produced radionuclides is popular in life sciences. However, cyclotron production of proton rich radionuclides are being more focused in recent times. These radionuclides have already gained attention in various fields, including life sciences, provided they are obtained in pure form. This article is a representative brief of our contributions in generating nuclear data for the production of proton rich radionuclides of terbium, astatine, technetium, ruthenium, cadmium, niobium, zirconium, rhenium, etc., which may have application in clinical, biological, agriculture studies or in basic research. The chemical data required to separate the product isotopes from the corresponding target matrix have been presented along with a few propositions of radiopharmaceuticals. It also emphasizes on the development of simple empirical technique, based on the nuclear reaction model analysis, to generate reliable nuclear data for the estimation of yield and angular distribution of emitted neutrons and light charged particles from light as well as heavy ion induced reactions on thick stopping targets. These data bear utmost important in radiation dosimetry. (author)
Energy Technology Data Exchange (ETDEWEB)
Mume, Eskender [Organic Chemistry, Department of Chemistry, Uppsala University, S-751 24 Uppsala (Sweden); Orlova, Anna [Affibody AB, S-161 02 Bromma (Sweden); Malmstroem, Per-Uno [Division of Urology, Department of Surgical Sciences, Uppsala University, S-751 85 Uppsala (Sweden); Lundqvist, Hans [Unit of Biomedical Radiation Sciences, Rudbeck Laboratory, Uppsala University, S-751 85 Uppsala (Sweden); Sjoeberg, Stefan [Organic Chemistry, Department of Chemistry, Uppsala University, S-751 24 Uppsala (Sweden); Tolmachev, Vladimir [Unit of Biomedical Radiation Sciences, Rudbeck Laboratory, Uppsala University, S-751 85 Uppsala (Sweden)]. E-mail: vladimir.tolmachev@bms.uu.se
2005-08-01
Combining the specificity of radioimmunoscintigraphy and the high sensitivity of PET in an in vivo detection technique could improve the quality of nuclear diagnostics. Positron-emitting nuclide {sup 76}Br (T {sub 1/2}=16.2 h) might be a possible candidate for labeling monoclonal antibodies (mAbs) and their fragments, provided that the appropriate labeling chemistry has been established. For internalizing antibodies, such as the humanized anti-HER2 monoclonal antibody, trastuzumab, radiobromine label should be residualizing, i.e., ensuring that radiocatabolites are trapped intracellularly after the proteolytic degradation of antibody. This study evaluated the chemistry of indirect radiobromination of trastuzumab using N-succinimidyl 5-(tributylstannyl)-3-pyridinecarboxylate. Literature data indicated that the use of this method provided residualizing properties for iodine and astatine labels on some antibodies. An optimized 'one-pot' procedure produced an overall labeling efficiency of 45.5{+-}1.2% over 15 min. The bromine label was stable under physiological and denaturing conditions. The labeled trastuzumab retained its capacity to bind specifically to HER2-expressing SKOV-3 ovarian carcinoma cells in vitro (immunoreactivity more than 75%). However, in vitro cell test did not demonstrate that the radiobromination of trastuzumab using N-succinimidyl 5-bromo-3-pyridinecarboxylate improves cellular retention of radioactivity in comparison with the use of N-succinimidyl 4-bromobenzoate.
The in vivo fate of a 211At labelled monoclonal antibody with known specificity in a murine system
International Nuclear Information System (INIS)
Vaughan, A.T.M.; Bateman, W.J.; Fisher, D.R.
1982-01-01
A monoclonal antibody reactive against the human transferrin receptor has been labelled with the alpha and X ray emitting isotope Astatine 211. The labelling procedure does not affect the ability of the product to bind to the transferrin receptor on the human leukemic cell line HL60. Using a direct binding assay, 211 At labelled antibody can be specifically inhibited from binding to its target cells by excess unlabelled antibody. Furthermore, the binding inhibition demonstrated in this system correlates to enhanced clonogenic survival of these cells, indicating that very few atoms of 211 At/cell are required for cell death. Data obtained from labelled antibody injected into mice show that the labelled product in serum retains the ability to bind to HL60 cells in vitro, although tissue distributions of the injected activity implies that some of the radiolabel is lost from the protein. Despite this loss of label, preliminary experiments on the localization of labelled antibody to HL60 cells growing s/c in nude mice show that tumor tissue has a higher specific activity than all other tissues, other than blood, after 12 hours. This suggests that further work on the nature of label degradation in vivo is warranted in the context of potential therapeutic and diagnostic studies
International Nuclear Information System (INIS)
Nestor, Marika; Sundstroem, Magnus; Anniko, Matti; Tolmachev, Vladimir
2011-01-01
Aim: The monoclonal antibody cetuximab, targeting the epidermal growth factor receptor (EGFR), is a promising molecular targeting agent to be used in combination with radiation for anticancer therapy. In this study, effects of cetuximab in combination with alpha-emitting radioimmunotherapy (RIT) in a panel of cultured human squamous cell carcinomas (SCCs) were assessed. Methods: SCC cell lines were characterized and treated with cetuximab in combination with anti-CD44v6 RIT using the astatinated chimeric monoclonal antibody U36 ( 211 At-cMAb U36). Effects on 211 At-cMAb U36 uptake, internalization and cell proliferation were then assessed in SCC cells. Results: Cetuximab in combination with 211 At-cMAb U36 mediated increased growth inhibition compared to RIT or cetuximab alone in two cell lines. However, cetuximab also mediated radioprotective effects compared to RIT alone in two cell lines. The radioprotective effects occurred in the cell lines in which cetuximab clearly inhibited cell growth during radiation exposure. Cetuximab treatment also influenced 211 At-cMAb-U36 uptake and internalization, suggesting interactions between CD44v6 and EGFR. Conclusions: Results from this study demonstrate the vast importance of further clarifying the mechanisms of cetuximab and radiation response, and the relationship between EGFR and suitable RIT targets. This is important not only in order to avoid potential radioprotective effects, but also in order to find and utilize potential synergistic effects from these combinations.
International Nuclear Information System (INIS)
Hofer, K.G.
1980-06-01
Internal radiotherapy should be performed with short-lived radionuclides which emit high LET radiation and short ranged radiation, and accumulated within cancers. Based on these considerations, several radionuclides (tritium, copper-64, gallium-67, iodine-123, iodine 125, iodine-131 and astatine-211) were chosen and their toxicity was assessed using cell division in mammalian cultured cells as a criterion. It was apparent that the toxic effects obtained with 125 I greatly exceeded those observed in cells treated with any other radionuclides. The possible hypotheses to explain the excessive radiosensitivity of 125 I were discussed in relation to microdosimetry calculation. It was also found that the division delay induced by radionuclide decay is primarily due to damage to the cell nucleus but not to the plasma membrane. The key problem remains the development of agents which can serve as carriers for radionuclide accumulation within tumors. Although several promising approaches (Synkavit, tamoxifen, iododeoxyuridine, antibodies, liposomes) were investigated, only 125 I-labelled Synkavit would be desirable for clinical application
211At-labelling of polymer particles for radiotherapy: synthesis, purification and stability
International Nuclear Information System (INIS)
Larsen, R.H.; Hassfjell, S.P.; Hoff, P.; Alstad, J.; Bjoergum, J.
1993-01-01
Cyclotron-produced 211 At was distilled from a Bi metal target and coupled to N-succinimidyl-3-(trimethylstannyl)benzoate. The resulting N-succinimidyl-3-( 211 At)astatobenzoate was thereafter coupled to aminated monosized polymer particles with a diameter of 1.8 μm. The total time elapsed from the end of the cyclotron irradiation until the final product was prepared was about 2.5 hours. From 23 to 51% of the target activity at the end of bombardment was measured in the final conjugate. Solid-liquid extraction purification of the astatinated intermediate, using Sep-pak columns (Waters), gave more reproducible yields in the final conjugation step. The 211 At-labelled particles were incubated with fetal calf serum, human serum and human full blood at room temperature. The 211 At activity on the particles was measured before and after three times washing at 4, 24 and 48 hours. The stability was not significantly different from 100% for all media and for all time points. This indicates that 211 At-labelled particles can be stable under in vivo conditions, and may thereby be a promising agent for intracavitary radiotherapy on free-floating cancer cells or surface fixed cells. (Author)
Silver impregnated nanoparticles of titanium dioxide as carriers for {sup 211}At
Energy Technology Data Exchange (ETDEWEB)
Cedrowska, Edyta; Lyczko, Monika; Piotrowska, Agata; Bilewicz, Aleksander [Institute of Nuclear Chemistry and Technology, Warsaw (Poland); Stolarz, Anna; Trcinska, Agnieszka [Warsaw Univ. (Poland). Heavy Ion Lab.; Szkliniarz, Katarzyna [Silesia Univ. Katowice (Poland). Inst. of Physics; Was, Bogdan [Polish Academy of Science, Cracow (Poland). Inst. of Nuclear Physics
2016-08-01
The {sup 211}At radioisotope exhibits very attractive nuclear properties for application in radionuclide therapy. Unfortunately use of {sup 211}At is limited, because astatine as the heaviest halogen forms weak bond with carbon atoms in the biomolecules which makes {sup 211}At bioconjugates unstable in physiological conditions. In our work we propose a new solution for binding of {sup 211}At which consists of using nanoparticles of titanium dioxide modified with silver atoms as carriers for {sup 211}At. Ag{sup +} cations have been absorbed on the nanometer-sized TiO{sub 2} particles (15 and 32 nm) through ion exchange process and were reduced in Tollens' reaction. The obtained TiO{sub 2}-Ag nanoparticles were labeled with {sup 211}At. It was found that labeling yields were almost quantitative under reducing conditions, while under oxidizing conditions they dropped to about 80%. The labeled nanoparticles exhibited very high stability in physiological salt, PBS buffer, solutions of peptides (0.001 M cysteine, 0.001 M glutathione) and in human blood serum. To make TiO{sub 2}/Ag nanoparticles well dispersed in water and biocompatible their surface was modified with a silane coupling agent containing poly(ethyleneglycol) molecules. The developed functionalization approach will allow us to attach biomolecules to the TiO{sub 2}/Ag surface.
Development of Reagents for Application of At-211 to Targeted Radionuclide Therapy of Cancer
International Nuclear Information System (INIS)
Wilbur, D. Scott
2011-01-01
This grant covered only a period of 4 months as the major portion of the award was returned to DOE due to an award of funding from NIH that covered the same research objectives. A letter regarding the termination of the research is attached as the last page of the Final Report. The research conducted was limited due to the short period of this grant, but the results obtained in that period are outlined in the Final Report. The studies addressed in the research effort were directed at a problem that is of critical importance to the in vivo application of the alpha-particle emitting radionuclide At-211. That problem, low in vivo stability of many astatinated molecules, severely limits the use of At-211 in therapeutic applications. The advances sought in the studies were expected to expand the types of biomolecules that can be used as carriers of At-211, and provide improved in vivo targeting of the radiation dose compared with the dose delivered to normal tissue.
Proceedings of transuranium elements
International Nuclear Information System (INIS)
Anon.
1992-01-01
The identification of the first synthetic elements was established by chemical evidence. Conclusive proof of the synthesis of the first artificial element, technetium, was published in 1937 by Perrier and Segre. An essential aspect of their achievement was the prediction of the chemical properties of element 43, which had been missing from the periodic table and which was expected to have properties similar to those of manganese and rhenium. The discovery of other artificial elements, astatine and francium, was facilitated in 1939-1940 by the prediction of their chemical properties. A little more than 50 years ago, in the spring of 1940, Edwin McMillan and Philip Abelson synthesized element 93, neptunium, and confirmed its uniqueness by chemical means. On August 30, 1940, Glenn Seaborg, Arthur Wahl, and the late Joseph Kennedy began their neutron irradiations of uranium nitrate hexahydrate. A few months later they synthesized element 94, later named plutonium, by observing the alpha particles emitted from uranium oxide targets that had been bombarded with deuterons. Shortly thereafter they proved that is was the second transuranium element by establishing its unique oxidation-reduction behavior. The symposium honored the scientists and engineers whose vision and dedication led to the discovery of the transuranium elements and to the understanding of the influence of 5f electrons on their electronic structure and bonding. This volume represents a record of papers presented at the symposium
What Are the Common Treatments for Menstrual Irregularities?
... NICHD Research Information Find a Study More Information Amenorrhea About NICHD Research Information Find a Study More ... Society for Reproductive Medicine. (2008). Current evaluation of amenorrhea. Fertility and Sterility, 90 , S219–S225. Apgar, B. S., ...
A complete degradation of organophosphates by microwave-assisted hydrolysis
Czech Academy of Sciences Publication Activity Database
Jansa, Petr; Čechová, Lucie; Janeba, Zlatko
2016-01-01
Roč. 3, č. 3 (2016), s. 219-226 ISSN 2213-3356 R&D Projects: GA MV VG20102015046 Institutional support: RVO:61388963 Keywords : organophosphates * microwave irradiation * hydrolysis Subject RIV: CC - Organic Chemistry
Plant species richness-productivity relationships in a low-productive boreal region
Czech Academy of Sciences Publication Activity Database
Axmanová, I.; Chytrý, M.; Danihelka, Jiří; Lustyk, P.; Kočí, M.; Kubešová, S.; Horsák, M.; Cherosov, M. M.; Gogoleva, P. A.
2013-01-01
Roč. 214, č. 2 (2013), s. 207-219 ISSN 1385-0237 Institutional support: RVO:67985939 Keywords : competitive excluison * forest herb layer * grassland Subject RIV: EF - Botanics Impact factor: 1.640, year: 2013
... spine. Much less common causes in children include: Achondroplasia , a disorder of bone growth that causes the ... Carson BS, Rigamonti D, Ahn ES. Achondroplasia and other dwarfisms. ... PA: Elsevier Saunders; 2011:chap 219. Mistovich RJ, Spiegel ...
African Journals Online (AJOL)
Lincoln User
Peer-reviewed paper: 10th World Conference on Animal Production. 219. Improving the quality of wool through the use of gene markers. T.O. Itenge. 1# .... International Wool Textile Organisation (IWTO) standards. Measurements included ...
77 FR 73516 - Federal Acquisition Regulation; Iran Threat Reduction
2012-12-10
... information provided. FOR FURTHER INFORMATION CONTACT: Ms. Cecelia L. Davis, Procurement Analyst, at 202-219... sector of Iran and impose sanctions with respect to transport of crude oil from Iran and evasion of...
Czech Academy of Sciences Publication Activity Database
Schifferová, Věra
18/42/, - (2004), s. 219-223 ISSN 0231-5955 Institutional research plan: CEZ:AV0Z9009908 Keywords : The interpretation of Comenius * the pupils of Edmund Husserl * rationalism and mysticism Subject RIV: AA - Philosophy ; Religion
African Journals Online (AJOL)
Items 51 - 100 of 219 ... Vol 9, No 2 (2018), Domestic amnesty for international crimes and the ... of Nigeria's international obligations in curbing domestic violence, Abstract PDF ... Nigerian copyright laws in the age of social media, Abstract PDF.
2010-03-19
... approved in 1988, there have been changes in economic, social, and ecological conditions, new policies and... effect. The 2000 Planning Rule's transition provisions (36 CFR 219.35) --amended in 2002 and 2003, and...
ORF Alignment: NC_003076 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available DNA-binding protein ... 19) ... Length = 153 ... Query: 160 GCVKGARGASGLCISH...GGGQRCQKPGCNKGAESKTTFCKTHGGGKRCEHLGCTKSAEGKT 219 ... GC KGAR ASG CISHGGG+RCQKP C KGAE KT +CK H...GGG+RCE+LGCTK AEG T Sbjct: 2 ... GCQKGARDASGRCISHGGGRRCQKPDCQKGAEGKTVYCKAHGGGRRCEYLGCTKGAEGST 61 ... Query: 280 K
National Research Council Canada - National Science Library
Provan, Drew; Gribben, John
2010-01-01
... The molecular basis of hemophilia, 219 Paul LF Giangrande 4 The genetics of acute myeloid leukemias, 42 Carolyn J Owen & Jude Fitzgibbon 19 The molecular basis of von Willebrand disease, 233 Luciano Baronc...
Cholesterol and fat lowering with hydrophobic polysaccharide derivatives
Czech Academy of Sciences Publication Activity Database
Čopíková, J.; Taubner, T.; Tůma, J.; Synytsya, A.; Dušková, Dagmar; Marounek, Milan
2015-01-01
Roč. 116, č. 1 (2015), s. 207-214 ISSN 0144-8617 Institutional support: RVO:67985904 Keywords : hydrophobically modified polysaccharides * structure * thermal analysis Subject RIV: CE - Biochemistry Impact factor: 4.219, year: 2015
Cationization of heparin for film applications
Czech Academy of Sciences Publication Activity Database
Šimkovic, I.; Mendichi, R.; Kelnar, Ivan; Filip, J.; Hricovíni, M.
2015-01-01
Roč. 115, 22 January (2015), s. 551-558 ISSN 0144-8617 Institutional support: RVO:61389013 Keywords : heparin * cationization * NMR Subject RIV: CD - Macromolecular Chemistry Impact factor: 4.219, year: 2015
National Oceanic and Atmospheric Administration, Department of Commerce — The Current, Temperature and Depth (CTD) data were collected by Naval Postgraduate School from Coastal Waters of California between 2-19 June, 1980 using ship...
Kvartérní geologická stavba historického jádra města Brna: aplikace poznatků ze stavby kolektorů
Czech Academy of Sciences Publication Activity Database
Lisá, Lenka; Zapletalová, D.; Pecka, M.; Zůbek, A.; Mroczek, P.
2006-01-01
Roč. 91, - (2006), s. 219-226 ISSN 1211-8796 Institutional research plan: CEZ:AV0Z30130516 Keywords : collector channels * sedimentology * micromorphology * Quaternary Subject RIV: DB - Geology ; Mineralogy
Two new species of the genus Xanthoxerampellia (Orchidaceae, Maxillariinae) from Antioquia, Colombia
Czech Academy of Sciences Publication Activity Database
Szlachetko, D. L.; Kolanowska, Marta
2017-01-01
Roč. 24, - (2017), s. 199-204 ISSN 1561-882X Institutional support: RVO:86652079 Keywords : biodiversity * Maxillariinae * Neotropics * orchids * taxonomy Subject RIV: EF - Botanics OBOR OECD: Plant sciences, botany Impact factor: 1.219, year: 2016
Indian Academy of Sciences (India)
sriranga
Page 1. 219. RESONANCE │ March 2011. GENERAL │ ARTICLE. Email for Correspondence: ionguha@gmail.com. Science Smiles. Ayan Guha. Your Honor, I have proof that this accused linkage traced that 'bone' graffiti on the painting.
Septin 9 hypermethylation contributes to migration and resistance to ...
African Journals Online (AJOL)
radiotherapy and chemotherapy are widely used but its outcomes are ... Multiple studies have shown that septin 9 gene spanning a region of 219 kb in the genome and encoding different ... suggested a tumor-suppressor role [10]. Despite.
African Journals Online (AJOL)
Timothy Ademakinwa
Keywords: Incubator, Biogas, Chicken egg, Temperature, Relative humidity, Hatchability. ABSTRACT. 219 ... hatching results are obtained with normal atmospheric air, which usually ... mixture of animal manures (cow dung, poultry and swine ...
Czech Academy of Sciences Publication Activity Database
Solecka, J.; Rajnisz, A.; Postek, M.; Zajko, J.; Kawecki, R.; Havlíček, Vladimír; Bednarek, E.; Kozerski, L.
2012-01-01
Roč. 65, č. 4 (2012), s. 219-221 ISSN 0021-8820 Institutional support: RVO:61388971 Keywords : antimicrobial activity * DD-peptidase inhibitor * JS-2 Subject RIV: EE - Microbiology, Virology Impact factor: 2.191, year: 2012
Varianty Gellnerovy komedie Přístav manželství jako rozcestník jeho tvorby
Czech Academy of Sciences Publication Activity Database
Peisertová, Lucie
2012-01-01
Roč. 44, č. 2012 (2012), s. 201-219 ISSN 0231-5904 Institutional support: RVO:68378068 Keywords : Czech drama * Gellner, František * textual criticism Subject RIV: AJ - Letters, Mass-media, Audiovision
Czech Academy of Sciences Publication Activity Database
Pečnerová, P.; Martínková, Natália
2012-01-01
Roč. 41, č. 3 (2012), s. 211-219 ISSN 0300-3256 Institutional research plan: CEZ:AV0Z60930519 Keywords : phylogeny * Sciurus * biogeography * colonisation Subject RIV: EG - Zoology Impact factor: 2.793, year: 2012
On Development of Medical Informatics Education via European Cooperation
Czech Academy of Sciences Publication Activity Database
Zvárová, Jana
1998-01-01
Roč. 50, - (1998), s. 219-223 ISSN 1386-5056 Keywords : information technologies * education * training * medical informatics * medical statistics * epidemiology Subject RIV: BB - Applied Statistics, Operational Research Impact factor: 0.357, year: 1998
Formulation and Characterization of Glutaraldehyde Cross-Linked ...
African Journals Online (AJOL)
... drug/polymer ratio, volume of cross linking agent and volume of surfactant were ... The microspheres were characterized for entrapment efficiency, drug loading, ... size distribution (105 – 219 μm) and an entrapment efficiency of up to 73 %.
Zwischenberichterstattung nach Börsenrecht, DRS, IAS und US-GAAP
Alvarez von Zerboni di Sposetti, Manuel
2003-01-01
Zwischenberichterstattung nach Börsenrecht, DRS, IAS und US-GAAP / von Manuel Alvarez und Stefan Wotschofsky. - 2., neubearb. und erw. Aufl. - Berlin : Erich Schmidt, 2003. - XX, 219 S. [1. Aufl. 2000
77 FR 76936 - Defense Federal Acquisition Regulation Supplement; Technical Amendments
2012-12-31
...; List of Subjects in 48 CFR Parts 201, 203, 204, 215, 219, 245, and 252 Government procurement. Manuel... clause 52.203-13, Contractor Code of Business Ethics and Conduct, is the DoD Office of Inspector General...
Relationship between patient satisfactions with diabetes care and ...
African Journals Online (AJOL)
2013-08-05
Aug 5, 2013 ... Bener, et al.: Patients satisfaction evaluation and management of diabetes care. 219 ... socioeconomic status (SES), females and the elderly.[5‑8] .... the subject was standing bare feet and with normal straight posture. Weight ...
49 CFR 212.223 - Operating practices compliance inspector.
2010-10-01
...) Control of Alcohol and Drug Use (49 CFR part 219); (3) Rear End Marking Device Regulations (49 CFR part... regulations listed in paragraph (a) of this section, including the remedial action required to bring defective...
Clinical effect of Fuzheng quyu therapy in patients undergoing ...
African Journals Online (AJOL)
Tropical Journal of Pharmaceutical Research January 2017; 16 (1): 219-224 ... cervical carcinoma surgery, thus suggesting its potential clinical applications. ..... surgery. However, further clinical investigations before it can be recommended for ...
48 CFR 1652.000 - Applicable clauses.
2010-10-01
.... 52.222-4Contract Work Hours and Safety Standards Act—Overtime Compensation—General. 52.222... Postretirement Benefits Other Than Pensions (PRB). 52.219-8Utilization of Small, Small Disadvantaged and Women...
Arbuscular mycorrhizal fungi associating with roots of Alnus and Rubus in Europe and the Middle East
Czech Academy of Sciences Publication Activity Database
Pölme, S.; Öpik, M.; Moora, M.; Zobel, M.; Kohout, Petr; Oja, J.; Köljalg, U.; Tedersoo, L.
2016-01-01
Roč. 24, Part A (2016), s. 27-34 ISSN 1754-5048 Institutional support: RVO:67985939 Keywords : arbuscular mycorrhiza * fungi * biogeography Subject RIV: EH - Ecology, Behaviour Impact factor: 3.219, year: 2016
Alternative models of entrance exams and access to higher education: the case of the Czech Republic
Czech Academy of Sciences Publication Activity Database
Konečný, Tomáš; Basl, J.; Mysliveček, Jan; Simonová, N.
2012-01-01
Roč. 63, č. 2 (2012), s. 219-235 ISSN 0018-1560 Institutional support: PRVOUK-P23 Keywords : higher education * admission exams * educational equity Subject RIV: AO - Sociology, Demography Impact factor: 0.937, year: 2012
Czech Academy of Sciences Publication Activity Database
Němcová, A.; Galal, O.; Skeldon, P.; Kuběna, Ivo; Šmíd, Miroslav; Briand, E.; Vickridge, I.; Ganem, J.-J.; Habazaki, H.
2016-01-01
Roč. 219, NOV (2016), s. 28-37 ISSN 0013-4686 Institutional support: RVO:68081723 Keywords : magnesium * anodic film * enrichment Subject RIV: JK - Corrosion ; Surface Treatment of Materials Impact factor: 4.798, year: 2016
Knowledge, attitude and practice of emergency contraceptives ...
African Journals Online (AJOL)
admin
contraceptives among female college students in Arba Minch ... those who mentioned pills as an emergency contraceptive method, 26.4% correctly ... The summary index for knowledge disclosed that 21.9% had good knowledge about EC.
Groin Exploration for the Nonpalpable Testes: A Single Center ...
African Journals Online (AJOL)
Laparoscopy enables the evaluation of the position, size, and the structural ... presentation, side involved, type of investigation done, mode of management ... 9 (21.9%) required admission for between 1 and 4 days (median. 3 days) either ...
Setkání bulharistů - Třetí mezinárodní kongres bulharistiky
Czech Academy of Sciences Publication Activity Database
Havlíková, Lubomíra
2014-01-01
Roč. 100, č. 1 (2014), s. 219-221 ISSN 0037-6922 Institutional support: RVO:68378017 Keywords : Bulgarian studies * International Congresses * history * philology * Cyrillo-Methodian studies Subject RIV: AB - History
South African Journal for Research in Sport, Physical Education and ...
African Journals Online (AJOL)
Perspective of coaches on LTAD of elite judo athletes: A comparative analysis · EMAIL FULL TEXT EMAIL FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Petrus L. Nolte, Cora Burnett, Wim Hollander, 219-228 ...
DEFF Research Database (Denmark)
Stensballe, L G; Trautner, S; Kofoed, P-E
2002-01-01
detection was defined as any test being positive. RESULTS: RSV antigen was detected in 84 (13%) children, the prevalence being 19% (41/219) among infants aged 230) in older children. Sensitivity of antigen detection was higher in NPA (92...
Antická dramata Jaroslava Vrchlického a jejich dobová recepce
Czech Academy of Sciences Publication Activity Database
Čadková, Daniela
2013-01-01
Roč. 136, 1-2 (2013), s. 189-219 ISSN 0024-4457 Institutional support: RVO:67985955 Keywords : J. Vrchlický * drama * National Theatre * classical tradition Subject RIV: AJ - Letters, Mass-media, Audiovision
75 FR 18076 - Changes in Flood Elevation Determinations
2010-04-09
...; Chairman, Coconino (08-09-1418P). Arizona Daily Sun. County Board of Supervisors, 219 East Cherry Avenue... February 13, 2009; The Honorable Paul Biane, June 19, 2009 060270 No: B-1044). of San Bernardino February...
Kester, Bernadette
1998-01-01
textabstractReview of: Cinema and the Great War. Andrew Kelly, Londen, New York (Routledge), 1997, 219 p.History by Hollywood. The use and abuse of the American past. Robert Brant Toplin, Chicago (Urbana), 1996, 267 p.
Optimal Mirrleesean taxation in a Ben-Porath economy
Czech Academy of Sciences Publication Activity Database
Kapička, Marek
2015-01-01
Roč. 7, č. 2 (2015), s. 219-248 ISSN 1945-7707 Institutional support: RVO:67985998 Keywords : optimal tax es * unobservable human capital * income tax es Subject RIV: AH - Economics Impact factor: 2.567, year: 2015
Czech Academy of Sciences Publication Activity Database
Slezáčková, Alena; Blatný, Marek; Millová, Katarína; Jelínek, Martin
2011-01-01
Roč. 26, č. 2 (2011), s. 219-219 ISSN 0887-0446. [European Health Psychology Conference: Engaging with Other Health Professions: Challenges and Perspectives /25./. 20.09.2011-24.09.2011, Hersonissos, Kréta] R&D Projects: GA ČR GAP407/10/2410 Institutional research plan: CEZ:AV0Z70250504 Keywords : psychosomatic problems * middle adulthood * subjectively assessed health Subject RIV: AN - Psychology
78 FR 54152 - Airworthiness Directives; Rolls-Royce plc Turbofan Engines
2013-09-03
... Airworthiness Directives; Rolls-Royce plc Turbofan Engines AGENCY: Federal Aviation Administration (FAA), DOT...; -535C-37; -535E4-37; - 535E4-B-37, and -535E4-B-75 turbofan engines, and all RB211-524G2-19; - 524G3-19; -524H2-19; and -524H-36 turbofan engines. This AD requires a one-time inspection of the front combustion...
78 FR 20505 - Airworthiness Directives; Rolls-Royce plc Turbofan Engines
2013-04-05
... Turbofan Engines AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of proposed rulemaking...; - 535E4-37; -535E4-B-37, and -535E4-B-75 turbofan engines, and all RB211- 524G2-19; -524G3-19; -524H2-19; and -524H-36 turbofan engines. This proposed AD was prompted by the discovery of a cracked and...
Veterinary Laboratory Services Study - 1976.
1976-09-01
years. Many tests , such as ;uman pregnancy testing , Mycobacterium tuberculosis isolation and :iers have been converted to in—vitro procedures. Sheep...assignment in laboratories and worked in chemistry , mic robiology , or diagnostic areas can be directly uti l ized with little additional orientation. They...Chorionic Gonadotropin 475 730 17 1,222 UCG or Human Pregnancy 147 42 189 Tularemia 332 332 OX—19 211 211 Salmonella 219 219 Trichinella 17 17 Venipuncture
Establishment and biological characteristics of Piedmontese cattle ...
African Journals Online (AJOL)
use
2011-12-12
Dec 12, 2011 ... 2.30 ± 0.48. T. 12. 3.25 ± 0.17. T. 27. 2.19 ± 0.13. T. 13. 3.25 ± 0.29. T. 28. 2.19 ± 0.33. T. 14 .... technique has been used for many years and is still being used today, practice .... tissue culture and the nude mouse. Tissue Cell.
The Enemies List: The Foreign Terrorist Organization List and Its Role in Defining Terrorism
2014-03-01
seven days before the designation is published in the Federal Register, as section 219 of the Immigration and Nationality Act requires. Upon the...Organizations.” 38 Antiterrorism and Effective Death Penalty Act of 1996, 110 Stat. 1214 (amends § 219 of the Immigration and Nationality Act (Public Law...and the Israeli-occupied territories, Chile , Iran, and Cambodia. Table 1 reflects the list of communist FTOs designated prior to 9/11, and a
Directory of Open Access Journals (Sweden)
Lin Zhang
Full Text Available A novel gene (designated as cen219 encoding endoglucanase was isolated from a Bursaphelenchus xylophilus metagenomic library by functional screening. Sequence analysis revealed that cen219 encoded a protein of 367 amino acids. SDS-PAGE analysis of purified endoglucanase suggested that Cen219 was a monomeric enzyme with a molecular mass of 40 kDa. The optimum temperature and pH for endoglucanase activity of Cen219 was separately 50 °C and 6.0. It was stable from 30 to 50 °C, and from pH 4.0 to 7.0. The activity was significantly enhanced by Mn(2+ and dramatically reduced by detergent SDS and metals Fe(3+, Cu(2+ or Hg(2+. The enzyme hydrolyzed a wide range of β-1, 3-, and β-1, 4-linked polysaccharides, with varying activities. Activities towards microcrystalline cellulose and filter paper were relatively high, while the highest activity was towards oat gum. The Km and Vmax of Cen219 towards CMC was 17.37 mg/ml and 333.33 U/mg, respectively. The findings have an insight into understanding the molecular basis of host-parasite interactions in B. xylophilus species. The properties also make Cen219 an interesting enzyme for biotechnological application.
Immuno-vectorization of radioelements emitters of alpha particles: a new therapy in cancerology
International Nuclear Information System (INIS)
Bourgeois, M.
2007-05-01
The radio-immunotherapy is an anti cancerous therapy which consists in vectorising with immuno-specific agents very radio toxic radioelements on tumors or in their environment to destroy them. The first part of this report presents the different characteristics of antibodies as well as their means of production under monoclonal shapes specifically steered against a tumoral antigen of interest. The second part of this report replaces the importance of the immunological vectors in the context of the nuclear medicine. It is notably described that the different methods which allow to radio-label the vector, as well as the different ways of optimization which were envisaged to improve the targeting of radioelements on a tumor. These different developments allow to define the potential place of the alpha radio-immunotherapy in treatments and so re-place the interest of the experimental part. If the radio-immunotherapy, using beta emitters isotopes as the 131 iodine or the 90 yttrium, is today current in anti cancerous therapy, it finds limits because of the disintegration characteristics of the isotopes it uses. Indeed, compared with alpha particles, the beta particles deposit less energy by unit of length in the crossed material.The experimental part of this report aims at studying the feasibility of the coupling between an immunological vector and an alpha emitter isotope.The different tests led on the bismuth 213, the bismuth 212, the lead 212 and the astatine 211 demonstrated that the fixation of these radionuclides was possible. This research theme is strengthened by the construction in Nantes of a cyclotron with high energy ( A.R.R.O.N.A.X.) and the optimization of the obtained promising results should allow a therapeutic use in oncology of the alpha radio-immunotherapy. (N.C.)
Cancer therapy with alpha-emitters labeled peptides.
Dadachova, Ekaterina
2010-05-01
Actively targeted alpha-particles offer specific tumor cell killing action with less collateral damage to surrounding normal tissues than beta-emitters. During the last decade, radiolabeled peptides that bind to different receptors on the tumors have been investigated as potential therapeutic agents both in the preclinical and clinical settings. Advantages of radiolabeled peptides over antibodies include relatively straightforward chemical synthesis, versatility, easier radiolabeling, rapid clearance from the circulation, faster penetration and more uniform distribution into tissues, and less immunogenicity. Rapid internalization of the radiolabeled peptides with equally rapid re-expression of the cell surface target is a highly desirable property that enhances the total delivery of these radionuclides into malignant sites. Peptides, such as octreotide, alpha-melanocyte-stimulating hormone analogues, arginine-glycine-aspartic acid-containing peptides, bombesin derivatives, and others may all be feasible for use with alpha-emitters. The on-going preclinical work has primarily concentrated on octreotide and octreotate analogues labeled with Bismuth-213 and Astatine-211. In addition, alpha-melanocyte-stimulating hormone analogue has been labeled with Lead-212/Bismuth-212 in vivo generator and demonstrated the encouraging therapeutic efficacy in treatment of experimental melanoma. Obstacles that continue to obstruct widespread acceptance of alpha-emitter-labeled peptides are primarily the supply of these radionuclides and concerns about potential kidney toxicity. New sources and methods for production of these medically valuable radionuclides and better understanding of mechanisms related to the peptide renal uptake and clearance should speed up the introduction of alpha-emitter-labeled peptides into the clinic. Copyright 2010 Elsevier Inc. All rights reserved.
International Nuclear Information System (INIS)
Demartis, S.; Tarli, L.; Neri, D.; Borsi, L.; Zardi, L.
2001-01-01
Angiogenesis is a characteristic feature of many aggressive tumours and other disorders. Antibodies capable of binding to new blood vessels, but not to mature vessels, could be used as selective targeting agents for immunoscintigraphic and radioimmunotherapeutic applications. Here we show that scFv(L19), a recombinant human antibody fragment with sub-nanomolar affinity for the ED-B domain of fibronectin, a marker of angiogenesis, can be stably labelled with iodine-125 and astatine-211 with full retention of immunoreactivity, using a trimethyl-stannyl benzoate bifunctional derivative. Biodistribution studies in mice bearing two different types of tumour grafted subcutaneously, followed by ex vivo micro-autoradiographic analysis, revealed that scFv(L19) rapidly localises around tumour blood vessels, but not around normal vessels. Four hours after intravenous injection of the stably radioiodinated scFv(L19), tumour to blood ratios were 6:1 in mice bearing the F9 murine teratocarcinoma and 9:1 in mice bearing an FE8 rat sarcoma. As expected, all other organs (including kidney) contained significantly less radioactivity than the tumour. Since the ED-B domain of fibronectin has an identical sequence in mouse and man, scFv(L19) is a pan-species antibody and the results presented here suggest clinical utility of radiolabelled scFv(L19) for the scintigraphic detection of angiogenesis in vivo. Furthermore, it should now be possible to investigate scFv(L19) for the selective delivery of 211 At to the tumour neovasculature, causing the selective death of tumour endothelial cells and tumour collapse. (orig.)
International Nuclear Information System (INIS)
Wilbur, D. Scott; Chyan, M.-K.; Hamlin, Donald K.; Perry, Matthew A.
2010-01-01
Introduction: In vivo deastatination of 211 At-labeled biomolecules can severely limit their use in endoradiotherapy. Our studies have shown that the use of closo-decaborate(2-) moiety for 211 At-labeling of biomolecules provides high in vivo stability towards deastatination. However, data from those studies have also been suggestive that some astatinated closo-decaborate(2-) catabolites may be retained in tissues. In this study, we investigated the in vivo distributions of several structurally simple closo-decaborate(2-) derivatives to gain information on the effects of functional groups if catabolites are released into the blood system from the carrier biomolecule. Methods: Thirteen closo-decaborate(2-) derivatives were synthesized and radioiodinated for evaluation. Tissue concentrations of the radioiodinated compounds were obtained in groups of five mice at 1 and 4 h postinjection (pi). Dual-label ( 125 I and 131 I) experiments permitted evaluation of two compounds in each set of mice. Results: All of the target compounds were readily synthesized. Radioiodination reactions were conducted with chloramine-T and Na[ 125/131 I]I in water to give high yields (75-96%) of the desired compounds. Biodistribution data at 1 and 4 h pi (representing catabolites released into the blood system) showed small differences in tissue concentrations for some compounds, but large differences for others. The results indicate that formal (overall) charge on the compounds could not be used as a predictor of tissue localization or retention. However, derivatives containing carboxylate groups generally had lower tissue concentrations. Acid cleavable hydrazone functionalities appeared to be the best candidates for further study. Conclusions: Further studies incorporating hydrazone functionalities into pendant groups for biomolecule radiohalogenation are warranted.
Nitrogen Dynamic Study on Rice Mutant Lines Using 15N Isotope Techniques
International Nuclear Information System (INIS)
Ahmad Nazrul Abd Wahid; Shyful Azizi Abdul Rahman; Abdul Rahim Harun
2015-01-01
Malaysian Nuclear Agency in collaboration with UPM and MARDI has produced two types of rice mutant lines of MR219, viz. MR219-4 and MR219-9 developed under rice radiation mutagenenesis programme for adaptability to aerobic conditions. Aerobic cultivating is rice cultivation system on well drained soil and using minimal water input. At Malaysian Nuclear Agency, a nitrogen fertilization study in aerobic condition for the rice mutant lines was carried out in the shade house and field. The study is intended to examine and assess the dynamics of nitrogen by rice mutant lines through the different soil water management and nitrogen levels. Direct 15 N isotopic tracer method was used in this study, whereby the 15 N labeled urea fertilizer was utilized as a tracer for nitrogen nutrient uptake by the test crops. This paper is intended to highlight the progress that has been made in the study of the nitrogen dynamics on MR219-4 and MR219-9 rice mutant lines. (author)
Moll, Lorna; Ben-Gedalya, Tziona; Reuveni, Hadas; Cohen, Ehud
2016-04-01
The discovery that the alteration of aging by reducing the activity of the insulin/IGF-1 signaling (IIS) cascade protects nematodes and mice from neurodegeneration-linked, toxic protein aggregation (proteotoxicity) raises the prospect that IIS inhibitors bear therapeutic potential to counter neurodegenerative diseases. Recently, we reported that NT219, a highly efficient IGF-1 signaling inhibitor, protects model worms from the aggregation of amyloid β peptide and polyglutamine peptides that are linked to the manifestation of Alzheimer's and Huntington's diseases, respectively. Here, we employed cultured cell systems to investigate whether NT219 promotes protein homeostasis (proteostasis) in mammalian cells and to explore its underlying mechanisms. We found that NT219 enhances the aggregation of misfolded prion protein and promotes its deposition in quality control compartments known as "aggresomes." NT219 also elevates the levels of certain molecular chaperones but, surprisingly, reduces proteasome activity and impairs autophagy. Our findings show that IGF-1 signaling inhibitors in general and NT219 in particular can promote proteostasis in mammalian cells by hyperaggregating hazardous proteins, thereby bearing the potential to postpone the onset and slow the progression of neurodegenerative illnesses in the elderly.-Moll, L., Ben-Gedalya, T., Reuveni, H., Cohen, E. The inhibition of IGF-1 signaling promotes proteostasis by enhancing protein aggregation and deposition. © FASEB.
Directory of Open Access Journals (Sweden)
Yuanyuan Guo
2017-05-01
Full Text Available The status of intestinal microbiota is a determinant of host health. However, the alteration of the gut microbiota caused by the innate immune response to virus infection is unclear. Caenorhabditis elegans and its natural virus Orsay provide an excellent model of host–virus interactions. We evaluated the intestinal microbial community complexity of the wild-type N2 and the innate immunity-deficient mutant rde-1 (ne219 strains of C. elegans upon Orsay virus infection. The gut microbiota diversity was decreased in rde-1 (ne219 mutant animals, and a large number of genes were associated with the difference between infected and uninfected rde-1 (ne219 mutant animals. Therefore, this study provides the first evaluation of the alterations caused by Orsay virus on intestinal microbiota in wildtype and innate immunity-deficient animals using C. elegans as the model species. Our findings indicate that virus infection may alters the microbiome in animals with defective immune response.
Guo, Yuanyuan; Xun, Zhe; Coffman, Stephanie R; Chen, Feng
2017-01-01
The status of intestinal microbiota is a determinant of host health. However, the alteration of the gut microbiota caused by the innate immune response to virus infection is unclear. Caenorhabditis elegans and its natural virus Orsay provide an excellent model of host-virus interactions. We evaluated the intestinal microbial community complexity of the wild-type N2 and the innate immunity-deficient mutant rde-1 ( ne219 ) strains of C. elegans upon Orsay virus infection. The gut microbiota diversity was decreased in rde-1 ( ne219 ) mutant animals, and a large number of genes were associated with the difference between infected and uninfected rde-1 ( ne219 ) mutant animals. Therefore, this study provides the first evaluation of the alterations caused by Orsay virus on intestinal microbiota in wildtype and innate immunity-deficient animals using C. elegans as the model species. Our findings indicate that virus infection may alters the microbiome in animals with defective immune response.
Multi-Energy Processing for Novel Coating Technologies
2014-12-18
shape bounced back with increased inner flame lengths and reduced diameters. At 10.532 ^m, the length of the inner flame was the shortest, 3 mm, with a...brighter and shorter. At 10.22 ^m, the inner flame length was the shortest, 4 mm with 2 m expansion in diameter, indicating accelerated combustion...absorption rates less than 1/3 of that at 9 219 um the lame length shrank further and became brighter. With a laser irradiation at 9.219 ^m the flame
Fifth international symposium on the natural radiation environment (NRE - V). Book of abstracts
International Nuclear Information System (INIS)
1991-01-01
Most of the 219 contributions Are on radon (to a much lesser extent: thoron) and its daughter products in dwellings and in the environment; on corresponding measuring instruments and - methods; on measurements done; and on radiation doses to professional workers and to the public. The section heading give a fairly good account of the subject matters treated. Measurement Techniques and Metrology (Nrs 1-33); Exposure to Natural Radiation in Non-Domestic Environments (34-56); Natural Radionuclides and Transfer Pathways (57-107); Radioactivity and Radiation in the Human Environment (108-183); Health Effects of Natural Radiation (184-205); Industrially Modified Levels of Radiation Exposure (206-219). (Quittner)
Monolithic Hybrid and Passive Mode-Locked 40GHz Quantum Dot Laser Diodes
DEFF Research Database (Denmark)
Thompson, M. G.; Larsson, David; Rae, A. R.
2006-01-01
For the first time hybrid and passive mode-locking jitter performance is investigated in 40GHz quantum-dot mode-locked lasers. Record low passive mode-locking jitter of 219fs is presented, along with promising hybrid mode-locking results of 124fs.......For the first time hybrid and passive mode-locking jitter performance is investigated in 40GHz quantum-dot mode-locked lasers. Record low passive mode-locking jitter of 219fs is presented, along with promising hybrid mode-locking results of 124fs....
Několik poznámek k problematice ochrany duševního vlastnictví
Czech Academy of Sciences Publication Activity Database
Krejčí, Jindřich
2011-01-01
Roč. 5, č. 2 (2011), s. 217-219 ISSN 1802-8152 R&D Projects: GA MŠk LM2010006 Institutional research plan: CEZ:AV0Z70280505 Keywords : social science databases * intellectual property rights * open access Subject RIV: AO - Sociology, Demography http://dav.soc.cas.cz/uploads/9aded5ef84867217588bfc788d640e8a3b0e50d2_DaVp217-219%20Krejci.pdf
ONUS, Ahmet Naci
2014-01-01
Selected isozymes were investigated in plants of Capsicum baccatum L. ( Solanaceae) accessions SA219 (P.G.Smith), Hawkes 6489 (P.G.Smith), Capsicum cardenasii Heiser and Smith accession SA268 (P.G.Smith), Capsicum eximium A.T.Hunz accession Hawkes 3860 (J.G.Hawkes) and two interspecific F1 hybrids, C. baccatum SA219 x C. eximium Hawkes 3860 and C. baccatum Hawkes 6489 x C. cardenasii SA 268. The standard technique of horizontal gel electrophoresis was employed. The gel was cut into severa...
Directory of Open Access Journals (Sweden)
Olmar Baller Weber
2003-12-01
Full Text Available O objetivo deste trabalho foi selecionar e avaliar bactérias diazotróficas isoladas de abacaxizeiro (Ananas comosus (L. Merril no desenvolvimento de cultivares micropropagadas da mesma espécie em casa de vegetação. Plantas da cultivar Perolera foram submetidas à inoculação com Asaia bogorensis (AB219 e cultivadas em tubetes, durante 145 dias, com as misturas: casca de arroz carbonizada, folha de carnaubeira triturada e vermicomposto; casca de arroz carbonizada, pó da casca do coco maduro e vermicomposto; casca de arroz carbonizada, vermiculita e vermicomposto. Plantas da cultivar Primavera receberam inóculos com o AB219 e bactérias relacionadas a Burkholderia cepacia (AB202 e AB213, enquanto plantas das cultivares Pérola e Smooth Cayenne receberam AB219 e AB213, sendo cultivadas, por 140 dias, em tubetes com a mistura de vermicomposto e vermiculita. A colonização dos abacaxizeiros pelas bactérias diazotróficas foi confirmada. As plantas da cultivar Perolera cresceram melhor em casca de arroz carbonizada, vermiculita e vermicomposto e responderam positivamente ao AB219. Já as plantas da cultivar Primavera não apresentaram resposta significativa à inoculação com AB219, AB202 e AB213. Houve incremento de 23,1% a 38,5% na matéria seca de raízes das plantas da cultivar Pérola na presença de AB213 e AB219, respectivamente. A presença de AB213 incrementou em 15,2% a matéria seca da parte aérea das plantas da cultivar Smooth Cayenne. Os resultados revelam a eficiência de bactérias diazotróficas na promoção do crescimento de abacaxizeiros.The objective of this work was to select and to evaluate isolates of diazotrophic bacteria associated to pineapple (Ananas comosus (L. Merril plants in the development of micropropagated plantlets of cultivars pineapple in greenhouse. Plantlets from the Perolera cultivar have been submitted to inoculation with Asaia bogorensis (AB219 and were cultivated during 145 days on the following
Ogden, Cynthia L.; Lamb, Molly M.; Carroll, Margaret D.; Flegal, Katherine M.
2010-01-01
In 2007-2008 almost 17% of children and adolescents aged 2-19 years were obese. Childhood obesity often tracks to adulthood and, in the short run, childhood obesity can lead to psychosocial problems and cardiovascular risk factors such as high blood pressure, high cholesterol, and abnormal glucose tolerance or diabetes. Studies have suggested that…
48 CFR 570.601 - FAR provisions and clauses.
2010-10-01
... Business Participation Program—Targets.52.219-25Small Disadvantaged Business Participation Program...-24Preaward On-Site Equal Opportunity Compliance Review. (i) you require cost or pricing data for work or services exceeding $500,000 52.215-10Price Reduction for Defective Cost or Pricing Data.52.215...
78 FR 70012 - Lake Tahoe Basin Management Unit, California, Land Management Plan Revision
2013-11-22
... 60 days after the date of publication of the legal notice in the Sacramento Bee, Sacramento, CA (36... 60 days after the date of publication of the legal notice in the Sacramento Bee, Sacramento, CA (36..., Sacramento, CA (36 CFR 219.56). The written notice of objection must be submitted to the Chief of the Forest...
Czech Academy of Sciences Publication Activity Database
Hamarová, Ivana; Šmíd, Petr; Horváth, P.; Hrabovský, M.
2014-01-01
Roč. 2014, č. 1 (2014), "704368-1"-"704368-12" ISSN 1537-744X R&D Projects: GA ČR GA13-12301S Institutional support: RVO:68378271 Keywords : one-dimensional speckle correlation * speckle * general In-plane translation Subject RIV: BH - Optics, Masers, Lasers Impact factor: 1.219, year: 2013
Effect of information and communication technology on culture of the ...
African Journals Online (AJOL)
Effect of information and communication technology on culture of the people of Saki west local government area of Oyo State, Nigeria. PO Eniola, Mf Siyanbola, OA Olaniyi. Abstract. No Abstract. International Journal of Tropical Agriculture and Food Systems Vol. 1 (3) 2007: pp. 214-219. Full Text: EMAIL FULL TEXT EMAIL ...
Placenta accreta in Aba, South Eastern Nigeria | Umezurike ...
African Journals Online (AJOL)
No Abstract. Nigerian Journal of Medicine Vol. 16 (3) 2007: pp.219-222. Full Text: EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT · AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More about AJOL · AJOL's Partners ...
7 CFR 1767.19 - Liabilities and other credits.
2010-01-01
... this section shall be used by all RUS borrowers. Liabilities and Other Credits Margins and Equities... Income Taxes—Other Liabilities and Other Credits Margins and Equities 200Memberships A. This account... conformance with the bylaws of the cooperative. 219Other Margins and Equities A. This account shall include...
Crack closure in near-threshold fatigue crack propagation in railway axle steel EA4T
Czech Academy of Sciences Publication Activity Database
Pokorný, Pavel; Vojtek, Tomáš; Náhlík, Luboš; Hutař, Pavel
2017-01-01
Roč. 185, NOV (2017), s. 2-19 ISSN 0013-7944 R&D Projects: GA MŠk(CZ) LQ1601 Institutional support: RVO:68081723 Keywords : Fatigue crack propagation * crack closure * EA4T * Railway axle Subject RIV: JL - Materials Fatigue, Friction Mechanics OBOR OECD: Audio engineering , reliability analysis Impact factor: 2.151, year: 2016
Czech Academy of Sciences Publication Activity Database
Bryja, Josef; Galan, M.; Charbonnel, N.; Cosson, J.-F.
2005-01-01
Roč. 5, č. 1 (2005), s. 173-176 ISSN 1471-8278 Institutional research plan: CEZ:AV0Z6093917 Keywords : water vole * population genetics Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.219, year: 2005
Application of compact finite-difference schemes to simulations of stably stratified fluid flows
Czech Academy of Sciences Publication Activity Database
Bodnár, Tomáš; Beneš, L.; Fraunie, P.; Kozel, Karel
2012-01-01
Roč. 219, č. 7 (2012), s. 3336-3353 ISSN 0096-3003 Institutional support: RVO:61388998 Keywords : stratification * finite- difference * finite-volume * Runge-Kutta Subject RIV: BA - General Mathematics Impact factor: 1.349, year: 2012 http://www.sciencedirect.com/science/article/pii/S0096300311010988
New floristic records in the Balkans: 3
DEFF Research Database (Denmark)
2006-01-01
), Euphorbiaceae (41-43, 77), Fabaceae (7, 8, 44, 45, 89, 90, 110, 111, 120, 121, 129, 164-168, 218, 219), Fagaceae (78, 79), Fumariaceae (80), Gentianaceae (169), Geraniaceae (46, 47, 170, 171, 220), Grossulariaceae (236), Guttiferae (9, 112, 172), Iridaceae (65, 66, 85), Juncaceae (240), Lamiaceae (10, 48-51, 81...
Study of the nickel-fullerene nano-structured thin films
Czech Academy of Sciences Publication Activity Database
Vacík, Jiří; Naramoto, H.; Narumi, K.; Yamamoto, S.; Abe, H.
2004-01-01
Roč. 219, č. 20 (2004), s. 862-866 ISSN 0168-583X Institutional research plan: CEZ:AV0Z1048901 Keywords : nickel * fullerene * magnesium oxide Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.997, year: 2004
Czech Academy of Sciences Publication Activity Database
Štechová, K.; Kolář, Michal; Blatný, R.; Halbhuber, Z.; Včeláková, J.; Hubáčková, M.; Petruželková, L.; Sumnik, Z.; Obermannová, B.; Pithová, P.; Staviková, V.; Krivjanská, M.; Neuwirth, Aleš; Kalousková, S.; Filipp, Dominik
2012-01-01
Roč. 75, č. 2 (2012), s. 210-219 ISSN 0300-9475 R&D Projects: GA MŠk 2B08066 Institutional research plan: CEZ:AV0Z50520514 Keywords : type 1 diabetes * microarray analysis * pathogenesis Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.199, year: 2012
Investigating the environmental adaptability of promising subtropical ...
African Journals Online (AJOL)
Trees were assessed for frost sensitivity at 15 months, and height and basal area at 48 months. Eucalyptus longirostrata, E. pilularis, Corymbia citriodora subsp. citriodora, C. henryi and C. maculata, species that performed well in forerunner ICFR coastal Zululand site-species trials (MAT range 21.7–21.9°C), generally ...
Buhs, Eric S.; Welch, Greg; Burt, Jennifer; Knoche, Lisa
2011-01-01
This study evaluated a data-set drawn using "The Familia"--a measure originally developed to evaluate shared-reading activities. A newly developed set of conceptual supports and a confirmatory factor analysis (CFA) were applied to a new factor structure/model. Data were drawn from 219 young children and their families (mean age = 43…
Combinatorial and Algorithmic Rigidity: Beyond Two Dimensions
2012-12-01
44]. Theorems of Maxwell- Laman type were ob- tained in [9, 15, 43]. 2 3. Counting and Enumeration. As anticipated in the project, we relied on methods...decompositions. Graphs and Combinatorics, 25:219–238, 2009. [43] I. Streinu and L. Theran. Slider-pinning rigidity: a Maxwell- Laman -type theorem. Discrete and
What Do Employers Ask for in Advertisements for Special Education Positions?
Stephenson, Jennifer; Carter, Mark
2014-01-01
Although qualified special educators are more likely to provide effective teaching for students with disabilities and special education needs, it seems many teachers in special education and support positions are not qualified for this role. The study reported here provided analysis of 219 job advertisements for special education positions in…
Evaluation of 11 polycyclic aromatic hydrocarbon metabolites in urine of Czech mothers and newborns
Czech Academy of Sciences Publication Activity Database
Urbancová, K.; Lanková, D.; Rössner ml., Pavel; Rössnerová, Andrea; Švecová, Vlasta; Tomaniová, M.; Veleminský Jr., M.; Šrám, Radim; Hajslová, J.; Pulkrabová, J.
2016-01-01
Roč. 577, jan (2016), s. 212-219 ISSN 0048-9697 R&D Projects: GA ČR(CZ) GA13-13458S Institutional support: RVO:68378041 Keywords : U-HPLC-MS/MS * OH-PAHs * Czech Republic Subject RIV: DN - Health Impact of the Environment Quality Impact factor: 4.900, year: 2016
Czech Academy of Sciences Publication Activity Database
Hromadová, Magdaléna; Pospíšil, Lubomír; Giannarelli, S.; Fuoco, R.; Colombini, M. P.
2002-01-01
Roč. 73, - (2002), s. 213-219 ISSN 0026-265X R&D Projects: GA MŠk OC D15.10; GA ČR GP203/02/P082 Institutional research plan: CEZ:AV0Z4040901 Keywords : electrochemical evidence * fungicide * cyclodextrin Subject RIV: CG - Electrochemistry Impact factor: 1.325, year: 2002
2010-10-07
... DEPARTMENT OF STATE [Public Notice: 7196] In the Matter of the Review of the Designation of Jemaah Islamiya (JI and Other Aliases) as a Foreign Terrorist Organization Pursuant to Section 219 of the Immigration and Nationality Act, as Amended Based upon a review of the Administrative Record assembled in this...
Osečtí cisterciáci doby barokní. Malachias Welcker a Anton Edelmann a jejich rukopisné „kroniky“
Czech Academy of Sciences Publication Activity Database
Wolf, Jiří
2014-01-01
Roč. 29, č. 2 (2014), s. 197-219 ISSN 0231-7494 R&D Projects: GA ČR(CZ) GA14-05167S Institutional support: RVO:67985963 Keywords : Cistercian order * Baroque historiography * the space * the body * Malachias Welcker * Anton Edelmann Subject RIV: AB - History
Removal of Perchlorate from Water and Wastewater by Catalytic Hydrogen Gas Membrane Systems
2007-01-01
Quimica, Serie A: Quimica Fisica e Ingenieria Quimica, 1984. 80(2): p. 219-25. Logan, B.E. and D. LaPoint, Treatment of Perchlorate- and Nitrate...ion at iridium electrodes. Ion concentration and solution pH effects. Anales de Quimica, Serie A: Quimica Fisica e Ingenieria Quimica (1985), 81(3
2013-11-21
... DEPARTMENT OF STATE [Public Notice 8527] In the Matter of the Review of the Designation of the Kurdistan Worker's Party (and Other Aliases) as a Foreign Terrorist Organization Pursuant to Section 219 of the Immigration and Nationality Act, as Amended Based upon a review of the Administrative Record...
2012-04-25
... National Lakeshore, 1100 North Mineral Springs Road, Porter, Indiana 46304; telephone 219-395- 1550. A copy... time to ensure that the local deer population does not become a dominant force that negatively... populations that provides multi-year (three to five years) efficacy for does. Alternative C would include all...
2012-12-13
... Mineral Springs Road, Porter, Indiana 46304; telephone (219) 395-1550. Copies of the document also may be... ensure that the local deer population does not become a dominant force that negatively influences... multiple year (three to five years) efficacy for does. Alternative C would have included all actions...
Energy Loss in Hadron Production in pp and Heavy Ion Collisions
Czech Academy of Sciences Publication Activity Database
Tokarev, M. V.; Zborovský, Imrich
2012-01-01
Roč. 219, č. 116 (2012), s. 301-304 ISSN 0920-5632. [5th Joint International Hadron Structure Conference. Tatranska Strba, 27.6.2011 - 1.7.2011] R&D Projects: GA MŠk LA08002 Institutional research plan: CEZ:AV0Z10480505 Keywords : TRANSVERSE-MOMENTUM * KAON PRODUCTION * SPECTRA Subject RIV: BE - Theoretical Physics